F496071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1925 | 773 | 3850 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0298273|Ga0496104_0298273_335_970 |
| Length | 211 |
| Sequence | MAKKTKQAEAPQAPVKAPTPRLLERYEKEIRPALAKQFGRTNPHALPRLQKIVLNMGVGSAITEKKHIEDATAALAQISGQKPLVTKSRVAIANFRLRENMPIGCKVTLRGVRMYEFLDRLISLALPRVRDFRGLSPDAFDGHGNYSLGLSEQLVFPELNPDKFLRPQGMNITIVISGGSNDESRELLRAFGMPFKVEEKEKEKGGKVPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003159 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_14 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003405 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM | Metagenome | Rhizosphere |
| 27 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 52 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 53 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 55 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 60 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 68 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 122 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 128 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 129 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 135 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 138 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 139 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 140 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 141 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 157 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 158 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 159 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 160 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 161 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 174 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 179 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 183 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 185 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 186 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 195 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 213 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 277 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 290 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 295 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 299 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 300 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 301 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 302 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 303 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 304 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 305 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 306 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 307 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 308 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 309 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 310 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 311 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 312 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 313 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 314 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 315 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 316 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 317 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 318 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 319 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 320 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 321 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 322 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 323 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 324 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 325 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 326 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 327 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 328 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 329 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 331 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 332 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 334 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 335 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 336 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 337 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 340 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 342 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 343 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 345 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 346 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 347 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 348 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 349 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 352 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 353 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 354 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 355 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 356 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 357 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 358 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 359 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 360 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 361 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 362 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 363 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 364 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 365 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 366 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 367 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 368 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 370 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 371 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 376 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 377 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 378 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 379 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 380 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 381 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 382 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 383 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 384 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 385 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 386 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 387 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 388 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 389 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 390 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 391 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 392 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 393 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 394 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 395 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 396 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 397 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 398 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 399 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 400 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 401 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 402 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 403 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 404 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 405 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 406 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 407 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 408 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 409 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 410 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 411 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 412 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 413 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 414 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 415 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 416 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 417 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 418 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 419 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 420 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 421 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 422 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 423 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 424 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 425 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 426 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 427 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 428 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 429 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 430 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 431 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 432 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 433 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 434 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 435 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 436 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 505 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 506 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 507 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 508 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 509 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 511 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 512 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 513 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 514 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 515 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 516 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 517 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 518 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 519 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 520 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 521 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 522 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 523 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 524 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 525 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 526 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 527 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 538 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 539 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 540 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 541 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 542 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 576 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 580 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 585 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 586 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 587 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 588 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 589 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 590 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 591 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 592 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 593 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 594 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 595 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 596 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 597 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 598 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 599 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 602 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 603 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 604 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 605 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 606 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 607 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 608 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 609 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 610 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 614 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 615 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 616 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 617 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 618 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 619 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 620 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 621 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 622 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 623 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 624 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 625 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 626 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 627 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 631 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 632 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 633 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 634 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 635 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 636 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 637 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 638 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 639 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 640 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 641 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 642 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 643 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 644 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 645 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 646 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 647 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 648 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 649 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 650 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 651 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 652 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 653 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 654 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 655 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 656 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 657 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 658 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 668 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 669 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 670 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 671 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 672 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 673 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 674 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 675 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 676 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 677 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 680 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 681 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 683 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 684 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 685 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 705 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 706 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 707 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 708 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 709 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 710 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 711 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 712 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 713 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 714 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 715 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 716 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 717 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 718 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 719 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 720 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 721 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 722 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 723 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 724 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 725 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 726 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 727 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 728 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 729 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 730 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 731 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 732 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 733 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 734 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 735 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 736 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 737 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 738 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 739 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 740 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 741 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 742 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 743 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 744 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 745 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 746 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 747 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 748 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 749 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 750 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 751 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 752 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 753 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 754 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 755 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 756 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 757 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 758 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 759 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 760 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 761 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 762 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 763 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 764 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 765 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 766 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 767 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 768 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 769 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 770 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 771 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 772 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 773 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.43 |
| Metatranscriptomes | 16.99 |
| Isolates | 3.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.17 |
| Nodule | 0.78 |
| Rhizoplane | 2.75 |
| Rhizosphere | 72.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0298273 | 3300048907 | Bacteria | 1524 |
| 2 | SwRhRL2b_contig_1765669 | 2162886007 | Bacteria | 2803 |
| 3 | SwRhRL2b_contig_2600354 | 2162886007 | Bacteria | 2171 |
| 4 | SwRhRL2b_contig_690899 | 2162886007 | Bacteria | 2794 |
| 5 | SwRhRL2b_contig_889991 | 2162886007 | Bacteria | 1611 |
| 6 | JGI24740J21852_10001487 | 3300001979 | Bacteria | 10770 |
| 7 | JGI24735J21928_10182907 | 3300002067 | Bacteria | 607 |
| 8 | JGI24750J21931_1036900 | 3300002070 | Bacteria | 733 |
| 9 | JGI24744J21845_10017966 | 3300002077 | Bacteria | 1403 |
| 10 | JGI25155J39150_1000064 | 3300002704 | Bacteria | 69949 |
| 11 | JGI25156J39149_1000085 | 3300002705 | Bacteria | 69953 |
| 12 | JGI25154J39366_1000112 | 3300002738 | Bacteria | 69961 |
| 13 | JGI25154J39366_1000593 | 3300002738 | Bacteria | 17447 |
| 14 | JGI25154J39366_1001042 | 3300002738 | Bacteria | 11063 |
| 15 | JGI25157J39369_1000109 | 3300002741 | Bacteria | 69961 |
| 16 | JGI25164J39214_1002084 | 3300002772 | Bacteria | 3435 |
| 17 | JGI25152J39213_1001073 | 3300002773 | Bacteria | 12895 |
| 18 | JGI25152J39213_1014680 | 3300002773 | Bacteria | 1577 |
| 19 | JGI25150J39212_1003907 | 3300002774 | Bacteria | 3415 |
| 20 | JGI25150J39212_1019452 | 3300002774 | Bacteria | 1064 |
| 21 | JGI25159J45721_1017949 | 3300002987 | Bacteria | 1443 |
| 22 | Ga0006771J45828_103610 | 3300003159 | Bacteria | 1974 |
| 23 | Ga0006771J45828_103876 | 3300003159 | Bacteria | 2154 |
| 24 | Ga0006765J45826_106373 | 3300003161 | Bacteria | 4293 |
| 25 | Ga0006778J45830_1009213 | 3300003162 | Bacteria | 15395 |
| 26 | Ga0006778J45830_1028609 | 3300003162 | Bacteria | 1950 |
| 27 | Ga0006759J45824_1019946 | 3300003163 | Bacteria | 12757 |
| 28 | Ga0006759J45824_1028038 | 3300003163 | Bacteria | 4414 |
| 29 | Ga0006759J45824_1029126 | 3300003163 | Bacteria | 2169 |
| 30 | Ga0006759J45824_1043209 | 3300003163 | Bacteria | 4631 |
| 31 | JGI25151J46595_10000457 | 3300003187 | Bacteria | 39373 |
| 32 | JGI25151J46595_10028695 | 3300003187 | Bacteria | 2213 |
| 33 | JGI25153J46596_10007740 | 3300003215 | Bacteria | 5229 |
| 34 | JGI25153J46596_10035613 | 3300003215 | Bacteria | 1609 |
| 35 | Ga0006758J48902_1008911 | 3300003300 | Bacteria | 7674 |
| 36 | Ga0006758J48902_1011628 | 3300003300 | Bacteria | 7270 |
| 37 | Ga0006758J48902_1015976 | 3300003300 | Bacteria | 2354 |
| 38 | Ga0006758J48902_1016024 | 3300003300 | Bacteria | 1731 |
| 39 | Ga0006758J48902_1016608 | 3300003300 | Bacteria | 2081 |
| 40 | Ga0006758J48902_1021934 | 3300003300 | Bacteria | 1503 |
| 41 | Ga0006770J48903_1001899 | 3300003305 | Bacteria | 11120 |
| 42 | Ga0006770J48903_1017003 | 3300003305 | Bacteria | 2309 |
| 43 | Ga0006770J48903_1020844 | 3300003305 | Bacteria | 2153 |
| 44 | Ga0006777J48905_1014855 | 3300003308 | Bacteria | 5027 |
| 45 | Ga0006777J48905_1017368 | 3300003308 | Bacteria | 915 |
| 46 | Ga0006777J48905_1043026 | 3300003308 | Bacteria | 748 |
| 47 | JGI26128J50194_1000191 | 3300003347 | Bacteria | 2835 |
| 48 | JGI25161J50226_1000036 | 3300003374 | Bacteria | 133407 |
| 49 | JGI26132J50249_100694 | 3300003405 | Bacteria | 1033 |
| 50 | Ga0007417J51691_1002612 | 3300003544 | Bacteria | 14201 |
| 51 | Ga0007417J51691_1011781 | 3300003544 | Bacteria | 8032 |
| 52 | Ga0007417J51691_1020817 | 3300003544 | Bacteria | 4053 |
| 53 | Ga0007417J51691_1027994 | 3300003544 | Bacteria | 1246 |
| 54 | Ga0007417J51691_1043945 | 3300003544 | Bacteria | 2500 |
| 55 | Ga0007427J51700_113492 | 3300003559 | Bacteria | 2911 |
| 56 | Ga0007427J51700_113549 | 3300003559 | Bacteria | 2002 |
| 57 | Ga0007410J51695_1004597 | 3300003574 | Bacteria | 14339 |
| 58 | Ga0007410J51695_1005226 | 3300003574 | Bacteria | 5217 |
| 59 | Ga0007410J51695_1012689 | 3300003574 | Bacteria | 12724 |
| 60 | Ga0007410J51695_1028665 | 3300003574 | Bacteria | 3145 |
| 61 | Ga0007410J51695_1032042 | 3300003574 | Bacteria | 2025 |
| 62 | Ga0007410J51695_1034122 | 3300003574 | Bacteria | 804 |
| 63 | Ga0007410J51695_1043180 | 3300003574 | Bacteria | 4391 |
| 64 | Ga0007409J51694_1019841 | 3300003575 | Bacteria | 1451 |
| 65 | Ga0007409J51694_1024055 | 3300003575 | Bacteria | 9433 |
| 66 | Ga0007409J51694_1069872 | 3300003575 | Bacteria | 1698 |
| 67 | Ga0007416J51690_1017602 | 3300003577 | Bacteria | 1373 |
| 68 | Ga0007416J51690_1027279 | 3300003577 | Bacteria | 2389 |
| 69 | Ga0007416J51690_1037564 | 3300003577 | Bacteria | 4820 |
| 70 | Ga0007416J51690_1051124 | 3300003577 | Bacteria | 2960 |
| 71 | Ga0007416J51690_1051380 | 3300003577 | Bacteria | 1428 |
| 72 | Ga0007429J51699_1044837 | 3300003579 | Bacteria | 1221 |
| 73 | Ga0007411J51799_103551 | 3300003611 | Bacteria | 13349 |
| 74 | Ga0007411J51799_109097 | 3300003611 | Bacteria | 3946 |
| 75 | Ga0007415J51800_102854 | 3300003613 | Bacteria | 5009 |
| 76 | Ga0007415J51800_107261 | 3300003613 | Bacteria | 3368 |
| 77 | Ga0032354_1010092 | 3300003693 | Bacteria | 2041 |
| 78 | Ga0032354_1011583 | 3300003693 | Bacteria | 845 |
| 79 | Ga0032354_1030488 | 3300003693 | Bacteria | 2759 |
