F496080

General Info

Members Datasets Scaffolds Average Seq Length
1930 773 1725 175

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1001001|JGI25160J50197_10010017
Length 170
Sequence MALGRFCSVMALVCTWLTATVGPSHSAKEATPQTASGLPVPRYVSLKSDHVNVRAGPTKDNDVAWVYVEITAEFENWRRVRDSEGAEGWVYXSLLSGRRTAVVTMKHKDELAPIYDRADPDSAVAAKLQAGVVTQVKKCAANWCRVTGNGFDGWIQQERLWGVYSDEQVN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
60 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
61 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
62 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
63 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
64 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
65 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
66 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
67 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
68 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
69 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
70 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
71 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
72 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
73 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
74 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
75 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
76 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
77 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
78 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
79 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
80 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
81 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
82 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
83 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
84 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
85 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
86 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
87 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
88 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
89 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
90 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
91 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
92 2904699407
93 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
94 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
95 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
96 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
97 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
98 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
99 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
100 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
101 2922368715
102 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
103 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
104 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
105 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
106 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
107 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
108 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
109 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
110 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
111 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
112 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
113 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
114 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
115 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
116 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
117 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
118 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
119 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
120 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
121 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
122 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
123 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
124 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
125 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
126 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
127 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
128 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
129 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
130 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
131 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
132 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
133 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
134 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
135 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
136 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
137 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
138 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
139 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
140 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
141 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
142 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
143 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
144 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
145 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
146 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
147 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
148 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
149 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
150 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
151 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
152 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
153 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
154 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
155 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
156 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
157 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
158 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
159 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
160 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
161 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
162 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
163 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
164 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
165 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
166 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
167 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
168 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
169 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
170 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
171 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
172 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
173 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
174 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
175 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
176 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
177 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
179 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
180 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
181 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
182 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
183 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
184 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
185 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
186 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
187 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
188 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
189 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
190 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
191 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
192 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
193 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
194 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
195 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
196 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
197 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
198 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
199 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
200 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
201 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
202 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
203 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
204 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
205 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
206 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
207 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
208 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
209 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
210 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
211 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
212 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
213 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
214 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
215 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
216 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
217 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
218 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
219 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
220 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
221 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
222 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
223 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
224 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
225 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
226 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
227 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
228 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
229 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
230 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
231 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
232 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
233 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
234 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
235 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
236 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
237 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
238 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
239 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
240 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
241 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
242 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
247 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
248 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
249 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
250 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
251 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
252 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
253 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
254 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
255 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
256 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
257 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
260 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
261 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
262 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
263 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
264 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
265 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
266 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
267 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
268 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
269 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
270 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
271 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
272 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
273 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
274 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
275 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
276 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
277 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
278 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
279 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
280 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
281 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
282 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
283 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
284 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
285 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
290 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
291 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
292 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
293 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
294 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
295 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
296 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
297 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
298 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
299 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
300 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
301 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
302 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
303 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
304 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
305 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
306 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
307 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
308 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
309 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
310 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
311 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
312 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
313 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
314 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
315 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
316 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
317 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
318 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
319 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
320 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
321 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
322 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
323 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
324 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
326 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
329 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
333 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
334 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
335 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
401 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
402 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
403 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
404 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
406 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
407 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
411 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
412 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
413 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
414 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
415 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
416 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
417 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
418 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
419 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
420 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
423 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
424 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
425 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
426 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
427 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
428 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
429 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
430 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
431 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
432 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
433 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
434 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
435 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
436 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
437 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
438 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
439 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
440 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
441 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
442 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
443 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
444 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
445 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
446 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
447 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
448 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
449 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
450 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
451 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
452 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
453 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
454 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
455 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
456 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
457 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
458 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
459 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
460 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
461 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
462 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
463 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
464 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
465 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
466 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
467 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
468 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
469 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
470 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
471 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
472 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
473 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
474 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
475 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
476 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
477 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
478 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
479 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
480 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
481 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
482 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
483 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
484 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
485 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
486 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
487 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
488 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
489 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
490 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
491 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
492 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
493 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
494 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
495 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
496 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
497 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
498 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
499 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
500 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
501 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
502 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
503 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
504 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
505 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
506 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
507 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
508 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
509 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
510 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
511 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
512 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
513 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
514 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
515 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
516 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
517 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
518 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
519 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
520 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
521 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
522 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
523 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
524 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
525 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
526 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
527 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
528 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
529 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
530 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
531 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
532 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
533 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
534 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
535 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
536 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
537 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
538 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
539 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
540 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
541 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
542 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
543 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
544 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
545 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
546 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
547 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
548 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
549 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
550 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
551 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
552 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
553 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
554 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
555 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
556 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
557 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
558 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
559 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
560 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
561 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
562 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
563 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
564 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
565 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
566 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
567 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
568 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
569 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
570 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
571 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
572 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
573 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
574 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
575 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
576 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
577 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
578 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
579 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
580 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
581 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
582 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
583 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
584 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
585 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
586 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
587 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
588 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
589 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
590 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
591 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
592 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
593 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
594 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
595 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
596 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
597 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
598 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
599 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
600 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
601 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
602 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
603 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
604 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
605 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
606 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
607 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
608 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
609 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
610 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
611 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
612 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
613 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
614 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
615 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
616 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
617 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
618 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
619 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
620 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
621 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
622 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
623 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
624 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
625 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
626 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
627 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
628 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
629 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
630 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
633 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
636 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
637 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
640 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
641 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
644 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
645 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
646 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
647 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
648 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
649 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
650 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
651 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
652 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
653 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
654 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
655 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
656 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
657 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
658 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
659 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
660 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
661 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
662 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
663 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
664 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
665 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
666 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
667 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
668 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
669 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
670 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
671 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
672 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
673 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
674 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
675 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
676 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
677 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
678 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
679 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
680 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
681 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
682 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
683 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
684 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
685 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
686 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
687 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
688 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
689 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
690 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
691 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
692 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
693 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
694 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
695 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
696 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
697 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
698 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
699 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
700 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
701 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
702 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
703 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
704 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
705 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
706 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
707 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
708 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
709 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
710 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
711 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
712 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
713 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
714 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
715 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
716 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
717 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
718 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
719 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
720 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
721 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
722 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
723 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
724 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
725 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
726 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
727 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
728 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
729 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
730 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
731 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
732 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
733 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
734 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
735 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
736 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
737 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
738 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
739 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
740 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
741 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
742 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
743 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
744 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
745 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
746 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
747 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
748 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
749 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
750 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
751 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
752 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
753 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
754 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
755 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
756 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
757 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
758 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
759 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
760 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
761 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
762 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
763 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
764 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
765 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
766 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
767 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
768 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
769 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
770 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
771 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
772 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
773 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.36
Metatranscriptomes 0.16
Isolates 10.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.42
Nodule 8.45
Rhizoplane 6.17
Rhizosphere 62.69
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003115 3300000549 Bacteria 2242
2 JGI24739J22299_10000950 3300001989 Bacteria 10788
3 JGI24737J22298_10003390 3300001990 Bacteria 5636
4 JGI24735J21928_10007692 3300002067 Bacteria 3506
5 JGI24750J21931_1011487 3300002070 Bacteria 1165
6 JGI24738J21930_10006447 3300002075 Bacteria 2751
7 JGI24742J22300_10006916 3300002244 Bacteria 1871
8 JGI25406J46586_10000015 3300003203 Bacteria 91406
9 JGI25406J46586_10013868 3300003203 Bacteria 3443
10 JGI25165J46597_1006926 3300003214 Bacteria 1952
11 JGI25153J46596_10004444 3300003215 Bacteria 7562
12 JGI25153J46596_10016721 3300003215 Bacteria 2924
13 JGI25153J46596_10018333 3300003215 Bacteria 2724
14 JGI25153J46596_10046570 3300003215 Bacteria 1284
15 JGI25160J50197_1001001 3300003354 Bacteria 14647
16 JGI25160J50197_1006880 3300003354 Bacteria 4537
17 JGI25404J52841_10003238 3300003659 Bacteria 3192
18 JGI25404J52841_10011196 3300003659 Bacteria 1932
19 Ga0055539_1008601 3300003752 Bacteria 1276
20 Ga0055529_1010850 3300003763 Bacteria 1179
21 Ga0055529_1013822 3300003763 Bacteria 1026
22 Ga0055526_1044030 3300003771 Bacteria 1081
23 Ga0055543_1003105 3300004625 Bacteria 5088
24 Ga0065165_1001886 3300005262 Bacteria 20226
25 Ga0065165_1041874 3300005262 Bacteria 1356
26 Ga0065707_10017090 3300005295 Bacteria 1557
27 Ga0070658_10116952 3300005327 Bacteria 2213
28 Ga0070658_10178918 3300005327 Bacteria 1784
29 Ga0070676_10158273 3300005328 Bacteria 1456
30 Ga0070676_10360655 3300005328 Bacteria 1001
31 Ga0070683_100299149 3300005329 Bacteria 1531
32 Ga0070683_100894143 3300005329 Bacteria 852
33 Ga0070690_100292355 3300005330 Bacteria 1166
34 Ga0070690_100505583 3300005330 Bacteria 905
35 Ga0070670_100240073 3300005331 Bacteria 1577
36 Ga0068869_100160569 3300005334 Bacteria 1749
37 Ga0068869_100168960 3300005334 Bacteria 1707
38 Ga0070680_100009352 3300005336 Bacteria 7530
39 Ga0070680_100109995 3300005336 Bacteria 2293
40 Ga0070680_100123724 3300005336 Bacteria 2160
41 Ga0070682_100289367 3300005337 Bacteria 1198
42 Ga0070682_100594443 3300005337 Bacteria 873
43 Ga0068868_101049560 3300005338 Bacteria 748
44 Ga0068868_101102029 3300005338 Bacteria 730
45 Ga0070660_100018794 3300005339 Bacteria 5056
46 Ga0070660_100173282 3300005339 Bacteria 1743
47 Ga0070660_100351557 3300005339 Bacteria 1214
48 Ga0070660_100581880 3300005339 Bacteria 935
49 Ga0070660_100707779 3300005339 Bacteria 845
50 Ga0070689_100539710 3300005340 Bacteria 1003
51 Ga0070691_10005991 3300005341 Bacteria 5548
52 Ga0070691_10409577 3300005341 Bacteria 766
53 Ga0070687_100643881 3300005343 Bacteria 734
54 Ga0070661_100209415 3300005344 Bacteria 1492
55 Ga0070661_100322031 3300005344 Bacteria 1207
56 Ga0070661_100486758 3300005344 Bacteria 986
57 Ga0070692_10173375 3300005345 Bacteria 1245
58 Ga0070668_100012224 3300005347 Bacteria 6396
59 Ga0070668_100074858 3300005347 Bacteria 2642
60 Ga0070668_100122443 3300005347 Bacteria 2080
61 Ga0070668_100246887 3300005347 Bacteria 1480
62 Ga0070668_100262224 3300005347 Bacteria 1437
63 Ga0070668_100302191 3300005347 Bacteria 1342
64 Ga0070668_100348033 3300005347 Bacteria 1253
65 Ga0070669_100099323 3300005353 Bacteria 2193
66 Ga0070669_100136605 3300005353 Bacteria 1886
67 Ga0070669_100188041 3300005353 Bacteria 1619
68 Ga0070669_100440211 3300005353 Bacteria 1073
69 Ga0070675_100554306 3300005354 Bacteria 1040
70 Ga0070671_100096306 3300005355 Bacteria 2482
71 Ga0070671_100737593 3300005355 Bacteria 856
72 Ga0070674_100087142 3300005356 Bacteria 2244
73 Ga0070674_100155154 3300005356 Bacteria 1731
74 Ga0070674_101303673 3300005356 Bacteria 648
75 Ga0070673_100358039 3300005364 Bacteria 1296
76 Ga0070688_100222632 3300005365 Bacteria 1330
77 Ga0070659_100039074 3300005366 Bacteria 3703
78 Ga0070659_100069607 3300005366 Bacteria 2793
79 Ga0070659_100986191 3300005366 Bacteria 739
80 Ga0070667_100229055 3300005367 Bacteria 1656
81 Ga0070709_10002011 3300005434 Bacteria 11061
82 Ga0070709_10057722 3300005434 Bacteria 2459
83 Ga0070709_10539826 3300005434 Bacteria 891
84 Ga0070714_100065139 3300005435 Bacteria 3138
85 Ga0070714_100073637 3300005435 Bacteria 2960
86 Ga0070714_100171751 3300005435 Bacteria 1967
87 Ga0070714_100422521 3300005435 Bacteria 1263
88 Ga0070713_100041608 3300005436 Bacteria 3745
89 Ga0070713_100078712 3300005436 Bacteria 2807
90 Ga0070713_100119880 3300005436 Bacteria 2306
91 Ga0070713_100264896 3300005436 Bacteria 1572
92 Ga0070713_100267066 3300005436 Bacteria 1566
93 Ga0070713_100322207 3300005436 Bacteria 1428
94 Ga0070710_10000872 3300005437 Bacteria 14419
95 Ga0070710_10013092 3300005437 Bacteria 4141
96 Ga0070710_10028873 3300005437 Bacteria 2971
97 Ga0070710_10195934 3300005437 Bacteria 1273
98 Ga0070710_10320347 3300005437 Bacteria 1018
99 Ga0070710_10504055 3300005437 Bacteria 829
100 Ga0070710_10539740 3300005437 Bacteria 804
101 Ga0070711_100008236 3300005439 Bacteria 6377
102 Ga0070711_100043404 3300005439 Bacteria 3045
103 Ga0070711_100090510 3300005439 Bacteria 2204
104 Ga0070711_100122058 3300005439 Bacteria 1929
105 Ga0070711_100187446 3300005439 Bacteria 1587
106 Ga0070711_100559012 3300005439 Bacteria 950
107 Ga0070711_100750453 3300005439 Bacteria 825
108 Ga0070700_100537694 3300005441 Bacteria 906
109 Ga0070663_100013673 3300005455 Bacteria 5185
110 Ga0070663_100018768 3300005455 Bacteria 4542
111 Ga0070663_100023522 3300005455 Bacteria 4131
112 Ga0070663_100077368 3300005455 Bacteria 2435
113 Ga0070663_100092535 3300005455 Bacteria 2242
114 Ga0070663_100204298 3300005455 Bacteria 1543
115 Ga0070663_100219999 3300005455 Bacteria 1490
116 Ga0070663_100335763 3300005455 Bacteria 1219
117 Ga0070663_100467154 3300005455 Bacteria 1042
118 Ga0070663_100640712 3300005455 Bacteria 898
119 Ga0070678_100043263 3300005456 Bacteria 3206
120 Ga0070678_100108302 3300005456 Bacteria 2168
121 Ga0070678_100178862 3300005456 Bacteria 1734
122 Ga0070662_100040180 3300005457 Bacteria 3330
123 Ga0070662_100183100 3300005457 Bacteria 1653
124 Ga0070662_100528446 3300005457 Bacteria 986
125 Ga0070662_100708822 3300005457 Bacteria 852
126 Ga0070662_100882379 3300005457 Bacteria 763
127 Ga0070662_101163248 3300005457 Bacteria 663
128 Ga0070681_10013547 3300005458 Bacteria 8109
129 Ga0070681_10072747 3300005458 Bacteria 3400
130 Ga0070681_10276518 3300005458 Bacteria 1590
131 Ga0070681_10320087 3300005458 Bacteria 1461
132 Ga0070681_10450146 3300005458 Bacteria 1200
133 Ga0068867_100083306 3300005459 Bacteria 2414
134 Ga0068867_100810829 3300005459 Bacteria 835
135 Ga0070685_10162228 3300005466 Bacteria 1426
136 Ga0070706_100224878 3300005467 Bacteria 1752
137 Ga0070706_100552791 3300005467 Bacteria 1071
138 Ga0070698_100128362 3300005471 Bacteria 2492
139 Ga0070698_100569266 3300005471 Bacteria 1073
140 Ga0070699_100131436 3300005518 Bacteria 2207
141 Ga0070679_100041775 3300005530 Bacteria 4564
142 Ga0070679_100206683 3300005530 Bacteria 1928
143 Ga0070679_100220342 3300005530 Bacteria 1858
144 Ga0070679_100246654 3300005530 Bacteria 1743
145 Ga0070679_100346124 3300005530 Bacteria 1434
146 Ga0070679_100433466 3300005530 Bacteria 1259
147 Ga0070684_100066098 3300005535 Bacteria 3174
148 Ga0070684_100127231 3300005535 Bacteria 2296