| 80 | Ga0032354_1037309 | 3300003693 | Bacteria | 2923 |
| 81 | Ga0032354_1038503 | 3300003693 | Bacteria | 3177 |
| 82 | Ga0032354_1043583 | 3300003693 | Bacteria | 1797 |
| 83 | Ga0032354_1045145 | 3300003693 | Bacteria | 2372 |
| 84 | Ga0006766_118421 | 3300003717 | Bacteria | 952 |
| 85 | Ga0006780_1014314 | 3300003735 | Bacteria | 584 |
| 86 | Ga0006780_1040471 | 3300003735 | Bacteria | 713 |
| 87 | Ga0055539_1019592 | 3300003752 | Bacteria | 810 |
| 88 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 89 | Ga0055525_1000161 | 3300003759 | Bacteria | 87478 |
| 90 | Ga0055525_1000641 | 3300003759 | Bacteria | 14040 |
| 91 | Ga0055529_1000079 | 3300003763 | Bacteria | 149370 |
| 92 | Ga0055529_1000322 | 3300003763 | Bacteria | 54232 |
| 93 | Ga0055529_1000804 | 3300003763 | Bacteria | 19180 |
| 94 | Ga0055526_1000791 | 3300003771 | Bacteria | 23567 |
| 95 | Ga0055526_1003343 | 3300003771 | Bacteria | 10245 |
| 96 | Ga0055526_1008246 | 3300003771 | Bacteria | 5232 |
| 97 | Ga0055537_1001762 | 3300003773 | Bacteria | 7927 |
| 98 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 99 | Ga0055524_1019174 | 3300003775 | Bacteria | 2347 |
| 100 | Ga0055524_1029964 | 3300003775 | Bacteria | 1596 |
| 101 | Ga0055524_1029968 | 3300003775 | Bacteria | 1596 |
| 102 | Ga0055536_1012654 | 3300003781 | Bacteria | 3111 |
| 103 | Ga0055528_1000762 | 3300003790 | Bacteria | 22492 |
| 104 | Ga0055528_1037491 | 3300003790 | Bacteria | 1139 |
| 105 | Ga0055530_10006458 | 3300003791 | Bacteria | 5230 |
| 106 | Ga0055530_10019398 | 3300003791 | Bacteria | 2061 |
| 107 | Ga0055540_1000133 | 3300003792 | Bacteria | 75104 |
| 108 | Ga0055540_1000137 | 3300003792 | Bacteria | 73229 |
| 109 | Ga0055540_1011339 | 3300003792 | Bacteria | 2882 |
| 110 | Ga0055540_1025018 | 3300003792 | Bacteria | 1470 |
| 111 | Ga0055540_1026414 | 3300003792 | Bacteria | 1406 |
| 112 | Ga0055540_1035141 | 3300003792 | Bacteria | 1123 |
| 113 | Ga0055531_10000281 | 3300003794 | Bacteria | 51971 |
| 114 | Ga0055531_10001985 | 3300003794 | Bacteria | 14214 |
| 115 | Ga0055531_10002079 | 3300003794 | Bacteria | 13764 |
| 116 | Ga0055531_10004806 | 3300003794 | Bacteria | 8068 |
| 117 | Ga0055531_10034681 | 3300003794 | Bacteria | 1596 |
| 118 | Ga0055543_1000157 | 3300004625 | Bacteria | 57172 |
| 119 | Ga0055543_1027494 | 3300004625 | Bacteria | 1006 |
| 120 | Ga0055543_1039962 | 3300004625 | Bacteria | 794 |
| 121 | Ga0058858_1430617 | 3300004785 | Bacteria | 1242 |
| 122 | Ga0058859_10003590 | 3300004798 | Bacteria | 1079 |
| 123 | Ga0058859_10014111 | 3300004798 | Bacteria | 1624 |
| 124 | Ga0058859_10053023 | 3300004798 | Bacteria | 1174 |
| 125 | Ga0058859_10055155 | 3300004798 | Bacteria | 1649 |
| 126 | Ga0058859_10114978 | 3300004798 | Bacteria | 1404 |
| 127 | Ga0058861_10032824 | 3300004800 | Bacteria | 1948 |
| 128 | Ga0058861_10142005 | 3300004800 | Bacteria | 1459 |
| 129 | Ga0058860_10052045 | 3300004801 | Bacteria | 1645 |
| 130 | Ga0058860_12036570 | 3300004801 | Bacteria | 1021 |
| 131 | Ga0058860_12226982 | 3300004801 | Bacteria | 1429 |
| 132 | Ga0058862_10051180 | 3300004803 | Bacteria | 1484 |
| 133 | Ga0065165_1007979 | 3300005262 | Bacteria | 5065 |
| 134 | Ga0065165_1010518 | 3300005262 | Bacteria | 3983 |
| 135 | Ga0065714_10003225 | 3300005288 | Bacteria | 8263 |
| 136 | Ga0065714_10403084 | 3300005288 | Bacteria | 584 |
| 137 | Ga0065704_10072380 | 3300005289 | Bacteria | 8635 |
| 138 | Ga0065704_10073672 | 3300005289 | Bacteria | 6901 |
| 139 | Ga0065704_10080021 | 3300005289 | Bacteria | 4028 |
| 140 | Ga0065704_10115708 | 3300005289 | Bacteria | 1856 |
| 141 | Ga0065712_10021088 | 3300005290 | Bacteria | 1548 |
| 142 | Ga0065707_10015436 | 3300005295 | Bacteria | 1755 |
| 143 | Ga0070658_10018142 | 3300005327 | Bacteria | 5631 |
| 144 | Ga0070658_10102014 | 3300005327 | Bacteria | 2372 |
| 145 | Ga0070658_10152764 | 3300005327 | Bacteria | 1933 |
| 146 | Ga0070676_10002282 | 3300005328 | Bacteria | 9791 |
| 147 | Ga0070676_10157576 | 3300005328 | Bacteria | 1458 |
| 148 | Ga0070676_10241559 | 3300005328 | Bacteria | 1201 |
| 149 | Ga0070676_10324837 | 3300005328 | Bacteria | 1050 |
| 150 | Ga0070683_100230594 | 3300005329 | Bacteria | 1760 |
| 151 | Ga0070683_100352957 | 3300005329 | Bacteria | 1400 |
| 152 | Ga0070690_100006927 | 3300005330 | Bacteria | 6450 |
| 153 | Ga0070690_100031978 | 3300005330 | Bacteria | 3282 |
| 154 | Ga0070690_100134141 | 3300005330 | Bacteria | 1675 |
| 155 | Ga0070670_100020621 | 3300005331 | Bacteria | 5668 |
| 156 | Ga0070670_100064589 | 3300005331 | Bacteria | 3140 |
| 157 | Ga0070670_100536933 | 3300005331 | Bacteria | 1042 |
| 158 | Ga0070670_100687288 | 3300005331 | Bacteria | 919 |
| 159 | Ga0070677_10069496 | 3300005333 | Bacteria | 1477 |
| 160 | Ga0068869_100001782 | 3300005334 | Bacteria | 12900 |
| 161 | Ga0068869_100012739 | 3300005334 | Bacteria | 5562 |
| 162 | Ga0068869_100052834 | 3300005334 | Bacteria | 2951 |
| 163 | Ga0068869_100054551 | 3300005334 | Bacteria | 2910 |
| 164 | Ga0068869_100167482 | 3300005334 | Bacteria | 1714 |
| 165 | Ga0070666_10109820 | 3300005335 | Bacteria | 1906 |
| 166 | Ga0070666_10283707 | 3300005335 | Bacteria | 1177 |
| 167 | Ga0070666_10312794 | 3300005335 | Bacteria | 1119 |
| 168 | Ga0070666_10340714 | 3300005335 | Bacteria | 1071 |
| 169 | Ga0070680_100032809 | 3300005336 | Bacteria | 4180 |
| 170 | Ga0068868_100045924 | 3300005338 | Bacteria | 3418 |
| 171 | Ga0068868_100133352 | 3300005338 | Bacteria | 2034 |
| 172 | Ga0068868_100185626 | 3300005338 | Bacteria | 1727 |
| 173 | Ga0068868_100240329 | 3300005338 | Bacteria | 1521 |
| 174 | Ga0068868_100272027 | 3300005338 | Bacteria | 1431 |
| 175 | Ga0068868_100395538 | 3300005338 | Bacteria | 1192 |
| 176 | Ga0068868_101211131 | 3300005338 | Bacteria | 698 |
| 177 | Ga0070660_100137713 | 3300005339 | Bacteria | 1957 |
| 178 | Ga0070660_100332256 | 3300005339 | Bacteria | 1250 |
| 179 | Ga0070689_100109373 | 3300005340 | Bacteria | 2197 |
| 180 | Ga0070691_10245118 | 3300005341 | Bacteria | 959 |
| 181 | Ga0070687_100651994 | 3300005343 | Bacteria | 730 |
| 182 | Ga0070661_100003672 | 3300005344 | Bacteria | 10572 |
| 183 | Ga0070661_100484849 | 3300005344 | Bacteria | 988 |
| 184 | Ga0070661_100633571 | 3300005344 | Bacteria | 867 |
| 185 | Ga0070661_100732093 | 3300005344 | Bacteria | 808 |
| 186 | Ga0070668_100101221 | 3300005347 | Bacteria | 2283 |
| 187 | Ga0070668_100238759 | 3300005347 | Bacteria | 1505 |
| 188 | Ga0070668_100967691 | 3300005347 | Bacteria | 764 |
| 189 | Ga0070669_100017536 | 3300005353 | Bacteria | 5107 |
| 190 | Ga0070669_100075981 | 3300005353 | Bacteria | 2492 |
| 191 | Ga0070669_100156484 | 3300005353 | Bacteria | 1768 |
| 192 | Ga0070669_100212897 | 3300005353 | Bacteria | 1525 |
| 193 | Ga0070669_100346164 | 3300005353 | Bacteria | 1205 |
| 194 | Ga0070669_100666194 | 3300005353 | Bacteria | 876 |
| 195 | Ga0070675_100107037 | 3300005354 | Bacteria | 2361 |
| 196 | Ga0070675_100262088 | 3300005354 | Bacteria | 1515 |
| 197 | Ga0070675_100318575 | 3300005354 | Bacteria | 1373 |
| 198 | Ga0070675_100330914 | 3300005354 | Bacteria | 1347 |
| 199 | Ga0070675_100556488 | 3300005354 | Bacteria | 1038 |
| 200 | Ga0070675_100775837 | 3300005354 | Bacteria | 875 |
| 201 | Ga0070675_100931940 | 3300005354 | Bacteria | 796 |
| 202 | Ga0070671_100085884 | 3300005355 | Bacteria | 2632 |
| 203 | Ga0070671_100133178 | 3300005355 | Bacteria | 2094 |
| 204 | Ga0070671_100170542 | 3300005355 | Bacteria | 1840 |
| 205 | Ga0070671_100250786 | 3300005355 | Bacteria | 1503 |
| 206 | Ga0070671_100472106 | 3300005355 | Bacteria | 1077 |
| 207 | Ga0070671_100630285 | 3300005355 | Bacteria | 927 |
| 208 | Ga0070671_100908201 | 3300005355 | Bacteria | 769 |
| 209 | Ga0070674_100016236 | 3300005356 | Bacteria | 4666 |
| 210 | Ga0070674_100056124 | 3300005356 | Bacteria | 2730 |
| 211 | Ga0070673_100117288 | 3300005364 | Bacteria | 2215 |
| 212 | Ga0070673_100764058 | 3300005364 | Bacteria | 890 |
| 213 | Ga0070673_100878766 | 3300005364 | Bacteria | 830 |
| 214 | Ga0070673_101034230 | 3300005364 | Bacteria | 766 |
| 215 | Ga0070688_100254873 | 3300005365 | Bacteria | 1251 |
| 216 | Ga0070659_100057420 | 3300005366 | Bacteria | 3069 |
| 217 | Ga0070667_100001546 | 3300005367 | Bacteria | 20614 |
| 218 | Ga0070667_100028082 | 3300005367 | Bacteria | 4683 |
| 219 | Ga0070667_100061737 | 3300005367 | Bacteria | 3173 |
| 220 | Ga0070667_100083378 | 3300005367 | Bacteria | 2738 |
| 221 | Ga0070667_100204785 | 3300005367 | Bacteria | 1752 |
| 222 | Ga0070667_100302097 | 3300005367 | Bacteria | 1441 |
| 223 | Ga0070667_100933135 | 3300005367 | Bacteria | 808 |
| 224 | Ga0070667_101303055 | 3300005367 | Bacteria | 680 |
| 225 | Ga0070701_10265092 | 3300005438 | Bacteria | 1043 |
| 226 | Ga0070705_100486464 | 3300005440 | Bacteria | 934 |
| 227 | Ga0070663_100003492 | 3300005455 | Bacteria | 9070 |
| 228 | Ga0070663_100175986 | 3300005455 | Bacteria | 1657 |
| 229 | Ga0070663_100489511 | 3300005455 | Bacteria | 1020 |
| 230 | Ga0070678_100037760 | 3300005456 | Bacteria | 3394 |
| 231 | Ga0070678_100078511 | 3300005456 | Bacteria | 2494 |
| 232 | Ga0070678_100104114 | 3300005456 | Bacteria | 2206 |
| 233 | Ga0070678_100421211 | 3300005456 | Bacteria | 1164 |
| 234 | Ga0070662_100274312 | 3300005457 | Bacteria | 1363 |
| 235 | Ga0070662_100412128 | 3300005457 | Bacteria | 1116 |
| 236 | Ga0070681_10088377 | 3300005458 | Bacteria | 3051 |
| 237 | Ga0070681_10118464 | 3300005458 | Bacteria | 2584 |
| 238 | Ga0068867_100000552 | 3300005459 | Bacteria | 24723 |
| 239 | Ga0068867_100002598 | 3300005459 | Bacteria | 12737 |
| 240 | Ga0068867_100011425 | 3300005459 | Bacteria | 6266 |
| 241 | Ga0068867_100069225 | 3300005459 | Bacteria | 2635 |
| 242 | Ga0068867_100235673 | 3300005459 | Bacteria | 1482 |
| 243 | Ga0068867_100402632 | 3300005459 | Bacteria | 1155 |
| 244 | Ga0068867_100692942 | 3300005459 | Bacteria | 898 |
| 245 | Ga0070706_100015900 | 3300005467 | Bacteria | 6947 |
| 246 | Ga0070706_100465093 | 3300005467 | Bacteria | 1177 |
| 247 | Ga0070698_100605474 | 3300005471 | Bacteria | 1036 |
| 248 | Ga0070699_100054613 | 3300005518 | Bacteria | 3457 |
| 249 | Ga0070679_100007565 | 3300005530 | Bacteria | 10160 |
| 250 | Ga0070679_100375973 | 3300005530 | Bacteria | 1367 |
| 251 | Ga0068853_100041378 | 3300005539 | Bacteria | 3936 |
| 252 | Ga0068853_100345863 | 3300005539 | Bacteria | 1382 |
| 253 | Ga0068853_100836205 | 3300005539 | Bacteria | 882 |
| 254 | Ga0070672_100065480 | 3300005543 | Bacteria | 2875 |
| 255 | Ga0070672_100226500 | 3300005543 | Bacteria | 1569 |
| 256 | Ga0070672_100334560 | 3300005543 | Bacteria | 1289 |
| 257 | Ga0070672_100370305 | 3300005543 | Bacteria | 1224 |
| 258 | Ga0070672_100623633 | 3300005543 | Bacteria | 940 |
| 259 | Ga0070686_100084049 | 3300005544 | Bacteria | 2114 |
| 260 | Ga0070686_100969821 | 3300005544 | Bacteria | 695 |
| 261 | Ga0070693_100023342 | 3300005547 | Bacteria | 3305 |
| 262 | Ga0070693_100069686 | 3300005547 | Bacteria | 2067 |
| 263 | Ga0070665_100113328 | 3300005548 | Bacteria | 2714 |
| 264 | Ga0070665_100261841 | 3300005548 | Bacteria | 1731 |
| 265 | Ga0070665_100982347 | 3300005548 | Bacteria | 857 |
| 266 | Ga0068855_100040434 | 3300005563 | Bacteria | 5534 |
| 267 | Ga0070664_100040179 | 3300005564 | Bacteria | 3943 |
| 268 | Ga0070664_100452105 | 3300005564 | Bacteria | 1179 |
| 269 | Ga0070664_101023760 | 3300005564 | Bacteria | 776 |
| 270 | Ga0068857_100040688 | 3300005577 | Bacteria | 4122 |
| 271 | Ga0068857_100822281 | 3300005577 | Bacteria | 888 |
| 272 | Ga0068857_100948381 | 3300005577 | Bacteria | 826 |
| 273 | Ga0068857_100998787 | 3300005577 | Bacteria | 805 |
| 274 | Ga0068854_100273417 | 3300005578 | Bacteria | 1357 |
| 275 | Ga0068854_100505329 | 3300005578 | Bacteria | 1018 |
| 276 | Ga0068854_101094394 | 3300005578 | Bacteria | 710 |
| 277 | Ga0068854_101163714 | 3300005578 | Bacteria | 690 |
| 278 | Ga0068856_100033721 | 3300005614 | Bacteria | 5014 |
| 279 | Ga0068856_100137146 | 3300005614 | Bacteria | 2452 |
| 280 | Ga0068856_100231329 | 3300005614 | Bacteria | 1864 |
| 281 | Ga0068856_100590718 | 3300005614 | Bacteria | 1131 |
| 282 | Ga0068852_100157329 | 3300005616 | Bacteria | 2118 |
| 283 | Ga0068852_100418900 | 3300005616 | Bacteria | 1321 |
| 284 | Ga0068852_100605267 | 3300005616 | Bacteria | 1100 |
| 285 | Ga0068852_101321877 | 3300005616 | Bacteria | 743 |
| 286 | Ga0068859_100421208 | 3300005617 | Bacteria | 1431 |
| 287 | Ga0068859_100595833 | 3300005617 | Bacteria | 1198 |
| 288 | Ga0068859_100722826 | 3300005617 | Bacteria | 1086 |
| 289 | Ga0068859_100743845 | 3300005617 | Bacteria | 1070 |
| 290 | Ga0068859_101096554 | 3300005617 | Bacteria | 876 |
| 291 | Ga0068859_101245369 | 3300005617 | Bacteria | 820 |
| 292 | Ga0068864_100018772 | 3300005618 | Bacteria | 5779 |
| 293 | Ga0068864_100060451 | 3300005618 | Bacteria | 3280 |
| 294 | Ga0068864_100103544 | 3300005618 | Bacteria | 2527 |
| 295 | Ga0068864_100596528 | 3300005618 | Bacteria | 1071 |
| 296 | Ga0068866_10033530 | 3300005718 | Bacteria | 2492 |
| 297 | Ga0068866_10225265 | 3300005718 | Bacteria | 1134 |
| 298 | Ga0068866_10411744 | 3300005718 | Bacteria | 875 |
| 299 | Ga0068866_10650977 | 3300005718 | Unclassified | 717 |
| 300 | Ga0068861_100004770 | 3300005719 | Bacteria | 9115 |
| 301 | Ga0068861_100016735 | 3300005719 | Bacteria | 5194 |
| 302 | Ga0068861_100067654 | 3300005719 | Bacteria | 2758 |
| 303 | Ga0068861_100250877 | 3300005719 | Bacteria | 1510 |
| 304 | Ga0068851_10097792 | 3300005834 | Bacteria | 1553 |
| 305 | Ga0068870_10096198 | 3300005840 | Bacteria | 1665 |
| 306 | Ga0068863_100104362 | 3300005841 | Bacteria | 2696 |
| 307 | Ga0068863_100177752 | 3300005841 | Bacteria | 2043 |
| 308 | Ga0068858_100008125 | 3300005842 | Bacteria | 10091 |
| 309 | Ga0068858_100030753 | 3300005842 | Bacteria | 4986 |
| 310 | Ga0068858_100087941 | 3300005842 | Bacteria | 2890 |
| 311 | Ga0068860_100008442 | 3300005843 | Bacteria | 10260 |
| 312 | Ga0068860_100089575 | 3300005843 | Bacteria | 2929 |
| 313 | Ga0068860_100214297 | 3300005843 | Bacteria | 1868 |
| 314 | Ga0068860_100234051 | 3300005843 | Bacteria | 1785 |
| 315 | Ga0068860_100347699 | 3300005843 | Bacteria | 1459 |
| 316 | Ga0068860_100416200 | 3300005843 | Bacteria | 1332 |
| 317 | Ga0068860_100426403 | 3300005843 | Bacteria | 1315 |
| 318 | Ga0068860_100571783 | 3300005843 | Bacteria | 1134 |
| 319 | Ga0068862_100009442 | 3300005844 | Bacteria | 8069 |
| 320 | Ga0068862_100090240 | 3300005844 | Bacteria | 2667 |
| 321 | Ga0068862_100103723 | 3300005844 | Bacteria | 2490 |
| 322 | Ga0068862_100847673 | 3300005844 | Bacteria | 895 |
| 323 | Ga0068862_101061660 | 3300005844 | Bacteria | 803 |
| 324 | Ga0081455_10214690 | 3300005937 | Bacteria | 1431 |
| 325 | Ga0081538_10007049 | 3300005981 | Bacteria | 9777 |
| 326 | Ga0081539_10024183 | 3300005985 | Bacteria | 3951 |
| 327 | Ga0075365_10024190 | 3300006038 | Bacteria | 3827 |
| 328 | Ga0075365_10088383 | 3300006038 | Bacteria | 2108 |
| 329 | Ga0075365_10100810 | 3300006038 | Bacteria | 1977 |
| 330 | Ga0075365_10360621 | 3300006038 | Bacteria | 1025 |
| 331 | Ga0075368_10003054 | 3300006042 | Bacteria | 5542 |
| 332 | Ga0075368_10027934 | 3300006042 | Bacteria | 2178 |
| 333 | Ga0075368_10066804 | 3300006042 | Bacteria | 1447 |
| 334 | Ga0075368_10073997 | 3300006042 | Bacteria | 1379 |
| 335 | Ga0075363_100000856 | 3300006048 | Bacteria | 10631 |
| 336 | Ga0075363_100005889 | 3300006048 | Bacteria | 5519 |
| 337 | Ga0075363_100035006 | 3300006048 | Bacteria | 2624 |
| 338 | Ga0075363_100093099 | 3300006048 | Bacteria | 1661 |
| 339 | Ga0075363_100207224 | 3300006048 | Bacteria | 1121 |
| 340 | Ga0075363_100385680 | 3300006048 | Bacteria | 822 |
| 341 | Ga0075364_10000860 | 3300006051 | Bacteria | 16000 |
| 342 | Ga0075364_10008140 | 3300006051 | Bacteria | 6255 |
| 343 | Ga0075364_10015296 | 3300006051 | Bacteria | 4757 |
| 344 | Ga0075364_10032491 | 3300006051 | Bacteria | 3355 |
| 345 | Ga0075364_10059924 | 3300006051 | Bacteria | 2496 |
| 346 | Ga0075364_10109005 | 3300006051 | Bacteria | 1847 |
| 347 | Ga0075364_10134805 | 3300006051 | Bacteria | 1658 |
| 348 | Ga0075364_10150994 | 3300006051 | Bacteria | 1566 |
| 349 | Ga0075432_10012424 | 3300006058 | Bacteria | 2892 |
| 350 | Ga0075362_10000222 | 3300006177 | Bacteria | 15765 |
| 351 | Ga0075362_10000565 | 3300006177 | Bacteria | 10784 |
| 352 | Ga0075362_10010792 | 3300006177 | Bacteria | 3579 |
| 353 | Ga0075362_10029405 | 3300006177 | Bacteria | 2367 |
| 354 | Ga0075362_10042495 | 3300006177 | Bacteria | 2009 |
| 355 | Ga0075362_10118078 | 3300006177 | Bacteria | 1254 |
| 356 | Ga0075362_10255536 | 3300006177 | Bacteria | 862 |
| 357 | Ga0075367_10000855 | 3300006178 | Bacteria | 12145 |
| 358 | Ga0075367_10001881 | 3300006178 | Bacteria | 9288 |
| 359 | Ga0075367_10072677 | 3300006178 | Bacteria | 2071 |
| 360 | Ga0075367_10092765 | 3300006178 | Bacteria | 1838 |
| 361 | Ga0075367_10129646 | 3300006178 | Bacteria | 1558 |
| 362 | Ga0075367_10582923 | 3300006178 | Bacteria | 711 |
| 363 | Ga0075367_10625480 | 3300006178 | Bacteria | 684 |
| 364 | Ga0075369_10003827 | 3300006186 | Bacteria | 5518 |
| 365 | Ga0075369_10005325 | 3300006186 | Bacteria | 4797 |
| 366 | Ga0075369_10031839 | 3300006186 | Bacteria | 2228 |
| 367 | Ga0075369_10072235 | 3300006186 | Bacteria | 1520 |
| 368 | Ga0075369_10076058 | 3300006186 | Bacteria | 1483 |
| 369 | Ga0075366_10000795 | 3300006195 | Bacteria | 15124 |
| 370 | Ga0075366_10016473 | 3300006195 | Bacteria | 4249 |
| 371 | Ga0075366_10018148 | 3300006195 | Bacteria | 4062 |
| 372 | Ga0075366_10029562 | 3300006195 | Bacteria | 3219 |
| 373 | Ga0075366_10032832 | 3300006195 | Bacteria | 3056 |
| 374 | Ga0075366_10045046 | 3300006195 | Bacteria | 2615 |
| 375 | Ga0075366_10058278 | 3300006195 | Bacteria | 2294 |
| 376 | Ga0075366_10072831 | 3300006195 | Bacteria | 2048 |
| 377 | Ga0075366_10077134 | 3300006195 | Bacteria | 1989 |
| 378 | Ga0075366_10102009 | 3300006195 | Bacteria | 1722 |
| 379 | Ga0075366_10111379 | 3300006195 | Bacteria | 1646 |
| 380 | Ga0075366_10151709 | 3300006195 | Bacteria | 1403 |
| 381 | Ga0075366_10173544 | 3300006195 | Bacteria | 1308 |
| 382 | Ga0075366_10183717 | 3300006195 | Bacteria | 1270 |
| 383 | Ga0075366_10184543 | 3300006195 | Bacteria | 1267 |
| 384 | Ga0075366_10215426 | 3300006195 | Bacteria | 1169 |
| 385 | Ga0075366_10225965 | 3300006195 | Bacteria | 1140 |
| 386 | Ga0075366_10255795 | 3300006195 | Bacteria | 1068 |
| 387 | Ga0075366_10264844 | 3300006195 | Bacteria | 1049 |
| 388 | Ga0075366_10267288 | 3300006195 | Bacteria | 1044 |
| 389 | Ga0075366_10287953 | 3300006195 | Bacteria | 1004 |
| 390 | Ga0075366_10333201 | 3300006195 | Bacteria | 930 |
| 391 | Ga0097621_100047739 | 3300006237 | Bacteria | 3470 |
| 392 | Ga0097621_100053861 | 3300006237 | Bacteria | 3279 |
| 393 | Ga0097621_100661150 | 3300006237 | Bacteria | 959 |
| 394 | Ga0097621_100957200 | 3300006237 | Bacteria | 799 |
| 395 | Ga0075370_10000073 | 3300006353 | Bacteria | 30960 |
| 396 | Ga0075370_10000701 | 3300006353 | Bacteria | 13221 |
| 397 | Ga0075370_10001150 | 3300006353 | Bacteria | 11110 |
| 398 | Ga0075370_10002824 | 3300006353 | Bacteria | 8149 |
| 399 | Ga0075370_10017546 | 3300006353 | Bacteria | 3869 |
| 400 | Ga0075370_10064344 | 3300006353 | Bacteria | 2091 |
| 401 | Ga0075370_10096809 | 3300006353 | Bacteria | 1706 |
| 402 | Ga0075370_10130823 | 3300006353 | Bacteria | 1464 |
| 403 | Ga0075370_10135320 | 3300006353 | Bacteria | 1439 |
| 404 | Ga0075370_10224585 | 3300006353 | Bacteria | 1110 |
| 405 | Ga0075370_10433321 | 3300006353 | Bacteria | 790 |
| 406 | Ga0068871_100038460 | 3300006358 | Bacteria | 3822 |
| 407 | Ga0068871_100336354 | 3300006358 | Bacteria | 1332 |
| 408 | Ga0068871_100519577 | 3300006358 | Bacteria | 1075 |
| 409 | Ga0075430_100097480 | 3300006846 | Bacteria | 2457 |
| 410 | Ga0075430_100148171 | 3300006846 | Bacteria | 1954 |
| 411 | Ga0075434_100344295 | 3300006871 | Bacteria | 1512 |
| 412 | Ga0075429_100034628 | 3300006880 | Bacteria | 4388 |
| 413 | Ga0075429_100217261 | 3300006880 | Bacteria | 1675 |
| 414 | Ga0068865_100004060 | 3300006881 | Bacteria | 8794 |
| 415 | Ga0068865_100504266 | 3300006881 | Bacteria | 1009 |
| 416 | Ga0068865_100547271 | 3300006881 | Bacteria | 971 |
| 417 | Ga0097620_100421176 | 3300006931 | Bacteria | 1431 |
| 418 | Ga0097620_100595835 | 3300006931 | Bacteria | 1198 |
| 419 | Ga0097620_100722741 | 3300006931 | Bacteria | 1086 |
| 420 | Ga0097620_100743907 | 3300006931 | Bacteria | 1070 |
| 421 | Ga0097620_101096527 | 3300006931 | Bacteria | 876 |
| 422 | Ga0097620_101245345 | 3300006931 | Bacteria | 820 |
| 423 | Ga0099824_1036695 | 3300006942 | Bacteria | 1406 |
| 424 | Ga0099824_1042081 | 3300006942 | Bacteria | 1063 |
| 425 | Ga0099823_1000064 | 3300006944 | Bacteria | 50328 |
| 426 | Ga0079104_1000027 | 3300006946 | Bacteria | 212641 |
| 427 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 428 | Ga0079104_1004078 | 3300006946 | Bacteria | 6424 |
| 429 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 430 | Ga0105244_10045359 | 3300009036 | Bacteria | 2262 |
| 431 | Ga0105244_10326682 | 3300009036 | Bacteria | 708 |
| 432 | Ga0105250_10000154 | 3300009092 | Bacteria | 59676 |
| 433 | Ga0105240_10608637 | 3300009093 | Bacteria | 1202 |
| 434 | Ga0105240_10612533 | 3300009093 | Bacteria | 1198 |
| 435 | Ga0111539_10313271 | 3300009094 | Bacteria | 1827 |
| 436 | Ga0105245_10048884 | 3300009098 | Bacteria | 3785 |
| 437 | Ga0105245_10060455 | 3300009098 | Bacteria | 3412 |
| 438 | Ga0105245_10720516 | 3300009098 | Bacteria | 1032 |
| 439 | Ga0105247_10117961 | 3300009101 | Bacteria | 1716 |
| 440 | Ga0105243_10001789 | 3300009148 | Bacteria | 18454 |
| 441 | Ga0105243_10002265 | 3300009148 | Bacteria | 16169 |
| 442 | Ga0105243_10030050 | 3300009148 | Bacteria | 4181 |
| 443 | Ga0105243_10252607 | 3300009148 | Bacteria | 1575 |
| 444 | Ga0105243_10303347 | 3300009148 | Bacteria | 1448 |
| 445 | Ga0105243_10310359 | 3300009148 | Bacteria | 1433 |
| 446 | Ga0105243_10701988 | 3300009148 | Bacteria | 986 |
| 447 | Ga0105243_10845019 | 3300009148 | Bacteria | 906 |
| 448 | Ga0105241_10030533 | 3300009174 | Bacteria | 4029 |
| 449 | Ga0105241_10082907 | 3300009174 | Bacteria | 2514 |
| 450 | Ga0105242_10003381 | 3300009176 | Bacteria | 12421 |
| 451 | Ga0105242_10059064 | 3300009176 | Bacteria | 3146 |
| 452 | Ga0105242_10297878 | 3300009176 | Bacteria | 1471 |
| 453 | Ga0105242_11086421 | 3300009176 | Bacteria | 813 |
| 454 | Ga0105248_10006768 | 3300009177 | Bacteria | 12569 |
| 455 | Ga0105248_10028458 | 3300009177 | Bacteria | 6225 |
| 456 | Ga0105248_10831802 | 3300009177 | Bacteria | 1042 |
| 457 | Ga0105248_10962973 | 3300009177 | Bacteria | 964 |
| 458 | Ga0105237_10147254 | 3300009545 | Bacteria | 2350 |
| 459 | Ga0105237_10169697 | 3300009545 | Bacteria | 2181 |
| 460 | Ga0105237_10258441 | 3300009545 | Bacteria | 1744 |
| 461 | Ga0105237_11669011 | 3300009545 | Bacteria | 644 |
| 462 | Ga0105238_10088675 | 3300009551 | Bacteria | 3080 |
| 463 | Ga0105238_10159156 | 3300009551 | Bacteria | 2234 |
| 464 | Ga0105238_10407957 | 3300009551 | Bacteria | 1352 |
| 465 | Ga0105238_10467421 | 3300009551 | Bacteria | 1260 |
| 466 | Ga0105238_10905629 | 3300009551 | Bacteria | 900 |
| 467 | Ga0105249_10068515 | 3300009553 | Bacteria | 3273 |
| 468 | Ga0105249_10081210 | 3300009553 | Bacteria | 3013 |
| 469 | Ga0105249_10311041 | 3300009553 | Bacteria | 1584 |
| 470 | Ga0105249_10528771 | 3300009553 | Bacteria | 1228 |
| 471 | Ga0105239_10036283 | 3300010375 | Bacteria | 5413 |
| 472 | Ga0105239_10390181 | 3300010375 | Bacteria | 1575 |
| 473 | Ga0105246_10060033 | 3300011119 | Bacteria | 2641 |
| 474 | Ga0105246_11155930 | 3300011119 | Bacteria | 710 |
| 475 | Ga0157317_1002112 | 3300012475 | Bacteria | 1147 |
| 476 | Ga0157325_1000370 | 3300012485 | Bacteria | 1869 |
| 477 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 478 | Ga0157315_1004462 | 3300012508 | Bacteria | 1002 |
| 479 | Ga0157327_1004812 | 3300012512 | Bacteria | 1065 |
| 480 | Ga0157326_1000710 | 3300012513 | Bacteria | 3908 |
| 481 | Ga0157326_1007484 | 3300012513 | Bacteria | 1180 |
| 482 | Ga0157373_10040286 | 3300013100 | Bacteria | 3343 |
| 483 | Ga0157373_10154902 | 3300013100 | Bacteria | 1612 |
| 484 | Ga0157373_10361352 | 3300013100 | Bacteria | 1036 |
| 485 | Ga0157373_10421549 | 3300013100 | Bacteria | 958 |
| 486 | Ga0157371_10065519 | 3300013102 | Bacteria | 2573 |
| 487 | Ga0157371_10130902 | 3300013102 | Bacteria | 1785 |
| 488 | Ga0157371_10172453 | 3300013102 | Bacteria | 1546 |
| 489 | Ga0157370_11075345 | 3300013104 | Bacteria | 727 |
| 490 | Ga0157370_11293870 | 3300013104 | Bacteria | 657 |
| 491 | Ga0157369_10115967 | 3300013105 | Bacteria | 2844 |
| 492 | Ga0157369_10723287 | 3300013105 | Bacteria | 1025 |
| 493 | Ga0157374_10009298 | 3300013296 | Bacteria | 8429 |
| 494 | Ga0157374_10293000 | 3300013296 | Bacteria | 1609 |
| 495 | Ga0157374_10440133 | 3300013296 | Bacteria | 1304 |
| 496 | Ga0157374_10728124 | 3300013296 | Bacteria | 1006 |
| 497 | Ga0157378_10008661 | 3300013297 | Bacteria | 8856 |
| 498 | Ga0157378_10029129 | 3300013297 | Bacteria | 4874 |