149 Ga0070684_100433063 3300005535 Bacteria 1214
150 Ga0070684_100518537 3300005535 Bacteria 1105
151 Ga0070697_100076378 3300005536 Bacteria 2755
152 Ga0068853_100010722 3300005539 Bacteria 7421
153 Ga0068853_100058648 3300005539 Bacteria 3323
154 Ga0068853_100063111 3300005539 Bacteria 3208
155 Ga0068853_100135559 3300005539 Bacteria 2207
156 Ga0068853_100307623 3300005539 Bacteria 1466
157 Ga0068853_100908965 3300005539 Bacteria 846
158 Ga0068853_101225955 3300005539 Bacteria 725
159 Ga0068853_101579449 3300005539 Bacteria 635
160 Ga0070672_100051989 3300005543 Bacteria 3197
161 Ga0070672_100223244 3300005543 Bacteria 1581
162 Ga0070686_100082807 3300005544 Bacteria 2128
163 Ga0070696_100811732 3300005546 Bacteria 771
164 Ga0070693_100182519 3300005547 Bacteria 1352
165 Ga0070693_100231614 3300005547 Bacteria 1216
166 Ga0070693_100256793 3300005547 Bacteria 1161
167 Ga0070693_100258217 3300005547 Bacteria 1158
168 Ga0070665_100122323 3300005548 Bacteria 2604
169 Ga0070665_100173976 3300005548 Bacteria 2154
170 Ga0070665_100219984 3300005548 Bacteria 1899
171 Ga0070665_100282652 3300005548 Bacteria 1661
172 Ga0070665_100432308 3300005548 Bacteria 1325
173 Ga0070665_100460944 3300005548 Bacteria 1281
174 Ga0070665_100559060 3300005548 Bacteria 1156
175 Ga0070665_100678299 3300005548 Bacteria 1043
176 Ga0070704_100701181 3300005549 Bacteria 898
177 Ga0068855_100034337 3300005563 Bacteria 6050
178 Ga0068855_100037580 3300005563 Bacteria 5757
179 Ga0068855_100051685 3300005563 Bacteria 4841
180 Ga0068855_100083979 3300005563 Bacteria 3688
181 Ga0068855_100266223 3300005563 Bacteria 1908
182 Ga0068855_100300171 3300005563 Bacteria 1779
183 Ga0068855_100575850 3300005563 Bacteria 1216
184 Ga0068855_101093612 3300005563 Bacteria 834
185 Ga0068855_101390712 3300005563 Bacteria 724
186 Ga0070664_100053626 3300005564 Bacteria 3419
187 Ga0070664_100297206 3300005564 Bacteria 1458
188 Ga0070664_100941790 3300005564 Bacteria 811
189 Ga0068857_100002988 3300005577 Bacteria 13941
190 Ga0068857_100008016 3300005577 Bacteria 9109
191 Ga0068857_100015801 3300005577 Bacteria 6606
192 Ga0068857_100130693 3300005577 Bacteria 2265
193 Ga0068854_100000689 3300005578 Bacteria 20158
194 Ga0068854_100176582 3300005578 Bacteria 1665
195 Ga0068854_100231226 3300005578 Bacteria 1467
196 Ga0068856_100041193 3300005614 Bacteria 4537
197 Ga0068856_100091417 3300005614 Bacteria 3028
198 Ga0068856_100122900 3300005614 Bacteria 2598
199 Ga0068856_100150365 3300005614 Bacteria 2337
200 Ga0068856_100285720 3300005614 Bacteria 1667
201 Ga0068856_100293164 3300005614 Bacteria 1644
202 Ga0068856_100565292 3300005614 Bacteria 1158
203 Ga0068856_100570665 3300005614 Bacteria 1153
204 Ga0068856_100578990 3300005614 Bacteria 1144
205 Ga0068856_100723432 3300005614 Bacteria 1016
206 Ga0068856_100781199 3300005614 Bacteria 975
207 Ga0070702_100164228 3300005615 Bacteria 1438
208 Ga0068852_100040046 3300005616 Bacteria 3951
209 Ga0068852_100052928 3300005616 Bacteria 3492
210 Ga0068852_100121689 3300005616 Bacteria 2391
211 Ga0068852_100295009 3300005616 Bacteria 1567
212 Ga0068852_100347869 3300005616 Bacteria 1447
213 Ga0068852_100450914 3300005616 Bacteria 1273
214 Ga0068852_100451944 3300005616 Bacteria 1272
215 Ga0068852_100999916 3300005616 Bacteria 855
216 Ga0068852_101005432 3300005616 Bacteria 852
217 Ga0068859_100055596 3300005617 Bacteria 3983
218 Ga0068859_100113481 3300005617 Bacteria 2773
219 Ga0068859_100368700 3300005617 Bacteria 1531
220 Ga0068859_100529064 3300005617 Bacteria 1274
221 Ga0068864_100010685 3300005618 Bacteria 7587
222 Ga0068864_100070104 3300005618 Bacteria 3050
223 Ga0068864_100193808 3300005618 Bacteria 1864
224 Ga0068861_100059460 3300005719 Bacteria 2926
225 Ga0068861_100223314 3300005719 Bacteria 1593
226 Ga0068861_100238612 3300005719 Bacteria 1545
227 Ga0068861_100276342 3300005719 Bacteria 1444
228 Ga0068851_10003958 3300005834 Bacteria 6633
229 Ga0068851_10058123 3300005834 Bacteria 1976
230 Ga0068870_10145690 3300005840 Bacteria 1390
231 Ga0068863_100199834 3300005841 Bacteria 1923
232 Ga0068863_100210895 3300005841 Bacteria 1871
233 Ga0068863_101037046 3300005841 Bacteria 824
234 Ga0068858_100019227 3300005842 Bacteria 6387
235 Ga0068858_100024626 3300005842 Bacteria 5607
236 Ga0068858_100133581 3300005842 Bacteria 2328
237 Ga0068858_100274839 3300005842 Bacteria 1603
238 Ga0068858_100430016 3300005842 Bacteria 1270
239 Ga0068858_100453634 3300005842 Bacteria 1236
240 Ga0068858_101191788 3300005842 Bacteria 748
241 Ga0068860_100001623 3300005843 Bacteria 24139
242 Ga0068860_100268252 3300005843 Bacteria 1665
243 Ga0068860_100373600 3300005843 Bacteria 1406
244 Ga0068860_100566113 3300005843 Bacteria 1139
245 Ga0068860_100758112 3300005843 Bacteria 982
246 Ga0068860_100871966 3300005843 Bacteria 915
247 Ga0068862_100118150 3300005844 Bacteria 2334
248 Ga0068862_100383474 3300005844 Bacteria 1311
249 Ga0068862_100392645 3300005844 Bacteria 1296
250 Ga0068862_100486013 3300005844 Bacteria 1169
251 Ga0068862_100513137 3300005844 Bacteria 1139
252 Ga0068862_100531476 3300005844 Bacteria 1120
253 Ga0068862_100574171 3300005844 Bacteria 1079
254 Ga0081455_10011753 3300005937 Bacteria 8768
255 Ga0081455_10030453 3300005937 Bacteria 4900
256 Ga0081455_10044915 3300005937 Bacteria 3849
257 Ga0081455_10065396 3300005937 Bacteria 3042
258 Ga0081538_10026982 3300005981 Bacteria 3996
259 Ga0081538_10081593 3300005981 Bacteria 1719
260 Ga0081538_10096710 3300005981 Bacteria 1503
261 Ga0081540_1000641 3300005983 Bacteria 33205
262 Ga0081540_1002768 3300005983 Bacteria 14227
263 Ga0081540_1004657 3300005983 Bacteria 10380
264 Ga0081540_1012285 3300005983 Bacteria 5653
265 Ga0081540_1019885 3300005983 Bacteria 4061
266 Ga0081540_1022974 3300005983 Bacteria 3665
267 Ga0081540_1030989 3300005983 Bacteria 2951
268 Ga0081540_1091743 3300005983 Bacteria 1335
269 Ga0081540_1116108 3300005983 Bacteria 1121
270 Ga0081539_10000064 3300005985 Bacteria 247020
271 Ga0081539_10001127 3300005985 Bacteria 48442
272 Ga0081539_10049479 3300005985 Bacteria 2385
273 Ga0070717_10003745 3300006028 Bacteria 10920
274 Ga0070717_10051071 3300006028 Bacteria 3401
275 Ga0070717_10062343 3300006028 Bacteria 3092
276 Ga0070717_10087173 3300006028 Bacteria 2629
277 Ga0070717_10251791 3300006028 Bacteria 1560
278 Ga0070717_10508766 3300006028 Bacteria 1089
279 Ga0070717_10746778 3300006028 Bacteria 889
280 Ga0075365_10009883 3300006038 Bacteria 5522
281 Ga0075365_10017356 3300006038 Bacteria 4402
282 Ga0075365_10061649 3300006038 Bacteria 2505
283 Ga0075365_10113512 3300006038 Bacteria 1864
284 Ga0075365_10156261 3300006038 Bacteria 1587
285 Ga0075365_10234326 3300006038 Bacteria 1289
286 Ga0075365_10514033 3300006038 Bacteria 847
287 Ga0075368_10013479 3300006042 Bacteria 3003
288 Ga0075368_10057272 3300006042 Bacteria 1556
289 Ga0075368_10117836 3300006042 Bacteria 1098
290 Ga0075368_10186706 3300006042 Bacteria 875
291 Ga0075363_100002972 3300006048 Bacteria 7076
292 Ga0075363_100101873 3300006048 Bacteria 1589
293 Ga0075363_100199888 3300006048 Bacteria 1142
294 Ga0075363_100274372 3300006048 Bacteria 974
295 Ga0075363_100516078 3300006048 Bacteria 711
296 Ga0075364_10027868 3300006051 Bacteria 3611
297 Ga0075364_10058333 3300006051 Bacteria 2530
298 Ga0075364_10205722 3300006051 Bacteria 1335
299 Ga0075364_10320528 3300006051 Bacteria 1055
300 Ga0075364_10371178 3300006051 Bacteria 976
301 Ga0070715_10001222 3300006163 Bacteria 7384
302 Ga0070715_10040865 3300006163 Bacteria 1941
303 Ga0070716_100023433 3300006173 Bacteria 3274
304 Ga0070716_100068726 3300006173 Bacteria 2073
305 Ga0070716_100405927 3300006173 Bacteria 981
306 Ga0070716_100443012 3300006173 Bacteria 945
307 Ga0070712_100009491 3300006175 Bacteria 6134
308 Ga0070712_100079979 3300006175 Bacteria 2364
309 Ga0070712_100114364 3300006175 Bacteria 2020
310 Ga0070712_100141178 3300006175 Bacteria 1838
311 Ga0070712_100212311 3300006175 Bacteria 1527
312 Ga0070712_100549527 3300006175 Bacteria 973
313 Ga0070712_100745083 3300006175 Bacteria 838
314 Ga0070712_100807331 3300006175 Bacteria 805
315 Ga0075362_10111361 3300006177 Bacteria 1289
316 Ga0075362_10195098 3300006177 Bacteria 984
317 Ga0075362_10246743 3300006177 Bacteria 878
318 Ga0075362_10318261 3300006177 Bacteria 774
319 Ga0075367_10026926 3300006178 Bacteria 3266
320 Ga0075367_10050636 3300006178 Bacteria 2453
321 Ga0075367_10165437 3300006178 Bacteria 1376
322 Ga0075367_10185763 3300006178 Bacteria 1296
323 Ga0075367_10437204 3300006178 Bacteria 829
324 Ga0075369_10030464 3300006186 Bacteria 2272
325 Ga0075369_10053362 3300006186 Bacteria 1754
326 Ga0075369_10057154 3300006186 Bacteria 1696
327 Ga0075369_10079997 3300006186 Bacteria 1448
328 Ga0075369_10161585 3300006186 Bacteria 1027
329 Ga0075366_10002189 3300006195 Bacteria 9977
330 Ga0075366_10075611 3300006195 Bacteria 2009
331 Ga0097621_100005281 3300006237 Bacteria 9095
332 Ga0097621_100046218 3300006237 Bacteria 3521
333 Ga0097621_100756708 3300006237 Bacteria 898
334 Ga0097621_101213849 3300006237 Bacteria 711
335 Ga0075370_10014282 3300006353 Bacteria 4235
336 Ga0075370_10046269 3300006353 Bacteria 2462
337 Ga0075370_10110178 3300006353 Bacteria 1598
338 Ga0075370_10239912 3300006353 Bacteria 1073
339 Ga0075370_10251878 3300006353 Bacteria 1047
340 Ga0075370_10254275 3300006353 Bacteria 1041
341 Ga0075370_10622119 3300006353 Bacteria 655
342 Ga0068871_100105507 3300006358 Bacteria 2364
343 Ga0068871_100130610 3300006358 Bacteria 2130
344 Ga0075433_10245834 3300006852 Bacteria 1588
345 Ga0075433_10527330 3300006852 Bacteria 1039
346 Ga0075434_100100279 3300006871 Bacteria 2902
347 Ga0075434_100119417 3300006871 Bacteria 2650
348 Ga0075434_100423347 3300006871 Bacteria 1353
349 Ga0068865_100077261 3300006881 Bacteria 2379
350 Ga0068865_100124039 3300006881 Bacteria 1925
351 Ga0068865_100504217 3300006881 Bacteria 1009
352 Ga0097620_100055594 3300006931 Bacteria 3983
353 Ga0097620_100113485 3300006931 Bacteria 2773
354 Ga0097620_100368689 3300006931 Bacteria 1531
355 Ga0097620_100529060 3300006931 Bacteria 1274
356 Ga0099825_1039686 3300006941 Bacteria 1433
357 Ga0099824_1004995 3300006942 Bacteria 18868
358 Ga0099822_1001207 3300006943 Bacteria 29221
359 Ga0099794_10024310 3300007265 Bacteria 2779
360 Ga0099794_10124935 3300007265 Bacteria 1297
361 Ga0099795_10034418 3300007788 Bacteria 1765
362 Ga0099795_10100085 3300007788 Bacteria 1136
363 Ga0099795_10141756 3300007788 Bacteria 978
364 Ga0105251_10130578 3300009011 Bacteria 1139
365 Ga0105251_10298853 3300009011 Bacteria 730
366 Ga0105250_10054952 3300009092 Bacteria 1598
367 Ga0105240_10007562 3300009093 Bacteria 15748
368 Ga0105240_10032680 3300009093 Bacteria 6734
369 Ga0105240_10069048 3300009093 Bacteria 4375
370 Ga0105240_10162542 3300009093 Bacteria 2651
371 Ga0105240_10218258 3300009093 Bacteria 2223
372 Ga0105240_10250981 3300009093 Bacteria 2046
373 Ga0105240_10321140 3300009093 Bacteria 1765
374 Ga0105240_10563251 3300009093 Bacteria 1259
375 Ga0111539_10394179 3300009094 Bacteria 1613
376 Ga0105245_10084813 3300009098 Bacteria 2903
377 Ga0105245_10740899 3300009098 Bacteria 1018
378 Ga0105245_10745722 3300009098 Bacteria 1015
379 Ga0105245_11097571 3300009098 Bacteria 842
380 Ga0105247_10034563 3300009101 Bacteria 3078
381 Ga0105247_10152729 3300009101 Bacteria 1523
382 Ga0105247_10213354 3300009101 Bacteria 1303
383 Ga0105247_10255145 3300009101 Bacteria 1200
384 Ga0105247_10260534 3300009101 Bacteria 1189
385 Ga0105247_10961168 3300009101 Bacteria 664
386 Ga0114129_10752504 3300009147 Bacteria 1247
387 Ga0105243_10222520 3300009148 Bacteria 1669
388 Ga0105243_10301176 3300009148 Bacteria 1453
389 Ga0105243_10673534 3300009148 Bacteria 1005
390 Ga0105243_11024974 3300009148 Bacteria 829
391 Ga0105241_10002823 3300009174 Bacteria 12985
392 Ga0105241_10037835 3300009174 Bacteria 3636
393 Ga0105241_10056298 3300009174 Bacteria 3015
394 Ga0105241_10091921 3300009174 Bacteria 2395
395 Ga0105241_10187570 3300009174 Bacteria 1719
396 Ga0105241_10301968 3300009174 Bacteria 1374
397 Ga0105242_10238466 3300009176 Bacteria 1634
398 Ga0105242_10240184 3300009176 Bacteria 1628
399 Ga0105242_11210465 3300009176 Bacteria 775
400 Ga0105248_10092104 3300009177 Bacteria 3413
401 Ga0105248_10363321 3300009177 Bacteria 1630
402 Ga0105248_10684713 3300009177 Bacteria 1157
403 Ga0105237_10003763 3300009545 Bacteria 17858
404 Ga0105237_10015975 3300009545 Bacteria 7806
405 Ga0105237_10041525 3300009545 Bacteria 4638
406 Ga0105237_10116175 3300009545 Bacteria 2669
407 Ga0105237_10154404 3300009545 Bacteria 2292
408 Ga0105237_10232636 3300009545 Bacteria 1844
409 Ga0105237_10283868 3300009545 Bacteria 1658
410 Ga0105237_10363991 3300009545 Bacteria 1450
411 Ga0105237_10431643 3300009545 Bacteria 1323
412 Ga0105238_10003292 3300009551 Bacteria 16138
413 Ga0105238_10028229 3300009551 Bacteria 5717
414 Ga0105238_10063611 3300009551 Bacteria 3690
415 Ga0105238_10067898 3300009551 Bacteria 3566
416 Ga0105238_10230198 3300009551 Bacteria 1830
417 Ga0105238_10285408 3300009551 Bacteria 1632
418 Ga0105238_10346394 3300009551 Bacteria 1474
419 Ga0105238_10353732 3300009551 Bacteria 1458
420 Ga0105238_10443881 3300009551 Bacteria 1294
421 Ga0105238_10450395 3300009551 Bacteria 1284
422 Ga0105238_10853638 3300009551 Bacteria 928
423 Ga0105238_11359110 3300009551 Bacteria 737
424 Ga0105249_10256296 3300009553 Bacteria 1736
425 Ga0105249_11302373 3300009553 Bacteria 798
426 Ga0105249_11330288 3300009553 Bacteria 790
427 Ga0099796_10001437 3300010159 Bacteria 4794
428 Ga0099796_10095654 3300010159 Bacteria 1110
429 Ga0099796_10170528 3300010159 Bacteria 868
430 Ga0105239_10008866 3300010375 Bacteria 11385
431 Ga0105239_10011356 3300010375 Bacteria 9936
432 Ga0105239_10086297 3300010375 Bacteria 3459
433 Ga0105239_10301128 3300010375 Bacteria 1806
434 Ga0105239_10314020 3300010375 Bacteria 1767
435 Ga0105239_10314283 3300010375 Bacteria 1766
436 Ga0105239_10335428 3300010375 Bacteria 1706
437 Ga0105239_10477319 3300010375 Bacteria 1416
438 Ga0105239_10605626 3300010375 Bacteria 1250
439 Ga0105239_10650730 3300010375 Bacteria 1204
440 Ga0105239_10706011 3300010375 Bacteria 1153
441 Ga0105239_10831249 3300010375 Bacteria 1059
442 Ga0105239_10924833 3300010375 Bacteria 1001
443 Ga0105246_10035926 3300011119 Bacteria 3315
444 Ga0105246_10157351 3300011119 Bacteria 1727
445 Ga0105246_10209134 3300011119 Bacteria 1522
446 Ga0105246_10641415 3300011119 Bacteria 923
447 Ga0105246_10894964 3300011119 Bacteria 795
448 Ga0105246_11716442 3300011119 Bacteria 597
449 Ga0157324_1005979 3300012506 Bacteria 900
450 Ga0157373_10034353 3300013100 Bacteria 3642
451 Ga0157371_10822979 3300013102 Bacteria 701
452 Ga0157370_10089286 3300013104 Bacteria 2895
453 Ga0157370_10138156 3300013104 Bacteria 2270
454 Ga0157370_10149133 3300013104 Bacteria 2177
455 Ga0157370_10387865 3300013104 Bacteria 1286
456 Ga0157370_10796504 3300013104 Bacteria 860
457 Ga0157369_10014541 3300013105 Bacteria 8880
458 Ga0157369_10092228 3300013105 Bacteria 3232
459 Ga0157369_10096129 3300013105 Bacteria 3161
460 Ga0157369_10098106 3300013105 Bacteria 3125
461 Ga0157369_10122600 3300013105 Bacteria 2757
462 Ga0157369_10503057 3300013105 Bacteria 1254
463 Ga0157369_11090462 3300013105 Bacteria 816
464 Ga0157369_11267428 3300013105 Bacteria 752
465 Ga0157374_10003265 3300013296 Bacteria 13623
466 Ga0157374_10232907 3300013296 Bacteria 1810
467 Ga0157374_10278484 3300013296 Bacteria 1651
468 Ga0157378_10125884 3300013297 Bacteria 2367
469 Ga0157378_10202070 3300013297 Bacteria 1880
470 Ga0163162_10087159 3300013306 Bacteria 3200
471 Ga0163162_10175710 3300013306 Bacteria 2267
472 Ga0163162_10776997 3300013306 Bacteria 1076
473 Ga0163162_11344740 3300013306 Bacteria 812
474 Ga0163162_11364441 3300013306 Bacteria 806
475 Ga0157372_10105097 3300013307 Bacteria 3230
476 Ga0157372_10289539 3300013307 Bacteria 1905
477 Ga0157372_10533287 3300013307 Bacteria 1368
478 Ga0157372_10715921 3300013307 Bacteria 1164
479 Ga0157372_10798483 3300013307 Bacteria 1097
480 Ga0157372_10975207 3300013307 Bacteria 982
481 Ga0157372_11294335 3300013307 Bacteria 841
482 Ga0157372_11304815 3300013307 Bacteria 838
483 Ga0157375_10026900 3300013308 Bacteria 5369
484 Ga0157375_10229758 3300013308 Bacteria 2014
485 Ga0157375_10476432 3300013308 Bacteria 1413
486 Ga0157375_10832461 3300013308 Bacteria 1070
487 Ga0163163_10052491 3300014325 Bacteria 4022
488 Ga0163163_10423706 3300014325 Bacteria 1390
489 Ga0163163_10697677 3300014325 Bacteria 1079
490 Ga0163163_11378748 3300014325 Bacteria 767
491 Ga0157380_10857415 3300014326 Bacteria 931
492 Ga0157380_11594667 3300014326 Bacteria 708
493 Ga0182008_10255591 3300014497 Bacteria 905
494 Ga0157379_11195695 3300014968 Bacteria 731
495 Ga0157376_10043730 3300014969 Bacteria 3677
496 Ga0157376_10049317 3300014969 Bacteria 3486
497 Ga0157376_10451447 3300014969 Bacteria 1254
498 Ga0157376_10704411 3300014969 Bacteria 1015
499 Ga0157376_10923548 3300014969 Bacteria 892
500 Ga0182007_10069713 3300015262 Bacteria 1152
501 Ga0163161_10189899 3300017792 Bacteria 1579
502 Ga0206352_10701083 3300020078 Bacteria 687
503 Ga0214544_1000056 3300021320 Bacteria 132760
504 Ga0214542_1000071 3300021321 Bacteria 124568
505 Ga0214545_1000033 3300021324 Bacteria 124568
506 Ga0214543_1000105 3300021327 Bacteria 108404
507 Ga0213873_10001574 3300021358 Bacteria 3811
508 Ga0213873_10007116 3300021358 Bacteria 2229
509 Ga0213874_10003476 3300021377 Bacteria 3497
510 Ga0213874_10077900 3300021377 Bacteria 1069
511 Ga0213876_10007380 3300021384 Bacteria 5978
512 Ga0213876_10125874 3300021384 Bacteria 1361
513 Ga0213871_10005961 3300021441 Bacteria 2550
514 Ga0209563_104671 3300025230 Bacteria 2588
515 Ga0207425_1019274 3300025245 Bacteria 1471
516 Ga0209677_100313 3300025253 Bacteria 31691
517 Ga0209677_104221 3300025253 Bacteria 4248
518 Ga0209148_1000308 3300025254 Bacteria 70131
519 Ga0209148_1011159 3300025254 Bacteria 1678
520 Ga0209233_1002747 3300025261 Bacteria 6335
521 Ga0209233_1004470 3300025261 Bacteria 4748
522 Ga0209233_1004898 3300025261 Bacteria 4502
523 Ga0209233_1010739 3300025261 Bacteria 2726
524 Ga0209455_1001786 3300025272 Bacteria 9080
525 Ga0209455_1002759 3300025272 Bacteria 6587
526 Ga0209455_1004855 3300025272 Bacteria 4287
527 Ga0209673_1020468 3300025273 Bacteria 2341
528 Ga0209564_1000747 3300025295 Bacteria 46025
529 Ga0209564_1003448 3300025295 Bacteria 10811
530 Ga0209564_1006612 3300025295 Bacteria 6206
531 Ga0209758_1000182 3300025297 Bacteria 140630
532 Ga0209758_1000293 3300025297 Bacteria 98643
533 Ga0209758_1000363 3300025297 Bacteria 80753
534 Ga0209758_1003509 3300025297 Bacteria 14159
535 Ga0209758_1003517 3300025297 Bacteria 14133
536 Ga0209758_1006314 3300025297 Bacteria 8605
537 Ga0209758_1011615 3300025297 Bacteria 5070
538 Ga0209758_1011704 3300025297 Bacteria 5039
539 Ga0209758_1032984 3300025297 Bacteria 2090
540 Ga0209758_1038054 3300025297 Bacteria 1850
541 Ga0209256_1008893 3300025299 Bacteria 4533
542 Ga0209256_1061560 3300025299 Bacteria 872
543 Ga0209256_1101099 3300025299 Bacteria 596
544 Ga0207426_1000628 3300025302 Bacteria 44820
545 Ga0207426_1000992 3300025302 Bacteria 27820
546 Ga0207426_1004958 3300025302 Bacteria 6274
547 Ga0207426_1006404 3300025302 Bacteria 5129
548 Ga0209051_1066456 3300025303 Bacteria 1107
549 Ga0207697_10197271 3300025315 Bacteria 885
550 Ga0207656_10009014 3300025321 Bacteria 3698
551 Ga0207696_1064733 3300025711 Bacteria 1024
552 Ga0207653_10092156 3300025885 Bacteria 1062
553 Ga0207692_10001137 3300025898 Bacteria 9787
554 Ga0207692_10010103 3300025898 Bacteria 3965
555 Ga0207692_10013707 3300025898 Bacteria 3523
556 Ga0207692_10264037 3300025898 Bacteria 1036
557 Ga0207642_10332300 3300025899 Bacteria 891
558 Ga0207710_10042271 3300025900 Bacteria 2024
559 Ga0207710_10078848 3300025900 Bacteria 1524
560 Ga0207710_10137713 3300025900 Bacteria 1177
561 Ga0207710_10156366 3300025900 Bacteria 1108
562 Ga0207710_10188126 3300025900 Bacteria 1016
563 Ga0207688_10012485 3300025901 Bacteria 4623
564 Ga0207688_10068049 3300025901 Bacteria 2016
565 Ga0207688_10072092 3300025901 Bacteria 1962
566 Ga0207688_10220535 3300025901 Bacteria 1142
567 Ga0207680_10099180 3300025903 Bacteria 1868
568 Ga0207680_10116114 3300025903 Bacteria 1744
569 Ga0207680_10146184 3300025903 Bacteria 1572
570 Ga0207680_10160065 3300025903 Bacteria 1508
571 Ga0207647_10006453 3300025904 Bacteria 8524
572 Ga0207647_10099975 3300025904 Bacteria 1722
573 Ga0207685_10026807 3300025905 Bacteria 2009
574 Ga0207685_10038670 3300025905 Bacteria 1765
575 Ga0207699_10000995 3300025906 Bacteria 13422
576 Ga0207699_10017718 3300025906 Bacteria 3758
577 Ga0207699_10066296 3300025906 Bacteria 2191
578 Ga0207699_10133590 3300025906 Bacteria 1622
579 Ga0207699_10691017 3300025906 Bacteria 746
580 Ga0207645_10278514 3300025907 Bacteria 1110
581 Ga0207645_10701827 3300025907 Bacteria 688
582 Ga0207643_10021166 3300025908 Bacteria 3571
583 Ga0207643_10251924 3300025908 Bacteria 1088
584 Ga0207705_10151296 3300025909 Bacteria 1739
585 Ga0207705_10461067 3300025909 Bacteria 986
586 Ga0207654_10000250 3300025911 Bacteria 32514
587 Ga0207654_10020214 3300025911 Bacteria 3526
588 Ga0207654_10024384 3300025911 Bacteria 3251
589 Ga0207654_10069183 3300025911 Bacteria 2091
590 Ga0207654_10110387 3300025911 Bacteria 1710
591 Ga0207654_10223849 3300025911 Bacteria 1249
592 Ga0207707_10000526 3300025912 Bacteria 39289
593 Ga0207707_10001497 3300025912 Bacteria 21565
594 Ga0207707_10034652 3300025912 Bacteria 4417
595 Ga0207707_10125242 3300025912 Bacteria 2247
596 Ga0207707_10352931 3300025912 Bacteria 1267
597 Ga0207707_10464788 3300025912 Bacteria 1082
598 Ga0207695_10000107 3300025913 Bacteria 252606
599 Ga0207695_10000479 3300025913 Bacteria 85874
600 Ga0207695_10001357 3300025913 Bacteria 41521
601 Ga0207695_10005090 3300025913 Bacteria 17617
602 Ga0207695_10048603 3300025913 Bacteria 4479
603 Ga0207695_10089217 3300025913 Bacteria 3101
604 Ga0207695_10090447 3300025913 Bacteria 3076
605 Ga0207695_10217187 3300025913 Bacteria 1820
606 Ga0207671_10004749 3300025914 Bacteria 12824
607 Ga0207671_10041272 3300025914 Bacteria 3415
608 Ga0207671_10091185 3300025914 Bacteria 2296
609 Ga0207671_10094823 3300025914 Bacteria 2252
610 Ga0207671_10097153 3300025914 Bacteria 2227
611 Ga0207671_10125116 3300025914 Bacteria 1968
612 Ga0207671_10172137 3300025914 Bacteria 1682
613 Ga0207671_10253575 3300025914 Bacteria 1383
614 Ga0207671_10306080 3300025914 Bacteria 1256
615 Ga0207693_10000156 3300025915 Bacteria 63230
616 Ga0207693_10009900 3300025915 Bacteria 7752
617 Ga0207693_10046531 3300025915 Bacteria 3408
618 Ga0207693_10183839 3300025915 Bacteria 1645
619 Ga0207693_10336257 3300025915 Bacteria 1182
620 Ga0207693_10483784 3300025915 Bacteria 967
621 Ga0207693_10541136 3300025915 Bacteria 908
622 Ga0207663_10000158 3300025916 Bacteria 31459
623 Ga0207663_10010958 3300025916 Bacteria 4846
624 Ga0207663_10085686 3300025916 Bacteria 2075
625 Ga0207663_10356544 3300025916 Bacteria 1108
626 Ga0207663_10366692 3300025916 Bacteria 1094
627 Ga0207663_10517897 3300025916 Bacteria 928
628 Ga0207660_10005316 3300025917 Bacteria 8367
629 Ga0207660_10091304 3300025917 Bacteria 2258
630 Ga0207660_10153953 3300025917 Bacteria 1769
631 Ga0207662_10313203 3300025918 Bacteria 1046
632 Ga0207657_10004389 3300025919 Bacteria 14926
633 Ga0207657_10011015 3300025919 Bacteria 8988
634 Ga0207657_10035461 3300025919 Bacteria 4473
635 Ga0207657_10310633 3300025919 Bacteria 1248
636 Ga0207657_10365074 3300025919 Bacteria 1138
637 Ga0207657_10530153 3300025919 Bacteria 921
638 Ga0207657_10532778 3300025919 Bacteria 919
639 Ga0207649_10156713 3300025920 Bacteria 1574
640 Ga0207649_10366818 3300025920 Bacteria 1070
641 Ga0207649_10654935 3300025920 Bacteria 812
642 Ga0207652_10001692 3300025921 Bacteria 19294
643 Ga0207652_10032926 3300025921 Bacteria 4362
644 Ga0207652_10146914 3300025921 Bacteria 2110
645 Ga0207652_10213035 3300025921 Bacteria 1740
646 Ga0207652_10463384 3300025921 Bacteria 1142
647 Ga0207681_10108510 3300025923 Bacteria 2015
648 Ga0207681_10492688 3300025923 Bacteria 1002
649 Ga0207694_10000662 3300025924 Bacteria 31000
650 Ga0207694_10009782 3300025924 Bacteria 7236
651 Ga0207694_10016406 3300025924 Bacteria 5592
652 Ga0207694_10055826 3300025924 Bacteria 3066
653 Ga0207694_10163266 3300025924 Bacteria 1800
654 Ga0207694_10206586 3300025924 Bacteria 1599
655 Ga0207694_10213773 3300025924 Bacteria 1571
656 Ga0207694_10273247 3300025924 Bacteria 1387
657 Ga0207694_10596093 3300025924 Bacteria 929
658 Ga0207687_10021258 3300025927 Bacteria 4310
659 Ga0207687_10021407 3300025927 Bacteria 4296
660 Ga0207687_10124497 3300025927 Bacteria 1933
661 Ga0207687_10793184 3300025927 Bacteria 808
662 Ga0207700_10013486 3300025928 Bacteria 5321
663 Ga0207700_10062912 3300025928 Bacteria 2820
664 Ga0207700_10148802 3300025928 Bacteria 1933
665 Ga0207700_10255803 3300025928 Bacteria 1498
666 Ga0207700_10261752 3300025928 Bacteria 1481
667 Ga0207700_10608878 3300025928 Bacteria 972
668 Ga0207700_11162551 3300025928 Bacteria 689
669 Ga0207664_10023882 3300025929 Bacteria 4588
670 Ga0207664_10056391 3300025929 Bacteria 3120
671 Ga0207664_10066338 3300025929 Bacteria 2893
672 Ga0207664_10135284 3300025929 Bacteria 2079
673 Ga0207664_10176417 3300025929 Bacteria 1832
674 Ga0207664_10304874 3300025929 Bacteria 1402
675 Ga0207644_10093046 3300025931 Bacteria 2250
676 Ga0207644_10103533 3300025931 Bacteria 2142
677 Ga0207644_10607570 3300025931 Bacteria 908
678 Ga0207644_10901776 3300025931 Bacteria 741
679 Ga0207690_10250673 3300025932 Bacteria 1367
680 Ga0207690_10338842 3300025932 Bacteria 1186
681 Ga0207690_10788357 3300025932 Bacteria 785
682 Ga0207690_10844335 3300025932 Bacteria 758
683 Ga0207706_10031400 3300025933 Bacteria 4732
684 Ga0207706_10178663 3300025933 Bacteria 1864
685 Ga0207706_10250133 3300025933 Bacteria 1548
686 Ga0207706_10294975 3300025933 Bacteria 1413
687 Ga0207706_10394640 3300025933 Bacteria 1200
688 Ga0207706_10523192 3300025933 Bacteria 1023
689 Ga0207686_10141777 3300025934 Bacteria 1662
690 Ga0207686_10301473 3300025934 Bacteria 1190
691 Ga0207686_10552874 3300025934 Bacteria 900
692 Ga0207709_10108534 3300025935 Bacteria 1851
693 Ga0207709_10232503 3300025935 Bacteria 1336
694 Ga0207670_10042390 3300025936 Bacteria 2998
695 Ga0207669_10097050 3300025937 Bacteria 1937
696 Ga0207669_10176913 3300025937 Bacteria 1525
697 Ga0207669_10411326 3300025937 Bacteria 1062
698 Ga0207669_10655678 3300025937 Bacteria 859
699 Ga0207704_10040225 3300025938 Bacteria 2730
700 Ga0207704_10104493 3300025938 Bacteria 1897
701 Ga0207704_10161752 3300025938 Bacteria 1594
702 Ga0207704_10976450 3300025938 Bacteria 715
703 Ga0207665_10000767 3300025939 Bacteria 21619
704 Ga0207665_10085667 3300025939 Bacteria 2176
705 Ga0207665_10160132 3300025939 Bacteria 1618
706 Ga0207665_10166950 3300025939 Bacteria 1587
707 Ga0207665_10545960 3300025939 Bacteria 900
708 Ga0207665_10926395 3300025939 Bacteria 692
709 Ga0207691_10359523 3300025940 Bacteria 1245
710 Ga0207691_10736296 3300025940 Bacteria 830
711 Ga0207711_10040386 3300025941 Bacteria 3970
712 Ga0207711_10051750 3300025941 Bacteria 3518
713 Ga0207711_10145914 3300025941 Bacteria 2132
714 Ga0207711_10623864 3300025941 Bacteria 1006
715 Ga0207689_10120540 3300025942 Bacteria 2158
716 Ga0207689_10300753 3300025942 Bacteria 1330
717 Ga0207661_10000579 3300025944 Bacteria 23347
718 Ga0207661_10154209 3300025944 Bacteria 1988
719 Ga0207661_10163164 3300025944 Bacteria 1934
720 Ga0207679_10035086 3300025945 Bacteria 3545
721 Ga0207679_10590918 3300025945 Bacteria 999
722 Ga0207679_10735724 3300025945 Bacteria 896
723 Ga0207679_11461799 3300025945 Bacteria 627
724 Ga0207667_10003118 3300025949 Bacteria 20511
725 Ga0207667_10004639 3300025949 Bacteria 16858
726 Ga0207667_10006730 3300025949 Bacteria 13883
727 Ga0207667_10040447 3300025949 Bacteria 4964
728 Ga0207667_10075301 3300025949 Bacteria 3505
729 Ga0207667_10122850 3300025949 Bacteria 2675
730 Ga0207667_10146401 3300025949 Bacteria 2432
731 Ga0207667_10192016 3300025949 Bacteria 2095
732 Ga0207667_10233206 3300025949 Bacteria 1884
733 Ga0207667_10252241 3300025949 Bacteria 1805
734 Ga0207667_10707297 3300025949 Bacteria 1010
735 Ga0207667_10946284 3300025949 Bacteria 851
736 Ga0207651_10104110 3300025960 Bacteria 2114
737 Ga0207651_11315938 3300025960 Bacteria 650
738 Ga0207712_10041791 3300025961 Bacteria 3153
739 Ga0207712_10140275 3300025961 Bacteria 1854
740 Ga0207712_10281049 3300025961 Bacteria 1358
741 Ga0207668_10075087 3300025972 Bacteria 2429
742 Ga0207668_10183978 3300025972 Bacteria 1650
743 Ga0207668_10274955 3300025972 Bacteria 1378
744 Ga0207668_10284939 3300025972 Bacteria 1356
745 Ga0207668_10540088 3300025972 Bacteria 1008
746 Ga0207640_10002370 3300025981 Bacteria 10102
747 Ga0207640_10170523 3300025981 Bacteria 1621
748 Ga0207640_10236314 3300025981 Bacteria 1409
749 Ga0207640_10326692 3300025981 Bacteria 1223
750 Ga0207640_10390890 3300025981 Bacteria 1130
751 Ga0207640_10799079 3300025981 Bacteria 817
752 Ga0207658_10365279 3300025986 Bacteria 1260
753 Ga0207658_11142151 3300025986 Bacteria 712
754 Ga0207677_10015264 3300026023 Bacteria 4511
755 Ga0207677_10483441 3300026023 Bacteria 1067
756 Ga0207677_10755698 3300026023 Bacteria 867
757 Ga0207703_10030990 3300026035 Bacteria 4228
758 Ga0207703_10109467 3300026035 Bacteria 2355
759 Ga0207703_10178944 3300026035 Bacteria 1870
760 Ga0207703_10434506 3300026035 Bacteria 1224
761 Ga0207703_10473550 3300026035 Bacteria 1173
762 Ga0207703_11016565 3300026035 Bacteria 795
763 Ga0207639_10011004 3300026041 Bacteria 6272
764 Ga0207639_10126847 3300026041 Bacteria 2106
765 Ga0207639_10181091 3300026041 Bacteria 1792
766 Ga0207639_10181850 3300026041 Bacteria 1789
767 Ga0207639_10269308 3300026041 Bacteria 1493
768 Ga0207639_10545268 3300026041 Bacteria 1064
769 Ga0207639_10639565 3300026041 Bacteria 983
770 Ga0207639_10690944 3300026041 Bacteria 946
771 Ga0207678_10004742 3300026067 Bacteria 12216
772 Ga0207678_10005908 3300026067 Bacteria 10905
773 Ga0207678_10027619 3300026067 Bacteria 4952
774 Ga0207678_10034302 3300026067 Bacteria 4420
775 Ga0207678_10045103 3300026067 Bacteria 3812
776 Ga0207678_10183024 3300026067 Bacteria 1789
777 Ga0207678_10281965 3300026067 Bacteria 1426
778 Ga0207678_10354436 3300026067 Bacteria 1266
779 Ga0207678_10708466 3300026067 Bacteria 886
780 Ga0207708_10103418 3300026075 Bacteria 2206
781 Ga0207708_10479217 3300026075 Bacteria 1040
782 Ga0207702_10000004 3300026078 Bacteria 422182
783 Ga0207702_10000350 3300026078 Bacteria 52867
784 Ga0207702_10127898 3300026078 Bacteria 2283
785 Ga0207702_10328969 3300026078 Bacteria 1457
786 Ga0207702_10625072 3300026078 Bacteria 1058
787 Ga0207702_10972214 3300026078 Bacteria 842
788 Ga0207641_10309494 3300026088 Bacteria 1495
789 Ga0207641_10401860 3300026088 Bacteria 1315
790 Ga0207641_10687156 3300026088 Bacteria 1007
791 Ga0207648_10322652 3300026089 Bacteria 1388
792 Ga0207676_10325356 3300026095 Bacteria 1413
793 Ga0207676_10547084 3300026095 Bacteria 1105
794 Ga0207676_10941712 3300026095 Bacteria 849
795 Ga0207674_10002413 3300026116 Bacteria 23592
796 Ga0207674_10003431 3300026116 Bacteria 19400
797 Ga0207674_10027875 3300026116 Bacteria 5967
798 Ga0207674_10137096 3300026116 Bacteria 2408
799 Ga0207674_10231139 3300026116 Bacteria 1797
800 Ga0207674_10309256 3300026116 Bacteria 1529
801 Ga0207674_10430133 3300026116 Bacteria 1276
802 Ga0207674_10667099 3300026116 Bacteria 1004
803 Ga0207675_100393016 3300026118 Bacteria 1365
804 Ga0207675_100488708 3300026118 Bacteria 1224
805 Ga0207675_100520210 3300026118 Bacteria 1186
806 Ga0207683_10019572 3300026121 Bacteria 5781
807 Ga0207683_10106094 3300026121 Bacteria 2512
808 Ga0207683_10195500 3300026121 Bacteria 1838
809 Ga0207683_10499216 3300026121 Bacteria 1124
810 Ga0207683_10594973 3300026121 Bacteria 1024
811 Ga0207698_10072550 3300026142 Bacteria 2737
812 Ga0207698_10400702 3300026142 Bacteria 1311
813 Ga0207698_10448893 3300026142 Bacteria 1244
814 Ga0207698_10875539 3300026142 Bacteria 904
815 Ga0207698_10933570 3300026142 Bacteria 876
816 Ga0207698_12036979 3300026142 Bacteria 588
817 Ga0209389_1000208 3300027296 Bacteria 42287
818 Ga0209389_1000217 3300027296 Bacteria 39758
819 Ga0209589_1000032 3300027357 Bacteria 141881
820 Ga0209589_1000046 3300027357 Bacteria 118780
821 Ga0209489_100106 3300027361 Bacteria 118780
822 Ga0209489_101970 3300027361 Bacteria 42287
823 Ga0209489_102214 3300027361 Bacteria 39758
824 Ga0209700_100011 3300027363 Bacteria 362159
825 Ga0209700_100105 3300027363 Bacteria 118780
826 Ga0209588_1022329 3300027671 Bacteria 1991
827 Ga0209813_10024260 3300027866 Bacteria 1733
828 Ga0209813_10076547 3300027866 Bacteria 1098
829 Ga0207428_10081696 3300027907 Bacteria 2523
830 Ga0207428_10158335 3300027907 Bacteria 1721
831 Ga0268266_10001794 3300028379 Bacteria 24326
832 Ga0268266_10003485 3300028379 Bacteria 15669
833 Ga0268266_10052016 3300028379 Bacteria 3516
834 Ga0268266_10080260 3300028379 Bacteria 2842
835 Ga0268266_10157851 3300028379 Bacteria 2050
836 Ga0268266_10273320 3300028379 Bacteria 1569
837 Ga0268266_10323404 3300028379 Bacteria 1444
838 Ga0268266_10434976 3300028379 Bacteria 1245
839 Ga0268266_10459317 3300028379 Bacteria 1211
840 Ga0268266_10635027 3300028379 Bacteria 1027
841 Ga0268266_10897475 3300028379 Bacteria 857
842 Ga0268266_11144245 3300028379 Bacteria 753
843 Ga0268265_10031179 3300028380 Bacteria 3848
844 Ga0268265_10035766 3300028380 Bacteria 3632
845 Ga0268265_10098352 3300028380 Bacteria 2356
846 Ga0268265_10499866 3300028380 Bacteria 1145
847 Ga0268265_10717526 3300028380 Bacteria 967
848 Ga0268265_11088052 3300028380 Bacteria 793
849 Ga0268264_10000227 3300028381 Bacteria 109454
850 Ga0268264_10146612 3300028381 Bacteria 2111
851 Ga0265319_1075277 3300028563 Bacteria 1077
852 Ga0265334_10005796 3300028573 Bacteria 5381
853 Ga0265318_10024584 3300028577 Bacteria 2388
854 Ga0265323_10001243 3300028653 Bacteria 12808
855 Ga0307517_10000748 3300028786 Bacteria 56107
856 Ga0307517_10247128 3300028786 Bacteria 1051
857 Ga0307517_10311345 3300028786 Bacteria 877
858 Ga0307515_10033584 3300028794 Bacteria 8437
859 Ga0307515_10549312 3300028794 Bacteria 765
860 Ga0265338_10000277 3300028800 Bacteria 93095
861 Ga0265338_10380167 3300028800 Bacteria 1010
862 Ga0265324_10032056 3300029957 Bacteria 1838
863 Ga0307511_10119296 3300030521 Bacteria 1639
864 Ga0307511_10321736 3300030521 Bacteria 683
865 Ga0307512_10180268 3300030522 Bacteria 1189
866 Ga0265770_1059654 3300030878 Bacteria 707
867 Ga0265760_10043486 3300031090 Bacteria 1343
868 Ga0265332_10050779 3300031238 Bacteria 1782
869 Ga0265328_10068047 3300031239 Bacteria 1308
870 Ga0265325_10016892 3300031241 Bacteria 4069
871 Ga0265340_10030891 3300031247 Bacteria 2683
872 Ga0265340_10155031 3300031247 Bacteria 1042
873 Ga0265339_10000971 3300031249 Bacteria 21969
874 Ga0265339_10154419 3300031249 Bacteria 1158
875 Ga0265339_10212781 3300031249 Bacteria 949
876 Ga0265339_10219204 3300031249 Bacteria 931
877 Ga0265339_10226465 3300031249 Bacteria 912
878 Ga0265316_10193756 3300031344 Bacteria 1509
879 Ga0307513_10104424 3300031456 Bacteria 2847
880 Ga0307513_10411605 3300031456 Bacteria 1084
881 Ga0307509_10109929 3300031507 Bacteria 2764
882 Ga0307509_10327048 3300031507 Bacteria 1266
883 Ga0307509_10338960 3300031507 Bacteria 1231
884 Ga0307509_10457314 3300031507 Bacteria 969
885 Ga0307408_100239629 3300031548 Bacteria 1490
886 Ga0307408_100926523 3300031548 Bacteria 799
887 Ga0265313_10105838 3300031595 Bacteria 1243
888 Ga0307508_10000002 3300031616 Bacteria 407635
889 Ga0307508_10069065 3300031616 Bacteria 3104
890 Ga0307508_10122470 3300031616 Bacteria 2203
891 Ga0307508_10277054 3300031616 Bacteria 1271
892 Ga0307514_10349235 3300031649 Bacteria 790
893 Ga0265314_10002643 3300031711 Bacteria 18036
894 Ga0265342_10025508 3300031712 Bacteria 3714
895 Ga0265342_10296689 3300031712 Bacteria 852
896 Ga0307516_10010347 3300031730 Bacteria 10269
897 Ga0307516_10057865 3300031730 Bacteria 3775
898 Ga0307516_10080348 3300031730 Bacteria 3104
899 Ga0307516_10194781 3300031730 Bacteria 1750
900 Ga0307516_10206258 3300031730 Bacteria 1682
901 Ga0307516_10254949 3300031730 Bacteria 1447
902 Ga0307516_10368644 3300031730 Bacteria 1099
903 Ga0307405_10397902 3300031731 Bacteria 1077
904 Ga0307405_10480557 3300031731 Bacteria 992
905 Ga0307405_10524171 3300031731 Bacteria 954
906 Ga0307413_10131084 3300031824 Bacteria 1716
907 Ga0307518_10446350 3300031838 Bacteria 695
908 Ga0307406_10300621 3300031901 Bacteria 1233
909 Ga0307406_10833496 3300031901 Bacteria 781
910 Ga0307407_11008579 3300031903 Bacteria 643
911 Ga0307412_10047890 3300031911 Bacteria 2809
912 Ga0307412_10212569 3300031911 Bacteria 1477
913 Ga0307412_10611833 3300031911 Bacteria 924
914 Ga0307409_100719317 3300031995 Bacteria 999
915 Ga0307409_101144653 3300031995 Bacteria 800
916 Ga0307409_101680384 3300031995 Bacteria 664
917 Ga0307416_100286049 3300032002 Bacteria 1629
918 Ga0307416_101286121 3300032002 Bacteria 837
919 Ga0307411_10043818 3300032005 Bacteria 2865
920 Ga0307411_10356706 3300032005 Bacteria 1194
921 Ga0307415_100120643 3300032126 Bacteria 1965
922 Ga0307415_100409367 3300032126 Bacteria 1160
923 Ga0307415_100459188 3300032126 Bacteria 1103
924 Ga0307415_101066138 3300032126 Bacteria 755
925 Ga0307507_10019880 3300033179 Bacteria 7544
926 Ga0307510_10006388 3300033180 Bacteria 14055
927 Ga0307510_10060535 3300033180 Bacteria 3895
928 Ga0307510_10098029 3300033180 Bacteria 2737
929 Ga0307510_10158713 3300033180 Bacteria 1863
930 Ga0307510_10263364 3300033180 Bacteria 1204
931 Ga0307510_10351245 3300033180 Bacteria 925
932 Ga0373926_0204760 3300035083 Bacteria 760
933 Ga0373929_0013219 3300035085 Bacteria 1580
934 Ga0373934_0403326 3300035086 Bacteria 571
935 Ga0373952_0036440 3300035092 Bacteria 1118
936 Ga0373936_0175848 3300035113 Bacteria 937
937 Ga0373941_0051773 3300035115 Bacteria 1308
938 Ga0373945_0012397 3300035116 Bacteria 2831
939 Ga0373953_0003462 3300035117 Bacteria 4921
940 Ga0373953_0020246 3300035117 Bacteria 2485
941 Ga0373954_0022141 3300035118 Bacteria 2881
942 Ga0373956_0021820 3300035119 Bacteria 2733
943 Ga0373960_0083787 3300035121 Bacteria 1009
944 Ga0373943_0166696 3300035170 Bacteria 1203
945 Ga0373946_0015222 3300035171 Bacteria 2913
946 Ga0373946_0059994 3300035171 Bacteria 1616
947 Ga0373946_0082896 3300035171 Bacteria 1407
948 Ga0373955_0355612 3300035172 Bacteria 887
949 Ga0373942_0087315 3300035207 Bacteria 935
950 Ga0373942_0093267 3300035207 Bacteria 910
951 Ga0373924_0012332 3300035410 Bacteria 3191
952 Ga0373924_0339503 3300035410 Bacteria 669
953 Ga0373931_0021852 3300035691 Bacteria 3214
954 Ga0373931_0459360 3300035691 Bacteria 816
955 Ga0373931_0590294 3300035691 Bacteria 725
956 Ga0373935_0195807 3300035692 Bacteria 1394
957 Ga0373935_0413105 3300035692 Bacteria 970
958 Ga0373935_0483323 3300035692 Bacteria 898
959 Ga0373935_0614193 3300035692 Bacteria 796
960 Ga0373927_0009105 3300035695 Bacteria 6662
961 Ga0373927_0031979 3300035695 Bacteria 3427
962 Ga0373927_0080808 3300035695 Bacteria 2106
963 Ga0373927_0184881 3300035695 Bacteria 1367
964 Ga0373927_0571068 3300035695 Bacteria 747
965 Ga0373933_0000698 3300035724 Bacteria 20659
966 Ga0373947_0063009 3300035725 Bacteria 2258
967 Ga0373947_0110883 3300035725 Bacteria 1733
968 Ga0373947_0663986 3300035725 Bacteria 711
969 Ga0373937_1502319 3300036401 Bacteria 621
970 Ga0373925_0068982 3300037068 Bacteria 2670
971 Ga0373925_0071521 3300037068 Bacteria 2624
972 Ga0373925_0074104 3300037068 Bacteria 2578
973 Ga0373925_0105854 3300037068 Bacteria 2168
974 Ga0373925_0113109 3300037068 Bacteria 2099
975 Ga0373925_0348751 3300037068 Bacteria 1202
976 Ga0373925_0400676 3300037068 Bacteria 1119
977 Ga0373925_0863353 3300037068 Bacteria 746
978 Ga0395899_0090738 3300037312 Bacteria 2215
979 Ga0395899_0611421 3300037312 Bacteria 693
980 Ga0395900_0001316 3300037418 Bacteria 30150
981 Ga0395900_0093150 3300037418 Bacteria 3095
982 Ga0395900_0196580 3300037418 Bacteria 2043
983 Ga0395900_1203688 3300037418 Bacteria 673
984 Ga0395898_0010275 3300037466 Bacteria 9797
985 Ga0395898_0094798 3300037466 Bacteria 2868
986 Ga0395898_0293021 3300037466 Bacteria 1552
987 Ga0395898_0821870 3300037466 Bacteria 869
988 Ga0395905_0032556 3300037471 Bacteria 4903
989 Ga0395905_0100478 3300037471 Bacteria 2716
990 Ga0395905_0583893 3300037471 Bacteria 1019
991 Ga0395905_0584936 3300037471 Bacteria 1018
992 Ga0436364_0479711 3300037853 Bacteria 1525
993 Ga0395901_0002762 3300038443 Bacteria 17695
994 Ga0395901_0024984 3300038443 Bacteria 6132
995 Ga0395901_0428126 3300038443 Bacteria 1356
996 Ga0395901_0681119 3300038443 Bacteria 1028
997 Ga0436365_0115121 3300039437 Bacteria 3034
998 Ga0436365_0758504 3300039437 Bacteria 12855
999 Ga0436365_0852398 3300039437 Bacteria 1509
1000 Ga0436365_1046572 3300039437 Bacteria 1742
1001 Ga0436365_1677482 3300039437 Bacteria 1688
1002 Ga0436365_1928398 3300039437 Bacteria 1915
1003 Ga0436360_0118011 3300039438 Bacteria 982
1004 Ga0436360_0578760 3300039438 Bacteria 3555
1005 Ga0436360_0758305 3300039438 Bacteria 899
1006 Ga0436361_0310662 3300039447 Bacteria 631
1007 Ga0436361_0944908 3300039447 Bacteria 1757
1008 Ga0436363_0519627 3300039450 Bacteria 1750
1009 Ga0436363_0768792 3300039450 Bacteria 1870
1010 Ga0436363_1259985 3300039450 Bacteria 767
1011 Ga0436363_1333239 3300039450 Bacteria 674
1012 Ga0436362_0646312 3300039453 Bacteria 4312
1013 Ga0436362_0683872 3300039453 Bacteria 1478
1014 Ga0436362_1179571 3300039453 Bacteria 864
1015 Ga0439465_0044053 3300041413 Bacteria 1449
1016 Ga0439465_0305056 3300041413 Bacteria 596
1017 Ga0451787_690731 3300041441 Bacteria 633
1018 Ga0451789_0739197 3300041443 Bacteria 782
1019 Ga0451802_1371081 3300041460 Bacteria 760
1020 Ga0451804_0892439 3300041463 Bacteria 733
1021 Ga0451835_0832063 3300041492 Bacteria 1673
1022 Ga0451837_1147329 3300041494 Bacteria 751
1023 Ga0451841_1120699 3300041498 Bacteria 928
1024 Ga0451847_0064418 3300041503 Bacteria 651
1025 Ga0451849_1286864 3300041505 Bacteria 609
1026 Ga0451855_0776935 3300041511 Bacteria 801
1027 Ga0451853_0660391 3300041512 Bacteria 1135
1028 Ga0439431_0086864 3300041997 Bacteria 849
1029 Ga0439432_062685 3300042006 Bacteria 1144
1030 Ga0439455_0115184 3300042012 Bacteria 750
1031 Ga0439459_0010127 3300042438 Bacteria 1639
1032 Ga0466969_0051658 3300044656 Bacteria 2022
1033 Ga0466969_0161890 3300044656 Bacteria 1028
1034 Ga0466969_0233157 3300044656 Bacteria 836
1035 Ga0466972_0000233 3300044658 Bacteria 38493
1036 Ga0466972_0159983 3300044658 Bacteria 1058
1037 Ga0466965_0036463 3300044683 Bacteria 2412
1038 Ga0466965_0310190 3300044683 Bacteria 858
1039 Ga0466966_0002503 3300044684 Bacteria 12045
1040 Ga0466966_0034745 3300044684 Bacteria 3259
1041 Ga0466961_0082983 3300044693 Bacteria 2027
1042 Ga0466963_0244298 3300044694 Bacteria 1259
1043 Ga0466963_0547362 3300044694 Bacteria 817
1044 Ga0466964_0085037 3300044706 Bacteria 1365
1045 Ga0466964_0095512 3300044706 Bacteria 1301
1046 Ga0466971_0197001 3300044719 Bacteria 950
1047 Ga0466968_0039562 3300044735 Bacteria 1985
1048 Ga0466968_0137252 3300044735 Bacteria 1116
1049 Ga0466968_0151835 3300044735 Bacteria 1065
1050 Ga0466968_0262932 3300044735 Bacteria 822
1051 Ga0466970_0198420 3300044765 Bacteria 1116
1052 Ga0466970_0475710 3300044765 Bacteria 718
1053 Ga0466957_0100843 3300044842 Bacteria 1820
1054 Ga0466957_0114068 3300044842 Bacteria 1716
1055 Ga0466960_0007069 3300044901 Bacteria 4538
1056 Ga0466960_0194318 3300044901 Bacteria 1106