| 499 | Ga0157378_10058938 | 3300013297 | Bacteria | 3425 |
| 500 | Ga0157378_10248653 | 3300013297 | Bacteria | 1701 |
| 501 | Ga0157378_10435035 | 3300013297 | Bacteria | 1299 |
| 502 | Ga0157378_10654939 | 3300013297 | Bacteria | 1066 |
| 503 | Ga0163162_10004148 | 3300013306 | Bacteria | 13915 |
| 504 | Ga0163162_10211873 | 3300013306 | Bacteria | 2067 |
| 505 | Ga0163162_10454521 | 3300013306 | Bacteria | 1413 |
| 506 | Ga0163162_10498220 | 3300013306 | Bacteria | 1349 |
| 507 | Ga0163162_10505539 | 3300013306 | Bacteria | 1339 |
| 508 | Ga0163162_11270210 | 3300013306 | Bacteria | 836 |
| 509 | Ga0163162_12327397 | 3300013306 | Bacteria | 616 |
| 510 | Ga0157372_11082189 | 3300013307 | Bacteria | 928 |
| 511 | Ga0157375_10041626 | 3300013308 | Bacteria | 4438 |
| 512 | Ga0157375_10137647 | 3300013308 | Bacteria | 2567 |
| 513 | Ga0157375_10151438 | 3300013308 | Bacteria | 2455 |
| 514 | Ga0157375_10240286 | 3300013308 | Bacteria | 1971 |
| 515 | Ga0157375_10408421 | 3300013308 | Bacteria | 1524 |
| 516 | Ga0157375_10710210 | 3300013308 | Bacteria | 1159 |
| 517 | Ga0157375_10987686 | 3300013308 | Bacteria | 982 |
| 518 | Ga0157375_11860096 | 3300013308 | Bacteria | 714 |
| 519 | Ga0163163_10510669 | 3300014325 | Bacteria | 1264 |
| 520 | Ga0163163_10710033 | 3300014325 | Bacteria | 1069 |
| 521 | Ga0157380_10285675 | 3300014326 | Bacteria | 1512 |
| 522 | Ga0157380_10297447 | 3300014326 | Bacteria | 1485 |
| 523 | Ga0157380_10338992 | 3300014326 | Bacteria | 1401 |
| 524 | Ga0157380_10349999 | 3300014326 | Bacteria | 1382 |
| 525 | Ga0182008_10001808 | 3300014497 | Bacteria | 13967 |
| 526 | Ga0157377_10000368 | 3300014745 | Bacteria | 20109 |
| 527 | Ga0157377_10115937 | 3300014745 | Bacteria | 1617 |
| 528 | Ga0157377_10152296 | 3300014745 | Bacteria | 1430 |
| 529 | Ga0157377_10425169 | 3300014745 | Bacteria | 911 |
| 530 | Ga0157379_10040412 | 3300014968 | Bacteria | 4162 |
| 531 | Ga0157379_10061342 | 3300014968 | Bacteria | 3362 |
| 532 | Ga0157379_10090060 | 3300014968 | Bacteria | 2752 |
| 533 | Ga0157379_10154533 | 3300014968 | Bacteria | 2070 |
| 534 | Ga0157379_10356655 | 3300014968 | Bacteria | 1340 |
| 535 | Ga0157379_10448165 | 3300014968 | Bacteria | 1191 |
| 536 | Ga0157376_10090219 | 3300014969 | Bacteria | 2652 |
| 537 | Ga0157376_10158282 | 3300014969 | Bacteria | 2050 |
| 538 | Ga0157376_10666310 | 3300014969 | Bacteria | 1042 |
| 539 | Ga0157376_10688965 | 3300014969 | Bacteria | 1026 |
| 540 | Ga0182006_1000240 | 3300015261 | Bacteria | 51334 |
| 541 | Ga0182006_1000274 | 3300015261 | Bacteria | 46140 |
| 542 | Ga0182007_10000196 | 3300015262 | Bacteria | 40434 |
| 543 | Ga0182007_10235263 | 3300015262 | Bacteria | 652 |
| 544 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 545 | Ga0182005_1000163 | 3300015265 | Bacteria | 46142 |
| 546 | Ga0182005_1178920 | 3300015265 | Bacteria | 629 |
| 547 | Ga0163161_10021239 | 3300017792 | Bacteria | 4564 |
| 548 | Ga0163161_10057420 | 3300017792 | Bacteria | 2828 |
| 549 | Ga0163161_10252609 | 3300017792 | Bacteria | 1375 |
| 550 | Ga0163161_10562961 | 3300017792 | Bacteria | 935 |
| 551 | Ga0197907_10761668 | 3300020069 | Bacteria | 1329 |
| 552 | Ga0206355_1548870 | 3300020076 | Bacteria | 1356 |
| 553 | Ga0206352_11007505 | 3300020078 | Bacteria | 3567 |
| 554 | Ga0206352_11093402 | 3300020078 | Bacteria | 1047 |
| 555 | Ga0206352_11327706 | 3300020078 | Bacteria | 1855 |
| 556 | Ga0206354_10722014 | 3300020081 | Bacteria | 1721 |
| 557 | Ga0213872_10000091 | 3300021361 | Bacteria | 83723 |
| 558 | Ga0213872_10002765 | 3300021361 | Bacteria | 10055 |
| 559 | Ga0213872_10004732 | 3300021361 | Bacteria | 7137 |
| 560 | Ga0213872_10030149 | 3300021361 | Bacteria | 2487 |
| 561 | Ga0213872_10070274 | 3300021361 | Bacteria | 1578 |
| 562 | Ga0213872_10070360 | 3300021361 | Bacteria | 1577 |
| 563 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 564 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 565 | Ga0209672_107040 | 3300025228 | Bacteria | 1770 |
| 566 | Ga0209672_115976 | 3300025228 | Bacteria | 827 |
| 567 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 568 | Ga0209563_100088 | 3300025230 | Bacteria | 175375 |
| 569 | Ga0207427_100260 | 3300025231 | Bacteria | 41435 |
| 570 | Ga0209437_103125 | 3300025233 | Bacteria | 3048 |
| 571 | Ga0209258_102113 | 3300025242 | Bacteria | 5574 |
| 572 | Ga0209258_105352 | 3300025242 | Bacteria | 2202 |
| 573 | Ga0209258_112329 | 3300025242 | Bacteria | 1052 |
| 574 | Ga0207425_1000680 | 3300025245 | Bacteria | 18554 |
| 575 | Ga0207425_1010240 | 3300025245 | Bacteria | 2291 |
| 576 | Ga0207425_1027536 | 3300025245 | Bacteria | 1159 |
| 577 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 578 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 579 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 580 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 581 | Ga0209026_1000121 | 3300025250 | Bacteria | 126801 |
| 582 | Ga0209026_1018764 | 3300025250 | Bacteria | 1091 |
| 583 | Ga0209677_100201 | 3300025253 | Bacteria | 47899 |
| 584 | Ga0209148_1002904 | 3300025254 | Bacteria | 5228 |
| 585 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 586 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 587 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 588 | Ga0209129_1012956 | 3300025258 | Bacteria | 1870 |
| 589 | Ga0209565_1000026 | 3300025263 | Bacteria | 365910 |
| 590 | Ga0207666_1009025 | 3300025271 | Bacteria | 1340 |
| 591 | Ga0207666_1022254 | 3300025271 | Bacteria | 938 |
| 592 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 593 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 594 | Ga0209455_1001216 | 3300025272 | Bacteria | 12270 |
| 595 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 596 | Ga0209673_1004093 | 3300025273 | Bacteria | 8026 |
| 597 | Ga0209673_1004985 | 3300025273 | Bacteria | 6882 |
| 598 | Ga0209673_1021095 | 3300025273 | Bacteria | 2288 |
| 599 | Ga0209673_1026632 | 3300025273 | Bacteria | 1894 |
| 600 | Ga0209673_1044208 | 3300025273 | Bacteria | 1236 |
| 601 | Ga0209130_1000109 | 3300025284 | Bacteria | 133520 |
| 602 | Ga0209130_1002387 | 3300025284 | Bacteria | 9506 |
| 603 | Ga0209130_1033062 | 3300025284 | Bacteria | 1050 |
| 604 | Ga0207673_1009790 | 3300025290 | Bacteria | 1227 |
| 605 | Ga0209675_1002624 | 3300025291 | Bacteria | 9104 |
| 606 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 607 | Ga0209676_1023059 | 3300025292 | Bacteria | 2046 |
| 608 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 609 | Ga0209025_1013316 | 3300025294 | Bacteria | 5182 |
| 610 | Ga0209025_1034111 | 3300025294 | Bacteria | 2334 |
| 611 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 612 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 613 | Ga0209564_1000243 | 3300025295 | Bacteria | 118066 |
| 614 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 615 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 616 | Ga0209758_1011080 | 3300025297 | Bacteria | 5275 |
| 617 | Ga0209758_1032506 | 3300025297 | Bacteria | 2116 |
| 618 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 619 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 620 | Ga0209050_1001097 | 3300025298 | Bacteria | 32856 |
| 621 | Ga0209050_1004273 | 3300025298 | Bacteria | 9808 |
| 622 | Ga0209050_1005688 | 3300025298 | Bacteria | 7709 |
| 623 | Ga0209050_1008272 | 3300025298 | Bacteria | 5607 |
| 624 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 625 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 626 | Ga0209256_1008928 | 3300025299 | Bacteria | 4516 |
| 627 | Ga0209256_1009680 | 3300025299 | Bacteria | 4174 |
| 628 | Ga0209256_1028202 | 3300025299 | Bacteria | 1588 |
| 629 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 630 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 631 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 632 | Ga0209051_1000172 | 3300025303 | Bacteria | 117180 |
| 633 | Ga0209051_1000938 | 3300025303 | Bacteria | 28786 |
| 634 | Ga0209051_1005321 | 3300025303 | Bacteria | 7574 |
| 635 | Ga0209051_1016791 | 3300025303 | Bacteria | 3292 |
| 636 | Ga0209051_1018074 | 3300025303 | Bacteria | 3132 |
| 637 | Ga0209051_1047179 | 3300025303 | Bacteria | 1474 |
| 638 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 639 | Ga0209257_1000047 | 3300025304 | Bacteria | 460507 |
| 640 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 641 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 642 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 643 | Ga0209257_1019529 | 3300025304 | Bacteria | 2547 |
| 644 | Ga0209257_1032769 | 3300025304 | Bacteria | 1643 |
| 645 | Ga0209257_1043589 | 3300025304 | Bacteria | 1315 |
| 646 | Ga0209257_1057461 | 3300025304 | Bacteria | 1070 |
| 647 | Ga0207697_10084989 | 3300025315 | Bacteria | 1336 |
| 648 | Ga0207656_10271043 | 3300025321 | Bacteria | 835 |
| 649 | Ga0207696_1000388 | 3300025711 | Bacteria | 42044 |
| 650 | Ga0207655_1000499 | 3300025728 | Bacteria | 50341 |
| 651 | Ga0207655_1024949 | 3300025728 | Bacteria | 2916 |
| 652 | Ga0207682_10017992 | 3300025893 | Bacteria | 2759 |
| 653 | Ga0207682_10021887 | 3300025893 | Bacteria | 2516 |
| 654 | Ga0207682_10186025 | 3300025893 | Bacteria | 950 |
| 655 | Ga0207642_10017753 | 3300025899 | Bacteria | 2714 |
| 656 | Ga0207642_10451467 | 3300025899 | Unclassified | 779 |
| 657 | Ga0207688_10149417 | 3300025901 | Bacteria | 1379 |
| 658 | Ga0207680_10014229 | 3300025903 | Bacteria | 4110 |
| 659 | Ga0207680_10857104 | 3300025903 | Bacteria | 651 |
| 660 | Ga0207647_10074272 | 3300025904 | Bacteria | 2048 |
| 661 | Ga0207647_10277845 | 3300025904 | Bacteria | 956 |
| 662 | Ga0207685_10051930 | 3300025905 | Bacteria | 1586 |
| 663 | Ga0207645_10009972 | 3300025907 | Bacteria | 6544 |
| 664 | Ga0207645_10048474 | 3300025907 | Bacteria | 2713 |
| 665 | Ga0207645_10160739 | 3300025907 | Bacteria | 1469 |
| 666 | Ga0207645_10210920 | 3300025907 | Bacteria | 1279 |
| 667 | Ga0207645_10495610 | 3300025907 | Bacteria | 827 |
| 668 | Ga0207643_10073671 | 3300025908 | Bacteria | 1969 |
| 669 | Ga0207643_10263156 | 3300025908 | Bacteria | 1065 |
| 670 | Ga0207643_10398381 | 3300025908 | Bacteria | 870 |
| 671 | Ga0207705_10254337 | 3300025909 | Bacteria | 1340 |
| 672 | Ga0207705_10558293 | 3300025909 | Bacteria | 890 |
| 673 | Ga0207684_10009766 | 3300025910 | Bacteria | 8465 |
| 674 | Ga0207684_10370574 | 3300025910 | Bacteria | 1232 |
| 675 | Ga0207654_10006606 | 3300025911 | Bacteria | 5831 |
| 676 | Ga0207654_10127876 | 3300025911 | Bacteria | 1604 |
| 677 | Ga0207707_10164577 | 3300025912 | Bacteria | 1938 |
| 678 | Ga0207707_10711238 | 3300025912 | Bacteria | 843 |
| 679 | Ga0207695_10103337 | 3300025913 | Bacteria | 2841 |
| 680 | Ga0207695_10203110 | 3300025913 | Bacteria | 1895 |
| 681 | Ga0207695_10501768 | 3300025913 | Bacteria | 1095 |
| 682 | Ga0207671_10047329 | 3300025914 | Bacteria | 3183 |
| 683 | Ga0207671_10269801 | 3300025914 | Bacteria | 1340 |
| 684 | Ga0207660_10046145 | 3300025917 | Bacteria | 3073 |
| 685 | Ga0207662_10013351 | 3300025918 | Bacteria | 4592 |
| 686 | Ga0207662_10034330 | 3300025918 | Bacteria | 2960 |
| 687 | Ga0207657_10092024 | 3300025919 | Bacteria | 2528 |
| 688 | Ga0207657_10309906 | 3300025919 | Bacteria | 1250 |
| 689 | Ga0207657_10364651 | 3300025919 | Bacteria | 1138 |
| 690 | Ga0207649_10001794 | 3300025920 | Bacteria | 12285 |
| 691 | Ga0207652_10002940 | 3300025921 | Bacteria | 14249 |
| 692 | Ga0207652_10202638 | 3300025921 | Bacteria | 1786 |
| 693 | Ga0207652_10449822 | 3300025921 | Bacteria | 1161 |
| 694 | Ga0207646_10141845 | 3300025922 | Bacteria | 2164 |
| 695 | Ga0207681_10005925 | 3300025923 | Bacteria | 7494 |
| 696 | Ga0207681_10021332 | 3300025923 | Bacteria | 4116 |
| 697 | Ga0207681_10083993 | 3300025923 | Bacteria | 2255 |
| 698 | Ga0207681_10193959 | 3300025923 | Bacteria | 1556 |
| 699 | Ga0207694_10026084 | 3300025924 | Bacteria | 4443 |
| 700 | Ga0207694_10034844 | 3300025924 | Bacteria | 3861 |
| 701 | Ga0207694_10352632 | 3300025924 | Bacteria | 1218 |
| 702 | Ga0207694_10596481 | 3300025924 | Bacteria | 929 |
| 703 | Ga0207650_10043623 | 3300025925 | Bacteria | 3293 |
| 704 | Ga0207650_10286339 | 3300025925 | Bacteria | 1343 |
| 705 | Ga0207650_10407122 | 3300025925 | Bacteria | 1127 |
| 706 | Ga0207650_10635503 | 3300025925 | Bacteria | 899 |
| 707 | Ga0207650_11037503 | 3300025925 | Bacteria | 698 |
| 708 | Ga0207659_10013941 | 3300025926 | Bacteria | 5170 |
| 709 | Ga0207659_10056531 | 3300025926 | Bacteria | 2811 |
| 710 | Ga0207659_10205388 | 3300025926 | Bacteria | 1576 |
| 711 | Ga0207659_10479150 | 3300025926 | Bacteria | 1051 |
| 712 | Ga0207687_10024918 | 3300025927 | Bacteria | 4001 |
| 713 | Ga0207687_10042371 | 3300025927 | Bacteria | 3131 |
| 714 | Ga0207687_10385611 | 3300025927 | Bacteria | 1149 |
| 715 | Ga0207644_10015416 | 3300025931 | Bacteria | 5129 |
| 716 | Ga0207644_10023313 | 3300025931 | Bacteria | 4238 |
| 717 | Ga0207644_10024978 | 3300025931 | Bacteria | 4105 |
| 718 | Ga0207644_10114633 | 3300025931 | Bacteria | 2042 |
| 719 | Ga0207644_10151897 | 3300025931 | Bacteria | 1792 |
| 720 | Ga0207644_10191672 | 3300025931 | Bacteria | 1607 |
| 721 | Ga0207644_10318792 | 3300025931 | Bacteria | 1256 |
| 722 | Ga0207644_10425539 | 3300025931 | Bacteria | 1088 |
| 723 | Ga0207690_10001731 | 3300025932 | Bacteria | 13411 |
| 724 | Ga0207690_10314401 | 3300025932 | Bacteria | 1229 |
| 725 | Ga0207690_10492603 | 3300025932 | Bacteria | 990 |
| 726 | Ga0207706_10044395 | 3300025933 | Bacteria | 3939 |
| 727 | Ga0207706_10079225 | 3300025933 | Bacteria | 2889 |
| 728 | Ga0207706_10300451 | 3300025933 | Bacteria | 1399 |
| 729 | Ga0207686_10000781 | 3300025934 | Bacteria | 19580 |
| 730 | Ga0207686_10048318 | 3300025934 | Bacteria | 2635 |
| 731 | Ga0207709_10000514 | 3300025935 | Bacteria | 34009 |
| 732 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 733 | Ga0207709_10020689 | 3300025935 | Bacteria | 3715 |
| 734 | Ga0207709_10092231 | 3300025935 | Bacteria | 1983 |
| 735 | Ga0207709_10207965 | 3300025935 | Bacteria | 1402 |
| 736 | Ga0207709_10215526 | 3300025935 | Bacteria | 1381 |
| 737 | Ga0207709_10226741 | 3300025935 | Bacteria | 1351 |
| 738 | Ga0207670_10104228 | 3300025936 | Bacteria | 2031 |
| 739 | Ga0207670_10138753 | 3300025936 | Bacteria | 1791 |
| 740 | Ga0207669_10089646 | 3300025937 | Bacteria | 1997 |
| 741 | Ga0207704_10257180 | 3300025938 | Bacteria | 1314 |
| 742 | Ga0207704_10311850 | 3300025938 | Bacteria | 1210 |
| 743 | Ga0207704_10411353 | 3300025938 | Bacteria | 1070 |
| 744 | Ga0207665_10121196 | 3300025939 | Bacteria | 1848 |
| 745 | Ga0207691_10028785 | 3300025940 | Bacteria | 5199 |
| 746 | Ga0207691_10102749 | 3300025940 | Bacteria | 2549 |
| 747 | Ga0207691_10115353 | 3300025940 | Bacteria | 2385 |
| 748 | Ga0207691_10230836 | 3300025940 | Bacteria | 1603 |
| 749 | Ga0207691_10464722 | 3300025940 | Bacteria | 1076 |
| 750 | Ga0207711_10009541 | 3300025941 | Bacteria | 8096 |
| 751 | Ga0207711_10023140 | 3300025941 | Bacteria | 5200 |
| 752 | Ga0207711_10072285 | 3300025941 | Bacteria | 2996 |
| 753 | Ga0207711_10162953 | 3300025941 | Bacteria | 2020 |
| 754 | Ga0207689_10002431 | 3300025942 | Bacteria | 17339 |
| 755 | Ga0207689_10028262 | 3300025942 | Bacteria | 4692 |
| 756 | Ga0207689_10033146 | 3300025942 | Bacteria | 4292 |
| 757 | Ga0207689_10038004 | 3300025942 | Bacteria | 3989 |
| 758 | Ga0207689_10642080 | 3300025942 | Bacteria | 894 |
| 759 | Ga0207689_10884337 | 3300025942 | Bacteria | 754 |
| 760 | Ga0207679_10001498 | 3300025945 | Bacteria | 14638 |
| 761 | Ga0207679_10016048 | 3300025945 | Bacteria | 4965 |
| 762 | Ga0207679_10497711 | 3300025945 | Bacteria | 1087 |
| 763 | Ga0207667_10188077 | 3300025949 | Bacteria | 2119 |
| 764 | Ga0207667_10505018 | 3300025949 | Bacteria | 1226 |
| 765 | Ga0207651_10003333 | 3300025960 | Bacteria | 7872 |
| 766 | Ga0207651_10063480 | 3300025960 | Bacteria | 2579 |
| 767 | Ga0207651_10413705 | 3300025960 | Bacteria | 1149 |
| 768 | Ga0207651_10511735 | 3300025960 | Bacteria | 1039 |
| 769 | Ga0207651_10578379 | 3300025960 | Bacteria | 979 |
| 770 | Ga0207712_10040645 | 3300025961 | Bacteria | 3193 |
| 771 | Ga0207712_10059578 | 3300025961 | Bacteria | 2703 |
| 772 | Ga0207712_10063392 | 3300025961 | Bacteria | 2632 |
| 773 | Ga0207712_10074729 | 3300025961 | Bacteria | 2448 |
| 774 | Ga0207712_10406765 | 3300025961 | Bacteria | 1145 |
| 775 | Ga0207668_10008000 | 3300025972 | Bacteria | 6291 |
| 776 | Ga0207668_10086989 | 3300025972 | Bacteria | 2284 |
| 777 | Ga0207668_10732749 | 3300025972 | Bacteria | 871 |
| 778 | Ga0207640_10018588 | 3300025981 | Bacteria | 4087 |
| 779 | Ga0207640_10312781 | 3300025981 | Bacteria | 1247 |
| 780 | Ga0207658_10002481 | 3300025986 | Bacteria | 13444 |
| 781 | Ga0207658_10005603 | 3300025986 | Bacteria | 8589 |
| 782 | Ga0207658_10054939 | 3300025986 | Bacteria | 2948 |
| 783 | Ga0207658_10140348 | 3300025986 | Bacteria | 1954 |
| 784 | Ga0207658_10174279 | 3300025986 | Bacteria | 1775 |
| 785 | Ga0207658_10212718 | 3300025986 | Bacteria | 1621 |
| 786 | Ga0207677_10007737 | 3300026023 | Bacteria | 5965 |
| 787 | Ga0207677_10074516 | 3300026023 | Bacteria | 2409 |
| 788 | Ga0207703_10008732 | 3300026035 | Bacteria | 7998 |
| 789 | Ga0207703_10030166 | 3300026035 | Bacteria | 4283 |
| 790 | Ga0207703_10194715 | 3300026035 | Bacteria | 1798 |
| 791 | Ga0207639_10039254 | 3300026041 | Bacteria | 3527 |
| 792 | Ga0207639_10048176 | 3300026041 | Bacteria | 3224 |
| 793 | Ga0207639_10261978 | 3300026041 | Bacteria | 1512 |
| 794 | Ga0207639_10359680 | 3300026041 | Bacteria | 1302 |
| 795 | Ga0207639_10493367 | 3300026041 | Bacteria | 1118 |
| 796 | Ga0207639_10653059 | 3300026041 | Bacteria | 973 |
| 797 | Ga0207678_10008286 | 3300026067 | Bacteria | 9159 |
| 798 | Ga0207678_10039587 | 3300026067 | Bacteria | 4091 |
| 799 | Ga0207678_10090610 | 3300026067 | Bacteria | 2613 |
| 800 | Ga0207678_10387740 | 3300026067 | Bacteria | 1208 |
| 801 | Ga0207678_10485421 | 3300026067 | Bacteria | 1076 |
| 802 | Ga0207678_10812950 | 3300026067 | Bacteria | 825 |
| 803 | Ga0207702_10001875 | 3300026078 | Bacteria | 20626 |
| 804 | Ga0207702_10004993 | 3300026078 | Bacteria | 11656 |
| 805 | Ga0207702_10098322 | 3300026078 | Bacteria | 2577 |
| 806 | Ga0207702_10215884 | 3300026078 | Bacteria | 1785 |
| 807 | Ga0207702_10431718 | 3300026078 | Bacteria | 1275 |
| 808 | Ga0207641_10093862 | 3300026088 | Bacteria | 2630 |
| 809 | Ga0207641_10093939 | 3300026088 | Bacteria | 2629 |
| 810 | Ga0207641_10118498 | 3300026088 | Bacteria | 2358 |
| 811 | Ga0207641_11672107 | 3300026088 | Bacteria | 638 |
| 812 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 813 | Ga0207648_10005939 | 3300026089 | Bacteria | 12211 |
| 814 | Ga0207648_10015751 | 3300026089 | Bacteria | 6936 |
| 815 | Ga0207648_10053064 | 3300026089 | Bacteria | 3545 |
| 816 | Ga0207648_10111939 | 3300026089 | Bacteria | 2397 |
| 817 | Ga0207648_10300208 | 3300026089 | Bacteria | 1440 |
| 818 | Ga0207648_11096272 | 3300026089 | Bacteria | 747 |
| 819 | Ga0207676_10010346 | 3300026095 | Bacteria | 6641 |
| 820 | Ga0207676_10011142 | 3300026095 | Bacteria | 6420 |
| 821 | Ga0207676_10154150 | 3300026095 | Bacteria | 1982 |
| 822 | Ga0207676_10393965 | 3300026095 | Bacteria | 1292 |
| 823 | Ga0207676_10583823 | 3300026095 | Bacteria | 1071 |
| 824 | Ga0207674_10004293 | 3300026116 | Bacteria | 17188 |
| 825 | Ga0207674_10158756 | 3300026116 | Bacteria | 2216 |
| 826 | Ga0207674_10952762 | 3300026116 | Bacteria | 827 |
| 827 | Ga0207675_100006663 | 3300026118 | Bacteria | 10927 |
| 828 | Ga0207683_10172753 | 3300026121 | Bacteria | 1958 |
| 829 | Ga0207683_10282833 | 3300026121 | Bacteria | 1516 |
| 830 | Ga0207683_10350849 | 3300026121 | Bacteria | 1354 |
| 831 | Ga0207683_10430813 | 3300026121 | Bacteria | 1215 |
| 832 | Ga0207683_10970415 | 3300026121 | Bacteria | 789 |
| 833 | Ga0207698_10091721 | 3300026142 | Bacteria | 2488 |
| 834 | Ga0207698_10180633 | 3300026142 | Bacteria | 1869 |
| 835 | Ga0207698_10383442 | 3300026142 | Bacteria | 1338 |
| 836 | Ga0207698_11249074 | 3300026142 | Bacteria | 757 |
| 837 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 838 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 839 | Ga0209281_1002282 | 3300027111 | Bacteria | 8082 |
| 840 | Ga0209389_1000305 | 3300027296 | Bacteria | 30534 |
| 841 | Ga0209371_1008392 | 3300027312 | Bacteria | 3443 |
| 842 | Ga0209371_1037824 | 3300027312 | Bacteria | 999 |
| 843 | Ga0209969_1000889 | 3300027360 | Bacteria | 4040 |
| 844 | Ga0209981_1007951 | 3300027378 | Bacteria | 1435 |
| 845 | Ga0209996_1000729 | 3300027395 | Bacteria | 3938 |
| 846 | Ga0209984_1037522 | 3300027424 | Bacteria | 693 |
| 847 | Ga0209995_1000242 | 3300027471 | Bacteria | 8706 |
| 848 | Ga0209968_1000130 | 3300027526 | Bacteria | 13315 |
| 849 | Ga0209968_1049434 | 3300027526 | Bacteria | 729 |
| 850 | Ga0209999_1001613 | 3300027543 | Bacteria | 3888 |
| 851 | Ga0209970_1001181 | 3300027614 | Bacteria | 4591 |
| 852 | Ga0210002_1010088 | 3300027617 | Bacteria | 1447 |
| 853 | Ga0209983_1011423 | 3300027665 | Bacteria | 1817 |
| 854 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 855 | Ga0209966_1000117 | 3300027695 | Bacteria | 35145 |
| 856 | Ga0209998_10002530 | 3300027717 | Bacteria | 4163 |
| 857 | Ga0209813_10001024 | 3300027866 | Bacteria | 6287 |
| 858 | Ga0209813_10024775 | 3300027866 | Bacteria | 1720 |
| 859 | Ga0209974_10000149 | 3300027876 | Bacteria | 21195 |
| 860 | Ga0209974_10004577 | 3300027876 | Bacteria | 4918 |
| 861 | Ga0209974_10055283 | 3300027876 | Bacteria | 1339 |
| 862 | Ga0207428_10148534 | 3300027907 | Bacteria | 1785 |
| 863 | Ga0268266_10047854 | 3300028379 | Bacteria | 3664 |
| 864 | Ga0268266_10532322 | 3300028379 | Bacteria | 1124 |
| 865 | Ga0268265_10047973 | 3300028380 | Bacteria | 3203 |
| 866 | Ga0268265_10058401 | 3300028380 | Bacteria | 2945 |
| 867 | Ga0268265_10173673 | 3300028380 | Bacteria | 1844 |
| 868 | Ga0268264_10002070 | 3300028381 | Bacteria | 17906 |
| 869 | Ga0268264_10002318 | 3300028381 | Bacteria | 16843 |
| 870 | Ga0268264_10052271 | 3300028381 | Bacteria | 3407 |
| 871 | Ga0268264_10057251 | 3300028381 | Bacteria | 3260 |
| 872 | Ga0268264_10235007 | 3300028381 | Bacteria | 1695 |
| 873 | Ga0268264_10248432 | 3300028381 | Bacteria | 1651 |
| 874 | Ga0268264_10470367 | 3300028381 | Bacteria | 1221 |
| 875 | Ga0307517_10014561 | 3300028786 | Bacteria | 10553 |
| 876 | Ga0307517_10103679 | 3300028786 | Bacteria | 2221 |
| 877 | Ga0307517_10178695 | 3300028786 | Bacteria | 1375 |
| 878 | Ga0307517_10245629 | 3300028786 | Bacteria | 1056 |
| 879 | Ga0307517_10279864 | 3300028786 | Bacteria | 952 |
| 880 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 881 | Ga0307515_10002443 | 3300028794 | Bacteria | 40478 |
| 882 | Ga0307515_10006150 | 3300028794 | Bacteria | 24126 |
| 883 | Ga0307515_10012540 | 3300028794 | Bacteria | 15942 |
| 884 | Ga0307515_10021273 | 3300028794 | Bacteria | 11511 |
| 885 | Ga0307515_10053115 | 3300028794 | Bacteria | 5987 |
| 886 | Ga0307515_10089443 | 3300028794 | Bacteria | 3877 |
| 887 | Ga0307515_10108460 | 3300028794 | Bacteria | 3271 |
| 888 | Ga0307515_10115015 | 3300028794 | Bacteria | 3104 |
| 889 | Ga0307515_10186828 | 3300028794 | Bacteria | 1998 |
| 890 | Ga0307515_10203755 | 3300028794 | Bacteria | 1846 |
| 891 | Ga0265324_10143397 | 3300029957 | Bacteria | 811 |
| 892 | Ga0268256_1008739 | 3300030500 | Bacteria | 3443 |
| 893 | Ga0268256_1043016 | 3300030500 | Bacteria | 999 |
| 894 | Ga0307511_10000653 | 3300030521 | Bacteria | 37038 |
| 895 | Ga0307511_10070244 | 3300030521 | Bacteria | 2566 |
| 896 | Ga0307512_10060099 | 3300030522 | Bacteria | 2942 |
| 897 | Ga0307512_10098413 | 3300030522 | Bacteria | 1996 |
| 898 | Ga0316181_1065259 | 3300030744 | Bacteria | 3733 |
| 899 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 900 | Ga0265332_10001586 | 3300031238 | Bacteria | 12458 |
| 901 | Ga0265329_10007973 | 3300031242 | Bacteria | 4054 |
| 902 | Ga0265331_10037135 | 3300031250 | Bacteria | 2387 |
| 903 | Ga0265327_10000178 | 3300031251 | Bacteria | 135732 |
| 904 | Ga0265327_10060743 | 3300031251 | Bacteria | 1931 |
| 905 | Ga0265327_10131623 | 3300031251 | Bacteria | 1176 |
| 906 | Ga0265316_10000201 | 3300031344 | Bacteria | 69415 |
| 907 | Ga0307513_10000028 | 3300031456 | Bacteria | 193264 |
| 908 | Ga0307513_10005218 | 3300031456 | Bacteria | 17209 |
| 909 | Ga0307513_10063852 | 3300031456 | Bacteria | 3884 |
| 910 | Ga0307513_10076724 | 3300031456 | Bacteria | 3464 |
| 911 | Ga0307513_10088393 | 3300031456 | Bacteria | 3167 |
| 912 | Ga0307513_10184235 | 3300031456 | Bacteria | 1947 |
| 913 | Ga0307513_10220352 | 3300031456 | Bacteria | 1719 |
| 914 | Ga0307513_10393592 | 3300031456 | Bacteria | 1122 |
| 915 | Ga0307509_10003616 | 3300031507 | Bacteria | 23221 |
| 916 | Ga0307509_10111735 | 3300031507 | Bacteria | 2734 |
| 917 | Ga0307509_10141229 | 3300031507 | Bacteria | 2343 |
| 918 | Ga0307509_10282377 | 3300031507 | Bacteria | 1420 |
| 919 | Ga0307509_10397800 | 3300031507 | Bacteria | 1085 |
| 920 | Ga0307509_10426950 | 3300031507 | Bacteria | 1025 |