1057 Ga0466959_0002845 3300045049 Bacteria 11154
1058 Ga0466959_0116366 3300045049 Bacteria 1904
1059 Ga0466959_0137990 3300045049 Bacteria 1725
1060 Ga0466959_0400247 3300045049 Bacteria 933
1061 Ga0466958_0216963 3300045836 Bacteria 1220
1062 Ga0466958_0619762 3300045836 Bacteria 704
1063 Ga0466967_0011377 3300045976 Bacteria 6736
1064 Ga0466967_0041810 3300045976 Bacteria 3956
1065 Ga0466967_0244800 3300045976 Bacteria 1711
1066 Ga0466967_0382066 3300045976 Bacteria 1367
1067 Ga0466967_1828536 3300045976 Bacteria 604
1068 Ga0495617_044432 3300046452 Bacteria 1482
1069 Ga0495592_0008192 3300046454 Bacteria 7850
1070 Ga0495592_0316684 3300046454 Bacteria 1009
1071 Ga0495603_0003601 3300046455 Bacteria 9207
1072 Ga0495603_0034333 3300046455 Bacteria 3049
1073 Ga0495603_0067820 3300046455 Bacteria 2099
1074 Ga0495603_0074844 3300046455 Bacteria 1988
1075 Ga0495603_0117159 3300046455 Bacteria 1553
1076 Ga0495590_0061425 3300046457 Bacteria 1316
1077 Ga0495590_0085742 3300046457 Bacteria 1111
1078 Ga0495591_107810 3300046458 Bacteria 686
1079 Ga0495629_0028838 3300046459 Bacteria 3939
1080 Ga0495629_0415907 3300046459 Bacteria 913
1081 Ga0495629_0705026 3300046459 Bacteria 670
1082 Ga0495638_0268296 3300046460 Bacteria 933
1083 Ga0495651_0024936 3300046462 Bacteria 4653
1084 Ga0495651_0037559 3300046462 Bacteria 3771
1085 Ga0495651_0074998 3300046462 Bacteria 2565
1086 Ga0495651_0134806 3300046462 Bacteria 1798
1087 Ga0495653_0034538 3300046463 Bacteria 3999
1088 Ga0495653_0672185 3300046463 Bacteria 631
1089 Ga0495650_0079005 3300046471 Bacteria 1273
1090 Ga0495650_0079623 3300046471 Bacteria 1266
1091 Ga0495650_0142071 3300046471 Bacteria 868
1092 Ga0495580_0006567 3300046472 Bacteria 9456
1093 Ga0495580_0094095 3300046472 Bacteria 2085
1094 Ga0495582_0033966 3300046473 Bacteria 2804
1095 Ga0495605_0225723 3300046474 Bacteria 808
1096 Ga0495605_0230476 3300046474 Bacteria 798
1097 Ga0495639_0020941 3300046475 Bacteria 2860
1098 Ga0495639_0057837 3300046475 Bacteria 1772
1099 Ga0495639_0082570 3300046475 Bacteria 1498
1100 Ga0495639_0135593 3300046475 Bacteria 1181
1101 Ga0495662_0124296 3300046476 Bacteria 1267
1102 Ga0495662_0298728 3300046476 Bacteria 792
1103 Ga0495664_0006504 3300046477 Bacteria 6457
1104 Ga0495664_0024055 3300046477 Bacteria 3538
1105 Ga0495664_0173613 3300046477 Bacteria 1307
1106 Ga0495664_0389133 3300046477 Bacteria 838
1107 Ga0495584_0039293 3300046491 Bacteria 2390
1108 Ga0495584_0129400 3300046491 Bacteria 1280
1109 Ga0495584_0130957 3300046491 Bacteria 1272
1110 Ga0495584_0348863 3300046491 Bacteria 752
1111 Ga0495585_0031581 3300046492 Bacteria 3005
1112 Ga0495594_0194338 3300046499 Bacteria 1156
1113 Ga0495583_0153022 3300046506 Bacteria 955
1114 Ga0495606_0000676 3300046507 Bacteria 53366
1115 Ga0495606_0033273 3300046507 Bacteria 3557
1116 Ga0495606_0088388 3300046507 Bacteria 1910
1117 Ga0495606_0272482 3300046507 Bacteria 929
1118 Ga0495606_0490660 3300046507 Bacteria 622
1119 Ga0495608_0010097 3300046511 Bacteria 6586
1120 Ga0495608_0174182 3300046511 Bacteria 1363
1121 Ga0495608_0382367 3300046511 Bacteria 863
1122 Ga0495608_0496713 3300046511 Bacteria 739
1123 Ga0495610_0089160 3300046512 Bacteria 1401
1124 Ga0495610_0089593 3300046512 Bacteria 1397
1125 Ga0495610_0090623 3300046512 Bacteria 1387
1126 Ga0495616_0071091 3300046513 Bacteria 1683
1127 Ga0495616_0305896 3300046513 Bacteria 670
1128 Ga0495620_0047663 3300046515 Bacteria 1843
1129 Ga0495628_0028701 3300046516 Bacteria 4519
1130 Ga0495630_0070146 3300046517 Bacteria 2637
1131 Ga0495631_0098781 3300046518 Bacteria 1256
1132 Ga0495631_0141639 3300046518 Bacteria 1032
1133 Ga0495632_0044136 3300046519 Bacteria 2225
1134 Ga0495632_0117916 3300046519 Bacteria 1242
1135 Ga0495632_0361282 3300046519 Bacteria 637
1136 Ga0495637_0078251 3300046520 Bacteria 1322
1137 Ga0495643_0141446 3300046522 Bacteria 1199
1138 Ga0495643_0148335 3300046522 Bacteria 1163
1139 Ga0495644_0051982 3300046523 Bacteria 1538
1140 Ga0495648_0001769 3300046524 Bacteria 20843
1141 Ga0495648_0009771 3300046524 Bacteria 7389
1142 Ga0495648_0020469 3300046524 Bacteria 4613
1143 Ga0495648_0098576 3300046524 Bacteria 1618
1144 Ga0495663_0081736 3300046525 Bacteria 1041
1145 Ga0495666_0057764 3300046526 Bacteria 1857
1146 Ga0495666_0125275 3300046526 Bacteria 1202
1147 Ga0495652_0030851 3300046529 Bacteria 4697
1148 Ga0495652_0190426 3300046529 Bacteria 1566
1149 Ga0495652_0202016 3300046529 Bacteria 1507
1150 Ga0495652_0494276 3300046529 Bacteria 849
1151 Ga0495665_0145730 3300046531 Bacteria 1237
1152 Ga0495640_0017649 3300046533 Bacteria 5312
1153 Ga0495640_0046403 3300046533 Bacteria 3010
1154 Ga0495640_0047669 3300046533 Bacteria 2965
1155 Ga0495587_0047806 3300046536 Bacteria 2536
1156 Ga0495587_0066525 3300046536 Bacteria 2102
1157 Ga0495598_0015535 3300046537 Bacteria 1924
1158 Ga0495609_0037202 3300046538 Bacteria 2195
1159 Ga0495609_0142683 3300046538 Bacteria 1021
1160 Ga0495621_0051267 3300046539 Bacteria 1476
1161 Ga0495621_0273617 3300046539 Bacteria 694
1162 Ga0495597_0110496 3300046542 Bacteria 1153
1163 Ga0495597_0137156 3300046542 Bacteria 1011
1164 Ga0495645_0005927 3300046543 Bacteria 8442
1165 Ga0495645_0113696 3300046543 Bacteria 1913
1166 Ga0495645_0147846 3300046543 Bacteria 1635
1167 Ga0495622_0104771 3300046557 Bacteria 1295
1168 Ga0495622_0117725 3300046557 Bacteria 1214
1169 Ga0495622_0303296 3300046557 Bacteria 696
1170 Ga0495622_0312049 3300046557 Bacteria 684
1171 Ga0495633_0067378 3300046558 Bacteria 1671
1172 Ga0495633_0151909 3300046558 Bacteria 1069
1173 Ga0495667_0056925 3300046559 Bacteria 2570
1174 Ga0495667_0195123 3300046559 Bacteria 1297
1175 Ga0495656_0071471 3300046615 Bacteria 1542
1176 Ga0495656_0096498 3300046615 Bacteria 1360
1177 Ga0495668_0043654 3300046616 Bacteria 2492
1178 Ga0495668_0056113 3300046616 Bacteria 2174
1179 Ga0495668_0065418 3300046616 Bacteria 2001
1180 Ga0495668_0086722 3300046616 Bacteria 1717
1181 Ga0495668_0089744 3300046616 Bacteria 1684
1182 Ga0495668_0122408 3300046616 Bacteria 1423
1183 Ga0495668_0262593 3300046616 Bacteria 945
1184 Ga0495668_0314981 3300046616 Bacteria 858
1185 Ga0495668_0372149 3300046616 Bacteria 784
1186 Ga0495634_0117269 3300046642 Bacteria 1707
1187 Ga0495611_0116671 3300046648 Bacteria 1244
1188 Ga0495611_0298937 3300046648 Bacteria 742
1189 Ga0495611_0329279 3300046648 Bacteria 702
1190 Ga0495625_0071902 3300046660 Bacteria 2426
1191 Ga0495625_0215516 3300046660 Bacteria 1260
1192 Ga0495625_0352750 3300046660 Bacteria 929
1193 Ga0495635_0136556 3300046663 Bacteria 1671
1194 Ga0495635_0159202 3300046663 Bacteria 1536
1195 Ga0495635_0231601 3300046663 Bacteria 1248
1196 Ga0495659_0028980 3300046664 Bacteria 1919
1197 Ga0495661_0371113 3300046665 Bacteria 701
1198 Ga0495588_0020225 3300046674 Bacteria 3268
1199 Ga0495588_0265036 3300046674 Bacteria 905
1200 Ga0495588_0272805 3300046674 Bacteria 891
1201 Ga0495657_0002607 3300046675 Bacteria 15083
1202 Ga0495657_0011477 3300046675 Bacteria 6622
1203 Ga0495599_0171310 3300046678 Bacteria 1339
1204 Ga0495623_0055634 3300046679 Bacteria 2493
1205 Ga0495623_0174201 3300046679 Bacteria 1255
1206 Ga0495623_0197848 3300046679 Bacteria 1157
1207 Ga0495646_0044662 3300046680 Bacteria 2709
1208 Ga0495646_0129781 3300046680 Bacteria 1420
1209 Ga0495647_0021934 3300046681 Bacteria 2304
1210 Ga0495658_0061625 3300046683 Bacteria 2154
1211 Ga0495669_0030344 3300046684 Bacteria 2373
1212 Ga0495669_0159733 3300046684 Bacteria 1069
1213 Ga0495669_0240688 3300046684 Bacteria 868
1214 Ga0495669_0340417 3300046684 Bacteria 725
1215 Ga0495613_0148244 3300046689 Bacteria 1674
1216 Ga0495613_0264477 3300046689 Bacteria 1197
1217 Ga0495624_0051457 3300046690 Bacteria 2606
1218 Ga0495624_0283639 3300046690 Bacteria 1000
1219 Ga0495624_0415619 3300046690 Bacteria 807
1220 Ga0495670_0171586 3300046691 Bacteria 1142
1221 Ga0495671_0044453 3300046692 Bacteria 2227
1222 Ga0495671_0278107 3300046692 Bacteria 806
1223 Ga0495671_0439866 3300046692 Bacteria 623
1224 Ga0495649_0002747 3300046694 Bacteria 12249
1225 Ga0495649_0156285 3300046694 Bacteria 1196
1226 Ga0495649_0356621 3300046694 Bacteria 738
1227 Ga0495589_0063551 3300046794 Bacteria 1811
1228 Ga0495589_0085016 3300046794 Bacteria 1537
1229 Ga0495589_0229217 3300046794 Bacteria 871
1230 Ga0495600_0004076 3300046809 Bacteria 8690
1231 Ga0495600_0051028 3300046809 Bacteria 2700
1232 Ga0495600_0053596 3300046809 Bacteria 2634
1233 Ga0495600_0248931 3300046809 Bacteria 1131
1234 Ga0495581_0032284 3300047315 Bacteria 3033
1235 Ga0495581_0080363 3300047315 Bacteria 1887
1236 Ga0495581_0507569 3300047315 Bacteria 701
1237 Ga0495604_0017042 3300047317 Bacteria 5811
1238 Ga0495604_0107040 3300047317 Bacteria 2044
1239 Ga0495604_0174913 3300047317 Bacteria 1506
1240 Ga0495604_0306912 3300047317 Bacteria 1064
1241 Ga0495636_0080836 3300047318 Bacteria 1399
1242 Ga0495636_0136043 3300047318 Bacteria 1095
1243 Ga0495674_0011448 3300047319 Bacteria 8369
1244 Ga0495674_0252779 3300047319 Bacteria 1450
1245 Ga0495674_0787159 3300047319 Bacteria 741
1246 Ga0495672_0014389 3300047320 Bacteria 5420
1247 Ga0495672_0017769 3300047320 Bacteria 4746
1248 Ga0495672_0371852 3300047320 Bacteria 659
1249 Ga0495676_0060257 3300047321 Bacteria 2976
1250 Ga0495676_0095841 3300047321 Bacteria 2207
1251 Ga0495676_0325583 3300047321 Bacteria 1032
1252 Ga0495676_0369370 3300047321 Bacteria 956
1253 Ga0495676_0435803 3300047321 Bacteria 866
1254 Ga0495680_0040840 3300047322 Bacteria 3692
1255 Ga0495683_0025892 3300047323 Bacteria 3004
1256 Ga0495683_0329099 3300047323 Bacteria 649
1257 Ga0495687_031675 3300047443 Bacteria 2423
1258 Ga0495675_0002941 3300047444 Bacteria 10234
1259 Ga0495685_207736 3300047447 Bacteria 627
1260 Ga0495673_0061080 3300047469 Bacteria 1615
1261 Ga0495673_0186320 3300047469 Bacteria 783
1262 Ga0495681_0081383 3300047470 Bacteria 1445
1263 Ga0495684_0033429 3300047471 Bacteria 3944
1264 Ga0495684_0098483 3300047471 Bacteria 2211
1265 Ga0495686_0082026 3300047472 Bacteria 1968
1266 Ga0495686_0100852 3300047472 Bacteria 1741
1267 Ga0495686_0148202 3300047472 Bacteria 1379
1268 Ga0495686_0222536 3300047472 Bacteria 1073
1269 Ga0495686_0238766 3300047472 Bacteria 1026
1270 Ga0495686_0314023 3300047472 Bacteria 861
1271 Ga0495602_0021964 3300048088 Bacteria 6258
1272 Ga0495602_0409516 3300048088 Bacteria 965
1273 Ga0495615_0007906 3300048090 Bacteria 2036
1274 Ga0495626_0109357 3300048091 Bacteria 1198
1275 Ga0496100_0028315 3300048903 Bacteria 3455
1276 Ga0496100_0140332 3300048903 Bacteria 1712
1277 Ga0496100_0650342 3300048903 Bacteria 821
1278 Ga0496100_0870388 3300048903 Bacteria 707
1279 Ga0496101_0003628 3300048904 Bacteria 9636
1280 Ga0496101_0070733 3300048904 Bacteria 2556
1281 Ga0496102_0004361 3300048905 Bacteria 11953
1282 Ga0496102_0129771 3300048905 Bacteria 2358
1283 Ga0496102_0375761 3300048905 Bacteria 1337
1284 Ga0496102_0433977 3300048905 Bacteria 1233
1285 Ga0496102_0584517 3300048905 Bacteria 1040
1286 Ga0496102_0975554 3300048905 Bacteria 768
1287 Ga0496103_0130167 3300048906 Bacteria 1607
1288 Ga0496103_0137613 3300048906 Bacteria 1561
1289 Ga0496103_0599734 3300048906 Bacteria 701
1290 Ga0496104_0020661 3300048907 Bacteria 6039
1291 Ga0496104_0118046 3300048907 Bacteria 2546
1292 Ga0496104_0131500 3300048907 Bacteria 2404
1293 Ga0496104_0199944 3300048907 Bacteria 1910
1294 Ga0496104_0222785 3300048907 Bacteria 1798
1295 Ga0496104_0255091 3300048907 Bacteria 1666
1296 Ga0496104_0321739 3300048907 Bacteria 1459
1297 Ga0496104_1388885 3300048907 Bacteria 605
1298 Ga0496105_0000647 3300048908 Bacteria 23344
1299 Ga0496105_0023303 3300048908 Bacteria 5018
1300 Ga0496105_0279500 3300048908 Bacteria 1346
1301 Ga0496105_0356569 3300048908 Bacteria 1167
1302 Ga0496105_0393931 3300048908 Bacteria 1100
1303 Ga0496105_0502624 3300048908 Bacteria 951
1304 Ga0496106_0000960 3300048909 Bacteria 21012
1305 Ga0496106_0011693 3300048909 Bacteria 6482
1306 Ga0496106_0026408 3300048909 Bacteria 4325
1307 Ga0496106_0046946 3300048909 Bacteria 3248
1308 Ga0496106_0077578 3300048909 Bacteria 2548
1309 Ga0496106_0144123 3300048909 Bacteria 1875
1310 Ga0496106_0229713 3300048909 Bacteria 1481
1311 Ga0496106_0321360 3300048909 Bacteria 1242
1312 Ga0496106_0500551 3300048909 Bacteria 976
1313 Ga0496106_0810702 3300048909 Bacteria 742
1314 Ga0496107_0003437 3300048910 Bacteria 10586
1315 Ga0496107_0018143 3300048910 Bacteria 4951
1316 Ga0496107_0018169 3300048910 Bacteria 4948
1317 Ga0496107_0051167 3300048910 Bacteria 2979
1318 Ga0496107_0168176 3300048910 Bacteria 1626
1319 Ga0496107_0266274 3300048910 Bacteria 1275
1320 Ga0496107_0985019 3300048910 Bacteria 612
1321 Ga0496108_0000803 3300048911 Bacteria 24388
1322 Ga0496108_0029498 3300048911 Bacteria 4543
1323 Ga0496108_0038906 3300048911 Bacteria 3964
1324 Ga0496108_0105623 3300048911 Bacteria 2404
1325 Ga0496108_0153998 3300048911 Bacteria 1984
1326 Ga0496108_0233495 3300048911 Bacteria 1599
1327 Ga0496108_0293029 3300048911 Bacteria 1417
1328 Ga0496108_0664449 3300048911 Bacteria 905
1329 Ga0496108_0695171 3300048911 Bacteria 882
1330 Ga0496108_0974966 3300048911 Bacteria 725
1331 Ga0496108_1154650 3300048911 Bacteria 656
1332 Ga0496109_0001236 3300048912 Bacteria 21235
1333 Ga0496109_0017599 3300048912 Bacteria 6268
1334 Ga0496109_0033008 3300048912 Bacteria 4656
1335 Ga0496109_0128689 3300048912 Bacteria 2362
1336 Ga0496109_0228190 3300048912 Bacteria 1751
1337 Ga0496109_0321310 3300048912 Bacteria 1461
1338 Ga0496109_0933745 3300048912 Bacteria 805
1339 Ga0496110_0027403 3300048913 Bacteria 4884
1340 Ga0496110_0078125 3300048913 Bacteria 2946
1341 Ga0496110_0155677 3300048913 Bacteria 2070
1342 Ga0496110_0171333 3300048913 Bacteria 1969
1343 Ga0496110_0231296 3300048913 Bacteria 1681
1344 Ga0496110_0372681 3300048913 Bacteria 1301
1345 Ga0496110_0621048 3300048913 Bacteria 979
1346 Ga0496110_0664355 3300048913 Bacteria 942
1347 Ga0496110_1075367 3300048913 Bacteria 712
1348 Ga0496111_0049775 3300048914 Bacteria 3021
1349 Ga0496111_0072278 3300048914 Bacteria 2511
1350 Ga0496111_0144636 3300048914 Bacteria 1762
1351 Ga0496111_0153009 3300048914 Bacteria 1711
1352 Ga0496111_0180632 3300048914 Bacteria 1568
1353 Ga0496111_0345559 3300048914 Bacteria 1101
1354 Ga0496111_0612502 3300048914 Bacteria 796
1355 Ga0496112_0000015 3300048915 Bacteria 206423
1356 Ga0496112_0002678 3300048915 Bacteria 14403
1357 Ga0496112_0019376 3300048915 Bacteria 6422
1358 Ga0496112_0024342 3300048915 Bacteria 5795
1359 Ga0496112_0029519 3300048915 Bacteria 5303
1360 Ga0496112_0067611 3300048915 Bacteria 3527
1361 Ga0496112_0167136 3300048915 Bacteria 2165
1362 Ga0496112_0230887 3300048915 Bacteria 1805
1363 Ga0496112_0390282 3300048915 Bacteria 1332
1364 Ga0496112_0413932 3300048915 Bacteria 1287
1365 Ga0496112_0515023 3300048915 Bacteria 1131
1366 Ga0496113_0006745 3300048916 Bacteria 7318
1367 Ga0496113_0042625 3300048916 Bacteria 3354
1368 Ga0496113_0058775 3300048916 Bacteria 2894
1369 Ga0496113_0125174 3300048916 Bacteria 2012
1370 Ga0496113_0357593 3300048916 Bacteria 1171
1371 Ga0496113_0444029 3300048916 Bacteria 1042
1372 Ga0496113_0835532 3300048916 Bacteria 730
1373 Ga0496114_0030749 3300048917 Bacteria 4418
1374 Ga0496114_0095732 3300048917 Bacteria 2527
1375 Ga0496114_0104240 3300048917 Bacteria 2425
1376 Ga0496114_0175899 3300048917 Bacteria 1867
1377 Ga0496114_0293444 3300048917 Bacteria 1435
1378 Ga0496115_0009727 3300048918 Bacteria 7160
1379 Ga0496115_0034663 3300048918 Bacteria 3989
1380 Ga0496115_0044070 3300048918 Bacteria 3557
1381 Ga0496115_0064821 3300048918 Bacteria 2950
1382 Ga0496115_0098472 3300048918 Bacteria 2395
1383 Ga0496115_0158782 3300048918 Bacteria 1868
1384 Ga0496115_0160537 3300048918 Bacteria 1857
1385 Ga0496115_0197494 3300048918 Bacteria 1662
1386 Ga0496115_0351997 3300048918 Bacteria 1201
1387 Ga0496115_0442544 3300048918 Bacteria 1051
1388 Ga0496115_0476550 3300048918 Bacteria 1005
1389 Ga0496116_0345004 3300048919 Bacteria 685
1390 Ga0496117_0027401 3300048920 Bacteria 4442
1391 Ga0496117_0065431 3300048920 Bacteria 2472
1392 Ga0496117_0122059 3300048920 Bacteria 1598
1393 Ga0496117_0125366 3300048920 Bacteria 1569
1394 Ga0496118_0004286 3300048921 Bacteria 17065
1395 Ga0496118_0040381 3300048921 Bacteria 3711
1396 Ga0496118_0053221 3300048921 Bacteria 3080
1397 Ga0496118_0057571 3300048921 Bacteria 2912
1398 Ga0496118_0093693 3300048921 Bacteria 2056
1399 Ga0496118_0137032 3300048921 Bacteria 1560
1400 Ga0496118_0179735 3300048921 Bacteria 1280
1401 Ga0496118_0287439 3300048921 Bacteria 911
1402 Ga0496118_0291127 3300048921 Bacteria 902
1403 Ga0496119_0183306 3300048922 Bacteria 1096
1404 Ga0496119_0312083 3300048922 Bacteria 772
1405 Ga0496120_0029227 3300048923 Bacteria 3366
1406 Ga0496120_0113881 3300048923 Bacteria 1409
1407 Ga0496121_0000423 3300048924 Bacteria 83271
1408 Ga0496121_0000865 3300048924 Bacteria 54663
1409 Ga0496121_0016177 3300048924 Bacteria 7722
1410 Ga0496121_0066527 3300048924 Bacteria 2925
1411 Ga0496121_0071616 3300048924 Bacteria 2787
1412 Ga0496121_0088411 3300048924 Bacteria 2429
1413 Ga0496121_0109860 3300048924 Bacteria 2105
1414 Ga0496121_0133830 3300048924 Bacteria 1850
1415 Ga0496121_0226364 3300048924 Bacteria 1313
1416 Ga0496121_0277560 3300048924 Bacteria 1148
1417 Ga0496121_0290060 3300048924 Bacteria 1115
1418 Ga0496121_0422065 3300048924 Bacteria 867
1419 Ga0496121_0673464 3300048924 Bacteria 627
1420 Ga0496122_0014922 3300048925 Bacteria 7477
1421 Ga0496122_0108994 3300048925 Bacteria 1824
1422 Ga0496122_0119135 3300048925 Bacteria 1708
1423 Ga0496123_0250282 3300048926 Bacteria 874
1424 Ga0496124_0005449 3300048927 Bacteria 14303
1425 Ga0496124_0134487 3300048927 Bacteria 1959
1426 Ga0496124_0199703 3300048927 Bacteria 1522
1427 Ga0496124_0249923 3300048927 Bacteria 1312
1428 Ga0496124_0351733 3300048927 Bacteria 1042
1429 Ga0496124_0370637 3300048927 Bacteria 1005
1430 Ga0496125_0000136 3300048928 Bacteria 160544
1431 Ga0496125_0049468 3300048928 Bacteria 3493
1432 Ga0496125_0063927 3300048928 Bacteria 2930
1433 Ga0496125_0064445 3300048928 Bacteria 2912
1434 Ga0496125_0066903 3300048928 Bacteria 2835
1435 Ga0496125_0148114 3300048928 Bacteria 1618
1436 Ga0496125_0191802 3300048928 Bacteria 1348
1437 Ga0496125_0329748 3300048928 Bacteria 921
1438 Ga0496125_0621598 3300048928 Bacteria 586
1439 Ga0496126_0007880 3300048929 Bacteria 11599
1440 Ga0496126_0008016 3300048929 Bacteria 11461
1441 Ga0496126_0013800 3300048929 Bacteria 8192
1442 Ga0496126_0018058 3300048929 Bacteria 7007
1443 Ga0496126_0046719 3300048929 Bacteria 3967
1444 Ga0496126_0074875 3300048929 Bacteria 3006
1445 Ga0496126_0107865 3300048929 Bacteria 2428
1446 Ga0496126_0173191 3300048929 Bacteria 1837
1447 Ga0496126_0185006 3300048929 Bacteria 1767
1448 Ga0496126_0214651 3300048929 Bacteria 1619
1449 Ga0496126_0235647 3300048929 Bacteria 1531
1450 Ga0496126_0249024 3300048929 Bacteria 1481
1451 Ga0496126_0253838 3300048929 Bacteria 1464
1452 Ga0496126_0382430 3300048929 Bacteria 1145
1453 Ga0496126_0430013 3300048929 Bacteria 1066
1454 Ga0496126_0453361 3300048929 Bacteria 1032
1455 Ga0496126_0887244 3300048929 Bacteria 677
1456 Ga0495682_0016334 3300049460 Bacteria 2810
1457 Ga0495682_0118667 3300049460 Bacteria 947
1458 Ga0495682_0146685 3300049460 Bacteria 842
1459 Ga0501031_0000390 3300049568 Bacteria 25691
1460 Ga0501032_0014322 3300049569 Bacteria 5617
1461 Ga0501032_0146640 3300049569 Bacteria 1553
1462 Ga0501032_0354299 3300049569 Bacteria 945
1463 Ga0501033_0000205 3300049570 Bacteria 56697
1464 Ga0501033_0202584 3300049570 Bacteria 1417
1465 Ga0501033_0431645 3300049570 Bacteria 916
1466 Ga0501034_0044925 3300049571 Bacteria 4465
1467 Ga0501034_0149277 3300049571 Bacteria 2314
1468 Ga0501034_0530731 3300049571 Bacteria 1088
1469 Ga0501036_0111918 3300049572 Bacteria 2307
1470 Ga0501036_0227538 3300049572 Bacteria 1565
1471 Ga0501036_0229541 3300049572 Bacteria 1558
1472 Ga0501036_0388014 3300049572 Bacteria 1165
1473 Ga0501036_0613038 3300049572 Bacteria 902
1474 Ga0501037_0001134 3300049573 Bacteria 19732
1475 Ga0501037_0213237 3300049573 Bacteria 1361
1476 Ga0501037_0299844 3300049573 Bacteria 1116
1477 Ga0501037_0818210 3300049573 Bacteria 614
1478 Ga0501038_0083624 3300049574 Bacteria 2686
1479 Ga0501038_0095343 3300049574 Bacteria 2485
1480 Ga0501038_0718608 3300049574 Bacteria 747
1481 Ga0501039_0005007 3300049575 Bacteria 10055
1482 Ga0501039_0283593 3300049575 Bacteria 1302
1483 Ga0501041_0219230 3300049577 Bacteria 1194
1484 Ga0501042_0041282 3300049578 Bacteria 3280
1485 Ga0501042_0443671 3300049578 Bacteria 941
1486 Ga0501043_0013802 3300049579 Bacteria 6322
1487 Ga0501046_0005064 3300049580 Bacteria 11815
1488 Ga0501046_0113933 3300049580 Bacteria 2063
1489 Ga0501046_0191270 3300049580 Bacteria 1526
1490 Ga0501047_0010641 3300049581 Bacteria 8696
1491 Ga0501047_0289630 3300049581 Bacteria 1481
1492 Ga0501047_0884414 3300049581 Bacteria 707
1493 Ga0501047_1106736 3300049581 Bacteria 605
1494 Ga0501067_0112428 3300049583 Bacteria 1515
1495 Ga0501067_0293368 3300049583 Bacteria 905
1496 Ga0501068_0531206 3300049584 Bacteria 764
1497 Ga0501068_0627946 3300049584 Bacteria 701
1498 Ga0501069_0157932 3300049585 Bacteria 1305
1499 Ga0501070_0052132 3300049586 Bacteria 3396
1500 Ga0501070_0106087 3300049586 Bacteria 2322
1501 Ga0501070_0226875 3300049586 Bacteria 1531
1502 Ga0501070_0370610 3300049586 Bacteria 1161
1503 Ga0501070_0754677 3300049586 Bacteria 766
1504 Ga0501071_0119488 3300049587 Bacteria 1953
1505 Ga0501071_0151756 3300049587 Bacteria 1729
1506 Ga0501073_0067728 3300049589 Bacteria 2489
1507 Ga0501073_0650660 3300049589 Bacteria 727
1508 Ga0501074_0031492 3300049590 Bacteria 3842
1509 Ga0501074_0072286 3300049590 Bacteria 2478
1510 Ga0501074_0563924 3300049590 Bacteria 806