| 921 | Ga0307408_100000089 | 3300031548 | Bacteria | 100712 |
| 922 | Ga0307408_100026553 | 3300031548 | Bacteria | 3979 |
| 923 | Ga0307408_100173708 | 3300031548 | Bacteria | 1722 |
| 924 | Ga0307408_100223586 | 3300031548 | Bacteria | 1537 |
| 925 | Ga0307408_100271807 | 3300031548 | Bacteria | 1407 |
| 926 | Ga0307408_100436865 | 3300031548 | Bacteria | 1132 |
| 927 | Ga0307408_100625521 | 3300031548 | Bacteria | 959 |
| 928 | Ga0307408_100675388 | 3300031548 | Bacteria | 926 |
| 929 | Ga0307408_101322723 | 3300031548 | Bacteria | 676 |
| 930 | Ga0307508_10000392 | 3300031616 | Bacteria | 52650 |
| 931 | Ga0307508_10061685 | 3300031616 | Bacteria | 3311 |
| 932 | Ga0307508_10484228 | 3300031616 | Bacteria | 831 |
| 933 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 934 | Ga0307514_10000530 | 3300031649 | Bacteria | 74660 |
| 935 | Ga0307514_10034392 | 3300031649 | Bacteria | 4039 |
| 936 | Ga0265314_10002097 | 3300031711 | Bacteria | 20985 |
| 937 | Ga0265314_10007665 | 3300031711 | Bacteria | 9334 |
| 938 | Ga0265314_10245661 | 3300031711 | Bacteria | 1030 |
| 939 | Ga0307516_10000048 | 3300031730 | Bacteria | 130378 |
| 940 | Ga0307516_10011689 | 3300031730 | Bacteria | 9527 |
| 941 | Ga0307516_10019197 | 3300031730 | Bacteria | 7085 |
| 942 | Ga0307516_10026535 | 3300031730 | Bacteria | 5881 |
| 943 | Ga0307516_10027941 | 3300031730 | Bacteria | 5714 |
| 944 | Ga0307516_10222839 | 3300031730 | Bacteria | 1594 |
| 945 | Ga0307516_10330542 | 3300031730 | Bacteria | 1193 |
| 946 | Ga0307516_10538908 | 3300031730 | Bacteria | 821 |
| 947 | Ga0307405_10012091 | 3300031731 | Bacteria | 4554 |
| 948 | Ga0307405_10046436 | 3300031731 | Bacteria | 2668 |
| 949 | Ga0307405_10108416 | 3300031731 | Bacteria | 1876 |
| 950 | Ga0307405_10137806 | 3300031731 | Bacteria | 1697 |
| 951 | Ga0307405_10170412 | 3300031731 | Bacteria | 1552 |
| 952 | Ga0307405_10732057 | 3300031731 | Bacteria | 822 |
| 953 | Ga0307405_11196347 | 3300031731 | Bacteria | 657 |
| 954 | Ga0307413_10032313 | 3300031824 | Bacteria | 2965 |
| 955 | Ga0307413_10042827 | 3300031824 | Bacteria | 2663 |
| 956 | Ga0307413_10124756 | 3300031824 | Bacteria | 1751 |
| 957 | Ga0307413_10544387 | 3300031824 | Bacteria | 940 |
| 958 | Ga0307413_10979169 | 3300031824 | Bacteria | 723 |
| 959 | Ga0307518_10004256 | 3300031838 | Bacteria | 10276 |
| 960 | Ga0307410_10105185 | 3300031852 | Bacteria | 2031 |
| 961 | Ga0307410_10220441 | 3300031852 | Bacteria | 1459 |
| 962 | Ga0307410_10232300 | 3300031852 | Bacteria | 1425 |
| 963 | Ga0307410_10392259 | 3300031852 | Bacteria | 1120 |
| 964 | Ga0307410_10490733 | 3300031852 | Bacteria | 1009 |
| 965 | Ga0307406_10004866 | 3300031901 | Bacteria | 7314 |
| 966 | Ga0307406_10063514 | 3300031901 | Bacteria | 2392 |
| 967 | Ga0307406_10116737 | 3300031901 | Bacteria | 1847 |
| 968 | Ga0307406_10166340 | 3300031901 | Bacteria | 1591 |
| 969 | Ga0307406_10239255 | 3300031901 | Bacteria | 1361 |
| 970 | Ga0307407_10135590 | 3300031903 | Bacteria | 1581 |
| 971 | Ga0307412_10000707 | 3300031911 | Bacteria | 19230 |
| 972 | Ga0307412_10074922 | 3300031911 | Bacteria | 2320 |
| 973 | Ga0307412_10094847 | 3300031911 | Bacteria | 2096 |
| 974 | Ga0307412_10160061 | 3300031911 | Bacteria | 1671 |
| 975 | Ga0307412_10190684 | 3300031911 | Bacteria | 1549 |
| 976 | Ga0307412_10304530 | 3300031911 | Bacteria | 1261 |
| 977 | Ga0307412_10636065 | 3300031911 | Bacteria | 908 |
| 978 | Ga0307409_100000577 | 3300031995 | Bacteria | 15970 |
| 979 | Ga0307409_100306813 | 3300031995 | Bacteria | 1479 |
| 980 | Ga0307409_100625855 | 3300031995 | Bacteria | 1067 |
| 981 | Ga0307409_101358411 | 3300031995 | Bacteria | 736 |
| 982 | Ga0307416_100025728 | 3300032002 | Bacteria | 4321 |
| 983 | Ga0307416_100043561 | 3300032002 | Bacteria | 3515 |
| 984 | Ga0307416_100260422 | 3300032002 | Bacteria | 1695 |
| 985 | Ga0307416_100879372 | 3300032002 | Bacteria | 995 |
| 986 | Ga0307416_102506524 | 3300032002 | Bacteria | 614 |
| 987 | Ga0307414_10047643 | 3300032004 | Bacteria | 2951 |
| 988 | Ga0307414_10057302 | 3300032004 | Bacteria | 2738 |
| 989 | Ga0307414_10075764 | 3300032004 | Bacteria | 2442 |
| 990 | Ga0307414_10121151 | 3300032004 | Bacteria | 2011 |
| 991 | Ga0307414_10129728 | 3300032004 | Bacteria | 1955 |
| 992 | Ga0307414_10296273 | 3300032004 | Bacteria | 1366 |
| 993 | Ga0307414_10306607 | 3300032004 | Bacteria | 1346 |
| 994 | Ga0307414_10858745 | 3300032004 | Bacteria | 830 |
| 995 | Ga0307411_10000085 | 3300032005 | Bacteria | 28904 |
| 996 | Ga0307411_10069652 | 3300032005 | Bacteria | 2376 |
| 997 | Ga0307411_10197371 | 3300032005 | Bacteria | 1542 |
| 998 | Ga0307411_10276119 | 3300032005 | Bacteria | 1335 |
| 999 | Ga0307411_10355962 | 3300032005 | Bacteria | 1195 |
| 1000 | Ga0307411_10480233 | 3300032005 | Bacteria | 1046 |
| 1001 | Ga0307411_10549901 | 3300032005 | Bacteria | 985 |
| 1002 | Ga0307415_100034663 | 3300032126 | Bacteria | 3289 |
| 1003 | Ga0307415_100039097 | 3300032126 | Bacteria | 3132 |
| 1004 | Ga0307415_101025991 | 3300032126 | Bacteria | 768 |
| 1005 | Ga0307415_101751537 | 3300032126 | Bacteria | 600 |
| 1006 | Ga0316593_10001300 | 3300032168 | Bacteria | 5433 |
| 1007 | Ga0316593_10002414 | 3300032168 | Bacteria | 4421 |
| 1008 | Ga0316593_10120311 | 3300032168 | Bacteria | 942 |
| 1009 | Ga0307507_10032678 | 3300033179 | Bacteria | 5425 |
| 1010 | Ga0307507_10087876 | 3300033179 | Bacteria | 2685 |
| 1011 | Ga0307510_10160136 | 3300033180 | Bacteria | 1849 |
| 1012 | Ga0307510_10170741 | 3300033180 | Bacteria | 1754 |
| 1013 | Ga0307510_10256916 | 3300033180 | Bacteria | 1231 |
| 1014 | Ga0316596_1000012 | 3300033541 | Bacteria | 16822 |
| 1015 | Ga0316596_1007848 | 3300033541 | Bacteria | 2529 |
| 1016 | Ga0373958_0010068 | 3300034819 | Bacteria | 1569 |
| 1017 | Ga0373959_0086787 | 3300034820 | Bacteria | 728 |
| 1018 | Ga0373928_0094074 | 3300035084 | Bacteria | 773 |
| 1019 | Ga0373940_0013733 | 3300035088 | Bacteria | 1966 |
| 1020 | Ga0373949_0033918 | 3300035090 | Bacteria | 1228 |
| 1021 | Ga0373951_0111160 | 3300035091 | Bacteria | 737 |
| 1022 | Ga0373952_0130008 | 3300035092 | Bacteria | 691 |
| 1023 | Ga0373923_0057896 | 3300035111 | Bacteria | 1640 |
| 1024 | Ga0373939_0000348 | 3300035114 | Bacteria | 11798 |
| 1025 | Ga0373939_0028000 | 3300035114 | Bacteria | 1601 |
| 1026 | Ga0373954_0456353 | 3300035118 | Bacteria | 633 |
| 1027 | Ga0373961_0015414 | 3300035241 | Bacteria | 1954 |
| 1028 | Ga0373962_0009014 | 3300035242 | Bacteria | 2464 |
| 1029 | Ga0316574_0000624 | 3300035398 | Bacteria | 14789 |
| 1030 | Ga0373924_0141394 | 3300035410 | Bacteria | 1050 |
| 1031 | Ga0373931_0000535 | 3300035691 | Bacteria | 15604 |
| 1032 | Ga0373931_0001474 | 3300035691 | Bacteria | 10131 |
| 1033 | Ga0373931_0002669 | 3300035691 | Bacteria | 7930 |
| 1034 | Ga0373931_0008660 | 3300035691 | Bacteria | 4836 |
| 1035 | Ga0373931_0022499 | 3300035691 | Bacteria | 3173 |
| 1036 | Ga0373927_0120122 | 3300035695 | Bacteria | 1715 |
| 1037 | Ga0373937_0025734 | 3300036401 | Bacteria | 5314 |
| 1038 | Ga0373937_0065847 | 3300036401 | Bacteria | 3336 |
| 1039 | Ga0373937_0816241 | 3300036401 | Bacteria | 881 |
| 1040 | Ga0265778_002283 | 3300036457 | Bacteria | 1835 |
| 1041 | Ga0316584_0500335 | 3300036712 | Bacteria | 854 |
| 1042 | Ga0373925_0269257 | 3300037068 | Bacteria | 1370 |
| 1043 | Ga0373925_0519418 | 3300037068 | Bacteria | 978 |
| 1044 | Ga0395899_0326984 | 3300037312 | Bacteria | 1031 |
| 1045 | Ga0395900_0000542 | 3300037418 | Bacteria | 52856 |
| 1046 | Ga0395900_0006501 | 3300037418 | Bacteria | 12183 |
| 1047 | Ga0395900_0010907 | 3300037418 | Bacteria | 9292 |
| 1048 | Ga0395900_0023864 | 3300037418 | Bacteria | 6258 |
| 1049 | Ga0395898_0003063 | 3300037466 | Bacteria | 18941 |
| 1050 | Ga0395898_0012209 | 3300037466 | Bacteria | 8885 |
| 1051 | Ga0395898_0154016 | 3300037466 | Bacteria | 2199 |
| 1052 | Ga0395898_0182958 | 3300037466 | Bacteria | 2003 |
| 1053 | Ga0395898_0395446 | 3300037466 | Bacteria | 1318 |
| 1054 | Ga0395905_0002507 | 3300037471 | Bacteria | 20284 |
| 1055 | Ga0395905_0016438 | 3300037471 | Bacteria | 7033 |
| 1056 | Ga0395905_0023115 | 3300037471 | Bacteria | 5877 |
| 1057 | Ga0395905_0024045 | 3300037471 | Bacteria | 5750 |
| 1058 | Ga0395905_0038305 | 3300037471 | Bacteria | 4498 |
| 1059 | Ga0395905_0097413 | 3300037471 | Bacteria | 2761 |
| 1060 | Ga0395905_0237728 | 3300037471 | Bacteria | 1702 |
| 1061 | Ga0395905_0304457 | 3300037471 | Bacteria | 1481 |
| 1062 | Ga0395905_0437884 | 3300037471 | Bacteria | 1204 |
| 1063 | Ga0395905_0505320 | 3300037471 | Bacteria | 1109 |
| 1064 | Ga0436364_0356747 | 3300037853 | Bacteria | 1624 |
| 1065 | Ga0436364_1033661 | 3300037853 | Bacteria | 1159 |
| 1066 | Ga0395901_0001925 | 3300038443 | Bacteria | 21375 |
| 1067 | Ga0395901_0018653 | 3300038443 | Bacteria | 7085 |
| 1068 | Ga0395901_0036377 | 3300038443 | Bacteria | 5089 |
| 1069 | Ga0395901_0063028 | 3300038443 | Bacteria | 3858 |
| 1070 | Ga0395901_0087625 | 3300038443 | Bacteria | 3255 |
| 1071 | Ga0395901_1189425 | 3300038443 | Bacteria | 729 |
| 1072 | Ga0436365_0023403 | 3300039437 | Bacteria | 2605 |
| 1073 | Ga0436365_1710980 | 3300039437 | Bacteria | 1601 |
| 1074 | Ga0436365_1889961 | 3300039437 | Bacteria | 683 |
| 1075 | Ga0436360_0060872 | 3300039438 | Bacteria | 1190 |
| 1076 | Ga0436360_0587704 | 3300039438 | Bacteria | 1125 |
| 1077 | Ga0436361_0110739 | 3300039447 | Bacteria | 2796 |
| 1078 | Ga0436361_0114178 | 3300039447 | Bacteria | 1053 |
| 1079 | Ga0436361_0209532 | 3300039447 | Bacteria | 1601 |
| 1080 | Ga0436361_0405071 | 3300039447 | Bacteria | 13061 |
| 1081 | Ga0436361_0714431 | 3300039447 | Bacteria | 79592 |
| 1082 | Ga0436361_1155176 | 3300039447 | Bacteria | 13767 |
| 1083 | Ga0436361_1205299 | 3300039447 | Bacteria | 6283 |
| 1084 | Ga0436363_0827848 | 3300039450 | Bacteria | 738 |
| 1085 | Ga0436363_0965849 | 3300039450 | Bacteria | 1295 |
| 1086 | Ga0439436_0017475 | 3300041404 | Bacteria | 2146 |
| 1087 | Ga0439453_0007909 | 3300041408 | Bacteria | 1698 |
| 1088 | Ga0439465_0005103 | 3300041413 | Bacteria | 4212 |
| 1089 | Ga0439465_0010171 | 3300041413 | Bacteria | 2956 |
| 1090 | Ga0451787_045197 | 3300041441 | Bacteria | 865 |
| 1091 | Ga0451788_07135 | 3300041442 | Bacteria | 925 |
| 1092 | Ga0451789_0166480 | 3300041443 | Bacteria | 966 |
| 1093 | Ga0451789_0965253 | 3300041443 | Bacteria | 2538 |
| 1094 | Ga0451790_30858 | 3300041444 | Bacteria | 1457 |
| 1095 | Ga0451794_03533 | 3300041446 | Bacteria | 1513 |
| 1096 | Ga0451794_19904 | 3300041446 | Bacteria | 839 |
| 1097 | Ga0451793_1396094 | 3300041452 | Bacteria | 2102 |
| 1098 | Ga0451793_1842659 | 3300041452 | Bacteria | 1288 |
| 1099 | Ga0451795_0013989 | 3300041456 | Bacteria | 2986 |
| 1100 | Ga0451795_1257071 | 3300041456 | Bacteria | 1735 |
| 1101 | Ga0451798_0237297 | 3300041458 | Bacteria | 2302 |
| 1102 | Ga0451798_0308085 | 3300041458 | Bacteria | 1147 |
| 1103 | Ga0451800_1546204 | 3300041459 | Bacteria | 1668 |
| 1104 | Ga0451802_0433132 | 3300041460 | Bacteria | 1756 |
| 1105 | Ga0451805_010980 | 3300041461 | Bacteria | 3772 |
| 1106 | Ga0451805_036774 | 3300041461 | Bacteria | 906 |
| 1107 | Ga0451805_102604 | 3300041461 | Bacteria | 1449 |
| 1108 | Ga0451805_122025 | 3300041461 | Bacteria | 657 |
| 1109 | Ga0451804_0350671 | 3300041463 | Bacteria | 3764 |
| 1110 | Ga0451804_0726774 | 3300041463 | Bacteria | 925 |
| 1111 | Ga0451807_0056791 | 3300041486 | Bacteria | 778 |
| 1112 | Ga0451807_1127722 | 3300041486 | Bacteria | 2271 |
| 1113 | Ga0451807_1506488 | 3300041486 | Bacteria | 1542 |
| 1114 | Ga0451833_0316321 | 3300041491 | Bacteria | 1235 |
| 1115 | Ga0451841_0726739 | 3300041498 | Bacteria | 952 |
| 1116 | Ga0451846_24314 | 3300041502 | Bacteria | 803 |
| 1117 | Ga0451850_23291 | 3300041506 | Bacteria | 651 |
| 1118 | Ga0451851_0657432 | 3300041507 | Bacteria | 755 |
| 1119 | Ga0451843_1094779 | 3300041509 | Bacteria | 1212 |
| 1120 | Ga0451843_1596578 | 3300041509 | Bacteria | 862 |
| 1121 | Ga0451855_0043459 | 3300041511 | Bacteria | 1949 |
| 1122 | Ga0451855_2055353 | 3300041511 | Bacteria | 658 |
| 1123 | Ga0451853_2297694 | 3300041512 | Bacteria | 679 |
| 1124 | Ga0451853_4042749 | 3300041512 | Bacteria | 1692 |
| 1125 | Ga0452268_34845 | 3300041907 | Bacteria | 570 |
| 1126 | Ga0439431_0002412 | 3300041997 | Bacteria | 4137 |
| 1127 | Ga0439443_004303 | 3300042003 | Bacteria | 1845 |
| 1128 | Ga0439449_0041597 | 3300042007 | Bacteria | 1709 |
| 1129 | Ga0439455_0002630 | 3300042012 | Bacteria | 3302 |
| 1130 | Ga0439455_0004568 | 3300042012 | Bacteria | 2751 |
| 1131 | Ga0439462_0001003 | 3300042015 | Bacteria | 6041 |
| 1132 | Ga0450911_007749 | 3300042115 | Bacteria | 1545 |
| 1133 | Ga0450913_000876 | 3300042117 | Bacteria | 1473 |
| 1134 | Ga0450914_020866 | 3300042118 | Bacteria | 729 |
| 1135 | Ga0450917_000001 | 3300042120 | Bacteria | 12228 |
| 1136 | Ga0450919_000025 | 3300042121 | Bacteria | 12249 |
| 1137 | Ga0450920_004654 | 3300042122 | Bacteria | 2420 |
| 1138 | Ga0450888_000612 | 3300042126 | Bacteria | 3384 |
| 1139 | Ga0450890_000549 | 3300042127 | Bacteria | 5493 |
| 1140 | Ga0450890_002585 | 3300042127 | Bacteria | 2472 |
| 1141 | Ga0450891_000262 | 3300042129 | Bacteria | 5316 |
| 1142 | Ga0450894_023369 | 3300042131 | Bacteria | 840 |
| 1143 | Ga0450896_008784 | 3300042133 | Bacteria | 1404 |
| 1144 | Ga0450898_006321 | 3300042134 | Bacteria | 1815 |
| 1145 | Ga0450903_014065 | 3300042138 | Bacteria | 1268 |
| 1146 | Ga0450889_000161 | 3300042144 | Bacteria | 6993 |
| 1147 | Ga0450907_006986 | 3300042146 | Bacteria | 1883 |
| 1148 | Ga0439446_0006408 | 3300042156 | Bacteria | 3066 |
| 1149 | Ga0439446_0031377 | 3300042156 | Bacteria | 1538 |
| 1150 | Ga0439446_0048248 | 3300042156 | Bacteria | 1268 |
| 1151 | Ga0439458_0046077 | 3300042157 | Bacteria | 1067 |
| 1152 | Ga0439434_0007708 | 3300042435 | Bacteria | 3155 |
| 1153 | Ga0439434_0022473 | 3300042435 | Bacteria | 1896 |
| 1154 | Ga0439434_0118186 | 3300042435 | Bacteria | 863 |
| 1155 | Ga0439435_0186154 | 3300042436 | Bacteria | 680 |
| 1156 | Ga0439459_0000309 | 3300042438 | Bacteria | 5891 |
| 1157 | Ga0439464_0010621 | 3300042439 | Bacteria | 2431 |
| 1158 | Ga0439460_0002749 | 3300042461 | Bacteria | 4235 |
| 1159 | Ga0439460_0046014 | 3300042461 | Bacteria | 1296 |
| 1160 | Ga0439460_0136302 | 3300042461 | Bacteria | 812 |
| 1161 | Ga0450916_000427 | 3300042530 | Bacteria | 3595 |
| 1162 | Ga0450918_000123 | 3300042531 | Bacteria | 16624 |
| 1163 | Ga0450918_010906 | 3300042531 | Bacteria | 1585 |
| 1164 | Ga0450893_0002832 | 3300042532 | Bacteria | 2720 |
| 1165 | Ga0451577_0000191 | 3300042876 | Bacteria | 128991 |
| 1166 | Ga0451577_0004247 | 3300042876 | Bacteria | 15249 |
| 1167 | Ga0451577_0004524 | 3300042876 | Bacteria | 14637 |
| 1168 | Ga0451577_0049877 | 3300042876 | Bacteria | 3737 |
| 1169 | Ga0451577_0069675 | 3300042876 | Bacteria | 3136 |
| 1170 | Ga0451577_0091475 | 3300042876 | Bacteria | 2715 |
| 1171 | Ga0451577_0219037 | 3300042876 | Bacteria | 1720 |
| 1172 | Ga0451577_0287511 | 3300042876 | Bacteria | 1490 |
| 1173 | Ga0466969_0001561 | 3300044656 | Bacteria | 12286 |
| 1174 | Ga0466969_0002589 | 3300044656 | Bacteria | 9661 |
| 1175 | Ga0466969_0002653 | 3300044656 | Bacteria | 9554 |
| 1176 | Ga0466972_0004583 | 3300044658 | Bacteria | 6926 |
| 1177 | Ga0466972_0026175 | 3300044658 | Bacteria | 2890 |
| 1178 | Ga0466972_0028508 | 3300044658 | Bacteria | 2753 |
| 1179 | Ga0453683_0007121 | 3300044673 | Bacteria | 7618 |
| 1180 | Ga0453683_0012361 | 3300044673 | Bacteria | 5596 |
| 1181 | Ga0466965_0008031 | 3300044683 | Bacteria | 4871 |
| 1182 | Ga0466966_0010593 | 3300044684 | Bacteria | 6129 |
| 1183 | Ga0466966_0026863 | 3300044684 | Bacteria | 3755 |
| 1184 | Ga0466961_0004306 | 3300044693 | Bacteria | 8909 |
| 1185 | Ga0466961_0005561 | 3300044693 | Bacteria | 7954 |
| 1186 | Ga0466964_0000637 | 3300044706 | Bacteria | 11177 |
| 1187 | Ga0453684_0000590 | 3300044712 | Bacteria | 134718 |
| 1188 | Ga0453684_0003452 | 3300044712 | Bacteria | 35581 |
| 1189 | Ga0453684_0014647 | 3300044712 | Bacteria | 12516 |
| 1190 | Ga0453684_0040021 | 3300044712 | Bacteria | 6374 |
| 1191 | Ga0453684_0077473 | 3300044712 | Bacteria | 4166 |
| 1192 | Ga0453684_0218561 | 3300044712 | Bacteria | 2209 |
| 1193 | Ga0453684_0436833 | 3300044712 | Bacteria | 1459 |
| 1194 | Ga0453684_0780306 | 3300044712 | Bacteria | 1032 |
| 1195 | Ga0466971_0002400 | 3300044719 | Bacteria | 7905 |
| 1196 | Ga0466971_0003261 | 3300044719 | Bacteria | 6925 |
| 1197 | Ga0466968_0007045 | 3300044735 | Bacteria | 4261 |
| 1198 | Ga0466968_0012515 | 3300044735 | Bacteria | 3324 |
| 1199 | Ga0466968_0307809 | 3300044735 | Bacteria | 763 |
| 1200 | Ga0466970_0030706 | 3300044765 | Bacteria | 2834 |
| 1201 | Ga0466970_0034790 | 3300044765 | Bacteria | 2668 |
| 1202 | Ga0466970_0249881 | 3300044765 | Bacteria | 993 |
| 1203 | Ga0466957_0029622 | 3300044842 | Bacteria | 3265 |
| 1204 | Ga0466957_0062776 | 3300044842 | Bacteria | 2282 |
| 1205 | Ga0466957_0556127 | 3300044842 | Bacteria | 800 |
| 1206 | Ga0466960_0006778 | 3300044901 | Bacteria | 4613 |
| 1207 | Ga0466960_0010573 | 3300044901 | Bacteria | 3835 |
| 1208 | Ga0466959_0003145 | 3300045049 | Bacteria | 10707 |
| 1209 | Ga0466959_0014533 | 3300045049 | Bacteria | 5725 |
| 1210 | Ga0466959_0051414 | 3300045049 | Bacteria | 3022 |
| 1211 | Ga0451576_0003595 | 3300045051 | Bacteria | 21077 |
| 1212 | Ga0451576_0003670 | 3300045051 | Bacteria | 20832 |
| 1213 | Ga0451576_0005877 | 3300045051 | Bacteria | 15243 |
| 1214 | Ga0451576_0044769 | 3300045051 | Bacteria | 4662 |
| 1215 | Ga0451576_0075129 | 3300045051 | Bacteria | 3516 |
| 1216 | Ga0451576_0106671 | 3300045051 | Bacteria | 2915 |
| 1217 | Ga0451576_0279243 | 3300045051 | Bacteria | 1746 |
| 1218 | Ga0466958_0002207 | 3300045836 | Bacteria | 9697 |
| 1219 | Ga0466967_0505904 | 3300045976 | Bacteria | 1186 |
| 1220 | Ga0466967_0589785 | 3300045976 | Bacteria | 1096 |
| 1221 | Ga0466967_0962570 | 3300045976 | Bacteria | 849 |
| 1222 | Ga0466967_1106498 | 3300045976 | Bacteria | 789 |
| 1223 | Ga0495617_000397 | 3300046452 | Bacteria | 24142 |
| 1224 | Ga0495617_007088 | 3300046452 | Bacteria | 3909 |
| 1225 | Ga0495617_031068 | 3300046452 | Bacteria | 1794 |
| 1226 | Ga0495627_000011 | 3300046453 | Bacteria | 354522 |
| 1227 | Ga0495592_0000203 | 3300046454 | Bacteria | 50733 |
| 1228 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 1229 | Ga0495590_0004188 | 3300046457 | Bacteria | 5838 |
| 1230 | Ga0495590_0011864 | 3300046457 | Bacteria | 3248 |
| 1231 | Ga0495591_085880 | 3300046458 | Bacteria | 796 |
| 1232 | Ga0495629_0435221 | 3300046459 | Bacteria | 889 |
| 1233 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 1234 | Ga0495638_0069996 | 3300046460 | Bacteria | 2149 |
| 1235 | Ga0495651_0348222 | 3300046462 | Bacteria | 980 |
| 1236 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 1237 | Ga0495650_0001809 | 3300046471 | Bacteria | 19254 |
| 1238 | Ga0495650_0002469 | 3300046471 | Bacteria | 14877 |
| 1239 | Ga0495650_0007879 | 3300046471 | Bacteria | 6324 |
| 1240 | Ga0495650_0111485 | 3300046471 | Bacteria | 1015 |
| 1241 | Ga0495580_0634982 | 3300046472 | Bacteria | 703 |
| 1242 | Ga0495582_0204500 | 3300046473 | Bacteria | 1128 |
| 1243 | Ga0495605_0001330 | 3300046474 | Bacteria | 16349 |
| 1244 | Ga0495605_0001735 | 3300046474 | Bacteria | 13971 |
| 1245 | Ga0495639_0194536 | 3300046475 | Bacteria | 991 |
| 1246 | Ga0495664_0369975 | 3300046477 | Bacteria | 862 |
| 1247 | Ga0495584_0023314 | 3300046491 | Bacteria | 3138 |
| 1248 | Ga0495585_0010449 | 3300046492 | Bacteria | 5520 |
| 1249 | Ga0495585_0015948 | 3300046492 | Bacteria | 4357 |
| 1250 | Ga0495594_0006316 | 3300046499 | Bacteria | 6095 |
| 1251 | Ga0495607_0000153 | 3300046501 | Bacteria | 72099 |
| 1252 | Ga0495607_0166449 | 3300046501 | Bacteria | 1116 |
| 1253 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 1254 | Ga0495583_0000510 | 3300046506 | Bacteria | 55787 |
| 1255 | Ga0495606_0003088 | 3300046507 | Bacteria | 18141 |
| 1256 | Ga0495606_0013080 | 3300046507 | Bacteria | 6592 |
| 1257 | Ga0495606_0035831 | 3300046507 | Bacteria | 3387 |
| 1258 | Ga0495606_0039991 | 3300046507 | Bacteria | 3154 |
| 1259 | Ga0495606_0055743 | 3300046507 | Bacteria | 2555 |
| 1260 | Ga0495606_0275841 | 3300046507 | Bacteria | 921 |
| 1261 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 1262 | Ga0495610_0004520 | 3300046512 | Bacteria | 10242 |
| 1263 | Ga0495610_0007369 | 3300046512 | Bacteria | 7341 |
| 1264 | Ga0495610_0025318 | 3300046512 | Bacteria | 3186 |
| 1265 | Ga0495610_0048651 | 3300046512 | Bacteria | 2080 |
| 1266 | Ga0495616_0028095 | 3300046513 | Bacteria | 2980 |
| 1267 | Ga0495616_0040567 | 3300046513 | Bacteria | 2377 |
| 1268 | Ga0495628_0436888 | 3300046516 | Bacteria | 952 |
| 1269 | Ga0495630_0113383 | 3300046517 | Bacteria | 2054 |
| 1270 | Ga0495631_0022122 | 3300046518 | Bacteria | 2957 |
| 1271 | Ga0495631_0113533 | 3300046518 | Bacteria | 1165 |
| 1272 | Ga0495632_0035459 | 3300046519 | Bacteria | 2545 |
| 1273 | Ga0495637_0002190 | 3300046520 | Bacteria | 10923 |
| 1274 | Ga0495643_0002891 | 3300046522 | Bacteria | 13023 |
| 1275 | Ga0495643_0129407 | 3300046522 | Bacteria | 1268 |
| 1276 | Ga0495644_0305745 | 3300046523 | Bacteria | 622 |
| 1277 | Ga0495648_0003167 | 3300046524 | Bacteria | 14648 |
| 1278 | Ga0495648_0009195 | 3300046524 | Bacteria | 7688 |
| 1279 | Ga0495648_0118352 | 3300046524 | Bacteria | 1428 |
| 1280 | Ga0495648_0189097 | 3300046524 | Bacteria | 1040 |
| 1281 | Ga0495666_0107065 | 3300046526 | Bacteria | 1315 |
| 1282 | Ga0495642_0090449 | 3300046528 | Bacteria | 1295 |
| 1283 | Ga0495654_0001400 | 3300046530 | Bacteria | 16709 |
| 1284 | Ga0495654_0063474 | 3300046530 | Bacteria | 1768 |
| 1285 | Ga0495654_0073901 | 3300046530 | Bacteria | 1611 |
| 1286 | Ga0495654_0105944 | 3300046530 | Bacteria | 1288 |
| 1287 | Ga0495586_0061618 | 3300046535 | Bacteria | 2042 |
| 1288 | Ga0495586_0227722 | 3300046535 | Bacteria | 1060 |
| 1289 | Ga0495598_0031772 | 3300046537 | Bacteria | 1487 |
| 1290 | Ga0495609_0005522 | 3300046538 | Bacteria | 6610 |
| 1291 | Ga0495609_0021767 | 3300046538 | Bacteria | 2957 |
| 1292 | Ga0495609_0064148 | 3300046538 | Bacteria | 1620 |
| 1293 | Ga0495621_0004071 | 3300046539 | Bacteria | 4071 |
| 1294 | Ga0495621_0012556 | 3300046539 | Bacteria | 2642 |
| 1295 | Ga0495597_0059514 | 3300046542 | Bacteria | 1668 |
| 1296 | Ga0495597_0085111 | 3300046542 | Bacteria | 1347 |
| 1297 | Ga0495597_0124240 | 3300046542 | Bacteria | 1074 |
| 1298 | Ga0495645_0034282 | 3300046543 | Bacteria | 3704 |
| 1299 | Ga0495622_0002906 | 3300046557 | Bacteria | 8173 |
| 1300 | Ga0495622_0010858 | 3300046557 | Bacteria | 4202 |
| 1301 | Ga0495633_0010195 | 3300046558 | Bacteria | 5140 |
| 1302 | Ga0495633_0017696 | 3300046558 | Bacteria | 3636 |
| 1303 | Ga0495633_0072696 | 3300046558 | Bacteria | 1603 |
| 1304 | Ga0495633_0105604 | 3300046558 | Bacteria | 1306 |
| 1305 | Ga0495656_0107150 | 3300046615 | Bacteria | 1301 |
| 1306 | Ga0495668_0002640 | 3300046616 | Bacteria | 14406 |
| 1307 | Ga0495668_0005163 | 3300046616 | Bacteria | 8962 |
| 1308 | Ga0495668_0089410 | 3300046616 | Bacteria | 1688 |
| 1309 | Ga0495611_0020577 | 3300046648 | Bacteria | 2841 |
| 1310 | Ga0495625_0006868 | 3300046660 | Bacteria | 10052 |
| 1311 | Ga0495625_0039878 | 3300046660 | Bacteria | 3427 |
| 1312 | Ga0495625_0056429 | 3300046660 | Bacteria | 2795 |
| 1313 | Ga0495625_0090743 | 3300046660 | Bacteria | 2113 |
| 1314 | Ga0495625_0102636 | 3300046660 | Bacteria | 1962 |
| 1315 | Ga0495625_0327176 | 3300046660 | Bacteria | 974 |
| 1316 | Ga0495659_0326785 | 3300046664 | Bacteria | 652 |
| 1317 | Ga0495661_0022142 | 3300046665 | Bacteria | 4136 |
| 1318 | Ga0495661_0068457 | 3300046665 | Bacteria | 2082 |
| 1319 | Ga0495661_0191580 | 3300046665 | Bacteria | 1076 |
| 1320 | Ga0495657_0099043 | 3300046675 | Bacteria | 1860 |
| 1321 | Ga0495647_0056319 | 3300046681 | Bacteria | 1541 |
| 1322 | Ga0495658_0134744 | 3300046683 | Bacteria | 1506 |
| 1323 | Ga0495669_0106577 | 3300046684 | Bacteria | 1306 |
| 1324 | Ga0495670_0004991 | 3300046691 | Bacteria | 6522 |
| 1325 | Ga0495670_0015412 | 3300046691 | Bacteria | 3755 |
| 1326 | Ga0495670_0096793 | 3300046691 | Bacteria | 1516 |
| 1327 | Ga0495670_0439497 | 3300046691 | Bacteria | 706 |
| 1328 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 1329 | Ga0495671_0085680 | 3300046692 | Bacteria | 1543 |
| 1330 | Ga0495671_0449985 | 3300046692 | Bacteria | 615 |
| 1331 | Ga0495649_0000961 | 3300046694 | Bacteria | 22764 |
| 1332 | Ga0495649_0006057 | 3300046694 | Bacteria | 7562 |
| 1333 | Ga0495649_0066300 | 3300046694 | Bacteria | 1937 |
| 1334 | Ga0495600_0374684 | 3300046809 | Bacteria | 889 |
| 1335 | Ga0495660_0007547 | 3300046810 | Bacteria | 6384 |
| 1336 | Ga0495660_0010186 | 3300046810 | Bacteria | 5468 |
| 1337 | Ga0495660_0034825 | 3300046810 | Bacteria | 2815 |
| 1338 | Ga0495660_0379705 | 3300046810 | Bacteria | 623 |
| 1339 | Ga0495636_0150053 | 3300047318 | Bacteria | 1045 |
| 1340 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 1341 | Ga0495672_0000157 | 3300047320 | Bacteria | 98544 |