1511 Ga0501076_0629471 3300049592 Bacteria 885
1512 Ga0501077_0045897 3300049593 Bacteria 2776
1513 Ga0501079_0361197 3300049741 Bacteria 1138
1514 Ga0501080_0082585 3300049742 Bacteria 2984
1515 Ga0501080_0238244 3300049742 Bacteria 1661
1516 Ga0501080_0242107 3300049742 Bacteria 1646
1517 Ga0501080_0856556 3300049742 Bacteria 794
1518 Ga0501083_0236285 3300049744 Bacteria 1190
1519 Ga0501035_0029757 3300049822 Bacteria 4980
1520 Ga0501035_0074363 3300049822 Bacteria 3006
1521 Ga0501035_0089143 3300049822 Bacteria 2717
1522 Ga0501035_0106217 3300049822 Bacteria 2462
1523 Ga0501035_0344564 3300049822 Bacteria 1248
1524 Ga0501035_0575158 3300049822 Bacteria 920
1525 Ga0501044_0005118 3300049823 Bacteria 14626
1526 Ga0501044_0059132 3300049823 Bacteria 3928
1527 Ga0501044_0153987 3300049823 Bacteria 2279
1528 Ga0501044_0197223 3300049823 Bacteria 1972
1529 Ga0501044_0271780 3300049823 Bacteria 1630
1530 Ga0501044_0338311 3300049823 Bacteria 1426
1531 Ga0501044_0401313 3300049823 Bacteria 1283
1532 Ga0501044_0662829 3300049823 Bacteria 931
1533 Ga0501044_0926597 3300049823 Bacteria 745
1534 Ga0501044_1269418 3300049823 Bacteria 603
1535 Ga0501045_0080700 3300049824 Bacteria 2399
1536 Ga0501045_0270674 3300049824 Bacteria 1265
1537 nmdc:mga03683_164689_c1 3300050489 Bacteria 1006
1538 nmdc:mga03683_40505_c1 3300050489 Bacteria 1911
1539 nmdc:mga03683_41994_c1 3300050489 Bacteria 1880
1540 nmdc:mga03683_94550_c1 3300050489 Bacteria 1307
1541 nmdc:mga03n38_1418_c1 3300050490 Bacteria 6843
1542 nmdc:mga03n38_453607_c1 3300050490 Bacteria 714
1543 nmdc:mga03n38_662521_c1 3300050490 Bacteria 599
1544 nmdc:mga00v17_186268_c1 3300050491 Bacteria 1340
1545 nmdc:mga00v17_227627_c1 3300050491 Bacteria 1208
1546 nmdc:mga00v17_43893_c1 3300050491 Bacteria 2694
1547 nmdc:mga00v17_81611_c2 3300050491 Bacteria 937
1548 nmdc:mga00v17_91466_c1 3300050491 Bacteria 1911
1549 nmdc:mga0yw44_111921_c1 3300050492 Bacteria 1750
1550 nmdc:mga0yw44_125363_c1 3300050492 Bacteria 1658
1551 nmdc:mga0yw44_168244_c1 3300050492 Bacteria 1062
1552 nmdc:mga0yw44_20997_c1 3300050492 Bacteria 3636
1553 nmdc:mga0yw44_278456_c1 3300050492 Bacteria 1118
1554 nmdc:mga0yw44_338777_c1 3300050492 Bacteria 1011
1555 nmdc:mga0yw44_363451_c1 3300050492 Bacteria 976
1556 nmdc:mga0yw44_365091_c1 3300050492 Bacteria 973
1557 nmdc:mga0yw44_41212_c1 3300050492 Bacteria 2748
1558 nmdc:mga0yw44_471048_c1 3300050492 Bacteria 852
1559 nmdc:mga0yw44_496868_c1 3300050492 Bacteria 828
1560 nmdc:mga0yw44_74121_c1 3300050492 Bacteria 2120
1561 nmdc:mga0k408_154685_c1 3300050493 Bacteria 1366
1562 nmdc:mga0k408_177588_c1 3300050493 Bacteria 1270
1563 nmdc:mga0k408_346773_c1 3300050493 Bacteria 885
1564 nmdc:mga0k408_748444_c1 3300050493 Bacteria 571
1565 nmdc:mga06z11_123724_c1 3300050494 Bacteria 1446
1566 nmdc:mga06z11_13229_c1 3300050494 Bacteria 3616
1567 nmdc:mga06z11_148848_c1 3300050494 Bacteria 1329
1568 nmdc:mga06z11_27037_c1 3300050494 Bacteria 2739
1569 nmdc:mga06z11_282116_c1 3300050494 Bacteria 984
1570 nmdc:mga06z11_604492_c1 3300050494 Bacteria 667
1571 nmdc:mga04h51_38193_c1 3300050495 Bacteria 1553
1572 nmdc:mga04h51_41658_c1 3300050495 Bacteria 1502
1573 nmdc:mga04h51_7254_c1 3300050495 Bacteria 2916
1574 nmdc:mga04h51_91102_c1 3300050495 Bacteria 1097
1575 nmdc:mga07m45_152587_c1 3300050496 Bacteria 1340
1576 nmdc:mga07m45_1693_c2 3300050496 Bacteria 8663
1577 nmdc:mga05p37_106683_c1 3300050507 Bacteria 3446
1578 nmdc:mga09592_275182_c1 3300050508 Bacteria 1460
1579 nmdc:mga08y16_139088_c1 3300050511 Bacteria 2524
1580 nmdc:mga08y16_50901_c1 3300050511 Bacteria 4334
1581 nmdc:mga0n895_1294201_c1 3300050512 Bacteria 700
1582 nmdc:mga0n895_286526_c1 3300050512 Bacteria 1670
1583 nmdc:mga0n895_37552_c1 3300050512 Bacteria 4687
1584 nmdc:mga0rr50_162398_c1 3300050513 Bacteria 1814
1585 nmdc:mga0rr50_320662_c1 3300050513 Bacteria 1299
1586 nmdc:mga0sz30_247978_c1 3300050516 Bacteria 793
1587 nmdc:mga0sz30_26227_c1 3300050516 Bacteria 2388
1588 nmdc:mga0sz30_307336_c1 3300050516 Bacteria 707
1589 Ga0495601_0097467 3300053077 Bacteria 1897
1590 Ga0495601_0154442 3300053077 Bacteria 1499
1591 Ga0495601_0193554 3300053077 Bacteria 1329
1592 Ga0495601_0476604 3300053077 Bacteria 806
1593 Ga0495612_0268675 3300053078 Bacteria 761
1594 Ga0500635_0011591 3300053080 Bacteria 2510
1595 Ga0500635_0014644 3300053080 Bacteria 2302
1596 Ga0500635_0323379 3300053080 Bacteria 610
1597 Ga0495655_0037102 3300053083 Bacteria 1222
1598 Ga0495655_0240072 3300053083 Bacteria 606
1599 Ga0495595_0035717 3300053084 Bacteria 2252
1600 Ga0495595_0302820 3300053084 Bacteria 804
1601 Ga0495619_0012457 3300053085 Bacteria 5356
1602 Ga0495619_0193105 3300053085 Bacteria 1409
1603 Ga0495619_0845653 3300053085 Bacteria 617
1604 Ga0500578_0140390 3300053086 Bacteria 1510
1605 Ga0500578_0213772 3300053086 Bacteria 1175
1606 Ga0500578_0238191 3300053086 Bacteria 1100
1607 Ga0500643_000049 3300053087 Bacteria 147107
1608 Ga0500643_046171 3300053087 Bacteria 1259
1609 Ga0500644_0030836 3300053088 Bacteria 1700
1610 Ga0500644_0073119 3300053088 Bacteria 1241
1611 Ga0500644_0182254 3300053088 Bacteria 860
1612 Ga0500646_0069815 3300053090 Bacteria 1051
1613 Ga0500647_0220604 3300053091 Bacteria 849
1614 Ga0500647_0261086 3300053091 Bacteria 757
1615 Ga0500583_0173891 3300053092 Bacteria 1072
1616 Ga0500651_0041180 3300053093 Bacteria 2911
1617 Ga0500651_0072214 3300053093 Bacteria 2146
1618 Ga0500651_0092244 3300053093 Bacteria 1863
1619 Ga0500651_0255144 3300053093 Bacteria 1018
1620 Ga0500651_0449324 3300053093 Bacteria 717
1621 Ga0500566_0000054 3300053094 Bacteria 54975
1622 Ga0500566_0000055 3300053094 Bacteria 54414
1623 Ga0500566_0002813 3300053094 Bacteria 10360
1624 Ga0500566_0006619 3300053094 Bacteria 6862
1625 Ga0500640_024388 3300053095 Bacteria 2627
1626 Ga0500641_0013558 3300053096 Bacteria 2995
1627 Ga0500641_0031164 3300053096 Bacteria 2101
1628 Ga0500650_0097072 3300053098 Bacteria 1380
1629 Ga0500650_0144159 3300053098 Bacteria 1103
1630 Ga0500554_003653 3300053102 Bacteria 3170
1631 Ga0500554_010329 3300053102 Bacteria 2271
1632 Ga0500555_005493 3300053103 Bacteria 3595
1633 Ga0500556_0031759 3300053104 Bacteria 1799
1634 Ga0500557_000118 3300053105 Bacteria 22375
1635 Ga0500562_015483 3300053108 Bacteria 1956
1636 Ga0500569_002326 3300053109 Bacteria 3728
1637 Ga0500572_000348 3300053111 Bacteria 16528
1638 Ga0500572_047110 3300053111 Bacteria 1272
1639 Ga0500572_224846 3300053111 Bacteria 613
1640 Ga0500591_086602 3300053115 Bacteria 1378
1641 Ga0500594_0002633 3300053118 Bacteria 3901
1642 Ga0500594_0038553 3300053118 Bacteria 1295
1643 Ga0500595_000345 3300053119 Bacteria 30235
1644 Ga0500595_005080 3300053119 Bacteria 5781
1645 Ga0500595_038392 3300053119 Bacteria 1557
1646 Ga0500595_046350 3300053119 Bacteria 1367
1647 Ga0500595_120872 3300053119 Bacteria 740
1648 Ga0500595_153644 3300053119 Bacteria 642
1649 Ga0500597_093367 3300053120 Bacteria 1308
1650 Ga0500597_108020 3300053120 Bacteria 1209
1651 Ga0500597_141879 3300053120 Bacteria 1035
1652 Ga0500597_331800 3300053120 Bacteria 598
1653 Ga0500608_002697 3300053122 Bacteria 6513
1654 Ga0500608_130969 3300053122 Bacteria 1125
1655 Ga0500614_008371 3300053123 Bacteria 2192
1656 Ga0500617_216891 3300053124 Bacteria 684
1657 Ga0500618_006151 3300053125 Bacteria 3553
1658 Ga0500618_014579 3300053125 Bacteria 2004
1659 Ga0500618_022546 3300053125 Bacteria 1530
1660 Ga0500626_092159 3300053128 Bacteria 1329
1661 Ga0500642_0000164 3300053130 Bacteria 27497
1662 Ga0500642_0039763 3300053130 Bacteria 2025
1663 Ga0500642_0048319 3300053130 Bacteria 1868
1664 Ga0500642_0049160 3300053130 Bacteria 1855
1665 Ga0500658_0193656 3300053134 Bacteria 928
1666 Ga0500658_0314249 3300053134 Bacteria 720
1667 Ga0500559_0000305 3300053136 Bacteria 37260
1668 Ga0500559_0000362 3300053136 Bacteria 33750
1669 Ga0500559_0003633 3300053136 Bacteria 7546
1670 Ga0500559_0028894 3300053136 Bacteria 2371
1671 Ga0500559_0058557 3300053136 Bacteria 1713
1672 Ga0500564_149111 3300053138 Bacteria 998
1673 Ga0500568_0006864 3300053139 Bacteria 5666
1674 Ga0500568_0026181 3300053139 Bacteria 2450
1675 Ga0500568_0051625 3300053139 Bacteria 1617
1676 Ga0500568_0052897 3300053139 Bacteria 1593
1677 Ga0500573_0007866 3300053140 Bacteria 5843
1678 Ga0500577_0001673 3300053142 Bacteria 5679
1679 Ga0500577_0102862 3300053142 Bacteria 1170
1680 Ga0500577_0128432 3300053142 Bacteria 1060
1681 Ga0500577_0262329 3300053142 Bacteria 751
1682 Ga0500590_246553 3300053148 Bacteria 714
1683 Ga0500590_315644 3300053148 Bacteria 579
1684 Ga0500603_011062 3300053150 Bacteria 2046
1685 Ga0500603_060652 3300053150 Bacteria 1057
1686 Ga0500604_0049689 3300053151 Bacteria 1290
1687 Ga0500616_0000038 3300053153 Bacteria 386801
1688 Ga0500616_0022311 3300053153 Bacteria 3536
1689 Ga0500619_092377 3300053154 Bacteria 1023
1690 Ga0500619_189488 3300053154 Bacteria 692
1691 Ga0500622_0005919 3300053156 Bacteria 7207
1692 Ga0500622_0114950 3300053156 Bacteria 1311
1693 Ga0500627_0148942 3300053158 Bacteria 1057
1694 Ga0500627_0155805 3300053158 Bacteria 1031
1695 Ga0500627_0168435 3300053158 Bacteria 987
1696 Ga0500634_0158147 3300053161 Bacteria 1049
1697 Ga0500638_027148 3300053162 Bacteria 2746
1698 Ga0500638_050485 3300053162 Bacteria 2011
1699 Ga0500638_295936 3300053162 Bacteria 627
1700 Ga0500639_005653 3300053163 Bacteria 6412
1701 Ga0500639_165395 3300053163 Bacteria 1000
1702 Ga0500639_188864 3300053163 Bacteria 900
1703 Ga0500636_0042723 3300053177 Bacteria 2678
1704 Ga0500636_0077320 3300053177 Bacteria 1922
1705 Ga0500637_0000053 3300053178 Bacteria 42767
1706 Ga0500567_134325 3300053723 Bacteria 961
1707 Ga0500570_048356 3300053724 Bacteria 2163
1708 Ga0500657_212671 3300053728 Bacteria 625
1709 Ga0500625_144878 3300053729 Bacteria 906
1710 Ga0500645_079033 3300053730 Bacteria 939
1711 Ga0500609_020309 3300053731 Bacteria 905
1712 Ga0500656_032456 3300053732 Bacteria 701
1713 Ga0500656_049629 3300053732 Bacteria 608
1714 Ga0500552_006359 3300053733 Bacteria 1323
1715 Ga0500596_000229 3300053735 Bacteria 9555
1716 Ga0500596_006628 3300053735 Bacteria 1945
1717 Ga0500596_029926 3300053735 Bacteria 841
1718 Ga0500599_006308 3300053736 Bacteria 1510
1719 Ga0500601_000388 3300053737 Bacteria 7571
1720 Ga0500661_000122 3300055283 Bacteria 12922
1721 Ga0500661_007332 3300055283 Bacteria 2043
1722 Ga0501082_0547170 3300060353 Bacteria 1012
1723 Ga0466962_0053071 3300061719 Bacteria 1937
1724 Ga0466962_0056426 3300061719 Bacteria 1876
1725 Ga0466962_0122178 3300061719 Bacteria 1257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2671180139 2671693532 167
2 3300003354 JGI25160J50197_1001001 JGI25160J50197_10010017 169
3 3300025900 Ga0207710_10078848 Ga0207710_100788482 169
4 3300025903 Ga0207680_10116114 Ga0207680_101161143 169
5 3300028379 Ga0268266_10897475 Ga0268266_108974751 169
6 3300053153 Ga0500616_0000038 Ga0500616_0000038_41681_42208 169
7 3300007265 Ga0099794_10024310 Ga0099794_100243103 170
8 3300010159 Ga0099796_10095654 Ga0099796_100956542 170
9 iso_pu_bacteria 2617270741 2617373608 170
10 iso_pu_bacteria 2824746037 2824751364 170
11 iso_pu_bacteria 8006926726 8006929803 170
12 3300005327 Ga0070658_10178918 Ga0070658_101789182 171
13 3300005366 Ga0070659_100039074 Ga0070659_1000390745 171
14 3300005435 Ga0070714_100065139 Ga0070714_1000651392 171
15 3300005458 Ga0070681_10320087 Ga0070681_103200871 171
16 3300005563 Ga0068855_100083979 Ga0068855_1000839792 171
17 3300005981 Ga0081538_10026982 Ga0081538_100269822 171
18 3300006038 Ga0075365_10009883 Ga0075365_100098834 171
19 3300006042 Ga0075368_10117836 Ga0075368_101178361 171
20 3300006042 Ga0075368_10186706 Ga0075368_101867061 171
21 3300006048 Ga0075363_100199888 Ga0075363_1001998882 171
22 3300006051 Ga0075364_10320528 Ga0075364_103205282 171
23 3300006177 Ga0075362_10111361 Ga0075362_101113612 171
24 3300006178 Ga0075367_10026926 Ga0075367_100269262 171
25 3300006178 Ga0075367_10437204 Ga0075367_104372041 171
26 3300009551 Ga0105238_10346394 Ga0105238_103463941 171
27 3300009551 Ga0105238_10853638 Ga0105238_108536381 171
28 3300013100 Ga0157373_10034353 Ga0157373_100343534 171
29 3300013104 Ga0157370_10089286 Ga0157370_100892864 171
30 3300013105 Ga0157369_10503057 Ga0157369_105030572 171
31 3300025919 Ga0207657_10004389 Ga0207657_1000438911 171
32 3300025924 Ga0207694_10213773 Ga0207694_102137732 171
33 3300025929 Ga0207664_10176417 Ga0207664_101764172 171
34 3300025932 Ga0207690_10338842 Ga0207690_103388422 171
35 3300025949 Ga0207667_10192016 Ga0207667_101920161 171
36 3300027866 Ga0209813_10076547 Ga0209813_100765472 171
37 3300039438 Ga0436360_0758305 Ga0436360_0758305_298_822 171
38 3300041463 Ga0451804_0892439 Ga0451804_0892439_43_567 171
39 3300046471 Ga0495650_0079623 Ga0495650_0079623_117_641 171
40 3300048910 Ga0496107_0018143 Ga0496107_0018143_2814_3338 171
41 3300048924 Ga0496121_0000865 Ga0496121_0000865_2200_2724 171
42 3300049569 Ga0501032_0146640 Ga0501032_0146640_26_550 171
43 3300049570 Ga0501033_0431645 Ga0501033_0431645_41_565 171
44 3300049571 Ga0501034_0530731 Ga0501034_0530731_100_624 171
45 3300049572 Ga0501036_0227538 Ga0501036_0227538_368_901 171
46 3300049574 Ga0501038_0083624 Ga0501038_0083624_1953_2477 171
47 3300049575 Ga0501039_0283593 Ga0501039_0283593_67_600 171
48 3300049578 Ga0501042_0443671 Ga0501042_0443671_44_568 171
49 3300049580 Ga0501046_0113933 Ga0501046_0113933_1031_1564 171
50 3300049580 Ga0501046_0191270 Ga0501046_0191270_227_751 171
51 3300049581 Ga0501047_1106736 Ga0501047_1106736_68_592 171
52 3300049584 Ga0501068_0531206 Ga0501068_0531206_25_549 171
53 3300049586 Ga0501070_0226875 Ga0501070_0226875_351_884 171
54 3300049587 Ga0501071_0151756 Ga0501071_0151756_1025_1549 171
55 3300049590 Ga0501074_0072286 Ga0501074_0072286_276_800 171
56 3300049742 Ga0501080_0242107 Ga0501080_0242107_46_570 171
57 3300049744 Ga0501083_0236285 Ga0501083_0236285_605_1138 171
58 3300049822 Ga0501035_0089143 Ga0501035_0089143_188_721 171
59 3300049822 Ga0501035_0575158 Ga0501035_0575158_16_549 171
60 3300049823 Ga0501044_0197223 Ga0501044_0197223_225_749 171
61 3300049823 Ga0501044_0338311 Ga0501044_0338311_183_707 171
62 3300049823 Ga0501044_0401313 Ga0501044_0401313_587_1120 171
63 3300049823 Ga0501044_0662829 Ga0501044_0662829_225_749 171
64 3300049823 Ga0501044_1269418 Ga0501044_1269418_34_567 171
65 3300049824 Ga0501045_0080700 Ga0501045_0080700_858_1382 171
66 3300050489 nmdc:mga03683_94550_c1 nmdc:mga03683_94550_c1_773_1297 171
67 3300050491 nmdc:mga00v17_227627_c1 nmdc:mga00v17_227627_c1_184_708 171
68 3300050492 nmdc:mga0yw44_365091_c1 nmdc:mga0yw44_365091_c1_320_844 171
69 3300050492 nmdc:mga0yw44_41212_c1 nmdc:mga0yw44_41212_c1_1546_2070 171
70 3300050493 nmdc:mga0k408_346773_c1 nmdc:mga0k408_346773_c1_320_844 171
71 3300050494 nmdc:mga06z11_27037_c1 nmdc:mga06z11_27037_c1_1256_1780 171
72 3300050494 nmdc:mga06z11_282116_c1 nmdc:mga06z11_282116_c1_111_635 171
73 3300050495 nmdc:mga04h51_38193_c1 nmdc:mga04h51_38193_c1_1018_1542 171
74 3300050495 nmdc:mga04h51_91102_c1 nmdc:mga04h51_91102_c1_485_1009 171
75 3300053087 Ga0500643_046171 Ga0500643_046171_26_547 171
76 3300053139 Ga0500568_0006864 Ga0500568_0006864_3314_3832 171
77 3300053139 Ga0500568_0051625 Ga0500568_0051625_242_766 171
78 3300060353 Ga0501082_0547170 Ga0501082_0547170_450_983 171
79 iso_pu_bacteria 2507262055 2507505089 171
80 iso_pu_bacteria 2508501009 2508539024 171
81 iso_pu_bacteria 2508501042 2508695341 171
82 iso_pu_bacteria 2511231028 2511394518 171
83 iso_pu_bacteria 2513237092 2513623246 171
84 iso_pu_bacteria 2513237094 2513639773 171
85 iso_pu_bacteria 2513237095 2513647737 171
86 iso_pu_bacteria 2513237098 2513677549 171
87 iso_pu_bacteria 2513237101 2513694255 171
88 iso_pu_bacteria 2513237102 2513699299 171
89 iso_pu_bacteria 2513237104 2513719838 171
90 iso_pu_bacteria 2513237139 2513873686 171
91 iso_pu_bacteria 2513237141 2513888896 171
92 iso_pu_bacteria 2513237161 2514012329 171
93 iso_pu_bacteria 2515154112 2515625643 171
94 iso_pu_bacteria 2517093001 2517102130 171
95 iso_pu_bacteria 2524023205 2524435946 171
96 iso_pu_bacteria 2524023210 2524467362 171
97 iso_pu_bacteria 2528768022 2528852492 171
98 iso_pu_bacteria 2602042107 2603858652 171
99 iso_pu_bacteria 2617270735 2617350953 171
100 iso_pu_bacteria 2721755755 2723841492 171
101 iso_pu_bacteria 2744054633 2745081542 171
102 iso_pu_bacteria 2791355196 2793064937 171
103 iso_pu_bacteria 2791355199 2793079274 171
104 iso_pu_bacteria 2802429603 2805915769 171
105 iso_pu_bacteria 2816332527 2818237508 171
106 iso_pu_bacteria 2824600985 2824608245 171
107 iso_pu_bacteria 2824609381 2824612181 171
108 iso_pu_bacteria 2824617872 2824620662 171
109 iso_pu_bacteria 2824626560 2824629911 171
110 iso_pu_bacteria 2824635225 2824640567 171
111 iso_pu_bacteria 2824644064 2824647490 171
112 iso_pu_bacteria 2824653114 2824655562 171
113 iso_pu_bacteria 2824661429 2824668992 171
114 iso_pu_bacteria 2824671348 2824675777 171
115 iso_pu_bacteria 2824679649 2824683791 171
116 iso_pu_bacteria 2824687955 2824691899 171
117 iso_pu_bacteria 2824696289 2824701030 171
118 iso_pu_bacteria 2824704595 2824711021 171
119 iso_pu_bacteria 2824714736 2824718270 171
120 iso_pu_bacteria 2824723954 2824728540 171
121 iso_pu_bacteria 2824732956 2824736201 171
122 iso_pu_bacteria 2824753945 2824760393 171
123 iso_pu_bacteria 2824763712 2824770843 171
124 iso_pu_bacteria 2824773399 2824775669 171
125 iso_pu_bacteria 2838122688 2838124353 171
126 iso_pu_bacteria 2841941048 2841945046 171
127 iso_pu_bacteria 2841949485 2841951832 171
128 iso_pu_bacteria 2841957949 2841964768 171
129 iso_pu_bacteria 2841966195 2841973792 171
130 iso_pu_bacteria 2841974524 2841980118 171
131 iso_pu_bacteria 2841983080 2841985301 171
132 iso_pu_bacteria 2842038055 2842043651 171
133 iso_pu_bacteria 2842045827 2842052359 171
134 iso_pu_bacteria 2844315083 2844315146 171
135 iso_pu_bacteria 2847930680 2847930931 171
136 iso_pu_bacteria 2847939898 2847941987 171
137 iso_pu_bacteria 2849076700 2849082895 171
138 iso_pu_bacteria 2874590934 2874597088 171
139 iso_pu_bacteria 2874612657 2874616674 171
140 iso_pu_bacteria 2874620515 2874624639 171
141 iso_pu_bacteria 2874628541 2874628961 171
142 iso_pu_bacteria 2874645413 2874648064 171
143 iso_pu_bacteria 2876761206 2876765591 171
144 iso_pu_bacteria 2876771140 2876777552 171
145 iso_pu_bacteria 2876808645 2876813429 171
146 iso_pu_bacteria 2876818435 2876825634 171
147 iso_pu_bacteria 2879074833 2879077752 171
148 iso_pu_bacteria 2879083081 2879089812 171
149 iso_pu_bacteria 2879099564 2879108720 171
150 iso_pu_bacteria 2879110137 2879113022 171
151 iso_pu_bacteria 2879127579 2879130918 171
152 iso_pu_bacteria 2879142872 2879148847 171
153 iso_pu_bacteria 2881364244 2881365823 171
154 iso_pu_bacteria 2881665667 2881665920 171
155 iso_pu_bacteria 2885366525 2885371185 171
156 iso_pu_bacteria 2885383462 2885389744 171
157 iso_pu_bacteria 2888378607 2888379736 171
158 iso_pu_bacteria 2888388044 2888390823 171
159 iso_pu_bacteria 2888419890 2888420459 171
160 iso_pu_bacteria 2889033259 2889035660 171
161 iso_pu_bacteria 2903727486 2903732047 171
162 iso_pu_bacteria 2903768456 2903773394 171
163 iso_pu_bacteria 2904666416 2904670406 171
164 iso_pu_bacteria 2904711408 2904715732 171
165 iso_pu_bacteria 2906602504 2906603095 171
166 iso_pu_bacteria 2906643746 2906648672 171
167 iso_pu_bacteria 2908775508 2908776082 171
168 iso_pu_bacteria 2922361189 2922364136 171
169 iso_pu_bacteria 2922368715 2922368782 171
170 iso_pu_bacteria 2922386360 2922392712 171
171 iso_pu_bacteria 2922393267 2922396289 171
172 iso_pu_bacteria 2929615660 2929618425 171
173 iso_pu_bacteria 2929624759 2929628890 171
174 iso_pu_bacteria 2932784394 2932786603 171
175 iso_pu_bacteria 2932794094 2932794471 171
176 iso_pu_bacteria 2932801729 2932806752 171
177 iso_pu_bacteria 2932809354 2932812337 171
178 iso_pu_bacteria 2932818245 2932823329 171
179 iso_pu_bacteria 2932828146 2932829831 171
180 iso_pu_bacteria 2933577622 2933580862 171
181 iso_pu_bacteria 2935608549 2935615335 171
182 iso_pu_bacteria 2935616580 2935618349 171
183 iso_pu_bacteria 2935638405 2935641253 171
184 iso_pu_bacteria 2935648319 2935654842 171
185 iso_pu_bacteria 2935656913 2935663725 171
186 iso_pu_bacteria 2935665750 2935670169 171
187 iso_pu_bacteria 2935675223 2935680833 171
188 iso_pu_bacteria 2935684952 2935689851 171
189 iso_pu_bacteria 2935694250 2935698372 171
190 iso_pu_bacteria 2935703347 2935707514 171
191 iso_pu_bacteria 2935713505 2935717371 171
192 iso_pu_bacteria 2935722832 2935723960 171
193 iso_pu_bacteria 2935732158 2935740169 171
194 iso_pu_bacteria 2935741537 2935749432 171
195 iso_pu_bacteria 2935750917 2935757205 171
196 iso_pu_bacteria 2935760218 2935763707 171
197 iso_pu_bacteria 2935769743 2935773399 171
198 iso_pu_bacteria 2935777560 2935782272 171
199 iso_pu_bacteria 2935785616 2935789225 171
200 iso_pu_bacteria 2935793552 2935797162 171
201 iso_pu_bacteria 2935801545 2935804108 171
202 iso_pu_bacteria 2935810662 2935815192 171
203 iso_pu_bacteria 2935819856 2935825287 171
204 iso_pu_bacteria 2935827899 2935830984 171
205 iso_pu_bacteria 2935837841 2935841595 171
206 iso_pu_bacteria 2935847175 2935853121 171
207 iso_pu_bacteria 2935855204 2935862556 171
208 iso_pu_bacteria 2935864058 2935866516 171
209 iso_pu_bacteria 2935873716 2935874823 171
210 iso_pu_bacteria 2935883170 2935888523 171
211 iso_pu_bacteria 2935908558 2935910131 171
212 iso_pu_bacteria 2935916978 2935918572 171
213 iso_pu_bacteria 2935926038 2935927958 171
214 iso_pu_bacteria 2935934488 2935936170 171
215 iso_pu_bacteria 2935942939 2935944277 171
216 iso_pu_bacteria 2935951376 2935952714 171
217 iso_pu_bacteria 2935959822 2935962493 171
218 iso_pu_bacteria 2935967501 2935969554 171
219 iso_pu_bacteria 2935975950 2935977685 171