| 1342 | Ga0495672_0007686 | 3300047320 | Bacteria | 8079 |
| 1343 | Ga0495672_0082508 | 3300047320 | Bacteria | 1787 |
| 1344 | Ga0495676_0010234 | 3300047321 | Bacteria | 8515 |
| 1345 | Ga0495683_0003225 | 3300047323 | Bacteria | 9532 |
| 1346 | Ga0495683_0043280 | 3300047323 | Bacteria | 2268 |
| 1347 | Ga0495687_000216 | 3300047443 | Bacteria | 81734 |
| 1348 | Ga0495687_000342 | 3300047443 | Bacteria | 59692 |
| 1349 | Ga0495687_002921 | 3300047443 | Bacteria | 12995 |
| 1350 | Ga0495677_0016634 | 3300047445 | Bacteria | 2669 |
| 1351 | Ga0495679_006474 | 3300047446 | Bacteria | 5030 |
| 1352 | Ga0495673_0000248 | 3300047469 | Bacteria | 75224 |
| 1353 | Ga0495673_0010480 | 3300047469 | Bacteria | 5036 |
| 1354 | Ga0495681_0072599 | 3300047470 | Bacteria | 1556 |
| 1355 | Ga0495686_0004619 | 3300047472 | Bacteria | 11207 |
| 1356 | Ga0495686_0007683 | 3300047472 | Bacteria | 8051 |
| 1357 | Ga0495686_0039632 | 3300047472 | Bacteria | 3008 |
| 1358 | Ga0495686_0066900 | 3300047472 | Bacteria | 2219 |
| 1359 | Ga0495593_0038039 | 3300047673 | Bacteria | 2600 |
| 1360 | Ga0496101_0512353 | 3300048904 | Bacteria | 948 |
| 1361 | Ga0496103_0014572 | 3300048906 | Bacteria | 4670 |
| 1362 | Ga0496104_0042754 | 3300048907 | Bacteria | 4254 |
| 1363 | Ga0496104_0104722 | 3300048907 | Bacteria | 2711 |
| 1364 | Ga0496104_0750240 | 3300048907 | Bacteria | 883 |
| 1365 | Ga0496106_0173396 | 3300048909 | Bacteria | 1710 |
| 1366 | Ga0496107_0080005 | 3300048910 | Bacteria | 2383 |
| 1367 | Ga0496107_0247453 | 3300048910 | Bacteria | 1327 |
| 1368 | Ga0496108_0009350 | 3300048911 | Bacteria | 7937 |
| 1369 | Ga0496108_0089279 | 3300048911 | Bacteria | 2619 |
| 1370 | Ga0496108_0097580 | 3300048911 | Bacteria | 2504 |
| 1371 | Ga0496108_0132496 | 3300048911 | Bacteria | 2142 |
| 1372 | Ga0496108_0311812 | 3300048911 | Bacteria | 1371 |
| 1373 | Ga0496108_0843377 | 3300048911 | Bacteria | 789 |
| 1374 | Ga0496109_0084426 | 3300048912 | Bacteria | 2930 |
| 1375 | Ga0496109_0188205 | 3300048912 | Bacteria | 1939 |
| 1376 | Ga0496109_0896304 | 3300048912 | Bacteria | 825 |
| 1377 | Ga0496110_0139203 | 3300048913 | Bacteria | 2194 |
| 1378 | Ga0496111_0388603 | 3300048914 | Bacteria | 1032 |
| 1379 | Ga0496111_0416148 | 3300048914 | Bacteria | 993 |
| 1380 | Ga0496112_0018422 | 3300048915 | Bacteria | 6573 |
| 1381 | Ga0496113_0089439 | 3300048916 | Bacteria | 2370 |
| 1382 | Ga0496113_0215057 | 3300048916 | Bacteria | 1531 |
| 1383 | Ga0496114_0010053 | 3300048917 | Bacteria | 7523 |
| 1384 | Ga0496114_0198844 | 3300048917 | Bacteria | 1755 |
| 1385 | Ga0496114_0360775 | 3300048917 | Bacteria | 1285 |
| 1386 | Ga0496115_0030230 | 3300048918 | Bacteria | 4260 |
| 1387 | Ga0496116_0078388 | 3300048919 | Bacteria | 2060 |
| 1388 | Ga0496116_0128468 | 3300048919 | Bacteria | 1450 |
| 1389 | Ga0496116_0381133 | 3300048919 | Bacteria | 632 |
| 1390 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1391 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 1392 | Ga0496118_0004271 | 3300048921 | Bacteria | 17094 |
| 1393 | Ga0496119_0006975 | 3300048922 | Bacteria | 10299 |
| 1394 | Ga0496120_0018751 | 3300048923 | Bacteria | 4448 |
| 1395 | Ga0496121_0002928 | 3300048924 | Bacteria | 24987 |
| 1396 | Ga0496121_0004491 | 3300048924 | Bacteria | 18710 |
| 1397 | Ga0496121_0042385 | 3300048924 | Bacteria | 3960 |
| 1398 | Ga0496121_0114637 | 3300048924 | Bacteria | 2048 |
| 1399 | Ga0496122_0002652 | 3300048925 | Bacteria | 24985 |
| 1400 | Ga0496122_0005873 | 3300048925 | Bacteria | 14382 |
| 1401 | Ga0496122_0265194 | 3300048925 | Bacteria | 950 |
| 1402 | Ga0496123_0005104 | 3300048926 | Bacteria | 13404 |
| 1403 | Ga0496123_0007601 | 3300048926 | Bacteria | 10151 |
| 1404 | Ga0496124_0001830 | 3300048927 | Bacteria | 29398 |
| 1405 | Ga0496124_0009077 | 3300048927 | Bacteria | 10283 |
| 1406 | Ga0496124_0030272 | 3300048927 | Bacteria | 4807 |
| 1407 | Ga0496124_0035888 | 3300048927 | Bacteria | 4332 |
| 1408 | Ga0496124_0101682 | 3300048927 | Bacteria | 2328 |
| 1409 | Ga0496125_0001934 | 3300048928 | Bacteria | 28316 |
| 1410 | Ga0496125_0005905 | 3300048928 | Bacteria | 13422 |
| 1411 | Ga0496125_0013937 | 3300048928 | Bacteria | 7862 |
| 1412 | Ga0496125_0211435 | 3300048928 | Bacteria | 1259 |
| 1413 | Ga0496126_0004622 | 3300048929 | Bacteria | 16312 |
| 1414 | Ga0496126_0071539 | 3300048929 | Bacteria | 3087 |
| 1415 | Ga0496126_0233051 | 3300048929 | Bacteria | 1542 |
| 1416 | Ga0496126_0317516 | 3300048929 | Bacteria | 1281 |
| 1417 | Ga0501306_000061 | 3300049127 | Bacteria | 5674 |
| 1418 | Ga0501306_001000 | 3300049127 | Bacteria | 2483 |
| 1419 | Ga0501306_001799 | 3300049127 | Bacteria | 2089 |
| 1420 | Ga0501306_001910 | 3300049127 | Bacteria | 2048 |
| 1421 | Ga0501306_002632 | 3300049127 | Bacteria | 1864 |
| 1422 | Ga0501306_004240 | 3300049127 | Bacteria | 1597 |
| 1423 | Ga0501306_008288 | 3300049127 | Bacteria | 1264 |
| 1424 | Ga0501306_034588 | 3300049127 | Bacteria | 764 |
| 1425 | Ga0501306_042519 | 3300049127 | Bacteria | 708 |
| 1426 | Ga0501308_000177 | 3300049128 | Bacteria | 3494 |
| 1427 | Ga0501308_000386 | 3300049128 | Bacteria | 2793 |
| 1428 | Ga0501308_001895 | 3300049128 | Bacteria | 1757 |
| 1429 | Ga0501308_004299 | 3300049128 | Bacteria | 1368 |
| 1430 | Ga0501309_000014 | 3300049129 | Bacteria | 8867 |
| 1431 | Ga0501309_001211 | 3300049129 | Bacteria | 2453 |
| 1432 | Ga0501309_003438 | 3300049129 | Bacteria | 1792 |
| 1433 | Ga0501309_028777 | 3300049129 | Bacteria | 812 |
| 1434 | Ga0501309_047471 | 3300049129 | Bacteria | 668 |
| 1435 | Ga0501309_047529 | 3300049129 | Bacteria | 668 |
| 1436 | Ga0501310_000059 | 3300049130 | Bacteria | 10166 |
| 1437 | Ga0501310_002023 | 3300049130 | Bacteria | 1893 |
| 1438 | Ga0501310_013605 | 3300049130 | Bacteria | 946 |
| 1439 | Ga0501341_04124 | 3300049131 | Bacteria | 841 |
| 1440 | Ga0501341_05144 | 3300049131 | Bacteria | 778 |
| 1441 | Ga0501304_000014 | 3300049160 | Bacteria | 8417 |
| 1442 | Ga0501304_000986 | 3300049160 | Bacteria | 1703 |
| 1443 | Ga0501304_001736 | 3300049160 | Bacteria | 1438 |
| 1444 | Ga0501304_004313 | 3300049160 | Bacteria | 1077 |
| 1445 | Ga0501304_004882 | 3300049160 | Bacteria | 1032 |
| 1446 | Ga0501304_018089 | 3300049160 | Bacteria | 678 |
| 1447 | Ga0501305_000004 | 3300049161 | Bacteria | 13267 |
| 1448 | Ga0501305_000819 | 3300049161 | Bacteria | 2765 |
| 1449 | Ga0501305_002660 | 3300049161 | Bacteria | 1951 |
| 1450 | Ga0501305_010383 | 3300049161 | Bacteria | 1242 |
| 1451 | Ga0501305_024612 | 3300049161 | Bacteria | 908 |
| 1452 | Ga0501305_027038 | 3300049161 | Bacteria | 878 |
| 1453 | Ga0501305_027533 | 3300049161 | Bacteria | 872 |
| 1454 | Ga0501305_037021 | 3300049161 | Bacteria | 782 |
| 1455 | Ga0501307_000029 | 3300049162 | Bacteria | 5210 |
| 1456 | Ga0501307_000963 | 3300049162 | Bacteria | 2241 |
| 1457 | Ga0501307_003905 | 3300049162 | Bacteria | 1491 |
| 1458 | Ga0501307_004808 | 3300049162 | Bacteria | 1399 |
| 1459 | Ga0501307_011993 | 3300049162 | Bacteria | 1025 |
| 1460 | Ga0501307_014709 | 3300049162 | Bacteria | 960 |
| 1461 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1462 | Ga0495678_013870 | 3300049459 | Bacteria | 3770 |
| 1463 | Ga0495678_077039 | 3300049459 | Bacteria | 1206 |
| 1464 | Ga0495678_086954 | 3300049459 | Bacteria | 1110 |
| 1465 | Ga0495682_0109952 | 3300049460 | Bacteria | 987 |
| 1466 | Ga0495682_0109955 | 3300049460 | Bacteria | 987 |
| 1467 | Ga0501291_001472 | 3300049514 | Bacteria | 2738 |
| 1468 | Ga0501292_005043 | 3300049515 | Bacteria | 1828 |
| 1469 | Ga0501293_005123 | 3300049516 | Bacteria | 1046 |
| 1470 | Ga0501294_003852 | 3300049517 | Bacteria | 1414 |
| 1471 | Ga0501299_081861 | 3300049522 | Bacteria | 719 |
| 1472 | Ga0501311_000038 | 3300049527 | Bacteria | 5334 |
| 1473 | Ga0501311_012577 | 3300049527 | Bacteria | 1058 |
| 1474 | Ga0501311_019819 | 3300049527 | Bacteria | 905 |
| 1475 | Ga0501311_031803 | 3300049527 | Bacteria | 767 |
| 1476 | Ga0501312_000016 | 3300049528 | Bacteria | 9244 |
| 1477 | Ga0501312_035753 | 3300049528 | Bacteria | 796 |
| 1478 | Ga0501312_039438 | 3300049528 | Bacteria | 767 |
| 1479 | Ga0501312_047855 | 3300049528 | Bacteria | 714 |
| 1480 | Ga0501312_054574 | 3300049528 | Bacteria | 681 |
| 1481 | Ga0501313_000012 | 3300049529 | Bacteria | 8507 |
| 1482 | Ga0501313_003194 | 3300049529 | Bacteria | 1613 |
| 1483 | Ga0501313_005027 | 3300049529 | Bacteria | 1382 |
| 1484 | Ga0501313_032965 | 3300049529 | Bacteria | 677 |
| 1485 | Ga0501314_000017 | 3300049530 | Bacteria | 8558 |
| 1486 | Ga0501314_000291 | 3300049530 | Bacteria | 2937 |
| 1487 | Ga0501314_002194 | 3300049530 | Bacteria | 1488 |
| 1488 | Ga0501314_002757 | 3300049530 | Bacteria | 1379 |
| 1489 | Ga0501314_007493 | 3300049530 | Bacteria | 969 |
| 1490 | Ga0501314_008399 | 3300049530 | Bacteria | 933 |
| 1491 | Ga0501314_020468 | 3300049530 | Bacteria | 685 |
| 1492 | Ga0501315_000082 | 3300049531 | Bacteria | 4574 |
| 1493 | Ga0501315_000346 | 3300049531 | Bacteria | 3048 |
| 1494 | Ga0501315_011621 | 3300049531 | Bacteria | 1078 |
| 1495 | Ga0501315_019448 | 3300049531 | Bacteria | 904 |
| 1496 | Ga0501315_031864 | 3300049531 | Bacteria | 763 |
| 1497 | Ga0501316_000002 | 3300049532 | Bacteria | 13278 |
| 1498 | Ga0501316_000872 | 3300049532 | Bacteria | 2338 |
| 1499 | Ga0501316_004359 | 3300049532 | Bacteria | 1416 |
| 1500 | Ga0501316_013599 | 3300049532 | Bacteria | 963 |
| 1501 | Ga0501316_028613 | 3300049532 | Bacteria | 737 |
| 1502 | Ga0501316_042876 | 3300049532 | Bacteria | 635 |
| 1503 | Ga0501317_006161 | 3300049533 | Bacteria | 1308 |
| 1504 | Ga0501317_008980 | 3300049533 | Bacteria | 1164 |
| 1505 | Ga0501317_019088 | 3300049533 | Bacteria | 913 |
| 1506 | Ga0501318_000131 | 3300049534 | Bacteria | 3541 |
| 1507 | Ga0501318_000712 | 3300049534 | Bacteria | 2277 |
| 1508 | Ga0501318_000842 | 3300049534 | Bacteria | 2162 |
| 1509 | Ga0501318_027117 | 3300049534 | Bacteria | 760 |
| 1510 | Ga0501319_000071 | 3300049535 | Bacteria | 3451 |
| 1511 | Ga0501319_000080 | 3300049535 | Bacteria | 3309 |
| 1512 | Ga0501319_000218 | 3300049535 | Bacteria | 2405 |
| 1513 | Ga0501319_000266 | 3300049535 | Bacteria | 2256 |
| 1514 | Ga0501319_001099 | 3300049535 | Bacteria | 1496 |
| 1515 | Ga0501319_002652 | 3300049535 | Bacteria | 1148 |
| 1516 | Ga0501319_018771 | 3300049535 | Bacteria | 608 |
| 1517 | Ga0501320_000131 | 3300049536 | Bacteria | 3444 |
| 1518 | Ga0501320_000176 | 3300049536 | Bacteria | 3180 |
| 1519 | Ga0501320_001178 | 3300049536 | Bacteria | 1838 |
| 1520 | Ga0501320_002176 | 3300049536 | Bacteria | 1543 |
| 1521 | Ga0501320_006390 | 3300049536 | Bacteria | 1103 |
| 1522 | Ga0501320_007324 | 3300049536 | Bacteria | 1059 |
| 1523 | Ga0501320_011478 | 3300049536 | Bacteria | 918 |
| 1524 | Ga0501321_000120 | 3300049537 | Bacteria | 3982 |
| 1525 | Ga0501321_001939 | 3300049537 | Bacteria | 1730 |
| 1526 | Ga0501321_003049 | 3300049537 | Bacteria | 1507 |
| 1527 | Ga0501321_012554 | 3300049537 | Bacteria | 961 |
| 1528 | Ga0501321_037361 | 3300049537 | Bacteria | 672 |
| 1529 | Ga0501321_053241 | 3300049537 | Bacteria | 596 |
| 1530 | Ga0501321_068408 | 3300049537 | Bacteria | 548 |
| 1531 | Ga0501322_000402 | 3300049538 | Bacteria | 1998 |
| 1532 | Ga0501323_000015 | 3300049539 | Bacteria | 8085 |
| 1533 | Ga0501323_000109 | 3300049539 | Bacteria | 4473 |
| 1534 | Ga0501323_002574 | 3300049539 | Bacteria | 1772 |
| 1535 | Ga0501323_003426 | 3300049539 | Bacteria | 1620 |
| 1536 | Ga0501323_005610 | 3300049539 | Bacteria | 1380 |
| 1537 | Ga0501323_012054 | 3300049539 | Bacteria | 1052 |
| 1538 | Ga0501323_016244 | 3300049539 | Bacteria | 947 |
| 1539 | Ga0501323_024144 | 3300049539 | Bacteria | 820 |
| 1540 | Ga0501323_032607 | 3300049539 | Bacteria | 737 |
| 1541 | Ga0501324_000221 | 3300049540 | Bacteria | 2719 |
| 1542 | Ga0501324_000294 | 3300049540 | Bacteria | 2531 |
| 1543 | Ga0501324_005041 | 3300049540 | Bacteria | 1072 |
| 1544 | Ga0501324_010830 | 3300049540 | Bacteria | 836 |
| 1545 | Ga0501324_014548 | 3300049540 | Bacteria | 755 |
| 1546 | Ga0501325_000034 | 3300049541 | Bacteria | 3949 |
| 1547 | Ga0501325_000873 | 3300049541 | Bacteria | 1668 |
| 1548 | Ga0501325_002337 | 3300049541 | Bacteria | 1286 |
| 1549 | Ga0501325_002669 | 3300049541 | Bacteria | 1241 |
| 1550 | Ga0501325_013412 | 3300049541 | Bacteria | 784 |
| 1551 | Ga0501326_02921 | 3300049542 | Bacteria | 859 |
| 1552 | Ga0501327_00604 | 3300049543 | Bacteria | 1513 |
| 1553 | Ga0501327_03461 | 3300049543 | Bacteria | 868 |
| 1554 | Ga0501327_03998 | 3300049543 | Bacteria | 831 |
| 1555 | Ga0501328_01304 | 3300049544 | Bacteria | 973 |
| 1556 | Ga0501328_04192 | 3300049544 | Bacteria | 694 |
| 1557 | Ga0501329_01972 | 3300049545 | Bacteria | 952 |
| 1558 | Ga0501329_02216 | 3300049545 | Bacteria | 919 |
| 1559 | Ga0501329_04026 | 3300049545 | Bacteria | 771 |
| 1560 | Ga0501332_02817 | 3300049548 | Bacteria | 988 |
| 1561 | Ga0501334_13346 | 3300049550 | Bacteria | 616 |
| 1562 | Ga0501335_004434 | 3300049551 | Bacteria | 1227 |
| 1563 | Ga0501335_007594 | 3300049551 | Bacteria | 1006 |
| 1564 | Ga0501335_011280 | 3300049551 | Bacteria | 872 |
| 1565 | Ga0501336_009456 | 3300049552 | Bacteria | 768 |
| 1566 | Ga0501336_010144 | 3300049552 | Bacteria | 751 |
| 1567 | Ga0501337_003001 | 3300049553 | Bacteria | 1058 |
| 1568 | Ga0501337_012388 | 3300049553 | Bacteria | 637 |
| 1569 | Ga0501338_00244 | 3300049554 | Bacteria | 2258 |
| 1570 | Ga0501031_0002025 | 3300049568 | Bacteria | 12754 |
| 1571 | Ga0501032_0005689 | 3300049569 | Bacteria | 9231 |
| 1572 | Ga0501032_0017302 | 3300049569 | Bacteria | 5061 |
| 1573 | Ga0501033_0001803 | 3300049570 | Bacteria | 18695 |
| 1574 | Ga0501033_0115139 | 3300049570 | Bacteria | 1954 |
| 1575 | Ga0501034_0007020 | 3300049571 | Bacteria | 12012 |
| 1576 | Ga0501034_0029030 | 3300049571 | Bacteria | 5623 |
| 1577 | Ga0501034_0080413 | 3300049571 | Bacteria | 3262 |
| 1578 | Ga0501034_0291137 | 3300049571 | Bacteria | 1571 |
| 1579 | Ga0501036_0011113 | 3300049572 | Bacteria | 7445 |
| 1580 | Ga0501036_0044117 | 3300049572 | Bacteria | 3776 |
| 1581 | Ga0501036_1370217 | 3300049572 | Bacteria | 574 |
| 1582 | Ga0501037_0029069 | 3300049573 | Bacteria | 4082 |
| 1583 | Ga0501037_0046758 | 3300049573 | Bacteria | 3173 |
| 1584 | Ga0501038_0002396 | 3300049574 | Bacteria | 17463 |
| 1585 | Ga0501038_0004562 | 3300049574 | Bacteria | 12890 |
| 1586 | Ga0501039_0012529 | 3300049575 | Bacteria | 6477 |
| 1587 | Ga0501039_0138984 | 3300049575 | Bacteria | 1908 |
| 1588 | Ga0501041_0243872 | 3300049577 | Bacteria | 1129 |
| 1589 | Ga0501043_0000090 | 3300049579 | Bacteria | 81336 |
| 1590 | Ga0501043_0044507 | 3300049579 | Bacteria | 3490 |
| 1591 | Ga0501043_0093617 | 3300049579 | Bacteria | 2362 |
| 1592 | Ga0501043_0096134 | 3300049579 | Bacteria | 2328 |
| 1593 | Ga0501046_0000126 | 3300049580 | Bacteria | 81334 |
| 1594 | Ga0501046_0007619 | 3300049580 | Bacteria | 9496 |
| 1595 | Ga0501047_0000160 | 3300049581 | Bacteria | 81946 |
| 1596 | Ga0501047_0030021 | 3300049581 | Bacteria | 5240 |
| 1597 | Ga0501047_0089170 | 3300049581 | Bacteria | 2961 |
| 1598 | Ga0501047_0095690 | 3300049581 | Bacteria | 2848 |
| 1599 | Ga0501048_0003429 | 3300049582 | Bacteria | 12039 |
| 1600 | Ga0501048_0782004 | 3300049582 | Bacteria | 686 |
| 1601 | Ga0501070_0016046 | 3300049586 | Bacteria | 6294 |
| 1602 | Ga0501071_0144572 | 3300049587 | Bacteria | 1772 |
| 1603 | Ga0501073_0022305 | 3300049589 | Bacteria | 4561 |
| 1604 | Ga0501075_0818786 | 3300049591 | Bacteria | 708 |
| 1605 | Ga0501198_000043 | 3300049649 | Bacteria | 44170 |
| 1606 | Ga0501202_000808 | 3300049652 | Bacteria | 4708 |
| 1607 | Ga0501206_011506 | 3300049653 | Bacteria | 1195 |
| 1608 | Ga0501208_025836 | 3300049655 | Bacteria | 1001 |
| 1609 | Ga0501211_000022 | 3300049658 | Bacteria | 11753 |
| 1610 | Ga0501222_000051 | 3300049662 | Bacteria | 43800 |
| 1611 | Ga0501222_002187 | 3300049662 | Bacteria | 2713 |
| 1612 | Ga0501222_012076 | 3300049662 | Bacteria | 1139 |
| 1613 | Ga0501223_007701 | 3300049663 | Bacteria | 2200 |
| 1614 | Ga0501233_002966 | 3300049668 | Bacteria | 3030 |
| 1615 | Ga0501235_001228 | 3300049669 | Bacteria | 5397 |
| 1616 | Ga0501235_018958 | 3300049669 | Bacteria | 1526 |
| 1617 | Ga0501238_000213 | 3300049671 | Bacteria | 8393 |
| 1618 | Ga0501238_027455 | 3300049671 | Bacteria | 818 |
| 1619 | Ga0501249_003813 | 3300049679 | Bacteria | 3043 |
| 1620 | Ga0501258_000137 | 3300049687 | Bacteria | 4092 |
| 1621 | Ga0501221_001094 | 3300049704 | Bacteria | 4449 |
| 1622 | Ga0501229_001006 | 3300049706 | Bacteria | 3217 |
| 1623 | Ga0501079_0008393 | 3300049741 | Bacteria | 7829 |
| 1624 | Ga0501080_0018310 | 3300049742 | Bacteria | 6482 |
| 1625 | Ga0501080_0044455 | 3300049742 | Bacteria | 4134 |
| 1626 | Ga0501083_0159916 | 3300049744 | Bacteria | 1474 |
| 1627 | Ga0501262_000590 | 3300049759 | Bacteria | 4309 |
| 1628 | Ga0501262_012757 | 3300049759 | Bacteria | 1077 |
| 1629 | Ga0501263_038886 | 3300049760 | Bacteria | 694 |
| 1630 | Ga0501265_002083 | 3300049762 | Bacteria | 2280 |
| 1631 | Ga0501267_000666 | 3300049764 | Bacteria | 2729 |
| 1632 | Ga0501268_001964 | 3300049765 | Bacteria | 2639 |
| 1633 | Ga0501269_000003 | 3300049766 | Bacteria | 111299 |
| 1634 | Ga0501269_001030 | 3300049766 | Bacteria | 3942 |
| 1635 | Ga0501272_000140 | 3300049769 | Bacteria | 5782 |
| 1636 | Ga0501275_029504 | 3300049772 | Bacteria | 719 |
| 1637 | Ga0501278_005782 | 3300049774 | Bacteria | 915 |
| 1638 | Ga0501035_0003746 | 3300049822 | Bacteria | 14504 |
| 1639 | Ga0501035_0010523 | 3300049822 | Bacteria | 8572 |
| 1640 | Ga0501035_0020355 | 3300049822 | Bacteria | 6092 |
| 1641 | Ga0501035_0084650 | 3300049822 | Bacteria | 2796 |
| 1642 | Ga0501044_0000210 | 3300049823 | Bacteria | 74323 |
| 1643 | Ga0501044_0003730 | 3300049823 | Bacteria | 17110 |
| 1644 | Ga0501044_0007653 | 3300049823 | Bacteria | 11876 |
| 1645 | Ga0501044_0025863 | 3300049823 | Bacteria | 6221 |
| 1646 | Ga0501044_0041861 | 3300049823 | Bacteria | 4768 |
| 1647 | Ga0501044_0057237 | 3300049823 | Bacteria | 4001 |
| 1648 | Ga0501044_0241667 | 3300049823 | Bacteria | 1749 |
| 1649 | Ga0501045_0000882 | 3300049824 | Bacteria | 19499 |
| 1650 | Ga0501226_002381 | 3300049853 | Bacteria | 2305 |
| 1651 | nmdc:mga03683_13626_c1 | 3300050489 | Bacteria | 2997 |
| 1652 | nmdc:mga03683_137878_c1 | 3300050489 | Bacteria | 1095 |
| 1653 | nmdc:mga03683_208080_c1 | 3300050489 | Bacteria | 899 |
| 1654 | nmdc:mga03683_40005_c1 | 3300050489 | Bacteria | 1921 |
| 1655 | nmdc:mga03683_5449_c1 | 3300050489 | Bacteria | 4299 |
| 1656 | nmdc:mga03683_59161_c1 | 3300050489 | Bacteria | 1616 |
| 1657 | nmdc:mga03683_60917_c2 | 3300050489 | Bacteria | 1346 |
| 1658 | nmdc:mga03683_65613_c1 | 3300050489 | Bacteria | 1542 |
| 1659 | nmdc:mga03n38_141615_c1 | 3300050490 | Bacteria | 1201 |
| 1660 | nmdc:mga03n38_4317_c1 | 3300050490 | Bacteria | 4691 |
| 1661 | nmdc:mga03n38_4851_c1 | 3300050490 | Bacteria | 4507 |
| 1662 | nmdc:mga00v17_13392_c1 | 3300050491 | Bacteria | 4553 |
| 1663 | nmdc:mga00v17_17620_c1 | 3300050491 | Bacteria | 4047 |
| 1664 | nmdc:mga00v17_198473_c1 | 3300050491 | Bacteria | 1297 |
| 1665 | nmdc:mga00v17_95981_c1 | 3300050491 | Bacteria | 1867 |
| 1666 | nmdc:mga00v17_9678_c1 | 3300050491 | Bacteria | 5229 |
| 1667 | nmdc:mga0yw44_159030_c1 | 3300050492 | Bacteria | 1478 |
| 1668 | nmdc:mga0yw44_22084_c1 | 3300050492 | Bacteria | 3562 |
| 1669 | nmdc:mga0yw44_240503_c1 | 3300050492 | Bacteria | 1203 |
| 1670 | nmdc:mga0yw44_312996_c1 | 3300050492 | Bacteria | 1053 |
| 1671 | nmdc:mga0k408_1021_c1 | 3300050493 | Bacteria | 15347 |
| 1672 | nmdc:mga0k408_112517_c1 | 3300050493 | Bacteria | 1610 |
| 1673 | nmdc:mga0k408_113462_c1 | 3300050493 | Bacteria | 1603 |
| 1674 | nmdc:mga0k408_12159_c1 | 3300050493 | Bacteria | 4701 |
| 1675 | nmdc:mga0k408_126436_c1 | 3300050493 | Bacteria | 1516 |
| 1676 | nmdc:mga0k408_12806_c1 | 3300050493 | Bacteria | 4590 |
| 1677 | nmdc:mga0k408_13979_c1 | 3300050493 | Bacteria | 4412 |
| 1678 | nmdc:mga0k408_144341_c1 | 3300050493 | Bacteria | 1417 |
| 1679 | nmdc:mga0k408_17134_c1 | 3300050493 | Bacteria | 4032 |
| 1680 | nmdc:mga0k408_191365_c1 | 3300050493 | Bacteria | 1221 |
| 1681 | nmdc:mga0k408_219_c1 | 3300050493 | Bacteria | 23656 |
| 1682 | nmdc:mga0k408_22144_c1 | 3300050493 | Bacteria | 3577 |
| 1683 | nmdc:mga0k408_34347_c1 | 3300050493 | Bacteria | 2903 |
| 1684 | nmdc:mga0k408_378964_c1 | 3300050493 | Bacteria | 843 |
| 1685 | nmdc:mga0k408_4092_c1 | 3300050493 | Bacteria | 5935 |
| 1686 | nmdc:mga0k408_46982_c1 | 3300050493 | Bacteria | 2494 |
| 1687 | nmdc:mga0k408_49108_c1 | 3300050493 | Bacteria | 2443 |
| 1688 | nmdc:mga0k408_52239_c1 | 3300050493 | Bacteria | 2369 |
| 1689 | nmdc:mga0k408_59597_c1 | 3300050493 | Bacteria | 2218 |
| 1690 | nmdc:mga0k408_6946_c1 | 3300050493 | Bacteria | 6039 |
| 1691 | nmdc:mga0k408_7194_c1 | 3300050493 | Bacteria | 5950 |
| 1692 | nmdc:mga0k408_80309_c1 | 3300050493 | Bacteria | 1360 |
| 1693 | nmdc:mga06z11_132141_c1 | 3300050494 | Bacteria | 1403 |
| 1694 | nmdc:mga06z11_1936_c1 | 3300050494 | Bacteria | 7811 |
| 1695 | nmdc:mga06z11_234289_c1 | 3300050494 | Bacteria | 1076 |
| 1696 | nmdc:mga06z11_3023_c1 | 3300050494 | Bacteria | 6473 |
| 1697 | nmdc:mga06z11_31530_c1 | 3300050494 | Bacteria | 2577 |
| 1698 | nmdc:mga06z11_49595_c1 | 3300050494 | Bacteria | 2143 |
| 1699 | nmdc:mga07m45_15127_c1 | 3300050496 | Bacteria | 4120 |
| 1700 | nmdc:mga07m45_173746_c1 | 3300050496 | Bacteria | 1253 |
| 1701 | nmdc:mga07m45_2931_c1 | 3300050496 | Bacteria | 8100 |
| 1702 | nmdc:mga07m45_313713_c1 | 3300050496 | Bacteria | 912 |
| 1703 | nmdc:mga07m45_398_c1 | 3300050496 | Bacteria | 17925 |
| 1704 | nmdc:mga07m45_44170_c1 | 3300050496 | Bacteria | 2500 |
| 1705 | nmdc:mga07m45_670_c1 | 3300050496 | Bacteria | 14551 |
| 1706 | nmdc:mga07m45_6867_c1 | 3300050496 | Bacteria | 5791 |
| 1707 | nmdc:mga07m45_73641_c1 | 3300050496 | Bacteria | 1944 |
| 1708 | nmdc:mga07m45_77026_c1 | 3300050496 | Bacteria | 1902 |
| 1709 | nmdc:mga05p37_217522_c1 | 3300050507 | Bacteria | 2307 |
| 1710 | nmdc:mga09592_38477_c1 | 3300050508 | Bacteria | 4016 |
| 1711 | nmdc:mga0qj67_514573_c1 | 3300050509 | Bacteria | 962 |
| 1712 | nmdc:mga08y16_406950_c1 | 3300050511 | Bacteria | 1392 |
| 1713 | nmdc:mga0n895_412583_c1 | 3300050512 | Bacteria | 1365 |
| 1714 | nmdc:mga0sz30_3989_c1 | 3300050516 | Bacteria | 5314 |
| 1715 | nmdc:mga0sz30_7140_c1 | 3300050516 | Bacteria | 4180 |
| 1716 | Ga0495601_0113176 | 3300053077 | Bacteria | 1759 |
| 1717 | Ga0495612_0194706 | 3300053078 | Bacteria | 893 |
| 1718 | Ga0495619_0018602 | 3300053085 | Bacteria | 4409 |
| 1719 | Ga0495619_0343377 | 3300053085 | Bacteria | 1033 |
| 1720 | Ga0500578_0003978 | 3300053086 | Bacteria | 10700 |
| 1721 | Ga0500644_0003475 | 3300053088 | Bacteria | 3899 |
| 1722 | Ga0500644_0007363 | 3300053088 | Bacteria | 2863 |
| 1723 | Ga0500646_0004768 | 3300053090 | Bacteria | 3432 |
| 1724 | Ga0500646_0014216 | 3300053090 | Bacteria | 2064 |
| 1725 | Ga0500583_0098796 | 3300053092 | Bacteria | 1427 |
| 1726 | Ga0500651_0000274 | 3300053093 | Bacteria | 30518 |
| 1727 | Ga0500651_0018933 | 3300053093 | Bacteria | 4267 |
| 1728 | Ga0500651_0066659 | 3300053093 | Bacteria | 2242 |
| 1729 | Ga0500641_0103989 | 3300053096 | Bacteria | 1219 |
| 1730 | Ga0500650_0063295 | 3300053098 | Bacteria | 1728 |
| 1731 | Ga0500569_001743 | 3300053109 | Bacteria | 4166 |
| 1732 | Ga0500593_000235 | 3300053117 | Bacteria | 22775 |
| 1733 | Ga0500594_0061291 | 3300053118 | Bacteria | 1085 |
| 1734 | Ga0500594_0063615 | 3300053118 | Bacteria | 1069 |
| 1735 | Ga0500614_049872 | 3300053123 | Bacteria | 1095 |
| 1736 | Ga0500618_002645 | 3300053125 | Bacteria | 6592 |
| 1737 | Ga0500618_040979 | 3300053125 | Bacteria | 1063 |
| 1738 | Ga0500642_0002530 | 3300053130 | Bacteria | 5383 |
| 1739 | Ga0500652_000400 | 3300053131 | Bacteria | 15538 |
| 1740 | Ga0500559_0003187 | 3300053136 | Bacteria | 8153 |
| 1741 | Ga0500564_123671 | 3300053138 | Bacteria | 1125 |
| 1742 | Ga0500568_0002797 | 3300053139 | Bacteria | 10095 |
| 1743 | Ga0500568_0013644 | 3300053139 | Bacteria | 3696 |
| 1744 | Ga0500590_019884 | 3300053148 | Bacteria | 3481 |
| 1745 | Ga0500604_0000352 | 3300053151 | Bacteria | 12731 |
| 1746 | Ga0500604_0033502 | 3300053151 | Bacteria | 1519 |
| 1747 | Ga0500616_0028067 | 3300053153 | Bacteria | 3105 |
| 1748 | Ga0500619_000012 | 3300053154 | Bacteria | 57280 |
| 1749 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 1750 | Ga0500622_0000978 | 3300053156 | Bacteria | 24237 |
| 1751 | Ga0500622_0001316 | 3300053156 | Bacteria | 20204 |
| 1752 | Ga0500634_0000642 | 3300053161 | Bacteria | 11826 |
| 1753 | Ga0500638_090974 | 3300053162 | Bacteria | 1436 |
| 1754 | Ga0500645_030785 | 3300053730 | Bacteria | 1613 |
| 1755 | Ga0500645_051755 | 3300053730 | Bacteria | 1197 |
| 1756 | Ga0500587_000541 | 3300053739 | Bacteria | 4638 |
| 1757 | Ga0590071_001831 | 3300059421 | Bacteria | 5489 |
| 1758 | Ga0590071_007079 | 3300059421 | Bacteria | 2655 |
| 1759 | Ga0590071_038065 | 3300059421 | Bacteria | 1155 |