220 iso_pu_bacteria 2935984226 2935984999 171
221 iso_pu_bacteria 2935992306 2935994329 171
222 iso_pu_bacteria 2936002035 2936004693 171
223 iso_pu_bacteria 2936011229 2936017878 171
224 iso_pu_bacteria 2936019824 2936026381 171
225 iso_pu_bacteria 2936028420 2936031571 171
226 iso_pu_bacteria 2936037263 2936043259 171
227 iso_pu_bacteria 2936046547 2936053357 171
228 iso_pu_bacteria 2936055302 2936056168 171
229 iso_pu_bacteria 2940556831 2940563119 171
230 iso_pu_bacteria 2941531003 2941532542 171
231 iso_pu_bacteria 2941538514 2941543035 171
232 iso_pu_bacteria 3005483717 3005486755 171
233 iso_pu_bacteria 3005506211 3005509327 171
234 iso_pu_bacteria 3005587118 3005594054 171
235 iso_pu_bacteria 3005594810 3005594870 171
236 iso_pu_bacteria 3005710791 3005710852 171
237 iso_pu_bacteria 3005718088 3005718148 171
238 iso_pu_bacteria 8006964411 8006969481 171
239 iso_pu_bacteria 8006984368 8006990775 171
240 iso_pu_bacteria 8006994254 8006996735 171
241 iso_pu_bacteria 8016511872 8016518367 171
242 iso_pu_bacteria 8016522445 8016525987 171
243 iso_pu_bacteria 8016530956 8016539590 171
244 iso_pu_bacteria 8016539877 8016543887 171
245 iso_pu_bacteria 8016548790 8016549417 171
246 iso_pu_bacteria 8016557553 8016557840 171
247 iso_pu_bacteria 8016575299 8016581917 171
248 iso_pu_bacteria 8016583857 8016586536 171
249 iso_pu_bacteria 8016595262 8016595859 171
250 iso_pu_bacteria 8016603502 8016606724 171
251 iso_pu_bacteria 8016613128 8016618624 171
252 iso_pu_bacteria 8016622563 8016623370 171
253 iso_pu_bacteria 8016630954 8016635828 171
254 iso_pu_bacteria 8017057580 8017058293 171
255 iso_pu_bacteria 8019530166 8019530871 171
256 iso_pu_bacteria 8019547302 8019550391 171
257 iso_pu_bacteria 8019576017 8019577416 171
258 iso_pu_bacteria 8019586578 8019595507 171
259 iso_pu_bacteria 8019597564 8019606256 171
260 iso_pu_bacteria 8019608314 8019612274 171
261 iso_pu_bacteria 8019619141 8019622808 171
262 iso_pu_bacteria 8019638758 8019640308 171
263 iso_pu_bacteria 8019648815 8019652637 171
264 iso_pu_bacteria 8019668869 8019676916 171
265 iso_pu_bacteria 8019678201 8019679074 171
266 iso_pu_bacteria 8019687851 8019696452 171
267 iso_pu_bacteria 8055742211 8055742276 171
268 iso_pu_bacteria 8056673599 8056675591 171
269 iso_pu_bacteria 8056681323 8056687539 171
270 iso_pu_bacteria 8056967851 8056971130 171
271 3300005467 Ga0070706_100552791 Ga0070706_1005527911 172
272 3300005471 Ga0070698_100128362 Ga0070698_1001283623 172
273 3300053080 Ga0500635_0014644 Ga0500635_0014644_1185_1703 172
274 3300053094 Ga0500566_0000054 Ga0500566_0000054_25640_26158 172
275 3300053095 Ga0500640_024388 Ga0500640_024388_1421_1939 172
276 3300053111 Ga0500572_047110 Ga0500572_047110_141_659 172
277 3300053115 Ga0500591_086602 Ga0500591_086602_441_959 172
278 3300053122 Ga0500608_130969 Ga0500608_130969_380_898 172
279 3300053123 Ga0500614_008371 Ga0500614_008371_42_560 172
280 3300053163 Ga0500639_005653 Ga0500639_005653_358_876 172
281 3300053735 Ga0500596_006628 Ga0500596_006628_884_1402 172
282 iso_pu_bacteria 2513237137 2513863563 172
283 iso_pu_bacteria 2524023228 2524538778 172
284 iso_pu_bacteria 2904690495 2904690653 172
285 iso_pu_bacteria 2904699407 2904708896 172
286 iso_pu_bacteria 2906635258 2906637383 172
287 iso_pu_bacteria 2906660503 2906668213 172
288 iso_pu_bacteria 2908756301 2908756357 172
289 iso_pu_bacteria 8006933436 8006936418 172
290 iso_pu_bacteria 8006973647 8006976388 172
291 3300001989 JGI24739J22299_10000950 JGI24739J22299_100009503 173
292 3300001990 JGI24737J22298_10003390 JGI24737J22298_100033906 173
293 3300002067 JGI24735J21928_10007692 JGI24735J21928_100076923 173
294 3300005339 Ga0070660_100581880 Ga0070660_1005818801 173
295 3300005437 Ga0070710_10195934 Ga0070710_101959342 173
296 3300005455 Ga0070663_100219999 Ga0070663_1002199991 173
297 3300005455 Ga0070663_100335763 Ga0070663_1003357632 173
298 3300005457 Ga0070662_100040180 Ga0070662_1000401804 173
299 3300005539 Ga0068853_100063111 Ga0068853_1000631113 173
300 3300005539 Ga0068853_100307623 Ga0068853_1003076233 173
301 3300005563 Ga0068855_100266223 Ga0068855_1002662231 173
302 3300005577 Ga0068857_100002988 Ga0068857_1000029882 173
303 3300005577 Ga0068857_100008016 Ga0068857_1000080165 173
304 3300005578 Ga0068854_100000689 Ga0068854_1000006895 173
305 3300005614 Ga0068856_100091417 Ga0068856_1000914173 173
306 3300005614 Ga0068856_100150365 Ga0068856_1001503653 173
307 3300005616 Ga0068852_100052928 Ga0068852_1000529282 173
308 3300005834 Ga0068851_10003958 Ga0068851_100039582 173
309 3300009093 Ga0105240_10007562 Ga0105240_100075625 173
310 3300009093 Ga0105240_10032680 Ga0105240_100326805 173
311 3300009174 Ga0105241_10002823 Ga0105241_100028233 173
312 3300009545 Ga0105237_10154404 Ga0105237_101544043 173
313 3300009551 Ga0105238_10003292 Ga0105238_100032928 173
314 3300010375 Ga0105239_10008866 Ga0105239_100088662 173
315 3300010375 Ga0105239_10011356 Ga0105239_100113563 173
316 3300025295 Ga0209564_1000747 Ga0209564_100074735 173
317 3300025321 Ga0207656_10009014 Ga0207656_100090142 173
318 3300025904 Ga0207647_10006453 Ga0207647_100064532 173
319 3300025911 Ga0207654_10000250 Ga0207654_1000025024 173
320 3300025913 Ga0207695_10000479 Ga0207695_1000047924 173
321 3300025913 Ga0207695_10001357 Ga0207695_100013578 173
322 3300025913 Ga0207695_10005090 Ga0207695_100050907 173
323 3300025914 Ga0207671_10041272 Ga0207671_100412724 173
324 3300025914 Ga0207671_10094823 Ga0207671_100948232 173
325 3300025919 Ga0207657_10365074 Ga0207657_103650742 173
326 3300025924 Ga0207694_10000662 Ga0207694_1000066224 173
327 3300025924 Ga0207694_10016406 Ga0207694_100164062 173
328 3300025933 Ga0207706_10031400 Ga0207706_100314002 173
329 3300025949 Ga0207667_10004639 Ga0207667_100046391 173
330 3300025949 Ga0207667_10006730 Ga0207667_100067305 173
331 3300025981 Ga0207640_10002370 Ga0207640_100023704 173
332 3300025981 Ga0207640_10236314 Ga0207640_102363141 173
333 3300026041 Ga0207639_10011004 Ga0207639_100110047 173
334 3300026041 Ga0207639_10269308 Ga0207639_102693082 173
335 3300026067 Ga0207678_10034302 Ga0207678_100343024 173
336 3300026078 Ga0207702_10000004 Ga0207702_10000004355 173
337 3300026078 Ga0207702_10127898 Ga0207702_101278983 173
338 3300026116 Ga0207674_10002413 Ga0207674_1000241310 173
339 3300026116 Ga0207674_10003431 Ga0207674_100034318 173
340 3300044684 Ga0466966_0034745 Ga0466966_0034745_2596_3117 173
341 3300046462 Ga0495651_0037559 Ga0495651_0037559_3016_3537 173
342 3300046511 Ga0495608_0496713 Ga0495608_0496713_196_717 173
343 3300046679 Ga0495623_0197848 Ga0495623_0197848_47_568 173
344 3300047320 Ga0495672_0014389 Ga0495672_0014389_1144_1671 173
345 3300047320 Ga0495672_0371852 Ga0495672_0371852_37_564 173
346 3300048088 Ga0495602_0409516 Ga0495602_0409516_181_702 173
347 3300048909 Ga0496106_0500551 Ga0496106_0500551_24_596 173
348 3300048911 Ga0496108_0293029 Ga0496108_0293029_64_636 173
349 3300048912 Ga0496109_0321310 Ga0496109_0321310_624_1196 173
350 3300048915 Ga0496112_0067611 Ga0496112_0067611_1329_1901 173
351 3300048916 Ga0496113_0835532 Ga0496113_0835532_104_676 173
352 3300048925 Ga0496122_0108994 Ga0496122_0108994_1182_1706 173
353 3300048926 Ga0496123_0250282 Ga0496123_0250282_14_562 173
354 3300048927 Ga0496124_0370637 Ga0496124_0370637_24_572 173
355 3300048929 Ga0496126_0887244 Ga0496126_0887244_97_621 173
356 3300003659 JGI25404J52841_10003238 JGI25404J52841_100032383 174
357 3300005437 Ga0070710_10000872 Ga0070710_100008724 174
358 3300005439 Ga0070711_100750453 Ga0070711_1007504531 174
359 3300005539 Ga0068853_100135559 Ga0068853_1001355592 174
360 3300005614 Ga0068856_100723432 Ga0068856_1007234322 174
361 3300005843 Ga0068860_100001623 Ga0068860_10000162315 174
362 3300005981 Ga0081538_10081593 Ga0081538_100815932 174
363 3300005983 Ga0081540_1004657 Ga0081540_100465710 174
364 3300006028 Ga0070717_10051071 Ga0070717_100510712 174
365 3300006028 Ga0070717_10062343 Ga0070717_100623432 174
366 3300006028 Ga0070717_10251791 Ga0070717_102517911 174
367 3300006163 Ga0070715_10001222 Ga0070715_100012223 174
368 3300006173 Ga0070716_100023433 Ga0070716_1000234333 174
369 3300006175 Ga0070712_100079979 Ga0070712_1000799792 174
370 3300006941 Ga0099825_1039686 Ga0099825_10396862 174
371 3300006942 Ga0099824_1004995 Ga0099824_10049958 174
372 3300006943 Ga0099822_1001207 Ga0099822_100120715 174
373 3300007788 Ga0099795_10141756 Ga0099795_101417562 174
374 3300009551 Ga0105238_10063611 Ga0105238_100636114 174
375 3300009551 Ga0105238_10443881 Ga0105238_104438811 174
376 3300010375 Ga0105239_10924833 Ga0105239_109248331 174
377 3300013296 Ga0157374_10232907 Ga0157374_102329072 174
378 3300013306 Ga0163162_10776997 Ga0163162_107769972 174
379 3300014325 Ga0163163_11378748 Ga0163163_113787481 174
380 3300021377 Ga0213874_10003476 Ga0213874_100034764 174
381 3300025261 Ga0209233_1002747 Ga0209233_10027474 174
382 3300025297 Ga0209758_1011615 Ga0209758_10116152 174
383 3300025898 Ga0207692_10010103 Ga0207692_100101032 174
384 3300025905 Ga0207685_10026807 Ga0207685_100268073 174
385 3300025906 Ga0207699_10017718 Ga0207699_100177181 174
386 3300025915 Ga0207693_10000156 Ga0207693_1000015631 174
387 3300025916 Ga0207663_10000158 Ga0207663_100001587 174
388 3300025916 Ga0207663_10366692 Ga0207663_103666921 174
389 3300025924 Ga0207694_10055826 Ga0207694_100558263 174
390 3300025928 Ga0207700_10608878 Ga0207700_106088781 174
391 3300025929 Ga0207664_10023882 Ga0207664_100238821 174
392 3300025929 Ga0207664_10066338 Ga0207664_100663382 174
393 3300025931 Ga0207644_10901776 Ga0207644_109017761 174
394 3300025939 Ga0207665_10000767 Ga0207665_1000076714 174
395 3300025949 Ga0207667_10233206 Ga0207667_102332062 174
396 3300025949 Ga0207667_10707297 Ga0207667_107072971 174
397 3300025961 Ga0207712_10281049 Ga0207712_102810491 174
398 3300026041 Ga0207639_10181850 Ga0207639_101818502 174
399 3300026078 Ga0207702_10625072 Ga0207702_106250721 174
400 3300027357 Ga0209589_1000046 Ga0209589_100004679 174
401 3300027361 Ga0209489_100106 Ga0209489_10010679 174
402 3300027363 Ga0209700_100105 Ga0209700_10010579 174
403 3300028379 Ga0268266_10459317 Ga0268266_104593172 174
404 3300028381 Ga0268264_10000227 Ga0268264_100002278 174
405 3300028786 Ga0307517_10000748 Ga0307517_1000074844 174
406 3300028794 Ga0307515_10033584 Ga0307515_100335848 174
407 3300031090 Ga0265760_10043486 Ga0265760_100434862 174
408 3300031249 Ga0265339_10154419 Ga0265339_101544192 174
409 3300031456 Ga0307513_10411605 Ga0307513_104116052 174
410 3300031712 Ga0265342_10296689 Ga0265342_102966891 174
411 3300031731 Ga0307405_10524171 Ga0307405_105241711 174
412 3300031901 Ga0307406_10300621 Ga0307406_103006212 174
413 3300035724 Ga0373933_0000698 Ga0373933_0000698_6235_6759 174
414 3300037466 Ga0395898_0293021 Ga0395898_0293021_712_1236 174
415 3300039437 Ga0436365_0852398 Ga0436365_0852398_932_1456 174
416 3300039437 Ga0436365_1677482 Ga0436365_1677482_915_1439 174
417 3300039437 Ga0436365_1928398 Ga0436365_1928398_1263_1787 174
418 3300039450 Ga0436363_1333239 Ga0436363_1333239_99_623 174
419 3300045976 Ga0466967_0041810 Ga0466967_0041810_3032_3556 174
420 3300046460 Ga0495638_0268296 Ga0495638_0268296_35_559 174
421 3300046491 Ga0495584_0129400 Ga0495584_0129400_229_753 174
422 3300046506 Ga0495583_0153022 Ga0495583_0153022_369_893 174
423 3300046519 Ga0495632_0361282 Ga0495632_0361282_80_604 174
424 3300046524 Ga0495648_0020469 Ga0495648_0020469_3266_3793 174
425 3300046616 Ga0495668_0086722 Ga0495668_0086722_70_594 174
426 3300047470 Ga0495681_0081383 Ga0495681_0081383_73_597 174
427 3300048911 Ga0496108_0974966 Ga0496108_0974966_10_534 174
428 3300048915 Ga0496112_0230887 Ga0496112_0230887_1191_1715 174
429 3300048917 Ga0496114_0104240 Ga0496114_0104240_1508_2080 174
430 3300048918 Ga0496115_0009727 Ga0496115_0009727_3506_4078 174
431 3300048918 Ga0496115_0158782 Ga0496115_0158782_870_1394 174
432 3300048921 Ga0496118_0137032 Ga0496118_0137032_304_828 174
433 3300048921 Ga0496118_0287439 Ga0496118_0287439_276_800 174
434 3300048924 Ga0496121_0088411 Ga0496121_0088411_1830_2357 174
435 3300048929 Ga0496126_0018058 Ga0496126_0018058_341_865 174
436 3300049460 Ga0495682_0118667 Ga0495682_0118667_308_832 174
437 3300049571 Ga0501034_0149277 Ga0501034_0149277_824_1351 174
438 3300049583 Ga0501067_0293368 Ga0501067_0293368_243_767 174
439 3300049593 Ga0501077_0045897 Ga0501077_0045897_1750_2277 174
440 3300049822 Ga0501035_0344564 Ga0501035_0344564_549_1076 174
441 3300050494 nmdc:mga06z11_604492_c1 nmdc:mga06z11_604492_c1_11_535 174
442 3300053088 Ga0500644_0030836 Ga0500644_0030836_456_980 174
443 3300053093 Ga0500651_0041180 Ga0500651_0041180_1870_2394 174
444 3300053098 Ga0500650_0144159 Ga0500650_0144159_538_1062 174
445 3300053118 Ga0500594_0002633 Ga0500594_0002633_2085_2609 174
446 3300053119 Ga0500595_038392 Ga0500595_038392_193_717 174
447 3300053125 Ga0500618_014579 Ga0500618_014579_364_900 174
448 3300053130 Ga0500642_0039763 Ga0500642_0039763_1241_1765 174
449 3300053136 Ga0500559_0028894 Ga0500559_0028894_1214_1750 174
450 3300053139 Ga0500568_0052897 Ga0500568_0052897_281_805 174
451 3300053142 Ga0500577_0001673 Ga0500577_0001673_3876_4412 174
452 3300053142 Ga0500577_0102862 Ga0500577_0102862_183_707 174
453 3300053177 Ga0500636_0042723 Ga0500636_0042723_1418_1945 174
454 3300053724 Ga0500570_048356 Ga0500570_048356_85_609 174
455 3300000549 LJQas_1003115 LJQas_10031151 175
456 3300002070 JGI24750J21931_1011487 JGI24750J21931_10114871 175
457 3300002075 JGI24738J21930_10006447 JGI24738J21930_100064471 175
458 3300002244 JGI24742J22300_10006916 JGI24742J22300_100069162 175
459 3300003203 JGI25406J46586_10000015 JGI25406J46586_1000001524 175
460 3300003203 JGI25406J46586_10013868 JGI25406J46586_100138683 175
461 3300003214 JGI25165J46597_1006926 JGI25165J46597_10069262 175
462 3300003215 JGI25153J46596_10004444 JGI25153J46596_100044444 175
463 3300003215 JGI25153J46596_10016721 JGI25153J46596_100167212 175
464 3300003215 JGI25153J46596_10018333 JGI25153J46596_100183334 175
465 3300003215 JGI25153J46596_10046570 JGI25153J46596_100465701 175
466 3300003354 JGI25160J50197_1006880 JGI25160J50197_10068804 175
467 3300003659 JGI25404J52841_10011196 JGI25404J52841_100111962 175
468 3300003752 Ga0055539_1008601 Ga0055539_10086011 175
469 3300003763 Ga0055529_1010850 Ga0055529_10108503 175
470 3300003763 Ga0055529_1013822 Ga0055529_10138222 175
471 3300003771 Ga0055526_1044030 Ga0055526_10440302 175
472 3300004625 Ga0055543_1003105 Ga0055543_10031052 175
473 3300005262 Ga0065165_1001886 Ga0065165_10018863 175
474 3300005262 Ga0065165_1041874 Ga0065165_10418742 175
475 3300005295 Ga0065707_10017090 Ga0065707_100170901 175
476 3300005327 Ga0070658_10116952 Ga0070658_101169522 175
477 3300005328 Ga0070676_10158273 Ga0070676_101582732 175
478 3300005328 Ga0070676_10360655 Ga0070676_103606551 175
479 3300005329 Ga0070683_100299149 Ga0070683_1002991491 175
480 3300005329 Ga0070683_100894143 Ga0070683_1008941431 175
481 3300005330 Ga0070690_100292355 Ga0070690_1002923552 175
482 3300005330 Ga0070690_100505583 Ga0070690_1005055832 175
483 3300005331 Ga0070670_100240073 Ga0070670_1002400731 175
484 3300005334 Ga0068869_100160569 Ga0068869_1001605692 175
485 3300005334 Ga0068869_100168960 Ga0068869_1001689602 175
486 3300005336 Ga0070680_100009352 Ga0070680_1000093526 175
487 3300005336 Ga0070680_100109995 Ga0070680_1001099951 175
488 3300005336 Ga0070680_100123724 Ga0070680_1001237243 175
489 3300005337 Ga0070682_100289367 Ga0070682_1002893672 175
490 3300005337 Ga0070682_100594443 Ga0070682_1005944431 175
491 3300005338 Ga0068868_101049560 Ga0068868_1010495601 175
492 3300005338 Ga0068868_101102029 Ga0068868_1011020291 175
493 3300005339 Ga0070660_100018794 Ga0070660_1000187944 175
494 3300005339 Ga0070660_100173282 Ga0070660_1001732821 175
495 3300005339 Ga0070660_100351557 Ga0070660_1003515571 175
496 3300005339 Ga0070660_100707779 Ga0070660_1007077791 175
497 3300005340 Ga0070689_100539710 Ga0070689_1005397101 175
498 3300005341 Ga0070691_10005991 Ga0070691_100059913 175
499 3300005341 Ga0070691_10409577 Ga0070691_104095771 175
500 3300005343 Ga0070687_100643881 Ga0070687_1006438811 175
501 3300005344 Ga0070661_100209415 Ga0070661_1002094151 175
502 3300005344 Ga0070661_100322031 Ga0070661_1003220312 175
503 3300005344 Ga0070661_100486758 Ga0070661_1004867582 175
504 3300005345 Ga0070692_10173375 Ga0070692_101733752 175
505 3300005347 Ga0070668_100012224 Ga0070668_1000122242 175
506 3300005347 Ga0070668_100074858 Ga0070668_1000748583 175
507 3300005347 Ga0070668_100122443 Ga0070668_1001224431 175
508 3300005347 Ga0070668_100246887 Ga0070668_1002468872 175
509 3300005347 Ga0070668_100262224 Ga0070668_1002622242 175
510 3300005347 Ga0070668_100302191 Ga0070668_1003021912 175
511 3300005347 Ga0070668_100348033 Ga0070668_1003480331 175
512 3300005353 Ga0070669_100099323 Ga0070669_1000993231 175
513 3300005353 Ga0070669_100136605 Ga0070669_1001366051 175
514 3300005353 Ga0070669_100188041 Ga0070669_1001880412 175
515 3300005353 Ga0070669_100440211 Ga0070669_1004402111 175
516 3300005354 Ga0070675_100554306 Ga0070675_1005543062 175
517 3300005355 Ga0070671_100096306 Ga0070671_1000963061 175
518 3300005355 Ga0070671_100737593 Ga0070671_1007375931 175
519 3300005356 Ga0070674_100087142 Ga0070674_1000871423 175
520 3300005356 Ga0070674_100155154 Ga0070674_1001551542 175
521 3300005356 Ga0070674_101303673 Ga0070674_1013036731 175
522 3300005364 Ga0070673_100358039 Ga0070673_1003580391 175
523 3300005365 Ga0070688_100222632 Ga0070688_1002226321 175
524 3300005366 Ga0070659_100069607 Ga0070659_1000696072 175
525 3300005366 Ga0070659_100986191 Ga0070659_1009861911 175
526 3300005367 Ga0070667_100229055 Ga0070667_1002290551 175
527 3300005434 Ga0070709_10002011 Ga0070709_100020116 175
528 3300005434 Ga0070709_10057722 Ga0070709_100577222 175
529 3300005434 Ga0070709_10539826 Ga0070709_105398261 175
530 3300005435 Ga0070714_100073637 Ga0070714_1000736372 175
531 3300005435 Ga0070714_100171751 Ga0070714_1001717512 175
532 3300005435 Ga0070714_100422521 Ga0070714_1004225211 175
533 3300005436 Ga0070713_100041608 Ga0070713_1000416085 175
534 3300005436 Ga0070713_100078712 Ga0070713_1000787122 175
535 3300005436 Ga0070713_100119880 Ga0070713_1001198802 175
536 3300005436 Ga0070713_100264896 Ga0070713_1002648962 175
537 3300005436 Ga0070713_100267066 Ga0070713_1002670661 175
538 3300005436 Ga0070713_100322207 Ga0070713_1003222071 175
539 3300005437 Ga0070710_10013092 Ga0070710_100130924 175
540 3300005437 Ga0070710_10028873 Ga0070710_100288733 175
541 3300005437 Ga0070710_10320347 Ga0070710_103203471 175
542 3300005437 Ga0070710_10504055 Ga0070710_105040551 175
543 3300005437 Ga0070710_10539740 Ga0070710_105397401 175
544 3300005439 Ga0070711_100008236 Ga0070711_1000082363 175
545 3300005439 Ga0070711_100043404 Ga0070711_1000434043 175
546 3300005439 Ga0070711_100090510 Ga0070711_1000905101 175
547 3300005439 Ga0070711_100122058 Ga0070711_1001220582 175
548 3300005439 Ga0070711_100187446 Ga0070711_1001874461 175
549 3300005439 Ga0070711_100559012 Ga0070711_1005590121 175
550 3300005441 Ga0070700_100537694 Ga0070700_1005376941 175
551 3300005455 Ga0070663_100013673 Ga0070663_1000136735 175
552 3300005455 Ga0070663_100018768 Ga0070663_1000187681 175
553 3300005455 Ga0070663_100023522 Ga0070663_1000235222 175
554 3300005455 Ga0070663_100077368 Ga0070663_1000773682 175
555 3300005455 Ga0070663_100092535 Ga0070663_1000925352 175
556 3300005455 Ga0070663_100204298 Ga0070663_1002042981 175
557 3300005455 Ga0070663_100467154 Ga0070663_1004671541 175
558 3300005455 Ga0070663_100640712 Ga0070663_1006407121 175
559 3300005456 Ga0070678_100043263 Ga0070678_1000432631 175
560 3300005456 Ga0070678_100108302 Ga0070678_1001083022 175
561 3300005456 Ga0070678_100178862 Ga0070678_1001788622 175
562 3300005457 Ga0070662_100183100 Ga0070662_1001831002 175
563 3300005457 Ga0070662_100528446 Ga0070662_1005284461 175
564 3300005457 Ga0070662_100708822 Ga0070662_1007088221 175
565 3300005457 Ga0070662_100882379 Ga0070662_1008823791 175
566 3300005457 Ga0070662_101163248 Ga0070662_1011632481 175
567 3300005458 Ga0070681_10013547 Ga0070681_100135471 175
568 3300005458 Ga0070681_10072747 Ga0070681_100727475 175
569 3300005458 Ga0070681_10276518 Ga0070681_102765182 175
570 3300005458 Ga0070681_10450146 Ga0070681_104501462 175
571 3300005459 Ga0068867_100083306 Ga0068867_1000833063 175
572 3300005459 Ga0068867_100810829 Ga0068867_1008108291 175
573 3300005466 Ga0070685_10162228 Ga0070685_101622282 175
574 3300005467 Ga0070706_100224878 Ga0070706_1002248783 175
575 3300005471 Ga0070698_100569266 Ga0070698_1005692661 175
576 3300005518 Ga0070699_100131436 Ga0070699_1001314361 175
577 3300005530 Ga0070679_100041775 Ga0070679_1000417753 175
578 3300005530 Ga0070679_100206683 Ga0070679_1002066832 175
579 3300005530 Ga0070679_100220342 Ga0070679_1002203421 175
580 3300005530 Ga0070679_100246654 Ga0070679_1002466543 175
581 3300005530 Ga0070679_100346124 Ga0070679_1003461242 175
582 3300005530 Ga0070679_100433466 Ga0070679_1004334661 175
583 3300005535 Ga0070684_100066098 Ga0070684_1000660983 175
584 3300005535 Ga0070684_100127231 Ga0070684_1001272313 175
585 3300005535 Ga0070684_100433063 Ga0070684_1004330632 175
586 3300005535 Ga0070684_100518537 Ga0070684_1005185371 175
587 3300005536 Ga0070697_100076378 Ga0070697_1000763782 175
588 3300005539 Ga0068853_100010722 Ga0068853_1000107226 175
589 3300005539 Ga0068853_100058648 Ga0068853_1000586484 175
590 3300005539 Ga0068853_100908965 Ga0068853_1009089652 175
591 3300005539 Ga0068853_101225955 Ga0068853_1012259551 175
592 3300005539 Ga0068853_101579449 Ga0068853_1015794491 175
593 3300005543 Ga0070672_100051989 Ga0070672_1000519892 175
594 3300005543 Ga0070672_100223244 Ga0070672_1002232442 175