| 1760 | Ga0590074_000612 | 3300059423 | Bacteria | 5384 |
| 1761 | Ga0590074_018003 | 3300059423 | Bacteria | 1208 |
| 1762 | Ga0587084_000147 | 3300059477 | Bacteria | 4251 |
| 1763 | Ga0587084_008054 | 3300059477 | Bacteria | 1324 |
| 1764 | Ga0587084_029056 | 3300059477 | Bacteria | 879 |
| 1765 | Ga0587093_000068 | 3300059478 | Bacteria | 4574 |
| 1766 | Ga0587093_003363 | 3300059478 | Bacteria | 1565 |
| 1767 | Ga0587093_012919 | 3300059478 | Bacteria | 1020 |
| 1768 | Ga0587093_013685 | 3300059478 | Bacteria | 1002 |
| 1769 | Ga0587066_004510 | 3300059490 | Bacteria | 1719 |
| 1770 | Ga0587070_000065 | 3300059491 | Bacteria | 5371 |
| 1771 | Ga0587070_002116 | 3300059491 | Bacteria | 2196 |
| 1772 | Ga0587070_013338 | 3300059491 | Bacteria | 1266 |
| 1773 | Ga0587073_0000528 | 3300059492 | Bacteria | 3601 |
| 1774 | Ga0587073_0012121 | 3300059492 | Bacteria | 1487 |
| 1775 | Ga0587077_000950 | 3300059493 | Bacteria | 2876 |
| 1776 | Ga0587077_001041 | 3300059493 | Bacteria | 2802 |
| 1777 | Ga0587077_009175 | 3300059493 | Bacteria | 1494 |
| 1778 | Ga0587077_009185 | 3300059493 | Bacteria | 1494 |
| 1779 | Ga0587077_126572 | 3300059493 | Bacteria | 644 |
| 1780 | Ga0587080_004865 | 3300059503 | Bacteria | 1772 |
| 1781 | Ga0587080_024618 | 3300059503 | Bacteria | 1011 |
| 1782 | Ga0587082_002352 | 3300059504 | Bacteria | 2123 |
| 1783 | Ga0587082_002436 | 3300059504 | Bacteria | 2097 |
| 1784 | Ga0587083_0000260 | 3300059505 | Bacteria | 4088 |
| 1785 | Ga0587083_0007825 | 3300059505 | Bacteria | 1650 |
| 1786 | Ga0587083_0022367 | 3300059505 | Bacteria | 1184 |
| 1787 | Ga0587083_0035204 | 3300059505 | Bacteria | 1020 |
| 1788 | Ga0587083_0104206 | 3300059505 | Bacteria | 711 |
| 1789 | Ga0587085_006077 | 3300059506 | Bacteria | 1453 |
| 1790 | Ga0587088_000741 | 3300059508 | Bacteria | 2965 |
| 1791 | Ga0587088_006778 | 3300059508 | Bacteria | 1560 |
| 1792 | Ga0587090_006053 | 3300059510 | Bacteria | 1541 |
| 1793 | Ga0587090_006400 | 3300059510 | Bacteria | 1512 |
| 1794 | Ga0587091_020896 | 3300059511 | Bacteria | 1141 |
| 1795 | Ga0587092_003731 | 3300059512 | Bacteria | 1756 |
| 1796 | Ga0587092_013128 | 3300059512 | Bacteria | 1179 |
| 1797 | Ga0587095_005582 | 3300059514 | Bacteria | 955 |
| 1798 | Ga0587106_001662 | 3300059605 | Bacteria | 2033 |
| 1799 | Ga0587106_027877 | 3300059605 | Bacteria | 887 |
| 1800 | Ga0587125_000700 | 3300059607 | Bacteria | 2137 |
| 1801 | Ga0587129_000468 | 3300059608 | Bacteria | 1815 |
| 1802 | Ga0587099_000652 | 3300059622 | Bacteria | 2125 |
| 1803 | Ga0587101_000448 | 3300059623 | Bacteria | 2910 |
| 1804 | Ga0587101_004507 | 3300059623 | Bacteria | 1492 |
| 1805 | Ga0587101_057660 | 3300059623 | Bacteria | 685 |
| 1806 | Ga0587109_004786 | 3300059624 | Bacteria | 1904 |
| 1807 | Ga0587109_006245 | 3300059624 | Bacteria | 1751 |
| 1808 | Ga0587115_001117 | 3300059626 | Bacteria | 2323 |
| 1809 | Ga0587115_009308 | 3300059626 | Bacteria | 1203 |
| 1810 | Ga0587127_000506 | 3300059629 | Bacteria | 1817 |
| 1811 | Ga0587128_001730 | 3300059630 | Bacteria | 2132 |
| 1812 | Ga0587128_016950 | 3300059630 | Bacteria | 1073 |
| 1813 | Ga0587128_037531 | 3300059630 | Bacteria | 833 |
| 1814 | Ga0587062_000400 | 3300059639 | Bacteria | 2970 |
| 1815 | Ga0587062_012649 | 3300059639 | Bacteria | 1086 |
| 1816 | Ga0587062_023713 | 3300059639 | Bacteria | 891 |
| 1817 | Ga0587067_002743 | 3300059640 | Bacteria | 2128 |
| 1818 | Ga0587068_001309 | 3300059641 | Bacteria | 2740 |
| 1819 | Ga0587068_002035 | 3300059641 | Bacteria | 2400 |
| 1820 | Ga0587068_002203 | 3300059641 | Bacteria | 2337 |
| 1821 | Ga0587068_065785 | 3300059641 | Bacteria | 706 |
| 1822 | Ga0587072_001392 | 3300059643 | Bacteria | 2980 |
| 1823 | Ga0587072_008796 | 3300059643 | Bacteria | 1606 |
| 1824 | Ga0587076_002043 | 3300059645 | Bacteria | 2197 |
| 1825 | Ga0587076_002122 | 3300059645 | Bacteria | 2173 |
| 1826 | Ga0587076_026054 | 3300059645 | Bacteria | 1004 |
| 1827 | Ga0587076_048146 | 3300059645 | Bacteria | 822 |
| 1828 | Ga0587076_056593 | 3300059645 | Bacteria | 780 |
| 1829 | Ga0587078_001557 | 3300059646 | Bacteria | 2075 |
| 1830 | Ga0587079_003155 | 3300059647 | Bacteria | 2119 |
| 1831 | Ga0587079_074262 | 3300059647 | Bacteria | 765 |
| 1832 | Ga0587100_000850 | 3300059648 | Bacteria | 1621 |
| 1833 | Ga0587102_000785 | 3300059649 | Bacteria | 1981 |
| 1834 | Ga0587105_000221 | 3300059651 | Bacteria | 2056 |
| 1835 | Ga0587107_000989 | 3300059652 | Bacteria | 2150 |
| 1836 | Ga0587108_001930 | 3300059653 | Bacteria | 1340 |
| 1837 | Ga0587110_002686 | 3300059654 | Bacteria | 1429 |
| 1838 | Ga0587114_002480 | 3300059655 | Bacteria | 1723 |
| 1839 | Ga0587116_02561 | 3300059656 | Bacteria | 966 |
| 1840 | Ga0587118_00289 | 3300059657 | Bacteria | 2380 |
| 1841 | Ga0587119_011551 | 3300059658 | Bacteria | 1018 |
| 1842 | Ga0587119_011607 | 3300059658 | Bacteria | 1017 |
| 1843 | Ga0587124_001207 | 3300059660 | Bacteria | 1640 |
| 1844 | Ga0587124_001529 | 3300059660 | Bacteria | 1514 |
| 1845 | Ga0587060_005879 | 3300060243 | Bacteria | 967 |
| 1846 | Ga0587096_00044 | 3300060247 | Bacteria | 2129 |
| 1847 | Ga0587071_000529 | 3300060344 | Bacteria | 3833 |
| 1848 | Ga0587071_026067 | 3300060344 | Bacteria | 1101 |
| 1849 | Ga0587071_032151 | 3300060344 | Bacteria | 1016 |
| 1850 | Ga0587111_0000186 | 3300060346 | Bacteria | 4817 |
| 1851 | Ga0587111_0000325 | 3300060346 | Bacteria | 4182 |
| 1852 | Ga0587111_0028503 | 3300060346 | Bacteria | 1125 |
| 1853 | Ga0587111_0150047 | 3300060346 | Bacteria | 625 |
| 1854 | Ga0466962_0000718 | 3300061719 | Bacteria | 14786 |
| 1855 | Ga0466962_0019514 | 3300061719 | Bacteria | 3258 |
| 1856 | Ga0466962_0341430 | 3300061719 | Bacteria | 745 |
| 1857 | 2511245076 | 2511231002 | Bacteria | 5042903 |
| 1858 | 2548501400 | 2547132374 | Bacteria | 5530232 |
| 1859 | 2587725924 | 2585428057 | Bacteria | 6737412 |
| 1860 | 2587735575 | 2585428058 | Bacteria | 6853932 |
| 1861 | 2587758986 | 2585428062 | Bacteria | 6842168 |
| 1862 | 2588292863 | 2588253510 | Bacteria | 6901809 |
| 1863 | 2601667014 | 2600255292 | Bacteria | 6300551 |
| 1864 | 2643746688 | 2643221544 | Bacteria | 5886209 |
| 1865 | 2643868378 | 2643221570 | Bacteria | 5103772 |
| 1866 | 2643937420 | 2643221585 | Bacteria | 5812563 |
| 1867 | 2643967972 | 2643221592 | Bacteria | 6608788 |
| 1868 | 2643994489 | 2643221596 | Bacteria | 5006805 |
| 1869 | 2644061503 | 2643221609 | Bacteria | 6756331 |
| 1870 | 2644075035 | 2643221611 | Bacteria | 6820941 |
| 1871 | 2644143128 | 2643221625 | Bacteria | 6512927 |
| 1872 | 2644218754 | 2643221639 | Bacteria | 6649903 |
| 1873 | 2644247752 | 2643221644 | Bacteria | 6865017 |
| 1874 | 2644254814 | 2643221645 | Bacteria | 7207331 |
| 1875 | 2644256841 | 2643221646 | Bacteria | 6433402 |
| 1876 | 2644271784 | 2643221648 | Bacteria | 6521465 |
| 1877 | 2644295314 | 2643221652 | Bacteria | 5140275 |
| 1878 | 2644305900 | 2643221654 | Bacteria | 5273570 |
| 1879 | 2644314958 | 2643221656 | Bacteria | 5809961 |
| 1880 | 2644338009 | 2643221660 | Bacteria | 4208257 |
| 1881 | 2644360375 | 2643221664 | Bacteria | 7272945 |
| 1882 | 2644649055 | 2643221717 | Bacteria | 5676132 |
| 1883 | 2722886129 | 2721755523 | Bacteria | 6430384 |
| 1884 | 2738738123 | 2738541280 | Bacteria | 6630198 |
| 1885 | 2738826782 | 2738541297 | Bacteria | 6549566 |
| 1886 | 2738843079 | 2738541300 | Bacteria | 6675882 |
| 1887 | 2739057971 | 2738541337 | Bacteria | 6183410 |
| 1888 | 2739150579 | 2738541357 | Bacteria | 6549408 |
| 1889 | 2739192498 | 2738543003 | Bacteria | 6549560 |
| 1890 | 2739243204 | 2738543012 | Bacteria | 7115078 |
| 1891 | 2739273830 | 2738543018 | Bacteria | 6718814 |
| 1892 | 2739318975 | 2738543026 | Bacteria | 6549408 |
| 1893 | 2739337216 | 2738543029 | Bacteria | 6549249 |
| 1894 | 2739342874 | 2738543030 | Bacteria | 6719714 |
| 1895 | 2816473779 | 2816332133 | Bacteria | 7249298 |
| 1896 | 2821135882 | 2821131069 | Bacteria | 6108407 |
| 1897 | 2839144217 | 2839138175 | Bacteria | 6549354 |
| 1898 | 2842712344 | 2842711865 | Bacteria | 7155354 |
| 1899 | 2842722291 | 2842718218 | Bacteria | 4560148 |
| 1900 | 2855735574 | 2855730933 | Bacteria | 7047938 |
| 1901 | 2855771357 | 2855767633 | Bacteria | 7049357 |
| 1902 | 2857549059 | 2857547612 | Bacteria | 6179999 |
| 1903 | 2857556288 | 2857553236 | Bacteria | 6166726 |
| 1904 | 2857560795 | 2857558681 | Bacteria | 6617694 |
| 1905 | 2857567994 | 2857564685 | Bacteria | 6290584 |
| 1906 | 2857578657 | 2857576091 | Bacteria | 5465855 |
| 1907 | 2881104315 | 2881101125 | Bacteria | 4590519 |
| 1908 | 2881416781 | 2881412998 | Bacteria | 6492157 |
| 1909 | 2885084377 | 2885080285 | Bacteria | 6355622 |
| 1910 | 2886854505 | 2886848708 | Bacteria | 5632523 |
| 1911 | 2894023738 | 2894023352 | Bacteria | 5167372 |
| 1912 | 2904428890 | 2904424332 | Bacteria | 7633521 |
| 1913 | 2919476950 | 2919476304 | Bacteria | 5888696 |
| 1914 | 2919708822 | 2919704043 | Bacteria | 5560311 |
| 1915 | 2928118414 | 2928115317 | Bacteria | 6477646 |
| 1916 | 2932416109 | 2932410948 | Bacteria | 6312192 |
| 1917 | 2932422215 | 2932416698 | Bacteria | 6315112 |
| 1918 | 2932423149 | 2932422444 | Bacteria | 4678430 |
| 1919 | 2939635358 | 2939631187 | Bacteria | 6118131 |
| 1920 | 2974320960 | 2974320154 | Bacteria | 4571377 |
| 1921 | 2989393093 | 2989392574 | Bacteria | 4554005 |
| 1922 | 2990715405 | 2990710928 | Bacteria | 5002431 |
| 1923 | 8002396096 | 8002392321 | Bacteria | 4159911 |
| 1924 | 8048749930 | 8048746797 | Bacteria | 3557226 |
| 1925 | 8055226498 | 8055225921 | Bacteria | 3341787 |
| 1926 | Ga0496104_0298273 | |||
| 1927 | SwRhRL2b_contig_1765669 | |||
| 1928 | SwRhRL2b_contig_2600354 | |||
| 1929 | SwRhRL2b_contig_690899 | |||
| 1930 | SwRhRL2b_contig_889991 | |||
| 1931 | JGI24740J21852_10001487 | |||
| 1932 | JGI24735J21928_10182907 | |||
| 1933 | JGI24750J21931_1036900 | |||
| 1934 | JGI24744J21845_10017966 | |||
| 1935 | JGI25155J39150_1000064 | |||
| 1936 | JGI25156J39149_1000085 | |||
| 1937 | JGI25154J39366_1000112 | |||
| 1938 | JGI25154J39366_1000593 | |||
| 1939 | JGI25154J39366_1001042 | |||
| 1940 | JGI25157J39369_1000109 | |||
| 1941 | JGI25164J39214_1002084 | |||
| 1942 | JGI25152J39213_1001073 | |||
| 1943 | JGI25152J39213_1014680 | |||
| 1944 | JGI25150J39212_1003907 | |||
| 1945 | JGI25150J39212_1019452 | |||
| 1946 | JGI25159J45721_1017949 | |||
| 1947 | Ga0006771J45828_103610 | |||
| 1948 | Ga0006771J45828_103876 | |||
| 1949 | Ga0006765J45826_106373 | |||
| 1950 | Ga0006778J45830_1009213 | |||
| 1951 | Ga0006778J45830_1028609 | |||
| 1952 | Ga0006759J45824_1019946 | |||
| 1953 | Ga0006759J45824_1028038 | |||
| 1954 | Ga0006759J45824_1029126 | |||
| 1955 | Ga0006759J45824_1043209 | |||
| 1956 | JGI25151J46595_10000457 | |||
| 1957 | JGI25151J46595_10028695 | |||
| 1958 | JGI25153J46596_10007740 | |||
| 1959 | JGI25153J46596_10035613 | |||
| 1960 | Ga0006758J48902_1008911 | |||
| 1961 | Ga0006758J48902_1011628 | |||
| 1962 | Ga0006758J48902_1015976 | |||
| 1963 | Ga0006758J48902_1016024 | |||
| 1964 | Ga0006758J48902_1016608 | |||
| 1965 | Ga0006758J48902_1021934 | |||
| 1966 | Ga0006770J48903_1001899 | |||
| 1967 | Ga0006770J48903_1017003 | |||
| 1968 | Ga0006770J48903_1020844 | |||
| 1969 | Ga0006777J48905_1014855 | |||
| 1970 | Ga0006777J48905_1017368 | |||
| 1971 | Ga0006777J48905_1043026 | |||
| 1972 | JGI26128J50194_1000191 | |||
| 1973 | JGI25161J50226_1000036 | |||
| 1974 | JGI26132J50249_100694 | |||
| 1975 | Ga0007417J51691_1002612 | |||
| 1976 | Ga0007417J51691_1011781 | |||
| 1977 | Ga0007417J51691_1020817 | |||
| 1978 | Ga0007417J51691_1027994 | |||
| 1979 | Ga0007417J51691_1043945 | |||
| 1980 | Ga0007427J51700_113492 | |||
| 1981 | Ga0007427J51700_113549 | |||
| 1982 | Ga0007410J51695_1004597 | |||
| 1983 | Ga0007410J51695_1005226 | |||
| 1984 | Ga0007410J51695_1012689 | |||
| 1985 | Ga0007410J51695_1028665 | |||
| 1986 | Ga0007410J51695_1032042 | |||
| 1987 | Ga0007410J51695_1034122 | |||
| 1988 | Ga0007410J51695_1043180 | |||
| 1989 | Ga0007409J51694_1019841 | |||
| 1990 | Ga0007409J51694_1024055 | |||
| 1991 | Ga0007409J51694_1069872 | |||
| 1992 | Ga0007416J51690_1017602 | |||
| 1993 | Ga0007416J51690_1027279 | |||
| 1994 | Ga0007416J51690_1037564 | |||
| 1995 | Ga0007416J51690_1051124 | |||
| 1996 | Ga0007416J51690_1051380 | |||
| 1997 | Ga0007429J51699_1044837 | |||
| 1998 | Ga0007411J51799_103551 | |||
| 1999 | Ga0007411J51799_109097 | |||
| 2000 | Ga0007415J51800_102854 | |||
| 2001 | Ga0007415J51800_107261 | |||
| 2002 | Ga0032354_1010092 | |||
| 2003 | Ga0032354_1011583 | |||
| 2004 | Ga0032354_1030488 | |||
| 2005 | Ga0032354_1037309 | |||
| 2006 | Ga0032354_1038503 | |||
| 2007 | Ga0032354_1043583 | |||
| 2008 | Ga0032354_1045145 | |||
| 2009 | Ga0006766_118421 | |||
| 2010 | Ga0006780_1014314 | |||
| 2011 | Ga0006780_1040471 | |||
| 2012 | Ga0055539_1019592 | |||
| 2013 | Ga0055533_1000043 | |||
| 2014 | Ga0055525_1000161 | |||
| 2015 | Ga0055525_1000641 | |||
| 2016 | Ga0055529_1000079 | |||
| 2017 | Ga0055529_1000322 | |||
| 2018 | Ga0055529_1000804 | |||
| 2019 | Ga0055526_1000791 | |||
| 2020 | Ga0055526_1003343 | |||
| 2021 | Ga0055526_1008246 | |||
| 2022 | Ga0055537_1001762 | |||
| 2023 | Ga0055524_1000140 | |||
| 2024 | Ga0055524_1019174 | |||
| 2025 | Ga0055524_1029964 | |||
| 2026 | Ga0055524_1029968 | |||
| 2027 | Ga0055536_1012654 | |||
| 2028 | Ga0055528_1000762 | |||
| 2029 | Ga0055528_1037491 | |||
| 2030 | Ga0055530_10006458 | |||
| 2031 | Ga0055530_10019398 | |||
| 2032 | Ga0055540_1000133 | |||
| 2033 | Ga0055540_1000137 | |||
| 2034 | Ga0055540_1011339 | |||
| 2035 | Ga0055540_1025018 | |||
| 2036 | Ga0055540_1026414 | |||
| 2037 | Ga0055540_1035141 | |||
| 2038 | Ga0055531_10000281 | |||
| 2039 | Ga0055531_10001985 | |||
| 2040 | Ga0055531_10002079 | |||
| 2041 | Ga0055531_10004806 | |||
| 2042 | Ga0055531_10034681 | |||
| 2043 | Ga0055543_1000157 | |||
| 2044 | Ga0055543_1027494 | |||
| 2045 | Ga0055543_1039962 | |||
| 2046 | Ga0058858_1430617 | |||
| 2047 | Ga0058859_10003590 | |||
| 2048 | Ga0058859_10014111 | |||
| 2049 | Ga0058859_10053023 | |||
| 2050 | Ga0058859_10055155 | |||
| 2051 | Ga0058859_10114978 | |||
| 2052 | Ga0058861_10032824 | |||
| 2053 | Ga0058861_10142005 | |||
| 2054 | Ga0058860_10052045 | |||
| 2055 | Ga0058860_12036570 | |||
| 2056 | Ga0058860_12226982 | |||
| 2057 | Ga0058862_10051180 | |||
| 2058 | Ga0065165_1007979 | |||
| 2059 | Ga0065165_1010518 | |||
| 2060 | Ga0065714_10003225 | |||
| 2061 | Ga0065714_10403084 | |||
| 2062 | Ga0065704_10072380 | |||
| 2063 | Ga0065704_10073672 | |||
| 2064 | Ga0065704_10080021 | |||
| 2065 | Ga0065704_10115708 | |||
| 2066 | Ga0065712_10021088 | |||
| 2067 | Ga0065707_10015436 | |||
| 2068 | Ga0070658_10018142 | |||
| 2069 | Ga0070658_10102014 | |||
| 2070 | Ga0070658_10152764 | |||
| 2071 | Ga0070676_10002282 | |||
| 2072 | Ga0070676_10157576 | |||
| 2073 | Ga0070676_10241559 | |||
| 2074 | Ga0070676_10324837 | |||
| 2075 | Ga0070683_100230594 | |||
| 2076 | Ga0070683_100352957 | |||
| 2077 | Ga0070690_100006927 | |||
| 2078 | Ga0070690_100031978 | |||
| 2079 | Ga0070690_100134141 | |||
| 2080 | Ga0070670_100020621 | |||
| 2081 | Ga0070670_100064589 | |||
| 2082 | Ga0070670_100536933 | |||
| 2083 | Ga0070670_100687288 | |||
| 2084 | Ga0070677_10069496 | |||
| 2085 | Ga0068869_100001782 | |||
| 2086 | Ga0068869_100012739 | |||
| 2087 | Ga0068869_100052834 | |||
| 2088 | Ga0068869_100054551 | |||
| 2089 | Ga0068869_100167482 | |||
| 2090 | Ga0070666_10109820 | |||
| 2091 | Ga0070666_10283707 | |||
| 2092 | Ga0070666_10312794 | |||
| 2093 | Ga0070666_10340714 | |||
| 2094 | Ga0070680_100032809 | |||
| 2095 | Ga0068868_100045924 | |||
| 2096 | Ga0068868_100133352 | |||
| 2097 | Ga0068868_100185626 | |||
| 2098 | Ga0068868_100240329 | |||
| 2099 | Ga0068868_100272027 | |||
| 2100 | Ga0068868_100395538 | |||
| 2101 | Ga0068868_101211131 | |||
| 2102 | Ga0070660_100137713 | |||
| 2103 | Ga0070660_100332256 | |||
| 2104 | Ga0070689_100109373 | |||
| 2105 | Ga0070691_10245118 | |||
| 2106 | Ga0070687_100651994 | |||
| 2107 | Ga0070661_100003672 | |||
| 2108 | Ga0070661_100484849 | |||
| 2109 | Ga0070661_100633571 | |||
| 2110 | Ga0070661_100732093 | |||
| 2111 | Ga0070668_100101221 | |||
| 2112 | Ga0070668_100238759 | |||
| 2113 | Ga0070668_100967691 | |||
| 2114 | Ga0070669_100017536 | |||
| 2115 | Ga0070669_100075981 | |||
| 2116 | Ga0070669_100156484 | |||
| 2117 | Ga0070669_100212897 | |||
| 2118 | Ga0070669_100346164 | |||
| 2119 | Ga0070669_100666194 | |||
| 2120 | Ga0070675_100107037 | |||
| 2121 | Ga0070675_100262088 | |||
| 2122 | Ga0070675_100318575 | |||
| 2123 | Ga0070675_100330914 | |||
| 2124 | Ga0070675_100556488 | |||
| 2125 | Ga0070675_100775837 | |||
| 2126 | Ga0070675_100931940 | |||
| 2127 | Ga0070671_100085884 | |||
| 2128 | Ga0070671_100133178 | |||
| 2129 | Ga0070671_100170542 | |||
| 2130 | Ga0070671_100250786 | |||
| 2131 | Ga0070671_100472106 | |||
| 2132 | Ga0070671_100630285 | |||
| 2133 | Ga0070671_100908201 | |||
| 2134 | Ga0070674_100016236 | |||
| 2135 | Ga0070674_100056124 | |||
| 2136 | Ga0070673_100117288 | |||
| 2137 | Ga0070673_100764058 | |||
| 2138 | Ga0070673_100878766 | |||
| 2139 | Ga0070673_101034230 | |||
| 2140 | Ga0070688_100254873 | |||
| 2141 | Ga0070659_100057420 | |||
| 2142 | Ga0070667_100001546 | |||
| 2143 | Ga0070667_100028082 | |||
| 2144 | Ga0070667_100061737 | |||
| 2145 | Ga0070667_100083378 | |||
| 2146 | Ga0070667_100204785 | |||
| 2147 | Ga0070667_100302097 | |||
| 2148 | Ga0070667_100933135 | |||
| 2149 | Ga0070667_101303055 | |||
| 2150 | Ga0070701_10265092 | |||
| 2151 | Ga0070705_100486464 | |||
| 2152 | Ga0070663_100003492 | |||
| 2153 | Ga0070663_100175986 | |||
| 2154 | Ga0070663_100489511 | |||
| 2155 | Ga0070678_100037760 | |||
| 2156 | Ga0070678_100078511 | |||
| 2157 | Ga0070678_100104114 | |||
| 2158 | Ga0070678_100421211 | |||
| 2159 | Ga0070662_100274312 | |||
| 2160 | Ga0070662_100412128 | |||
| 2161 | Ga0070681_10088377 | |||
| 2162 | Ga0070681_10118464 | |||
| 2163 | Ga0068867_100000552 | |||
| 2164 | Ga0068867_100002598 | |||
| 2165 | Ga0068867_100011425 | |||
| 2166 | Ga0068867_100069225 | |||
| 2167 | Ga0068867_100235673 | |||
| 2168 | Ga0068867_100402632 | |||
| 2169 | Ga0068867_100692942 | |||
| 2170 | Ga0070706_100015900 | |||
| 2171 | Ga0070706_100465093 | |||
| 2172 | Ga0070698_100605474 | |||
| 2173 | Ga0070699_100054613 | |||
| 2174 | Ga0070679_100007565 | |||
| 2175 | Ga0070679_100375973 | |||
| 2176 | Ga0068853_100041378 | |||
| 2177 | Ga0068853_100345863 | |||
| 2178 | Ga0068853_100836205 | |||
| 2179 | Ga0070672_100065480 | |||
| 2180 | Ga0070672_100226500 | |||
| 2181 | Ga0070672_100334560 | |||
| 2182 | Ga0070672_100370305 | |||
| 2183 | Ga0070672_100623633 | |||
| 2184 | Ga0070686_100084049 | |||
| 2185 | Ga0070686_100969821 | |||
| 2186 | Ga0070693_100023342 | |||
| 2187 | Ga0070693_100069686 | |||
| 2188 | Ga0070665_100113328 | |||
| 2189 | Ga0070665_100261841 | |||
| 2190 | Ga0070665_100982347 | |||
| 2191 | Ga0068855_100040434 | |||
| 2192 | Ga0070664_100040179 | |||
| 2193 | Ga0070664_100452105 | |||
| 2194 | Ga0070664_101023760 | |||
| 2195 | Ga0068857_100040688 | |||
| 2196 | Ga0068857_100822281 | |||
| 2197 | Ga0068857_100948381 | |||
| 2198 | Ga0068857_100998787 | |||
| 2199 | Ga0068854_100273417 | |||
| 2200 | Ga0068854_100505329 | |||
| 2201 | Ga0068854_101094394 | |||
| 2202 | Ga0068854_101163714 | |||
| 2203 | Ga0068856_100033721 | |||
| 2204 | Ga0068856_100137146 | |||
| 2205 | Ga0068856_100231329 | |||
| 2206 | Ga0068856_100590718 | |||
| 2207 | Ga0068852_100157329 | |||
| 2208 | Ga0068852_100418900 | |||
| 2209 | Ga0068852_100605267 | |||
| 2210 | Ga0068852_101321877 | |||
| 2211 | Ga0068859_100421208 | |||
| 2212 | Ga0068859_100595833 | |||
| 2213 | Ga0068859_100722826 | |||
| 2214 | Ga0068859_100743845 | |||
| 2215 | Ga0068859_101096554 | |||
| 2216 | Ga0068859_101245369 | |||
| 2217 | Ga0068864_100018772 | |||
| 2218 | Ga0068864_100060451 | |||
| 2219 | Ga0068864_100103544 | |||
| 2220 | Ga0068864_100596528 | |||
| 2221 | Ga0068866_10033530 | |||
| 2222 | Ga0068866_10225265 | |||
| 2223 | Ga0068866_10411744 | |||
| 2224 | Ga0068866_10650977 | |||
| 2225 | Ga0068861_100004770 | |||
| 2226 | Ga0068861_100016735 | |||
| 2227 | Ga0068861_100067654 | |||
| 2228 | Ga0068861_100250877 | |||
| 2229 | Ga0068851_10097792 | |||
| 2230 | Ga0068870_10096198 | |||
| 2231 | Ga0068863_100104362 | |||
| 2232 | Ga0068863_100177752 | |||
| 2233 | Ga0068858_100008125 | |||
| 2234 | Ga0068858_100030753 | |||
| 2235 | Ga0068858_100087941 | |||
| 2236 | Ga0068860_100008442 | |||
| 2237 | Ga0068860_100089575 | |||
| 2238 | Ga0068860_100214297 | |||
| 2239 | Ga0068860_100234051 | |||
| 2240 | Ga0068860_100347699 | |||
| 2241 | Ga0068860_100416200 | |||
| 2242 | Ga0068860_100426403 | |||
| 2243 | Ga0068860_100571783 | |||
| 2244 | Ga0068862_100009442 | |||
| 2245 | Ga0068862_100090240 | |||
| 2246 | Ga0068862_100103723 | |||
| 2247 | Ga0068862_100847673 | |||
| 2248 | Ga0068862_101061660 | |||
| 2249 | Ga0081455_10214690 | |||
| 2250 | Ga0081538_10007049 | |||
| 2251 | Ga0081539_10024183 | |||
| 2252 | Ga0075365_10024190 | |||
| 2253 | Ga0075365_10088383 | |||
| 2254 | Ga0075365_10100810 | |||
| 2255 | Ga0075365_10360621 | |||
| 2256 | Ga0075368_10003054 | |||
| 2257 | Ga0075368_10027934 | |||
| 2258 | Ga0075368_10066804 | |||
| 2259 | Ga0075368_10073997 | |||
| 2260 | Ga0075363_100000856 | |||
| 2261 | Ga0075363_100005889 | |||
| 2262 | Ga0075363_100035006 | |||
| 2263 | Ga0075363_100093099 | |||
| 2264 | Ga0075363_100207224 | |||
| 2265 | Ga0075363_100385680 | |||
| 2266 | Ga0075364_10000860 | |||
| 2267 | Ga0075364_10008140 | |||
| 2268 | Ga0075364_10015296 | |||
| 2269 | Ga0075364_10032491 | |||
| 2270 | Ga0075364_10059924 | |||
| 2271 | Ga0075364_10109005 | |||
| 2272 | Ga0075364_10134805 | |||
| 2273 | Ga0075364_10150994 | |||
| 2274 | Ga0075432_10012424 | |||
| 2275 | Ga0075362_10000222 | |||
| 2276 | Ga0075362_10000565 | |||
| 2277 | Ga0075362_10010792 | |||
| 2278 | Ga0075362_10029405 | |||
| 2279 | Ga0075362_10042495 | |||
| 2280 | Ga0075362_10118078 | |||
| 2281 | Ga0075362_10255536 | |||
| 2282 | Ga0075367_10000855 | |||
| 2283 | Ga0075367_10001881 | |||
| 2284 | Ga0075367_10072677 | |||
| 2285 | Ga0075367_10092765 | |||
| 2286 | Ga0075367_10129646 | |||
| 2287 | Ga0075367_10582923 | |||
| 2288 | Ga0075367_10625480 | |||
| 2289 | Ga0075369_10003827 | |||
| 2290 | Ga0075369_10005325 | |||
| 2291 | Ga0075369_10031839 | |||
| 2292 | Ga0075369_10072235 | |||
| 2293 | Ga0075369_10076058 | |||
| 2294 | Ga0075366_10000795 | |||
| 2295 | Ga0075366_10016473 | |||
| 2296 | Ga0075366_10018148 | |||
| 2297 | Ga0075366_10029562 | |||
| 2298 | Ga0075366_10032832 | |||
| 2299 | Ga0075366_10045046 | |||
| 2300 | Ga0075366_10058278 | |||
| 2301 | Ga0075366_10072831 | |||
| 2302 | Ga0075366_10077134 | |||
| 2303 | Ga0075366_10102009 | |||
| 2304 | Ga0075366_10111379 | |||
| 2305 | Ga0075366_10151709 | |||
| 2306 | Ga0075366_10173544 | |||
| 2307 | Ga0075366_10183717 | |||
| 2308 | Ga0075366_10184543 | |||
| 2309 | Ga0075366_10215426 | |||
| 2310 | Ga0075366_10225965 | |||
| 2311 | Ga0075366_10255795 | |||
| 2312 | Ga0075366_10264844 | |||
| 2313 | Ga0075366_10267288 | |||
| 2314 | Ga0075366_10287953 | |||
| 2315 | Ga0075366_10333201 | |||
| 2316 | Ga0097621_100047739 | |||
| 2317 | Ga0097621_100053861 | |||
| 2318 | Ga0097621_100661150 | |||
| 2319 | Ga0097621_100957200 | |||
| 2320 | Ga0075370_10000073 | |||
| 2321 | Ga0075370_10000701 | |||
| 2322 | Ga0075370_10001150 | |||
| 2323 | Ga0075370_10002824 | |||
| 2324 | Ga0075370_10017546 | |||
| 2325 | Ga0075370_10064344 | |||
| 2326 | Ga0075370_10096809 | |||
| 2327 | Ga0075370_10130823 | |||
| 2328 | Ga0075370_10135320 | |||
| 2329 | Ga0075370_10224585 | |||
| 2330 | Ga0075370_10433321 | |||
| 2331 | Ga0068871_100038460 | |||
| 2332 | Ga0068871_100336354 | |||
| 2333 | Ga0068871_100519577 | |||
| 2334 | Ga0075430_100097480 | |||
| 2335 | Ga0075430_100148171 | |||
| 2336 | Ga0075434_100344295 | |||
| 2337 | Ga0075429_100034628 | |||
| 2338 | Ga0075429_100217261 | |||
| 2339 | Ga0068865_100004060 | |||
| 2340 | Ga0068865_100504266 | |||
| 2341 | Ga0068865_100547271 | |||
| 2342 | Ga0097620_100421176 | |||
| 2343 | Ga0097620_100595835 | |||
| 2344 | Ga0097620_100722741 | |||
| 2345 | Ga0097620_100743907 | |||
| 2346 | Ga0097620_101096527 | |||
| 2347 | Ga0097620_101245345 | |||
| 2348 | Ga0099824_1036695 | |||
| 2349 | Ga0099824_1042081 | |||
| 2350 | Ga0099823_1000064 | |||
| 2351 | Ga0079104_1000027 | |||
| 2352 | Ga0079104_1000053 | |||
| 2353 | Ga0079104_1004078 | |||
| 2354 | Ga0099826_10000010 | |||
| 2355 | Ga0105244_10045359 | |||
| 2356 | Ga0105244_10326682 | |||
| 2357 | Ga0105250_10000154 | |||
| 2358 | Ga0105240_10608637 | |||
| 2359 | Ga0105240_10612533 | |||
| 2360 | Ga0111539_10313271 | |||
| 2361 | Ga0105245_10048884 | |||
| 2362 | Ga0105245_10060455 | |||
| 2363 | Ga0105245_10720516 | |||
| 2364 | Ga0105247_10117961 | |||
| 2365 | Ga0105243_10001789 | |||
| 2366 | Ga0105243_10002265 | |||
| 2367 | Ga0105243_10030050 | |||
| 2368 | Ga0105243_10252607 | |||
| 2369 | Ga0105243_10303347 | |||
| 2370 | Ga0105243_10310359 | |||
| 2371 | Ga0105243_10701988 | |||
| 2372 | Ga0105243_10845019 | |||
| 2373 | Ga0105241_10030533 | |||
| 2374 | Ga0105241_10082907 | |||
| 2375 | Ga0105242_10003381 | |||
| 2376 | Ga0105242_10059064 | |||
| 2377 | Ga0105242_10297878 | |||
| 2378 | Ga0105242_11086421 | |||
| 2379 | Ga0105248_10006768 | |||
| 2380 | Ga0105248_10028458 | |||
| 2381 | Ga0105248_10831802 | |||
| 2382 | Ga0105248_10962973 | |||
| 2383 | Ga0105237_10147254 | |||
| 2384 | Ga0105237_10169697 | |||
| 2385 | Ga0105237_10258441 | |||
| 2386 | Ga0105237_11669011 | |||
| 2387 | Ga0105238_10088675 | |||
| 2388 | Ga0105238_10159156 | |||
| 2389 | Ga0105238_10407957 | |||
| 2390 | Ga0105238_10467421 | |||
| 2391 | Ga0105238_10905629 | |||
| 2392 | Ga0105249_10068515 | |||
| 2393 | Ga0105249_10081210 | |||
| 2394 | Ga0105249_10311041 | |||
| 2395 | Ga0105249_10528771 | |||
| 2396 | Ga0105239_10036283 | |||
| 2397 | Ga0105239_10390181 | |||
| 2398 | Ga0105246_10060033 | |||
| 2399 | Ga0105246_11155930 | |||
| 2400 | Ga0157317_1002112 | |||
| 2401 | Ga0157325_1000370 | |||
| 2402 | Ga0157319_1000005 | |||
| 2403 | Ga0157315_1004462 | |||
| 2404 | Ga0157327_1004812 | |||
| 2405 | Ga0157326_1000710 | |||
| 2406 | Ga0157326_1007484 | |||
| 2407 | Ga0157373_10040286 | |||
| 2408 | Ga0157373_10154902 | |||
| 2409 | Ga0157373_10361352 | |||
| 2410 | Ga0157373_10421549 | |||
| 2411 | Ga0157371_10065519 | |||
| 2412 | Ga0157371_10130902 | |||
| 2413 | Ga0157371_10172453 | |||
| 2414 | Ga0157370_11075345 | |||
| 2415 | Ga0157370_11293870 | |||
| 2416 | Ga0157369_10115967 | |||
| 2417 | Ga0157369_10723287 | |||
| 2418 | Ga0157374_10009298 | |||
| 2419 | Ga0157374_10293000 | |||
| 2420 | Ga0157374_10440133 | |||
| 2421 | Ga0157374_10728124 | |||
| 2422 | Ga0157378_10008661 | |||
| 2423 | Ga0157378_10029129 | |||
| 2424 | Ga0157378_10058938 | |||
| 2425 | Ga0157378_10248653 | |||
| 2426 | Ga0157378_10435035 | |||
| 2427 | Ga0157378_10654939 | |||
| 2428 | Ga0163162_10004148 | |||
| 2429 | Ga0163162_10211873 | |||
| 2430 | Ga0163162_10454521 | |||
| 2431 | Ga0163162_10498220 | |||
| 2432 | Ga0163162_10505539 | |||
| 2433 | Ga0163162_11270210 | |||
| 2434 | Ga0163162_12327397 | |||
| 2435 | Ga0157372_11082189 | |||
| 2436 | Ga0157375_10041626 | |||
| 2437 | Ga0157375_10137647 | |||
| 2438 | Ga0157375_10151438 | |||
| 2439 | Ga0157375_10240286 | |||
| 2440 | Ga0157375_10408421 | |||
| 2441 | Ga0157375_10710210 | |||
| 2442 | Ga0157375_10987686 | |||
| 2443 | Ga0157375_11860096 | |||
| 2444 | Ga0163163_10510669 | |||
| 2445 | Ga0163163_10710033 | |||
| 2446 | Ga0157380_10285675 | |||
| 2447 | Ga0157380_10297447 | |||
| 2448 | Ga0157380_10338992 | |||
| 2449 | Ga0157380_10349999 | |||
| 2450 | Ga0182008_10001808 | |||
| 2451 | Ga0157377_10000368 | |||
| 2452 | Ga0157377_10115937 | |||
| 2453 | Ga0157377_10152296 | |||
| 2454 | Ga0157377_10425169 | |||
| 2455 | Ga0157379_10040412 | |||
| 2456 | Ga0157379_10061342 | |||
| 2457 | Ga0157379_10090060 | |||
| 2458 | Ga0157379_10154533 | |||
| 2459 | Ga0157379_10356655 | |||
| 2460 | Ga0157379_10448165 | |||
| 2461 | Ga0157376_10090219 | |||
| 2462 | Ga0157376_10158282 | |||
| 2463 | Ga0157376_10666310 | |||
| 2464 | Ga0157376_10688965 | |||
| 2465 | Ga0182006_1000240 | |||
| 2466 | Ga0182006_1000274 | |||
| 2467 | Ga0182007_10000196 | |||
| 2468 | Ga0182007_10235263 | |||
| 2469 | Ga0182005_1000016 | |||
| 2470 | Ga0182005_1000163 | |||
| 2471 | Ga0182005_1178920 | |||
| 2472 | Ga0163161_10021239 | |||
| 2473 | Ga0163161_10057420 | |||
| 2474 | Ga0163161_10252609 | |||
| 2475 | Ga0163161_10562961 | |||
| 2476 | Ga0197907_10761668 | |||
| 2477 | Ga0206355_1548870 | |||
| 2478 | Ga0206352_11007505 | |||
| 2479 | Ga0206352_11093402 | |||
| 2480 | Ga0206352_11327706 | |||
| 2481 | Ga0206354_10722014 | |||
| 2482 | Ga0213872_10000091 | |||
| 2483 | Ga0213872_10002765 | |||
| 2484 | Ga0213872_10004732 | |||
| 2485 | Ga0213872_10030149 | |||
| 2486 | Ga0213872_10070274 | |||
| 2487 | Ga0213872_10070360 | |||
| 2488 | Ga0209435_100002 | |||
| 2489 | Ga0209674_100067 | |||
| 2490 | Ga0209672_107040 | |||
| 2491 | Ga0209672_115976 | |||
| 2492 | Ga0209563_100068 | |||
| 2493 | Ga0209563_100088 | |||
| 2494 | Ga0207427_100260 | |||
| 2495 | Ga0209437_103125 | |||
| 2496 | Ga0209258_102113 | |||
| 2497 | Ga0209258_105352 | |||
| 2498 | Ga0209258_112329 | |||
| 2499 | Ga0207425_1000680 | |||
| 2500 | Ga0207425_1010240 | |||
| 2501 | Ga0207425_1027536 | |||
| 2502 | Ga0209646_1000001 | |||
| 2503 | Ga0209646_1000068 | |||
| 2504 | Ga0209646_1000127 | |||
| 2505 | Ga0209026_1000004 | |||
| 2506 | Ga0209026_1000121 | |||
| 2507 | Ga0209026_1018764 | |||
| 2508 | Ga0209677_100201 | |||
| 2509 | Ga0209148_1002904 | |||
| 2510 | Ga0209759_1000001 | |||
| 2511 | Ga0209759_1000129 | |||
| 2512 | Ga0209129_1000158 | |||
| 2513 | Ga0209129_1012956 | |||
| 2514 | Ga0209565_1000026 | |||
| 2515 | Ga0207666_1009025 | |||
| 2516 | Ga0207666_1022254 | |||
| 2517 | Ga0209455_1000070 | |||
| 2518 | Ga0209455_1000083 | |||
| 2519 | Ga0209455_1001216 | |||
| 2520 | Ga0209673_1000009 | |||
| 2521 | Ga0209673_1004093 | |||
| 2522 | Ga0209673_1004985 | |||
| 2523 | Ga0209673_1021095 | |||
| 2524 | Ga0209673_1026632 | |||
| 2525 | Ga0209673_1044208 | |||
| 2526 | Ga0209130_1000109 | |||
| 2527 | Ga0209130_1002387 | |||
| 2528 | Ga0209130_1033062 | |||
| 2529 | Ga0207673_1009790 | |||
| 2530 | Ga0209675_1002624 | |||
| 2531 | Ga0209676_1000013 | |||
| 2532 | Ga0209676_1023059 | |||
| 2533 | Ga0209025_1000039 | |||
| 2534 | Ga0209025_1013316 | |||
| 2535 | Ga0209025_1034111 | |||
| 2536 | Ga0209564_1000008 | |||
| 2537 | Ga0209564_1000047 | |||
| 2538 | Ga0209564_1000243 | |||
| 2539 | Ga0209564_1000282 | |||
| 2540 | Ga0209758_1000910 | |||
| 2541 | Ga0209758_1011080 | |||
| 2542 | Ga0209758_1032506 | |||
| 2543 | Ga0209050_1000008 | |||
| 2544 | Ga0209050_1000223 | |||
| 2545 | Ga0209050_1001097 | |||
| 2546 | Ga0209050_1004273 | |||
| 2547 | Ga0209050_1005688 | |||
| 2548 | Ga0209050_1008272 | |||
| 2549 | Ga0209256_1000003 | |||
| 2550 | Ga0209256_1000045 | |||
| 2551 | Ga0209256_1008928 | |||
| 2552 | Ga0209256_1009680 | |||
| 2553 | Ga0209256_1028202 | |||
| 2554 | Ga0207426_1000062 | |||
| 2555 | Ga0209051_1000004 | |||
| 2556 | Ga0209051_1000005 | |||
| 2557 | Ga0209051_1000172 | |||
| 2558 | Ga0209051_1000938 | |||
| 2559 | Ga0209051_1005321 | |||
| 2560 | Ga0209051_1016791 | |||
| 2561 | Ga0209051_1018074 | |||
| 2562 | Ga0209051_1047179 | |||
| 2563 | Ga0209257_1000015 | |||
| 2564 | Ga0209257_1000047 | |||
| 2565 | Ga0209257_1000048 | |||
| 2566 | Ga0209257_1000108 | |||
| 2567 | Ga0209257_1000315 | |||
| 2568 | Ga0209257_1019529 | |||
| 2569 | Ga0209257_1032769 | |||
| 2570 | Ga0209257_1043589 | |||
| 2571 | Ga0209257_1057461 | |||
| 2572 | Ga0207697_10084989 | |||
| 2573 | Ga0207656_10271043 | |||
| 2574 | Ga0207696_1000388 | |||
| 2575 | Ga0207655_1000499 | |||
| 2576 | Ga0207655_1024949 | |||
| 2577 | Ga0207682_10017992 | |||
| 2578 | Ga0207682_10021887 | |||
| 2579 | Ga0207682_10186025 | |||
| 2580 | Ga0207642_10017753 | |||
| 2581 | Ga0207642_10451467 | |||
| 2582 | Ga0207688_10149417 | |||
| 2583 | Ga0207680_10014229 | |||
| 2584 | Ga0207680_10857104 | |||
| 2585 | Ga0207647_10074272 | |||
| 2586 | Ga0207647_10277845 | |||
| 2587 | Ga0207685_10051930 | |||
| 2588 | Ga0207645_10009972 | |||
| 2589 | Ga0207645_10048474 | |||
| 2590 | Ga0207645_10160739 | |||
| 2591 | Ga0207645_10210920 | |||
| 2592 | Ga0207645_10495610 | |||
| 2593 | Ga0207643_10073671 | |||
| 2594 | Ga0207643_10263156 | |||
| 2595 | Ga0207643_10398381 | |||
| 2596 | Ga0207705_10254337 | |||
| 2597 | Ga0207705_10558293 | |||
| 2598 | Ga0207684_10009766 | |||
| 2599 | Ga0207684_10370574 | |||
| 2600 | Ga0207654_10006606 | |||
| 2601 | Ga0207654_10127876 | |||
| 2602 | Ga0207707_10164577 | |||
| 2603 | Ga0207707_10711238 | |||
| 2604 | Ga0207695_10103337 | |||
| 2605 | Ga0207695_10203110 | |||
| 2606 | Ga0207695_10501768 | |||
| 2607 | Ga0207671_10047329 | |||
| 2608 | Ga0207671_10269801 | |||
| 2609 | Ga0207660_10046145 | |||
| 2610 | Ga0207662_10013351 | |||
| 2611 | Ga0207662_10034330 | |||
| 2612 | Ga0207657_10092024 | |||
| 2613 | Ga0207657_10309906 | |||
| 2614 | Ga0207657_10364651 | |||
| 2615 | Ga0207649_10001794 | |||
| 2616 | Ga0207652_10002940 | |||
| 2617 | Ga0207652_10202638 | |||
| 2618 | Ga0207652_10449822 | |||
| 2619 | Ga0207646_10141845 | |||
| 2620 | Ga0207681_10005925 | |||
| 2621 | Ga0207681_10021332 | |||
| 2622 | Ga0207681_10083993 | |||
| 2623 | Ga0207681_10193959 | |||
| 2624 | Ga0207694_10026084 | |||
| 2625 | Ga0207694_10034844 | |||
| 2626 | Ga0207694_10352632 | |||
| 2627 | Ga0207694_10596481 | |||
| 2628 | Ga0207650_10043623 | |||
| 2629 | Ga0207650_10286339 | |||
| 2630 | Ga0207650_10407122 | |||
| 2631 | Ga0207650_10635503 | |||
| 2632 | Ga0207650_11037503 | |||
| 2633 | Ga0207659_10013941 | |||
| 2634 | Ga0207659_10056531 | |||
| 2635 | Ga0207659_10205388 | |||
| 2636 | Ga0207659_10479150 | |||
| 2637 | Ga0207687_10024918 | |||
| 2638 | Ga0207687_10042371 | |||
| 2639 | Ga0207687_10385611 | |||
| 2640 | Ga0207644_10015416 | |||
| 2641 | Ga0207644_10023313 | |||
| 2642 | Ga0207644_10024978 | |||
| 2643 | Ga0207644_10114633 | |||
| 2644 | Ga0207644_10151897 | |||
| 2645 | Ga0207644_10191672 | |||
| 2646 | Ga0207644_10318792 | |||
| 2647 | Ga0207644_10425539 | |||
| 2648 | Ga0207690_10001731 | |||
| 2649 | Ga0207690_10314401 | |||
| 2650 | Ga0207690_10492603 | |||
| 2651 | Ga0207706_10044395 | |||
| 2652 | Ga0207706_10079225 | |||
| 2653 | Ga0207706_10300451 | |||
| 2654 | Ga0207686_10000781 | |||
| 2655 | Ga0207686_10048318 | |||
| 2656 | Ga0207709_10000514 | |||
| 2657 | Ga0207709_10001005 | |||
| 2658 | Ga0207709_10020689 | |||
| 2659 | Ga0207709_10092231 | |||
| 2660 | Ga0207709_10207965 | |||
| 2661 | Ga0207709_10215526 | |||
| 2662 | Ga0207709_10226741 | |||
| 2663 | Ga0207670_10104228 | |||
| 2664 | Ga0207670_10138753 | |||
| 2665 | Ga0207669_10089646 | |||
| 2666 | Ga0207704_10257180 | |||
| 2667 | Ga0207704_10311850 | |||
| 2668 | Ga0207704_10411353 | |||
| 2669 | Ga0207665_10121196 | |||
| 2670 | Ga0207691_10028785 | |||
| 2671 | Ga0207691_10102749 | |||
| 2672 | Ga0207691_10115353 | |||
| 2673 | Ga0207691_10230836 | |||
| 2674 | Ga0207691_10464722 | |||
| 2675 | Ga0207711_10009541 | |||
| 2676 | Ga0207711_10023140 | |||
| 2677 | Ga0207711_10072285 | |||
| 2678 | Ga0207711_10162953 | |||
| 2679 | Ga0207689_10002431 | |||
| 2680 | Ga0207689_10028262 | |||
| 2681 | Ga0207689_10033146 | |||
| 2682 | Ga0207689_10038004 | |||
| 2683 | Ga0207689_10642080 | |||
| 2684 | Ga0207689_10884337 | |||
| 2685 | Ga0207679_10001498 | |||
| 2686 | Ga0207679_10016048 | |||
| 2687 | Ga0207679_10497711 | |||
| 2688 | Ga0207667_10188077 | |||
| 2689 | Ga0207667_10505018 | |||
| 2690 | Ga0207651_10003333 | |||
| 2691 | Ga0207651_10063480 | |||
| 2692 | Ga0207651_10413705 | |||
| 2693 | Ga0207651_10511735 | |||
| 2694 | Ga0207651_10578379 | |||
| 2695 | Ga0207712_10040645 | |||
| 2696 | Ga0207712_10059578 | |||
| 2697 | Ga0207712_10063392 | |||
| 2698 | Ga0207712_10074729 | |||
| 2699 | Ga0207712_10406765 | |||
| 2700 | Ga0207668_10008000 | |||
| 2701 | Ga0207668_10086989 | |||
| 2702 | Ga0207668_10732749 | |||
| 2703 | Ga0207640_10018588 | |||
| 2704 | Ga0207640_10312781 | |||
| 2705 | Ga0207658_10002481 | |||
| 2706 | Ga0207658_10005603 | |||
| 2707 | Ga0207658_10054939 | |||
| 2708 | Ga0207658_10140348 | |||
| 2709 | Ga0207658_10174279 | |||
| 2710 | Ga0207658_10212718 | |||
| 2711 | Ga0207677_10007737 | |||
| 2712 | Ga0207677_10074516 | |||
| 2713 | Ga0207703_10008732 | |||
| 2714 | Ga0207703_10030166 | |||
| 2715 | Ga0207703_10194715 | |||
| 2716 | Ga0207639_10039254 | |||
| 2717 | Ga0207639_10048176 | |||
| 2718 | Ga0207639_10261978 | |||
| 2719 | Ga0207639_10359680 | |||
| 2720 | Ga0207639_10493367 | |||
| 2721 | Ga0207639_10653059 | |||
| 2722 | Ga0207678_10008286 | |||
| 2723 | Ga0207678_10039587 | |||
| 2724 | Ga0207678_10090610 | |||
| 2725 | Ga0207678_10387740 | |||
| 2726 | Ga0207678_10485421 | |||
| 2727 | Ga0207678_10812950 | |||
| 2728 | Ga0207702_10001875 | |||
| 2729 | Ga0207702_10004993 | |||
| 2730 | Ga0207702_10098322 | |||
| 2731 | Ga0207702_10215884 | |||
| 2732 | Ga0207702_10431718 | |||
| 2733 | Ga0207641_10093862 | |||
| 2734 | Ga0207641_10093939 | |||
| 2735 | Ga0207641_10118498 | |||
| 2736 | Ga0207641_11672107 | |||
| 2737 | Ga0207648_10002176 | |||
| 2738 | Ga0207648_10005939 | |||
| 2739 | Ga0207648_10015751 | |||
| 2740 | Ga0207648_10053064 | |||
| 2741 | Ga0207648_10111939 | |||
| 2742 | Ga0207648_10300208 | |||
| 2743 | Ga0207648_11096272 | |||
| 2744 | Ga0207676_10010346 | |||
| 2745 | Ga0207676_10011142 | |||
| 2746 | Ga0207676_10154150 | |||
| 2747 | Ga0207676_10393965 | |||
| 2748 | Ga0207676_10583823 | |||
| 2749 | Ga0207674_10004293 | |||
| 2750 | Ga0207674_10158756 | |||
| 2751 | Ga0207674_10952762 | |||
| 2752 | Ga0207675_100006663 | |||
| 2753 | Ga0207683_10172753 | |||
| 2754 | Ga0207683_10282833 | |||
| 2755 | Ga0207683_10350849 | |||
| 2756 | Ga0207683_10430813 | |||
| 2757 | Ga0207683_10970415 | |||
| 2758 | Ga0207698_10091721 | |||
| 2759 | Ga0207698_10180633 | |||
| 2760 | Ga0207698_10383442 | |||
| 2761 | Ga0207698_11249074 | |||
| 2762 | Ga0209281_1000002 | |||
| 2763 | Ga0209281_1000147 | |||
| 2764 | Ga0209281_1002282 | |||
| 2765 | Ga0209389_1000305 | |||
| 2766 | Ga0209371_1008392 | |||
| 2767 | Ga0209371_1037824 | |||
| 2768 | Ga0209969_1000889 | |||
| 2769 | Ga0209981_1007951 | |||
| 2770 | Ga0209996_1000729 | |||
| 2771 | Ga0209984_1037522 | |||
| 2772 | Ga0209995_1000242 | |||
| 2773 | Ga0209968_1000130 | |||
| 2774 | Ga0209968_1049434 | |||
| 2775 | Ga0209999_1001613 | |||
| 2776 | Ga0209970_1001181 | |||
| 2777 | Ga0210002_1010088 | |||
| 2778 | Ga0209983_1011423 | |||
| 2779 | Ga0209282_1000072 | |||
| 2780 | Ga0209966_1000117 | |||
| 2781 | Ga0209998_10002530 | |||
| 2782 | Ga0209813_10001024 | |||
| 2783 | Ga0209813_10024775 | |||
| 2784 | Ga0209974_10000149 | |||
| 2785 | Ga0209974_10004577 | |||
| 2786 | Ga0209974_10055283 | |||
| 2787 | Ga0207428_10148534 | |||
| 2788 | Ga0268266_10047854 | |||
| 2789 | Ga0268266_10532322 | |||
| 2790 | Ga0268265_10047973 | |||
| 2791 | Ga0268265_10058401 | |||
| 2792 | Ga0268265_10173673 | |||
| 2793 | Ga0268264_10002070 | |||
| 2794 | Ga0268264_10002318 | |||
| 2795 | Ga0268264_10052271 | |||
| 2796 | Ga0268264_10057251 | |||
| 2797 | Ga0268264_10235007 | |||
| 2798 | Ga0268264_10248432 | |||
| 2799 | Ga0268264_10470367 | |||
| 2800 | Ga0307517_10014561 | |||
| 2801 | Ga0307517_10103679 | |||
| 2802 | Ga0307517_10178695 | |||
| 2803 | Ga0307517_10245629 | |||
| 2804 | Ga0307517_10279864 | |||
| 2805 | Ga0307515_10000096 | |||
| 2806 | Ga0307515_10002443 | |||
| 2807 | Ga0307515_10006150 | |||
| 2808 | Ga0307515_10012540 | |||
| 2809 | Ga0307515_10021273 | |||
| 2810 | Ga0307515_10053115 | |||
| 2811 | Ga0307515_10089443 | |||
| 2812 | Ga0307515_10108460 | |||
| 2813 | Ga0307515_10115015 | |||
| 2814 | Ga0307515_10186828 | |||
| 2815 | Ga0307515_10203755 | |||
| 2816 | Ga0265324_10143397 | |||
| 2817 | Ga0268256_1008739 | |||
| 2818 | Ga0268256_1043016 | |||
| 2819 | Ga0307511_10000653 | |||
| 2820 | Ga0307511_10070244 | |||
| 2821 | Ga0307512_10060099 | |||
| 2822 | Ga0307512_10098413 | |||
| 2823 | Ga0316181_1065259 | |||
| 2824 | Ga0265332_10000006 | |||
| 2825 | Ga0265332_10001586 | |||
| 2826 | Ga0265329_10007973 | |||
| 2827 | Ga0265331_10037135 | |||
| 2828 | Ga0265327_10000178 | |||
| 2829 | Ga0265327_10060743 | |||
| 2830 | Ga0265327_10131623 | |||
| 2831 | Ga0265316_10000201 | |||
| 2832 | Ga0307513_10000028 | |||
| 2833 | Ga0307513_10005218 | |||
| 2834 | Ga0307513_10063852 | |||
| 2835 | Ga0307513_10076724 | |||
| 2836 | Ga0307513_10088393 | |||
| 2837 | Ga0307513_10184235 | |||
| 2838 | Ga0307513_10220352 | |||
| 2839 | Ga0307513_10393592 | |||
| 2840 | Ga0307509_10003616 | |||
| 2841 | Ga0307509_10111735 | |||
| 2842 | Ga0307509_10141229 | |||
| 2843 | Ga0307509_10282377 | |||
| 2844 | Ga0307509_10397800 | |||
| 2845 | Ga0307509_10426950 | |||
| 2846 | Ga0307408_100000089 | |||
| 2847 | Ga0307408_100026553 | |||
| 2848 | Ga0307408_100173708 | |||
| 2849 | Ga0307408_100223586 | |||
| 2850 | Ga0307408_100271807 | |||
| 2851 | Ga0307408_100436865 | |||
| 2852 | Ga0307408_100625521 | |||
| 2853 | Ga0307408_100675388 | |||
| 2854 | Ga0307408_101322723 | |||
| 2855 | Ga0307508_10000392 | |||
| 2856 | Ga0307508_10061685 | |||
| 2857 | Ga0307508_10484228 | |||
| 2858 | Ga0307514_10000339 | |||
| 2859 | Ga0307514_10000530 | |||
| 2860 | Ga0307514_10034392 | |||
| 2861 | Ga0265314_10002097 | |||
| 2862 | Ga0265314_10007665 | |||
| 2863 | Ga0265314_10245661 | |||
| 2864 | Ga0307516_10000048 | |||
| 2865 | Ga0307516_10011689 | |||
| 2866 | Ga0307516_10019197 | |||
| 2867 | Ga0307516_10026535 | |||
| 2868 | Ga0307516_10027941 | |||
| 2869 | Ga0307516_10222839 | |||
| 2870 | Ga0307516_10330542 | |||
| 2871 | Ga0307516_10538908 | |||
| 2872 | Ga0307405_10012091 | |||
| 2873 | Ga0307405_10046436 | |||
| 2874 | Ga0307405_10108416 | |||
| 2875 | Ga0307405_10137806 | |||
| 2876 | Ga0307405_10170412 | |||
| 2877 | Ga0307405_10732057 | |||
| 2878 | Ga0307405_11196347 | |||
| 2879 | Ga0307413_10032313 | |||
| 2880 | Ga0307413_10042827 | |||
| 2881 | Ga0307413_10124756 | |||
| 2882 | Ga0307413_10544387 | |||
| 2883 | Ga0307413_10979169 | |||
| 2884 | Ga0307518_10004256 | |||
| 2885 | Ga0307410_10105185 | |||
| 2886 | Ga0307410_10220441 | |||
| 2887 | Ga0307410_10232300 | |||
| 2888 | Ga0307410_10392259 | |||
| 2889 | Ga0307410_10490733 | |||
| 2890 | Ga0307406_10004866 | |||
| 2891 | Ga0307406_10063514 | |||
| 2892 | Ga0307406_10116737 | |||
| 2893 | Ga0307406_10166340 | |||
| 2894 | Ga0307406_10239255 | |||
| 2895 | Ga0307407_10135590 | |||
| 2896 | Ga0307412_10000707 | |||
| 2897 | Ga0307412_10074922 | |||
| 2898 | Ga0307412_10094847 | |||
| 2899 | Ga0307412_10160061 | |||
| 2900 | Ga0307412_10190684 | |||
| 2901 | Ga0307412_10304530 | |||
| 2902 | Ga0307412_10636065 | |||
| 2903 | Ga0307409_100000577 | |||
| 2904 | Ga0307409_100306813 | |||
| 2905 | Ga0307409_100625855 | |||
| 2906 | Ga0307409_101358411 | |||
| 2907 | Ga0307416_100025728 | |||
| 2908 | Ga0307416_100043561 | |||
| 2909 | Ga0307416_100260422 | |||
| 2910 | Ga0307416_100879372 | |||
| 2911 | Ga0307416_102506524 | |||
| 2912 | Ga0307414_10047643 | |||
| 2913 | Ga0307414_10057302 | |||
| 2914 | Ga0307414_10075764 | |||
| 2915 | Ga0307414_10121151 | |||
| 2916 | Ga0307414_10129728 | |||
| 2917 | Ga0307414_10296273 | |||
| 2918 | Ga0307414_10306607 | |||
| 2919 | Ga0307414_10858745 | |||
| 2920 | Ga0307411_10000085 | |||
| 2921 | Ga0307411_10069652 | |||
| 2922 | Ga0307411_10197371 | |||
| 2923 | Ga0307411_10276119 | |||
| 2924 | Ga0307411_10355962 | |||
| 2925 | Ga0307411_10480233 | |||
| 2926 | Ga0307411_10549901 | |||
| 2927 | Ga0307415_100034663 | |||
| 2928 | Ga0307415_100039097 | |||
| 2929 | Ga0307415_101025991 | |||
| 2930 | Ga0307415_101751537 | |||
| 2931 | Ga0316593_10001300 | |||
| 2932 | Ga0316593_10002414 | |||
| 2933 | Ga0316593_10120311 | |||
| 2934 | Ga0307507_10032678 | |||
| 2935 | Ga0307507_10087876 | |||
| 2936 | Ga0307510_10160136 | |||
| 2937 | Ga0307510_10170741 | |||
| 2938 | Ga0307510_10256916 | |||
| 2939 | Ga0316596_1000012 | |||
| 2940 | Ga0316596_1007848 | |||
| 2941 | Ga0373958_0010068 | |||
| 2942 | Ga0373959_0086787 | |||
| 2943 | Ga0373928_0094074 | |||
| 2944 | Ga0373940_0013733 | |||
| 2945 | Ga0373949_0033918 | |||
| 2946 | Ga0373951_0111160 | |||
| 2947 | Ga0373952_0130008 | |||
| 2948 | Ga0373923_0057896 | |||
| 2949 | Ga0373939_0000348 | |||
| 2950 | Ga0373939_0028000 | |||
| 2951 | Ga0373954_0456353 | |||
| 2952 | Ga0373961_0015414 | |||
| 2953 | Ga0373962_0009014 | |||
| 2954 | Ga0316574_0000624 | |||
| 2955 | Ga0373924_0141394 | |||
| 2956 | Ga0373931_0000535 | |||
| 2957 | Ga0373931_0001474 | |||
| 2958 | Ga0373931_0002669 | |||
| 2959 | Ga0373931_0008660 | |||
| 2960 | Ga0373931_0022499 | |||
| 2961 | Ga0373927_0120122 | |||
| 2962 | Ga0373937_0025734 | |||
| 2963 | Ga0373937_0065847 | |||
| 2964 | Ga0373937_0816241 | |||
| 2965 | Ga0265778_002283 | |||
| 2966 | Ga0316584_0500335 | |||
| 2967 | Ga0373925_0269257 | |||
| 2968 | Ga0373925_0519418 | |||
| 2969 | Ga0395899_0326984 | |||
| 2970 | Ga0395900_0000542 | |||
| 2971 | Ga0395900_0006501 | |||
| 2972 | Ga0395900_0010907 | |||
| 2973 | Ga0395900_0023864 | |||
| 2974 | Ga0395898_0003063 | |||
| 2975 | Ga0395898_0012209 | |||
| 2976 | Ga0395898_0154016 | |||
| 2977 | Ga0395898_0182958 | |||
| 2978 | Ga0395898_0395446 | |||
| 2979 | Ga0395905_0002507 | |||
| 2980 | Ga0395905_0016438 | |||
| 2981 | Ga0395905_0023115 | |||
| 2982 | Ga0395905_0024045 | |||
| 2983 | Ga0395905_0038305 | |||
| 2984 | Ga0395905_0097413 | |||
| 2985 | Ga0395905_0237728 | |||
| 2986 | Ga0395905_0304457 | |||
| 2987 | Ga0395905_0437884 | |||
| 2988 | Ga0395905_0505320 | |||
| 2989 | Ga0436364_0356747 | |||
| 2990 | Ga0436364_1033661 | |||
| 2991 | Ga0395901_0001925 | |||
| 2992 | Ga0395901_0018653 | |||
| 2993 | Ga0395901_0036377 | |||
| 2994 | Ga0395901_0063028 | |||
| 2995 | Ga0395901_0087625 | |||
| 2996 | Ga0395901_1189425 | |||
| 2997 | Ga0436365_0023403 | |||
| 2998 | Ga0436365_1710980 | |||
| 2999 | Ga0436365_1889961 | |||
| 3000 | Ga0436360_0060872 | |||
| 3001 | Ga0436360_0587704 | |||
| 3002 | Ga0436361_0110739 | |||
| 3003 | Ga0436361_0114178 | |||
| 3004 | Ga0436361_0209532 | |||
| 3005 | Ga0436361_0405071 | |||
| 3006 | Ga0436361_0714431 | |||
| 3007 | Ga0436361_1155176 | |||
| 3008 | Ga0436361_1205299 | |||
| 3009 | Ga0436363_0827848 | |||
| 3010 | Ga0436363_0965849 | |||
| 3011 | Ga0439436_0017475 | |||
| 3012 | Ga0439453_0007909 | |||
| 3013 | Ga0439465_0005103 | |||
| 3014 | Ga0439465_0010171 | |||
| 3015 | Ga0451787_045197 | |||
| 3016 | Ga0451788_07135 | |||
| 3017 | Ga0451789_0166480 | |||
| 3018 | Ga0451789_0965253 | |||
| 3019 | Ga0451790_30858 | |||
| 3020 | Ga0451794_03533 | |||
| 3021 | Ga0451794_19904 | |||
| 3022 | Ga0451793_1396094 | |||
| 3023 | Ga0451793_1842659 | |||
| 3024 | Ga0451795_0013989 | |||
| 3025 | Ga0451795_1257071 | |||
| 3026 | Ga0451798_0237297 | |||
| 3027 | Ga0451798_0308085 | |||
| 3028 | Ga0451800_1546204 | |||
| 3029 | Ga0451802_0433132 | |||
| 3030 | Ga0451805_010980 | |||
| 3031 | Ga0451805_036774 | |||
| 3032 | Ga0451805_102604 | |||
| 3033 | Ga0451805_122025 | |||
| 3034 | Ga0451804_0350671 | |||
| 3035 | Ga0451804_0726774 | |||
| 3036 | Ga0451807_0056791 | |||
| 3037 | Ga0451807_1127722 | |||
| 3038 | Ga0451807_1506488 | |||
| 3039 | Ga0451833_0316321 | |||
| 3040 | Ga0451841_0726739 | |||
| 3041 | Ga0451846_24314 | |||
| 3042 | Ga0451850_23291 | |||
| 3043 | Ga0451851_0657432 | |||
| 3044 | Ga0451843_1094779 | |||
| 3045 | Ga0451843_1596578 | |||
| 3046 | Ga0451855_0043459 | |||
| 3047 | Ga0451855_2055353 | |||
| 3048 | Ga0451853_2297694 | |||
| 3049 | Ga0451853_4042749 | |||
| 3050 | Ga0452268_34845 | |||
| 3051 | Ga0439431_0002412 | |||
| 3052 | Ga0439443_004303 | |||
| 3053 | Ga0439449_0041597 | |||
| 3054 | Ga0439455_0002630 | |||
| 3055 | Ga0439455_0004568 | |||
| 3056 | Ga0439462_0001003 | |||
| 3057 | Ga0450911_007749 | |||
| 3058 | Ga0450913_000876 | |||
| 3059 | Ga0450914_020866 | |||
| 3060 | Ga0450917_000001 | |||
| 3061 | Ga0450919_000025 | |||
| 3062 | Ga0450920_004654 | |||
| 3063 | Ga0450888_000612 | |||
| 3064 | Ga0450890_000549 | |||
| 3065 | Ga0450890_002585 | |||
| 3066 | Ga0450891_000262 | |||
| 3067 | Ga0450894_023369 | |||
| 3068 | Ga0450896_008784 | |||
| 3069 | Ga0450898_006321 | |||
| 3070 | Ga0450903_014065 | |||
| 3071 | Ga0450889_000161 | |||
| 3072 | Ga0450907_006986 | |||
| 3073 | Ga0439446_0006408 | |||
| 3074 | Ga0439446_0031377 | |||
| 3075 | Ga0439446_0048248 | |||
| 3076 | Ga0439458_0046077 | |||
| 3077 | Ga0439434_0007708 | |||
| 3078 | Ga0439434_0022473 | |||
| 3079 | Ga0439434_0118186 | |||
| 3080 | Ga0439435_0186154 | |||
| 3081 | Ga0439459_0000309 | |||
| 3082 | Ga0439464_0010621 | |||
| 3083 | Ga0439460_0002749 | |||
| 3084 | Ga0439460_0046014 | |||
| 3085 | Ga0439460_0136302 | |||
| 3086 | Ga0450916_000427 | |||
| 3087 | Ga0450918_000123 | |||
| 3088 | Ga0450918_010906 | |||
| 3089 | Ga0450893_0002832 | |||
| 3090 | Ga0451577_0000191 | |||
| 3091 | Ga0451577_0004247 | |||
| 3092 | Ga0451577_0004524 | |||
| 3093 | Ga0451577_0049877 | |||
| 3094 | Ga0451577_0069675 | |||
| 3095 | Ga0451577_0091475 | |||
| 3096 | Ga0451577_0219037 | |||
| 3097 | Ga0451577_0287511 | |||
| 3098 | Ga0466969_0001561 | |||
| 3099 | Ga0466969_0002589 | |||
| 3100 | Ga0466969_0002653 | |||
| 3101 | Ga0466972_0004583 | |||
| 3102 | Ga0466972_0026175 | |||
| 3103 | Ga0466972_0028508 | |||
| 3104 | Ga0453683_0007121 | |||
| 3105 | Ga0453683_0012361 | |||
| 3106 | Ga0466965_0008031 | |||
| 3107 | Ga0466966_0010593 | |||
| 3108 | Ga0466966_0026863 | |||
| 3109 | Ga0466961_0004306 | |||
| 3110 | Ga0466961_0005561 | |||
| 3111 | Ga0466964_0000637 | |||
| 3112 | Ga0453684_0000590 | |||
| 3113 | Ga0453684_0003452 | |||
| 3114 | Ga0453684_0014647 | |||
| 3115 | Ga0453684_0040021 | |||
| 3116 | Ga0453684_0077473 | |||
| 3117 | Ga0453684_0218561 | |||
| 3118 | Ga0453684_0436833 | |||
| 3119 | Ga0453684_0780306 | |||
| 3120 | Ga0466971_0002400 | |||