595 3300005544 Ga0070686_100082807 Ga0070686_1000828072 175
596 3300005546 Ga0070696_100811732 Ga0070696_1008117321 175
597 3300005547 Ga0070693_100182519 Ga0070693_1001825191 175
598 3300005547 Ga0070693_100231614 Ga0070693_1002316142 175
599 3300005547 Ga0070693_100256793 Ga0070693_1002567931 175
600 3300005547 Ga0070693_100258217 Ga0070693_1002582172 175
601 3300005548 Ga0070665_100122323 Ga0070665_1001223234 175
602 3300005548 Ga0070665_100173976 Ga0070665_1001739761 175
603 3300005548 Ga0070665_100219984 Ga0070665_1002199842 175
604 3300005548 Ga0070665_100282652 Ga0070665_1002826522 175
605 3300005548 Ga0070665_100432308 Ga0070665_1004323082 175
606 3300005548 Ga0070665_100460944 Ga0070665_1004609442 175
607 3300005548 Ga0070665_100559060 Ga0070665_1005590601 175
608 3300005548 Ga0070665_100678299 Ga0070665_1006782991 175
609 3300005549 Ga0070704_100701181 Ga0070704_1007011811 175
610 3300005563 Ga0068855_100034337 Ga0068855_1000343375 175
611 3300005563 Ga0068855_100037580 Ga0068855_1000375804 175
612 3300005563 Ga0068855_100051685 Ga0068855_1000516855 175
613 3300005563 Ga0068855_100300171 Ga0068855_1003001712 175
614 3300005563 Ga0068855_100575850 Ga0068855_1005758501 175
615 3300005563 Ga0068855_101093612 Ga0068855_1010936121 175
616 3300005563 Ga0068855_101390712 Ga0068855_1013907121 175
617 3300005564 Ga0070664_100053626 Ga0070664_1000536262 175
618 3300005564 Ga0070664_100297206 Ga0070664_1002972061 175
619 3300005564 Ga0070664_100941790 Ga0070664_1009417901 175
620 3300005577 Ga0068857_100015801 Ga0068857_1000158012 175
621 3300005577 Ga0068857_100130693 Ga0068857_1001306932 175
622 3300005578 Ga0068854_100176582 Ga0068854_1001765821 175
623 3300005578 Ga0068854_100231226 Ga0068854_1002312262 175
624 3300005614 Ga0068856_100041193 Ga0068856_1000411934 175
625 3300005614 Ga0068856_100122900 Ga0068856_1001229002 175
626 3300005614 Ga0068856_100285720 Ga0068856_1002857202 175
627 3300005614 Ga0068856_100293164 Ga0068856_1002931643 175
628 3300005614 Ga0068856_100565292 Ga0068856_1005652921 175
629 3300005614 Ga0068856_100570665 Ga0068856_1005706652 175
630 3300005614 Ga0068856_100578990 Ga0068856_1005789901 175
631 3300005614 Ga0068856_100781199 Ga0068856_1007811992 175
632 3300005615 Ga0070702_100164228 Ga0070702_1001642282 175
633 3300005616 Ga0068852_100040046 Ga0068852_1000400462 175
634 3300005616 Ga0068852_100121689 Ga0068852_1001216892 175
635 3300005616 Ga0068852_100295009 Ga0068852_1002950092 175
636 3300005616 Ga0068852_100347869 Ga0068852_1003478692 175
637 3300005616 Ga0068852_100450914 Ga0068852_1004509142 175
638 3300005616 Ga0068852_100451944 Ga0068852_1004519442 175
639 3300005616 Ga0068852_100999916 Ga0068852_1009999161 175
640 3300005616 Ga0068852_101005432 Ga0068852_1010054321 175
641 3300005617 Ga0068859_100055596 Ga0068859_1000555962 175
642 3300005617 Ga0068859_100113481 Ga0068859_1001134811 175
643 3300005617 Ga0068859_100368700 Ga0068859_1003687001 175
644 3300005617 Ga0068859_100529064 Ga0068859_1005290642 175
645 3300005618 Ga0068864_100010685 Ga0068864_1000106855 175
646 3300005618 Ga0068864_100070104 Ga0068864_1000701041 175
647 3300005618 Ga0068864_100193808 Ga0068864_1001938083 175
648 3300005719 Ga0068861_100059460 Ga0068861_1000594602 175
649 3300005719 Ga0068861_100223314 Ga0068861_1002233141 175
650 3300005719 Ga0068861_100238612 Ga0068861_1002386122 175
651 3300005719 Ga0068861_100276342 Ga0068861_1002763421 175
652 3300005834 Ga0068851_10058123 Ga0068851_100581232 175
653 3300005840 Ga0068870_10145690 Ga0068870_101456902 175
654 3300005841 Ga0068863_100199834 Ga0068863_1001998342 175
655 3300005841 Ga0068863_100210895 Ga0068863_1002108952 175
656 3300005841 Ga0068863_101037046 Ga0068863_1010370461 175
657 3300005842 Ga0068858_100019227 Ga0068858_1000192274 175
658 3300005842 Ga0068858_100024626 Ga0068858_1000246265 175
659 3300005842 Ga0068858_100133581 Ga0068858_1001335813 175
660 3300005842 Ga0068858_100274839 Ga0068858_1002748391 175
661 3300005842 Ga0068858_100430016 Ga0068858_1004300162 175
662 3300005842 Ga0068858_100453634 Ga0068858_1004536342 175
663 3300005842 Ga0068858_101191788 Ga0068858_1011917881 175
664 3300005843 Ga0068860_100268252 Ga0068860_1002682523 175
665 3300005843 Ga0068860_100373600 Ga0068860_1003736001 175
666 3300005843 Ga0068860_100566113 Ga0068860_1005661132 175
667 3300005843 Ga0068860_100758112 Ga0068860_1007581121 175
668 3300005843 Ga0068860_100871966 Ga0068860_1008719661 175
669 3300005844 Ga0068862_100118150 Ga0068862_1001181502 175
670 3300005844 Ga0068862_100383474 Ga0068862_1003834741 175
671 3300005844 Ga0068862_100392645 Ga0068862_1003926452 175
672 3300005844 Ga0068862_100486013 Ga0068862_1004860132 175
673 3300005844 Ga0068862_100513137 Ga0068862_1005131371 175
674 3300005844 Ga0068862_100531476 Ga0068862_1005314761 175
675 3300005844 Ga0068862_100574171 Ga0068862_1005741711 175
676 3300005937 Ga0081455_10011753 Ga0081455_100117534 175
677 3300005937 Ga0081455_10030453 Ga0081455_100304532 175
678 3300005937 Ga0081455_10044915 Ga0081455_100449154 175
679 3300005937 Ga0081455_10065396 Ga0081455_100653964 175
680 3300005981 Ga0081538_10096710 Ga0081538_100967103 175
681 3300005983 Ga0081540_1000641 Ga0081540_100064120 175
682 3300005983 Ga0081540_1002768 Ga0081540_10027685 175
683 3300005983 Ga0081540_1012285 Ga0081540_10122857 175
684 3300005983 Ga0081540_1019885 Ga0081540_10198852 175
685 3300005983 Ga0081540_1022974 Ga0081540_10229742 175
686 3300005983 Ga0081540_1030989 Ga0081540_10309893 175
687 3300005983 Ga0081540_1091743 Ga0081540_10917432 175
688 3300005983 Ga0081540_1116108 Ga0081540_11161082 175
689 3300005985 Ga0081539_10000064 Ga0081539_10000064189 175
690 3300005985 Ga0081539_10001127 Ga0081539_1000112722 175
691 3300005985 Ga0081539_10049479 Ga0081539_100494792 175
692 3300006028 Ga0070717_10003745 Ga0070717_100037459 175
693 3300006028 Ga0070717_10087173 Ga0070717_100871734 175
694 3300006028 Ga0070717_10508766 Ga0070717_105087662 175
695 3300006028 Ga0070717_10746778 Ga0070717_107467781 175
696 3300006038 Ga0075365_10017356 Ga0075365_100173563 175
697 3300006038 Ga0075365_10061649 Ga0075365_100616494 175
698 3300006038 Ga0075365_10113512 Ga0075365_101135123 175
699 3300006038 Ga0075365_10156261 Ga0075365_101562612 175
700 3300006038 Ga0075365_10234326 Ga0075365_102343262 175
701 3300006038 Ga0075365_10514033 Ga0075365_105140331 175
702 3300006042 Ga0075368_10013479 Ga0075368_100134792 175
703 3300006042 Ga0075368_10057272 Ga0075368_100572723 175
704 3300006048 Ga0075363_100002972 Ga0075363_1000029722 175
705 3300006048 Ga0075363_100101873 Ga0075363_1001018732 175
706 3300006048 Ga0075363_100274372 Ga0075363_1002743722 175
707 3300006048 Ga0075363_100516078 Ga0075363_1005160781 175
708 3300006051 Ga0075364_10027868 Ga0075364_100278682 175
709 3300006051 Ga0075364_10058333 Ga0075364_100583332 175
710 3300006051 Ga0075364_10205722 Ga0075364_102057221 175
711 3300006051 Ga0075364_10371178 Ga0075364_103711782 175
712 3300006163 Ga0070715_10040865 Ga0070715_100408652 175
713 3300006173 Ga0070716_100068726 Ga0070716_1000687263 175
714 3300006173 Ga0070716_100405927 Ga0070716_1004059271 175
715 3300006173 Ga0070716_100443012 Ga0070716_1004430121 175
716 3300006175 Ga0070712_100009491 Ga0070712_1000094914 175
717 3300006175 Ga0070712_100114364 Ga0070712_1001143642 175
718 3300006175 Ga0070712_100141178 Ga0070712_1001411784 175
719 3300006175 Ga0070712_100212311 Ga0070712_1002123112 175
720 3300006175 Ga0070712_100549527 Ga0070712_1005495272 175
721 3300006175 Ga0070712_100745083 Ga0070712_1007450831 175
722 3300006175 Ga0070712_100807331 Ga0070712_1008073311 175
723 3300006177 Ga0075362_10195098 Ga0075362_101950982 175
724 3300006177 Ga0075362_10246743 Ga0075362_102467431 175
725 3300006177 Ga0075362_10318261 Ga0075362_103182611 175
726 3300006178 Ga0075367_10050636 Ga0075367_100506363 175
727 3300006178 Ga0075367_10165437 Ga0075367_101654372 175
728 3300006178 Ga0075367_10185763 Ga0075367_101857632 175
729 3300006186 Ga0075369_10030464 Ga0075369_100304641 175
730 3300006186 Ga0075369_10053362 Ga0075369_100533622 175
731 3300006186 Ga0075369_10057154 Ga0075369_100571542 175
732 3300006186 Ga0075369_10079997 Ga0075369_100799972 175
733 3300006186 Ga0075369_10161585 Ga0075369_101615851 175
734 3300006195 Ga0075366_10002189 Ga0075366_1000218911 175
735 3300006195 Ga0075366_10075611 Ga0075366_100756113 175
736 3300006237 Ga0097621_100005281 Ga0097621_1000052818 175
737 3300006237 Ga0097621_100046218 Ga0097621_1000462182 175
738 3300006237 Ga0097621_100756708 Ga0097621_1007567082 175
739 3300006237 Ga0097621_101213849 Ga0097621_1012138491 175
740 3300006353 Ga0075370_10014282 Ga0075370_100142825 175
741 3300006353 Ga0075370_10046269 Ga0075370_100462693 175
742 3300006353 Ga0075370_10110178 Ga0075370_101101781 175
743 3300006353 Ga0075370_10239912 Ga0075370_102399122 175
744 3300006353 Ga0075370_10251878 Ga0075370_102518781 175
745 3300006353 Ga0075370_10254275 Ga0075370_102542751 175
746 3300006353 Ga0075370_10622119 Ga0075370_106221191 175
747 3300006358 Ga0068871_100105507 Ga0068871_1001055075 175
748 3300006358 Ga0068871_100130610 Ga0068871_1001306102 175
749 3300006852 Ga0075433_10245834 Ga0075433_102458342 175
750 3300006852 Ga0075433_10527330 Ga0075433_105273302 175
751 3300006871 Ga0075434_100100279 Ga0075434_1001002791 175
752 3300006871 Ga0075434_100119417 Ga0075434_1001194171 175
753 3300006871 Ga0075434_100423347 Ga0075434_1004233472 175
754 3300006881 Ga0068865_100077261 Ga0068865_1000772611 175
755 3300006881 Ga0068865_100124039 Ga0068865_1001240392 175
756 3300006881 Ga0068865_100504217 Ga0068865_1005042171 175
757 3300006931 Ga0097620_100055594 Ga0097620_1000555945 175
758 3300006931 Ga0097620_100113485 Ga0097620_1001134853 175
759 3300006931 Ga0097620_100368689 Ga0097620_1003686891 175
760 3300006931 Ga0097620_100529060 Ga0097620_1005290601 175
761 3300007265 Ga0099794_10124935 Ga0099794_101249352 175
762 3300007788 Ga0099795_10034418 Ga0099795_100344182 175
763 3300007788 Ga0099795_10100085 Ga0099795_101000851 175
764 3300009011 Ga0105251_10130578 Ga0105251_101305782 175
765 3300009011 Ga0105251_10298853 Ga0105251_102988531 175
766 3300009092 Ga0105250_10054952 Ga0105250_100549522 175
767 3300009093 Ga0105240_10069048 Ga0105240_100690482 175
768 3300009093 Ga0105240_10162542 Ga0105240_101625424 175
769 3300009093 Ga0105240_10218258 Ga0105240_102182583 175
770 3300009093 Ga0105240_10250981 Ga0105240_102509812 175
771 3300009093 Ga0105240_10321140 Ga0105240_103211402 175
772 3300009093 Ga0105240_10563251 Ga0105240_105632511 175
773 3300009094 Ga0111539_10394179 Ga0111539_103941792 175
774 3300009098 Ga0105245_10084813 Ga0105245_100848133 175
775 3300009098 Ga0105245_10740899 Ga0105245_107408991 175
776 3300009098 Ga0105245_10745722 Ga0105245_107457221 175
777 3300009098 Ga0105245_11097571 Ga0105245_110975711 175
778 3300009101 Ga0105247_10034563 Ga0105247_100345632 175
779 3300009101 Ga0105247_10152729 Ga0105247_101527291 175
780 3300009101 Ga0105247_10213354 Ga0105247_102133542 175
781 3300009101 Ga0105247_10255145 Ga0105247_102551452 175
782 3300009101 Ga0105247_10260534 Ga0105247_102605342 175
783 3300009101 Ga0105247_10961168 Ga0105247_109611681 175
784 3300009147 Ga0114129_10752504 Ga0114129_107525042 175
785 3300009148 Ga0105243_10222520 Ga0105243_102225201 175
786 3300009148 Ga0105243_10301176 Ga0105243_103011762 175
787 3300009148 Ga0105243_10673534 Ga0105243_106735342 175
788 3300009148 Ga0105243_11024974 Ga0105243_110249741 175
789 3300009174 Ga0105241_10037835 Ga0105241_100378352 175
790 3300009174 Ga0105241_10056298 Ga0105241_100562984 175
791 3300009174 Ga0105241_10091921 Ga0105241_100919212 175
792 3300009174 Ga0105241_10187570 Ga0105241_101875701 175
793 3300009174 Ga0105241_10301968 Ga0105241_103019681 175
794 3300009176 Ga0105242_10238466 Ga0105242_102384662 175
795 3300009176 Ga0105242_10240184 Ga0105242_102401842 175
796 3300009176 Ga0105242_11210465 Ga0105242_112104651 175
797 3300009177 Ga0105248_10092104 Ga0105248_100921042 175
798 3300009177 Ga0105248_10363321 Ga0105248_103633212 175
799 3300009177 Ga0105248_10684713 Ga0105248_106847131 175
800 3300009545 Ga0105237_10003763 Ga0105237_1000376310 175
801 3300009545 Ga0105237_10015975 Ga0105237_100159753 175
802 3300009545 Ga0105237_10041525 Ga0105237_100415254 175
803 3300009545 Ga0105237_10116175 Ga0105237_101161753 175
804 3300009545 Ga0105237_10232636 Ga0105237_102326362 175
805 3300009545 Ga0105237_10283868 Ga0105237_102838682 175
806 3300009545 Ga0105237_10363991 Ga0105237_103639912 175
807 3300009545 Ga0105237_10431643 Ga0105237_104316432 175
808 3300009551 Ga0105238_10028229 Ga0105238_100282296 175
809 3300009551 Ga0105238_10067898 Ga0105238_100678984 175
810 3300009551 Ga0105238_10230198 Ga0105238_102301982 175
811 3300009551 Ga0105238_10285408 Ga0105238_102854081 175
812 3300009551 Ga0105238_10353732 Ga0105238_103537322 175
813 3300009551 Ga0105238_10450395 Ga0105238_104503952 175
814 3300009551 Ga0105238_11359110 Ga0105238_113591101 175
815 3300009553 Ga0105249_10256296 Ga0105249_102562962 175
816 3300009553 Ga0105249_11302373 Ga0105249_113023732 175
817 3300009553 Ga0105249_11330288 Ga0105249_113302881 175
818 3300010159 Ga0099796_10001437 Ga0099796_100014373 175
819 3300010159 Ga0099796_10170528 Ga0099796_101705281 175
820 3300010375 Ga0105239_10086297 Ga0105239_100862972 175
821 3300010375 Ga0105239_10301128 Ga0105239_103011282 175
822 3300010375 Ga0105239_10314020 Ga0105239_103140202 175
823 3300010375 Ga0105239_10314283 Ga0105239_103142831 175
824 3300010375 Ga0105239_10335428 Ga0105239_103354282 175
825 3300010375 Ga0105239_10477319 Ga0105239_104773192 175
826 3300010375 Ga0105239_10605626 Ga0105239_106056261 175
827 3300010375 Ga0105239_10650730 Ga0105239_106507302 175
828 3300010375 Ga0105239_10706011 Ga0105239_107060111 175
829 3300010375 Ga0105239_10831249 Ga0105239_108312491 175
830 3300011119 Ga0105246_10035926 Ga0105246_100359262 175
831 3300011119 Ga0105246_10157351 Ga0105246_101573512 175
832 3300011119 Ga0105246_10209134 Ga0105246_102091342 175
833 3300011119 Ga0105246_10641415 Ga0105246_106414152 175
834 3300011119 Ga0105246_10894964 Ga0105246_108949641 175
835 3300011119 Ga0105246_11716442 Ga0105246_117164421 175
836 3300012506 Ga0157324_1005979 Ga0157324_10059791 175
837 3300013102 Ga0157371_10822979 Ga0157371_108229791 175
838 3300013104 Ga0157370_10138156 Ga0157370_101381562 175
839 3300013104 Ga0157370_10149133 Ga0157370_101491332 175
840 3300013104 Ga0157370_10387865 Ga0157370_103878652 175
841 3300013104 Ga0157370_10796504 Ga0157370_107965041 175
842 3300013105 Ga0157369_10014541 Ga0157369_100145417 175
843 3300013105 Ga0157369_10092228 Ga0157369_100922282 175
844 3300013105 Ga0157369_10096129 Ga0157369_100961294 175
845 3300013105 Ga0157369_10098106 Ga0157369_100981061 175
846 3300013105 Ga0157369_10122600 Ga0157369_101226002 175
847 3300013105 Ga0157369_11090462 Ga0157369_110904621 175
848 3300013105 Ga0157369_11267428 Ga0157369_112674281 175
849 3300013296 Ga0157374_10003265 Ga0157374_100032658 175
850 3300013296 Ga0157374_10278484 Ga0157374_102784842 175
851 3300013297 Ga0157378_10125884 Ga0157378_101258844 175
852 3300013297 Ga0157378_10202070 Ga0157378_102020702 175
853 3300013306 Ga0163162_10087159 Ga0163162_100871593 175
854 3300013306 Ga0163162_10175710 Ga0163162_101757102 175
855 3300013306 Ga0163162_11344740 Ga0163162_113447401 175
856 3300013306 Ga0163162_11364441 Ga0163162_113644411 175
857 3300013307 Ga0157372_10105097 Ga0157372_101050974 175
858 3300013307 Ga0157372_10289539 Ga0157372_102895392 175
859 3300013307 Ga0157372_10533287 Ga0157372_105332872 175
860 3300013307 Ga0157372_10715921 Ga0157372_107159211 175
861 3300013307 Ga0157372_10798483 Ga0157372_107984831 175
862 3300013307 Ga0157372_10975207 Ga0157372_109752071 175
863 3300013307 Ga0157372_11294335 Ga0157372_112943352 175
864 3300013307 Ga0157372_11304815 Ga0157372_113048151 175
865 3300013308 Ga0157375_10026900 Ga0157375_100269005 175
866 3300013308 Ga0157375_10229758 Ga0157375_102297582 175
867 3300013308 Ga0157375_10476432 Ga0157375_104764322 175
868 3300013308 Ga0157375_10832461 Ga0157375_108324611 175
869 3300014325 Ga0163163_10052491 Ga0163163_100524913 175
870 3300014325 Ga0163163_10423706 Ga0163163_104237062 175
871 3300014325 Ga0163163_10697677 Ga0163163_106976772 175
872 3300014326 Ga0157380_10857415 Ga0157380_108574151 175
873 3300014326 Ga0157380_11594667 Ga0157380_115946671 175
874 3300014497 Ga0182008_10255591 Ga0182008_102555912 175
875 3300014968 Ga0157379_11195695 Ga0157379_111956952 175
876 3300014969 Ga0157376_10043730 Ga0157376_100437302 175
877 3300014969 Ga0157376_10049317 Ga0157376_100493172 175
878 3300014969 Ga0157376_10451447 Ga0157376_104514471 175
879 3300014969 Ga0157376_10704411 Ga0157376_107044111 175
880 3300014969 Ga0157376_10923548 Ga0157376_109235481 175
881 3300015262 Ga0182007_10069713 Ga0182007_100697132 175
882 3300017792 Ga0163161_10189899 Ga0163161_101898992 175
883 3300020078 Ga0206352_10701083 Ga0206352_107010831 175
884 3300021320 Ga0214544_1000056 Ga0214544_100005669 175
885 3300021321 Ga0214542_1000071 Ga0214542_100007166 175
886 3300021324 Ga0214545_1000033 Ga0214545_100003356 175
887 3300021327 Ga0214543_1000105 Ga0214543_100010556 175
888 3300021358 Ga0213873_10001574 Ga0213873_100015742 175
889 3300021358 Ga0213873_10007116 Ga0213873_100071162 175
890 3300021377 Ga0213874_10077900 Ga0213874_100779001 175
891 3300021384 Ga0213876_10007380 Ga0213876_100073808 175
892 3300021384 Ga0213876_10125874 Ga0213876_101258742 175
893 3300021441 Ga0213871_10005961 Ga0213871_100059613 175
894 3300025230 Ga0209563_104671 Ga0209563_1046712 175
895 3300025245 Ga0207425_1019274 Ga0207425_10192741 175
896 3300025253 Ga0209677_100313 Ga0209677_1003132 175
897 3300025253 Ga0209677_104221 Ga0209677_1042212 175
898 3300025254 Ga0209148_1000308 Ga0209148_100030814 175
899 3300025254 Ga0209148_1011159 Ga0209148_10111591 175
900 3300025261 Ga0209233_1004470 Ga0209233_10044704 175
901 3300025261 Ga0209233_1004898 Ga0209233_10048982 175
902 3300025261 Ga0209233_1010739 Ga0209233_10107393 175
903 3300025272 Ga0209455_1001786 Ga0209455_100178610 175
904 3300025272 Ga0209455_1002759 Ga0209455_10027597 175
905 3300025272 Ga0209455_1004855 Ga0209455_10048555 175
906 3300025273 Ga0209673_1020468 Ga0209673_10204682 175
907 3300025295 Ga0209564_1003448 Ga0209564_10034484 175
908 3300025295 Ga0209564_1006612 Ga0209564_10066122 175
909 3300025297 Ga0209758_1000182 Ga0209758_1000182125 175
910 3300025297 Ga0209758_1000293 Ga0209758_100029356 175
911 3300025297 Ga0209758_1000363 Ga0209758_100036340 175
912 3300025297 Ga0209758_1003509 Ga0209758_10035093 175
913 3300025297 Ga0209758_1003517 Ga0209758_10035175 175
914 3300025297 Ga0209758_1006314 Ga0209758_100631410 175
915 3300025297 Ga0209758_1011704 Ga0209758_10117044 175
916 3300025297 Ga0209758_1032984 Ga0209758_10329842 175
917 3300025297 Ga0209758_1038054 Ga0209758_10380542 175
918 3300025299 Ga0209256_1008893 Ga0209256_10088934 175
919 3300025299 Ga0209256_1061560 Ga0209256_10615602 175
920 3300025299 Ga0209256_1101099 Ga0209256_11010991 175
921 3300025302 Ga0207426_1000628 Ga0207426_10006288 175
922 3300025302 Ga0207426_1000992 Ga0207426_100099214 175
923 3300025302 Ga0207426_1004958 Ga0207426_10049589 175
924 3300025302 Ga0207426_1006404 Ga0207426_10064046 175
925 3300025303 Ga0209051_1066456 Ga0209051_10664561 175
926 3300025315 Ga0207697_10197271 Ga0207697_101972711 175
927 3300025711 Ga0207696_1064733 Ga0207696_10647331 175
928 3300025885 Ga0207653_10092156 Ga0207653_100921561 175
929 3300025898 Ga0207692_10001137 Ga0207692_100011377 175
930 3300025898 Ga0207692_10013707 Ga0207692_100137074 175
931 3300025898 Ga0207692_10264037 Ga0207692_102640372 175
932 3300025899 Ga0207642_10332300 Ga0207642_103323002 175
933 3300025900 Ga0207710_10042271 Ga0207710_100422712 175
934 3300025900 Ga0207710_10137713 Ga0207710_101377131 175
935 3300025900 Ga0207710_10156366 Ga0207710_101563662 175
936 3300025900 Ga0207710_10188126 Ga0207710_101881261 175
937 3300025901 Ga0207688_10012485 Ga0207688_100124852 175
938 3300025901 Ga0207688_10068049 Ga0207688_100680492 175
939 3300025901 Ga0207688_10072092 Ga0207688_100720921 175
940 3300025901 Ga0207688_10220535 Ga0207688_102205352 175
941 3300025903 Ga0207680_10099180 Ga0207680_100991801 175
942 3300025903 Ga0207680_10146184 Ga0207680_101461842 175
943 3300025903 Ga0207680_10160065 Ga0207680_101600651 175
944 3300025904 Ga0207647_10099975 Ga0207647_100999752 175
945 3300025905 Ga0207685_10038670 Ga0207685_100386702 175
946 3300025906 Ga0207699_10000995 Ga0207699_100009958 175
947 3300025906 Ga0207699_10066296 Ga0207699_100662962 175
948 3300025906 Ga0207699_10133590 Ga0207699_101335902 175
949 3300025906 Ga0207699_10691017 Ga0207699_106910171 175
950 3300025907 Ga0207645_10278514 Ga0207645_102785141 175
951 3300025907 Ga0207645_10701827 Ga0207645_107018271 175
952 3300025908 Ga0207643_10021166 Ga0207643_100211662 175
953 3300025908 Ga0207643_10251924 Ga0207643_102519241 175
954 3300025909 Ga0207705_10151296 Ga0207705_101512962 175
955 3300025909 Ga0207705_10461067 Ga0207705_104610671 175
956 3300025911 Ga0207654_10020214 Ga0207654_100202145 175
957 3300025911 Ga0207654_10024384 Ga0207654_100243842 175
958 3300025911 Ga0207654_10069183 Ga0207654_100691832 175
959 3300025911 Ga0207654_10110387 Ga0207654_101103871 175
960 3300025911 Ga0207654_10223849 Ga0207654_102238491 175
961 3300025912 Ga0207707_10000526 Ga0207707_1000052628 175
962 3300025912 Ga0207707_10001497 Ga0207707_1000149713 175
963 3300025912 Ga0207707_10034652 Ga0207707_100346522 175
964 3300025912 Ga0207707_10125242 Ga0207707_101252422 175
965 3300025912 Ga0207707_10352931 Ga0207707_103529312 175
966 3300025912 Ga0207707_10464788 Ga0207707_104647882 