| 3121 | Ga0466971_0003261 | |||
| 3122 | Ga0466968_0007045 | |||
| 3123 | Ga0466968_0012515 | |||
| 3124 | Ga0466968_0307809 | |||
| 3125 | Ga0466970_0030706 | |||
| 3126 | Ga0466970_0034790 | |||
| 3127 | Ga0466970_0249881 | |||
| 3128 | Ga0466957_0029622 | |||
| 3129 | Ga0466957_0062776 | |||
| 3130 | Ga0466957_0556127 | |||
| 3131 | Ga0466960_0006778 | |||
| 3132 | Ga0466960_0010573 | |||
| 3133 | Ga0466959_0003145 | |||
| 3134 | Ga0466959_0014533 | |||
| 3135 | Ga0466959_0051414 | |||
| 3136 | Ga0451576_0003595 | |||
| 3137 | Ga0451576_0003670 | |||
| 3138 | Ga0451576_0005877 | |||
| 3139 | Ga0451576_0044769 | |||
| 3140 | Ga0451576_0075129 | |||
| 3141 | Ga0451576_0106671 | |||
| 3142 | Ga0451576_0279243 | |||
| 3143 | Ga0466958_0002207 | |||
| 3144 | Ga0466967_0505904 | |||
| 3145 | Ga0466967_0589785 | |||
| 3146 | Ga0466967_0962570 | |||
| 3147 | Ga0466967_1106498 | |||
| 3148 | Ga0495617_000397 | |||
| 3149 | Ga0495617_007088 | |||
| 3150 | Ga0495617_031068 | |||
| 3151 | Ga0495627_000011 | |||
| 3152 | Ga0495592_0000203 | |||
| 3153 | Ga0495590_0000020 | |||
| 3154 | Ga0495590_0004188 | |||
| 3155 | Ga0495590_0011864 | |||
| 3156 | Ga0495591_085880 | |||
| 3157 | Ga0495629_0435221 | |||
| 3158 | Ga0495638_0000235 | |||
| 3159 | Ga0495638_0069996 | |||
| 3160 | Ga0495651_0348222 | |||
| 3161 | Ga0495653_0000067 | |||
| 3162 | Ga0495650_0001809 | |||
| 3163 | Ga0495650_0002469 | |||
| 3164 | Ga0495650_0007879 | |||
| 3165 | Ga0495650_0111485 | |||
| 3166 | Ga0495580_0634982 | |||
| 3167 | Ga0495582_0204500 | |||
| 3168 | Ga0495605_0001330 | |||
| 3169 | Ga0495605_0001735 | |||
| 3170 | Ga0495639_0194536 | |||
| 3171 | Ga0495664_0369975 | |||
| 3172 | Ga0495584_0023314 | |||
| 3173 | Ga0495585_0010449 | |||
| 3174 | Ga0495585_0015948 | |||
| 3175 | Ga0495594_0006316 | |||
| 3176 | Ga0495607_0000153 | |||
| 3177 | Ga0495607_0166449 | |||
| 3178 | Ga0495583_0000317 | |||
| 3179 | Ga0495583_0000510 | |||
| 3180 | Ga0495606_0003088 | |||
| 3181 | Ga0495606_0013080 | |||
| 3182 | Ga0495606_0035831 | |||
| 3183 | Ga0495606_0039991 | |||
| 3184 | Ga0495606_0055743 | |||
| 3185 | Ga0495606_0275841 | |||
| 3186 | Ga0495610_0000017 | |||
| 3187 | Ga0495610_0004520 | |||
| 3188 | Ga0495610_0007369 | |||
| 3189 | Ga0495610_0025318 | |||
| 3190 | Ga0495610_0048651 | |||
| 3191 | Ga0495616_0028095 | |||
| 3192 | Ga0495616_0040567 | |||
| 3193 | Ga0495628_0436888 | |||
| 3194 | Ga0495630_0113383 | |||
| 3195 | Ga0495631_0022122 | |||
| 3196 | Ga0495631_0113533 | |||
| 3197 | Ga0495632_0035459 | |||
| 3198 | Ga0495637_0002190 | |||
| 3199 | Ga0495643_0002891 | |||
| 3200 | Ga0495643_0129407 | |||
| 3201 | Ga0495644_0305745 | |||
| 3202 | Ga0495648_0003167 | |||
| 3203 | Ga0495648_0009195 | |||
| 3204 | Ga0495648_0118352 | |||
| 3205 | Ga0495648_0189097 | |||
| 3206 | Ga0495666_0107065 | |||
| 3207 | Ga0495642_0090449 | |||
| 3208 | Ga0495654_0001400 | |||
| 3209 | Ga0495654_0063474 | |||
| 3210 | Ga0495654_0073901 | |||
| 3211 | Ga0495654_0105944 | |||
| 3212 | Ga0495586_0061618 | |||
| 3213 | Ga0495586_0227722 | |||
| 3214 | Ga0495598_0031772 | |||
| 3215 | Ga0495609_0005522 | |||
| 3216 | Ga0495609_0021767 | |||
| 3217 | Ga0495609_0064148 | |||
| 3218 | Ga0495621_0004071 | |||
| 3219 | Ga0495621_0012556 | |||
| 3220 | Ga0495597_0059514 | |||
| 3221 | Ga0495597_0085111 | |||
| 3222 | Ga0495597_0124240 | |||
| 3223 | Ga0495645_0034282 | |||
| 3224 | Ga0495622_0002906 | |||
| 3225 | Ga0495622_0010858 | |||
| 3226 | Ga0495633_0010195 | |||
| 3227 | Ga0495633_0017696 | |||
| 3228 | Ga0495633_0072696 | |||
| 3229 | Ga0495633_0105604 | |||
| 3230 | Ga0495656_0107150 | |||
| 3231 | Ga0495668_0002640 | |||
| 3232 | Ga0495668_0005163 | |||
| 3233 | Ga0495668_0089410 | |||
| 3234 | Ga0495611_0020577 | |||
| 3235 | Ga0495625_0006868 | |||
| 3236 | Ga0495625_0039878 | |||
| 3237 | Ga0495625_0056429 | |||
| 3238 | Ga0495625_0090743 | |||
| 3239 | Ga0495625_0102636 | |||
| 3240 | Ga0495625_0327176 | |||
| 3241 | Ga0495659_0326785 | |||
| 3242 | Ga0495661_0022142 | |||
| 3243 | Ga0495661_0068457 | |||
| 3244 | Ga0495661_0191580 | |||
| 3245 | Ga0495657_0099043 | |||
| 3246 | Ga0495647_0056319 | |||
| 3247 | Ga0495658_0134744 | |||
| 3248 | Ga0495669_0106577 | |||
| 3249 | Ga0495670_0004991 | |||
| 3250 | Ga0495670_0015412 | |||
| 3251 | Ga0495670_0096793 | |||
| 3252 | Ga0495670_0439497 | |||
| 3253 | Ga0495671_0000037 | |||
| 3254 | Ga0495671_0085680 | |||
| 3255 | Ga0495671_0449985 | |||
| 3256 | Ga0495649_0000961 | |||
| 3257 | Ga0495649_0006057 | |||
| 3258 | Ga0495649_0066300 | |||
| 3259 | Ga0495600_0374684 | |||
| 3260 | Ga0495660_0007547 | |||
| 3261 | Ga0495660_0010186 | |||
| 3262 | Ga0495660_0034825 | |||
| 3263 | Ga0495660_0379705 | |||
| 3264 | Ga0495636_0150053 | |||
| 3265 | Ga0495672_0000013 | |||
| 3266 | Ga0495672_0000157 | |||
| 3267 | Ga0495672_0007686 | |||
| 3268 | Ga0495672_0082508 | |||
| 3269 | Ga0495676_0010234 | |||
| 3270 | Ga0495683_0003225 | |||
| 3271 | Ga0495683_0043280 | |||
| 3272 | Ga0495687_000216 | |||
| 3273 | Ga0495687_000342 | |||
| 3274 | Ga0495687_002921 | |||
| 3275 | Ga0495677_0016634 | |||
| 3276 | Ga0495679_006474 | |||
| 3277 | Ga0495673_0000248 | |||
| 3278 | Ga0495673_0010480 | |||
| 3279 | Ga0495681_0072599 | |||
| 3280 | Ga0495686_0004619 | |||
| 3281 | Ga0495686_0007683 | |||
| 3282 | Ga0495686_0039632 | |||
| 3283 | Ga0495686_0066900 | |||
| 3284 | Ga0495593_0038039 | |||
| 3285 | Ga0496101_0512353 | |||
| 3286 | Ga0496103_0014572 | |||
| 3287 | Ga0496104_0042754 | |||
| 3288 | Ga0496104_0104722 | |||
| 3289 | Ga0496104_0750240 | |||
| 3290 | Ga0496106_0173396 | |||
| 3291 | Ga0496107_0080005 | |||
| 3292 | Ga0496107_0247453 | |||
| 3293 | Ga0496108_0009350 | |||
| 3294 | Ga0496108_0089279 | |||
| 3295 | Ga0496108_0097580 | |||
| 3296 | Ga0496108_0132496 | |||
| 3297 | Ga0496108_0311812 | |||
| 3298 | Ga0496108_0843377 | |||
| 3299 | Ga0496109_0084426 | |||
| 3300 | Ga0496109_0188205 | |||
| 3301 | Ga0496109_0896304 | |||
| 3302 | Ga0496110_0139203 | |||
| 3303 | Ga0496111_0388603 | |||
| 3304 | Ga0496111_0416148 | |||
| 3305 | Ga0496112_0018422 | |||
| 3306 | Ga0496113_0089439 | |||
| 3307 | Ga0496113_0215057 | |||
| 3308 | Ga0496114_0010053 | |||
| 3309 | Ga0496114_0198844 | |||
| 3310 | Ga0496114_0360775 | |||
| 3311 | Ga0496115_0030230 | |||
| 3312 | Ga0496116_0078388 | |||
| 3313 | Ga0496116_0128468 | |||
| 3314 | Ga0496116_0381133 | |||
| 3315 | Ga0496117_0000005 | |||
| 3316 | Ga0496118_0000031 | |||
| 3317 | Ga0496118_0004271 | |||
| 3318 | Ga0496119_0006975 | |||
| 3319 | Ga0496120_0018751 | |||
| 3320 | Ga0496121_0002928 | |||
| 3321 | Ga0496121_0004491 | |||
| 3322 | Ga0496121_0042385 | |||
| 3323 | Ga0496121_0114637 | |||
| 3324 | Ga0496122_0002652 | |||
| 3325 | Ga0496122_0005873 | |||
| 3326 | Ga0496122_0265194 | |||
| 3327 | Ga0496123_0005104 | |||
| 3328 | Ga0496123_0007601 | |||
| 3329 | Ga0496124_0001830 | |||
| 3330 | Ga0496124_0009077 | |||
| 3331 | Ga0496124_0030272 | |||
| 3332 | Ga0496124_0035888 | |||
| 3333 | Ga0496124_0101682 | |||
| 3334 | Ga0496125_0001934 | |||
| 3335 | Ga0496125_0005905 | |||
| 3336 | Ga0496125_0013937 | |||
| 3337 | Ga0496125_0211435 | |||
| 3338 | Ga0496126_0004622 | |||
| 3339 | Ga0496126_0071539 | |||
| 3340 | Ga0496126_0233051 | |||
| 3341 | Ga0496126_0317516 | |||
| 3342 | Ga0501306_000061 | |||
| 3343 | Ga0501306_001000 | |||
| 3344 | Ga0501306_001799 | |||
| 3345 | Ga0501306_001910 | |||
| 3346 | Ga0501306_002632 | |||
| 3347 | Ga0501306_004240 | |||
| 3348 | Ga0501306_008288 | |||
| 3349 | Ga0501306_034588 | |||
| 3350 | Ga0501306_042519 | |||
| 3351 | Ga0501308_000177 | |||
| 3352 | Ga0501308_000386 | |||
| 3353 | Ga0501308_001895 | |||
| 3354 | Ga0501308_004299 | |||
| 3355 | Ga0501309_000014 | |||
| 3356 | Ga0501309_001211 | |||
| 3357 | Ga0501309_003438 | |||
| 3358 | Ga0501309_028777 | |||
| 3359 | Ga0501309_047471 | |||
| 3360 | Ga0501309_047529 | |||
| 3361 | Ga0501310_000059 | |||
| 3362 | Ga0501310_002023 | |||
| 3363 | Ga0501310_013605 | |||
| 3364 | Ga0501341_04124 | |||
| 3365 | Ga0501341_05144 | |||
| 3366 | Ga0501304_000014 | |||
| 3367 | Ga0501304_000986 | |||
| 3368 | Ga0501304_001736 | |||
| 3369 | Ga0501304_004313 | |||
| 3370 | Ga0501304_004882 | |||
| 3371 | Ga0501304_018089 | |||
| 3372 | Ga0501305_000004 | |||
| 3373 | Ga0501305_000819 | |||
| 3374 | Ga0501305_002660 | |||
| 3375 | Ga0501305_010383 | |||
| 3376 | Ga0501305_024612 | |||
| 3377 | Ga0501305_027038 | |||
| 3378 | Ga0501305_027533 | |||
| 3379 | Ga0501305_037021 | |||
| 3380 | Ga0501307_000029 | |||
| 3381 | Ga0501307_000963 | |||
| 3382 | Ga0501307_003905 | |||
| 3383 | Ga0501307_004808 | |||
| 3384 | Ga0501307_011993 | |||
| 3385 | Ga0501307_014709 | |||
| 3386 | Ga0495678_000010 | |||
| 3387 | Ga0495678_013870 | |||
| 3388 | Ga0495678_077039 | |||
| 3389 | Ga0495678_086954 | |||
| 3390 | Ga0495682_0109952 | |||
| 3391 | Ga0495682_0109955 | |||
| 3392 | Ga0501291_001472 | |||
| 3393 | Ga0501292_005043 | |||
| 3394 | Ga0501293_005123 | |||
| 3395 | Ga0501294_003852 | |||
| 3396 | Ga0501299_081861 | |||
| 3397 | Ga0501311_000038 | |||
| 3398 | Ga0501311_012577 | |||
| 3399 | Ga0501311_019819 | |||
| 3400 | Ga0501311_031803 | |||
| 3401 | Ga0501312_000016 | |||
| 3402 | Ga0501312_035753 | |||
| 3403 | Ga0501312_039438 | |||
| 3404 | Ga0501312_047855 | |||
| 3405 | Ga0501312_054574 | |||
| 3406 | Ga0501313_000012 | |||
| 3407 | Ga0501313_003194 | |||
| 3408 | Ga0501313_005027 | |||
| 3409 | Ga0501313_032965 | |||
| 3410 | Ga0501314_000017 | |||
| 3411 | Ga0501314_000291 | |||
| 3412 | Ga0501314_002194 | |||
| 3413 | Ga0501314_002757 | |||
| 3414 | Ga0501314_007493 | |||
| 3415 | Ga0501314_008399 | |||
| 3416 | Ga0501314_020468 | |||
| 3417 | Ga0501315_000082 | |||
| 3418 | Ga0501315_000346 | |||
| 3419 | Ga0501315_011621 | |||
| 3420 | Ga0501315_019448 | |||
| 3421 | Ga0501315_031864 | |||
| 3422 | Ga0501316_000002 | |||
| 3423 | Ga0501316_000872 | |||
| 3424 | Ga0501316_004359 | |||
| 3425 | Ga0501316_013599 | |||
| 3426 | Ga0501316_028613 | |||
| 3427 | Ga0501316_042876 | |||
| 3428 | Ga0501317_006161 | |||
| 3429 | Ga0501317_008980 | |||
| 3430 | Ga0501317_019088 | |||
| 3431 | Ga0501318_000131 | |||
| 3432 | Ga0501318_000712 | |||
| 3433 | Ga0501318_000842 | |||
| 3434 | Ga0501318_027117 | |||
| 3435 | Ga0501319_000071 | |||
| 3436 | Ga0501319_000080 | |||
| 3437 | Ga0501319_000218 | |||
| 3438 | Ga0501319_000266 | |||
| 3439 | Ga0501319_001099 | |||
| 3440 | Ga0501319_002652 | |||
| 3441 | Ga0501319_018771 | |||
| 3442 | Ga0501320_000131 | |||
| 3443 | Ga0501320_000176 | |||
| 3444 | Ga0501320_001178 | |||
| 3445 | Ga0501320_002176 | |||
| 3446 | Ga0501320_006390 | |||
| 3447 | Ga0501320_007324 | |||
| 3448 | Ga0501320_011478 | |||
| 3449 | Ga0501321_000120 | |||
| 3450 | Ga0501321_001939 | |||
| 3451 | Ga0501321_003049 | |||
| 3452 | Ga0501321_012554 | |||
| 3453 | Ga0501321_037361 | |||
| 3454 | Ga0501321_053241 | |||
| 3455 | Ga0501321_068408 | |||
| 3456 | Ga0501322_000402 | |||
| 3457 | Ga0501323_000015 | |||
| 3458 | Ga0501323_000109 | |||
| 3459 | Ga0501323_002574 | |||
| 3460 | Ga0501323_003426 | |||
| 3461 | Ga0501323_005610 | |||
| 3462 | Ga0501323_012054 | |||
| 3463 | Ga0501323_016244 | |||
| 3464 | Ga0501323_024144 | |||
| 3465 | Ga0501323_032607 | |||
| 3466 | Ga0501324_000221 | |||
| 3467 | Ga0501324_000294 | |||
| 3468 | Ga0501324_005041 | |||
| 3469 | Ga0501324_010830 | |||
| 3470 | Ga0501324_014548 | |||
| 3471 | Ga0501325_000034 | |||
| 3472 | Ga0501325_000873 | |||
| 3473 | Ga0501325_002337 | |||
| 3474 | Ga0501325_002669 | |||
| 3475 | Ga0501325_013412 | |||
| 3476 | Ga0501326_02921 | |||
| 3477 | Ga0501327_00604 | |||
| 3478 | Ga0501327_03461 | |||
| 3479 | Ga0501327_03998 | |||
| 3480 | Ga0501328_01304 | |||
| 3481 | Ga0501328_04192 | |||
| 3482 | Ga0501329_01972 | |||
| 3483 | Ga0501329_02216 | |||
| 3484 | Ga0501329_04026 | |||
| 3485 | Ga0501332_02817 | |||
| 3486 | Ga0501334_13346 | |||
| 3487 | Ga0501335_004434 | |||
| 3488 | Ga0501335_007594 | |||
| 3489 | Ga0501335_011280 | |||
| 3490 | Ga0501336_009456 | |||
| 3491 | Ga0501336_010144 | |||
| 3492 | Ga0501337_003001 | |||
| 3493 | Ga0501337_012388 | |||
| 3494 | Ga0501338_00244 | |||
| 3495 | Ga0501031_0002025 | |||
| 3496 | Ga0501032_0005689 | |||
| 3497 | Ga0501032_0017302 | |||
| 3498 | Ga0501033_0001803 | |||
| 3499 | Ga0501033_0115139 | |||
| 3500 | Ga0501034_0007020 | |||
| 3501 | Ga0501034_0029030 | |||
| 3502 | Ga0501034_0080413 | |||
| 3503 | Ga0501034_0291137 | |||
| 3504 | Ga0501036_0011113 | |||
| 3505 | Ga0501036_0044117 | |||
| 3506 | Ga0501036_1370217 | |||
| 3507 | Ga0501037_0029069 | |||
| 3508 | Ga0501037_0046758 | |||
| 3509 | Ga0501038_0002396 | |||
| 3510 | Ga0501038_0004562 | |||
| 3511 | Ga0501039_0012529 | |||
| 3512 | Ga0501039_0138984 | |||
| 3513 | Ga0501041_0243872 | |||
| 3514 | Ga0501043_0000090 | |||
| 3515 | Ga0501043_0044507 | |||
| 3516 | Ga0501043_0093617 | |||
| 3517 | Ga0501043_0096134 | |||
| 3518 | Ga0501046_0000126 | |||
| 3519 | Ga0501046_0007619 | |||
| 3520 | Ga0501047_0000160 | |||
| 3521 | Ga0501047_0030021 | |||
| 3522 | Ga0501047_0089170 | |||
| 3523 | Ga0501047_0095690 | |||
| 3524 | Ga0501048_0003429 | |||
| 3525 | Ga0501048_0782004 | |||
| 3526 | Ga0501070_0016046 | |||
| 3527 | Ga0501071_0144572 | |||
| 3528 | Ga0501073_0022305 | |||
| 3529 | Ga0501075_0818786 | |||
| 3530 | Ga0501198_000043 | |||
| 3531 | Ga0501202_000808 | |||
| 3532 | Ga0501206_011506 | |||
| 3533 | Ga0501208_025836 | |||
| 3534 | Ga0501211_000022 | |||
| 3535 | Ga0501222_000051 | |||
| 3536 | Ga0501222_002187 | |||
| 3537 | Ga0501222_012076 | |||
| 3538 | Ga0501223_007701 | |||
| 3539 | Ga0501233_002966 | |||
| 3540 | Ga0501235_001228 | |||
| 3541 | Ga0501235_018958 | |||
| 3542 | Ga0501238_000213 | |||
| 3543 | Ga0501238_027455 | |||
| 3544 | Ga0501249_003813 | |||
| 3545 | Ga0501258_000137 | |||
| 3546 | Ga0501221_001094 | |||
| 3547 | Ga0501229_001006 | |||
| 3548 | Ga0501079_0008393 | |||
| 3549 | Ga0501080_0018310 | |||
| 3550 | Ga0501080_0044455 | |||
| 3551 | Ga0501083_0159916 | |||
| 3552 | Ga0501262_000590 | |||
| 3553 | Ga0501262_012757 | |||
| 3554 | Ga0501263_038886 | |||
| 3555 | Ga0501265_002083 | |||
| 3556 | Ga0501267_000666 | |||
| 3557 | Ga0501268_001964 | |||
| 3558 | Ga0501269_000003 | |||
| 3559 | Ga0501269_001030 | |||
| 3560 | Ga0501272_000140 | |||
| 3561 | Ga0501275_029504 | |||
| 3562 | Ga0501278_005782 | |||
| 3563 | Ga0501035_0003746 | |||
| 3564 | Ga0501035_0010523 | |||
| 3565 | Ga0501035_0020355 | |||
| 3566 | Ga0501035_0084650 | |||
| 3567 | Ga0501044_0000210 | |||
| 3568 | Ga0501044_0003730 | |||
| 3569 | Ga0501044_0007653 | |||
| 3570 | Ga0501044_0025863 | |||
| 3571 | Ga0501044_0041861 | |||
| 3572 | Ga0501044_0057237 | |||
| 3573 | Ga0501044_0241667 | |||
| 3574 | Ga0501045_0000882 | |||
| 3575 | Ga0501226_002381 | |||
| 3576 | nmdc:mga03683_13626_c1 | |||
| 3577 | nmdc:mga03683_137878_c1 | |||
| 3578 | nmdc:mga03683_208080_c1 | |||
| 3579 | nmdc:mga03683_40005_c1 | |||
| 3580 | nmdc:mga03683_5449_c1 | |||
| 3581 | nmdc:mga03683_59161_c1 | |||
| 3582 | nmdc:mga03683_60917_c2 | |||
| 3583 | nmdc:mga03683_65613_c1 | |||
| 3584 | nmdc:mga03n38_141615_c1 | |||
| 3585 | nmdc:mga03n38_4317_c1 | |||
| 3586 | nmdc:mga03n38_4851_c1 | |||
| 3587 | nmdc:mga00v17_13392_c1 | |||
| 3588 | nmdc:mga00v17_17620_c1 | |||
| 3589 | nmdc:mga00v17_198473_c1 | |||
| 3590 | nmdc:mga00v17_95981_c1 | |||
| 3591 | nmdc:mga00v17_9678_c1 | |||
| 3592 | nmdc:mga0yw44_159030_c1 | |||
| 3593 | nmdc:mga0yw44_22084_c1 | |||
| 3594 | nmdc:mga0yw44_240503_c1 | |||
| 3595 | nmdc:mga0yw44_312996_c1 | |||
| 3596 | nmdc:mga0k408_1021_c1 | |||
| 3597 | nmdc:mga0k408_112517_c1 | |||
| 3598 | nmdc:mga0k408_113462_c1 | |||
| 3599 | nmdc:mga0k408_12159_c1 | |||
| 3600 | nmdc:mga0k408_126436_c1 | |||
| 3601 | nmdc:mga0k408_12806_c1 | |||
| 3602 | nmdc:mga0k408_13979_c1 | |||
| 3603 | nmdc:mga0k408_144341_c1 | |||
| 3604 | nmdc:mga0k408_17134_c1 | |||
| 3605 | nmdc:mga0k408_191365_c1 | |||
| 3606 | nmdc:mga0k408_219_c1 | |||
| 3607 | nmdc:mga0k408_22144_c1 | |||
| 3608 | nmdc:mga0k408_34347_c1 | |||
| 3609 | nmdc:mga0k408_378964_c1 | |||
| 3610 | nmdc:mga0k408_4092_c1 | |||
| 3611 | nmdc:mga0k408_46982_c1 | |||
| 3612 | nmdc:mga0k408_49108_c1 | |||
| 3613 | nmdc:mga0k408_52239_c1 | |||
| 3614 | nmdc:mga0k408_59597_c1 | |||
| 3615 | nmdc:mga0k408_6946_c1 | |||
| 3616 | nmdc:mga0k408_7194_c1 | |||
| 3617 | nmdc:mga0k408_80309_c1 | |||
| 3618 | nmdc:mga06z11_132141_c1 | |||
| 3619 | nmdc:mga06z11_1936_c1 | |||
| 3620 | nmdc:mga06z11_234289_c1 | |||
| 3621 | nmdc:mga06z11_3023_c1 | |||
| 3622 | nmdc:mga06z11_31530_c1 | |||
| 3623 | nmdc:mga06z11_49595_c1 | |||
| 3624 | nmdc:mga07m45_15127_c1 | |||
| 3625 | nmdc:mga07m45_173746_c1 | |||
| 3626 | nmdc:mga07m45_2931_c1 | |||
| 3627 | nmdc:mga07m45_313713_c1 | |||
| 3628 | nmdc:mga07m45_398_c1 | |||
| 3629 | nmdc:mga07m45_44170_c1 | |||
| 3630 | nmdc:mga07m45_670_c1 | |||
| 3631 | nmdc:mga07m45_6867_c1 | |||
| 3632 | nmdc:mga07m45_73641_c1 | |||
| 3633 | nmdc:mga07m45_77026_c1 | |||
| 3634 | nmdc:mga05p37_217522_c1 | |||
| 3635 | nmdc:mga09592_38477_c1 | |||
| 3636 | nmdc:mga0qj67_514573_c1 | |||
| 3637 | nmdc:mga08y16_406950_c1 | |||
| 3638 | nmdc:mga0n895_412583_c1 | |||
| 3639 | nmdc:mga0sz30_3989_c1 | |||
| 3640 | nmdc:mga0sz30_7140_c1 | |||
| 3641 | Ga0495601_0113176 | |||
| 3642 | Ga0495612_0194706 | |||
| 3643 | Ga0495619_0018602 | |||
| 3644 | Ga0495619_0343377 | |||
| 3645 | Ga0500578_0003978 | |||
| 3646 | Ga0500644_0003475 | |||
| 3647 | Ga0500644_0007363 | |||
| 3648 | Ga0500646_0004768 | |||
| 3649 | Ga0500646_0014216 | |||
| 3650 | Ga0500583_0098796 | |||
| 3651 | Ga0500651_0000274 | |||
| 3652 | Ga0500651_0018933 | |||
| 3653 | Ga0500651_0066659 | |||
| 3654 | Ga0500641_0103989 | |||
| 3655 | Ga0500650_0063295 | |||
| 3656 | Ga0500569_001743 | |||
| 3657 | Ga0500593_000235 | |||
| 3658 | Ga0500594_0061291 | |||
| 3659 | Ga0500594_0063615 | |||
| 3660 | Ga0500614_049872 | |||
| 3661 | Ga0500618_002645 | |||
| 3662 | Ga0500618_040979 | |||
| 3663 | Ga0500642_0002530 | |||
| 3664 | Ga0500652_000400 | |||
| 3665 | Ga0500559_0003187 | |||
| 3666 | Ga0500564_123671 | |||
| 3667 | Ga0500568_0002797 | |||
| 3668 | Ga0500568_0013644 | |||
| 3669 | Ga0500590_019884 | |||
| 3670 | Ga0500604_0000352 | |||
| 3671 | Ga0500604_0033502 | |||
| 3672 | Ga0500616_0028067 | |||
| 3673 | Ga0500619_000012 | |||
| 3674 | Ga0500622_0000198 | |||
| 3675 | Ga0500622_0000978 | |||
| 3676 | Ga0500622_0001316 | |||
| 3677 | Ga0500634_0000642 | |||
| 3678 | Ga0500638_090974 | |||
| 3679 | Ga0500645_030785 | |||
| 3680 | Ga0500645_051755 | |||
| 3681 | Ga0500587_000541 | |||
| 3682 | Ga0590071_001831 | |||
| 3683 | Ga0590071_007079 | |||
| 3684 | Ga0590071_038065 | |||
| 3685 | Ga0590074_000612 | |||
| 3686 | Ga0590074_018003 | |||
| 3687 | Ga0587084_000147 | |||
| 3688 | Ga0587084_008054 | |||
| 3689 | Ga0587084_029056 | |||
| 3690 | Ga0587093_000068 | |||
| 3691 | Ga0587093_003363 | |||
| 3692 | Ga0587093_012919 | |||
| 3693 | Ga0587093_013685 | |||
| 3694 | Ga0587066_004510 | |||
| 3695 | Ga0587070_000065 | |||
| 3696 | Ga0587070_002116 | |||
| 3697 | Ga0587070_013338 | |||
| 3698 | Ga0587073_0000528 | |||
| 3699 | Ga0587073_0012121 | |||
| 3700 | Ga0587077_000950 | |||
| 3701 | Ga0587077_001041 | |||
| 3702 | Ga0587077_009175 | |||
| 3703 | Ga0587077_009185 | |||
| 3704 | Ga0587077_126572 | |||
| 3705 | Ga0587080_004865 | |||
| 3706 | Ga0587080_024618 | |||
| 3707 | Ga0587082_002352 | |||
| 3708 | Ga0587082_002436 | |||
| 3709 | Ga0587083_0000260 | |||
| 3710 | Ga0587083_0007825 | |||
| 3711 | Ga0587083_0022367 | |||
| 3712 | Ga0587083_0035204 | |||
| 3713 | Ga0587083_0104206 | |||
| 3714 | Ga0587085_006077 | |||
| 3715 | Ga0587088_000741 | |||
| 3716 | Ga0587088_006778 | |||
| 3717 | Ga0587090_006053 | |||
| 3718 | Ga0587090_006400 | |||
| 3719 | Ga0587091_020896 | |||
| 3720 | Ga0587092_003731 | |||
| 3721 | Ga0587092_013128 | |||
| 3722 | Ga0587095_005582 | |||
| 3723 | Ga0587106_001662 | |||
| 3724 | Ga0587106_027877 | |||
| 3725 | Ga0587125_000700 | |||
| 3726 | Ga0587129_000468 | |||
| 3727 | Ga0587099_000652 | |||
| 3728 | Ga0587101_000448 | |||
| 3729 | Ga0587101_004507 | |||
| 3730 | Ga0587101_057660 | |||
| 3731 | Ga0587109_004786 | |||
| 3732 | Ga0587109_006245 | |||
| 3733 | Ga0587115_001117 | |||
| 3734 | Ga0587115_009308 | |||
| 3735 | Ga0587127_000506 | |||
| 3736 | Ga0587128_001730 | |||
| 3737 | Ga0587128_016950 | |||
| 3738 | Ga0587128_037531 | |||
| 3739 | Ga0587062_000400 | |||
| 3740 | Ga0587062_012649 | |||
| 3741 | Ga0587062_023713 | |||
| 3742 | Ga0587067_002743 | |||
| 3743 | Ga0587068_001309 | |||
| 3744 | Ga0587068_002035 | |||
| 3745 | Ga0587068_002203 | |||
| 3746 | Ga0587068_065785 | |||
| 3747 | Ga0587072_001392 | |||
| 3748 | Ga0587072_008796 | |||
| 3749 | Ga0587076_002043 | |||
| 3750 | Ga0587076_002122 | |||
| 3751 | Ga0587076_026054 | |||
| 3752 | Ga0587076_048146 | |||
| 3753 | Ga0587076_056593 | |||
| 3754 | Ga0587078_001557 | |||
| 3755 | Ga0587079_003155 | |||
| 3756 | Ga0587079_074262 | |||
| 3757 | Ga0587100_000850 | |||
| 3758 | Ga0587102_000785 | |||
| 3759 | Ga0587105_000221 | |||
| 3760 | Ga0587107_000989 | |||
| 3761 | Ga0587108_001930 | |||
| 3762 | Ga0587110_002686 | |||
| 3763 | Ga0587114_002480 | |||
| 3764 | Ga0587116_02561 | |||
| 3765 | Ga0587118_00289 | |||
| 3766 | Ga0587119_011551 | |||
| 3767 | Ga0587119_011607 | |||
| 3768 | Ga0587124_001207 | |||
| 3769 | Ga0587124_001529 | |||
| 3770 | Ga0587060_005879 | |||
| 3771 | Ga0587096_00044 | |||
| 3772 | Ga0587071_000529 | |||
| 3773 | Ga0587071_026067 | |||
| 3774 | Ga0587071_032151 | |||
| 3775 | Ga0587111_0000186 | |||
| 3776 | Ga0587111_0000325 | |||
| 3777 | Ga0587111_0028503 | |||
| 3778 | Ga0587111_0150047 | |||
| 3779 | Ga0466962_0000718 | |||
| 3780 | Ga0466962_0019514 | |||
| 3781 | Ga0466962_0341430 | |||
| 3782 | 2511245076 | |||
| 3783 | 2548501400 | |||
| 3784 | 2587725924 | |||
| 3785 | 2587735575 | |||
| 3786 | 2587758986 | |||
| 3787 | 2588292863 | |||
| 3788 | 2601667014 | |||
| 3789 | 2643746688 | |||
| 3790 | 2643868378 | |||
| 3791 | 2643937420 | |||
| 3792 | 2643967972 | |||
| 3793 | 2643994489 | |||
| 3794 | 2644061503 | |||
| 3795 | 2644075035 | |||
| 3796 | 2644143128 | |||
| 3797 | 2644218754 | |||
| 3798 | 2644247752 | |||
| 3799 | 2644254814 | |||
| 3800 | 2644256841 | |||
| 3801 | 2644271784 | |||
| 3802 | 2644295314 | |||
| 3803 | 2644305900 | |||
| 3804 | 2644314958 | |||
| 3805 | 2644338009 | |||
| 3806 | 2644360375 | |||
| 3807 | 2644649055 | |||
| 3808 | 2722886129 | |||
| 3809 | 2738738123 | |||
| 3810 | 2738826782 | |||
| 3811 | 2738843079 | |||
| 3812 | 2739057971 | |||
| 3813 | 2739150579 | |||
| 3814 | 2739192498 | |||
| 3815 | 2739243204 | |||
| 3816 | 2739273830 | |||
| 3817 | 2739318975 | |||
| 3818 | 2739337216 | |||
| 3819 | 2739342874 | |||
| 3820 | 2816473779 | |||
| 3821 | 2821135882 | |||
| 3822 | 2839144217 | |||
| 3823 | 2842712344 | |||
| 3824 | 2842722291 | |||
| 3825 | 2855735574 | |||
| 3826 | 2855771357 | |||
| 3827 | 2857549059 | |||
| 3828 | 2857556288 | |||
| 3829 | 2857560795 | |||
| 3830 | 2857567994 | |||
| 3831 | 2857578657 | |||
| 3832 | 2881104315 | |||
| 3833 | 2881416781 | |||
| 3834 | 2885084377 | |||
| 3835 | 2886854505 | |||
| 3836 | 2894023738 | |||
| 3837 | 2904428890 | |||
| 3838 | 2919476950 | |||
| 3839 | 2919708822 | |||
| 3840 | 2928118414 | |||
| 3841 | 2932416109 | |||
| 3842 | 2932422215 | |||
| 3843 | 2932423149 | |||
| 3844 | 2939635358 | |||
| 3845 | 2974320960 | |||
| 3846 | 2989393093 | |||
| 3847 | 2990715405 | |||
| 3848 | 8002396096 | |||
| 3849 | 8048749930 | |||
| 3850 | 8055226498 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mmm-assembly1.cif.gz_F | structure of the 70s chloroplast ribosome | 0.9831 | 3 | 178 |
| 8a63-assembly1.cif.gz_J | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.978 | 3 | 176 |
| 6ore-assembly1.cif.gz_E | release complex 70s | 0.9774 | 2 | 178 |
| 8fn2-assembly1.cif.gz_G | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9765 | 1 | 179 |
| 7azo-assembly1.cif.gz_L5A | 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 | 0.9765 | 1 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9731 | 2 | 178 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9678 | 2 | 178 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9267 | 22 | 179 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9244 | 22 | 177 | 3.30.1440.10 |
| 4hubD00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9038 | 26 | 158 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520A9X5-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL24; Large ribosomal subunit protein uL5] | 0.998 | 51 | 178 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A351CMI8-F1-model_v4 | 50S ribosomal protein L5 | 0.9976 | 56 | 179 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A6L7RZT1-F1-model_v4 | 50S ribosomal protein L5 | 0.9943 | 56 | 179 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A139R9T6-F1-model_v4 | 50S ribosomal protein L5 | 0.9943 | 58 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7W0H3C9-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9942 | 3 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |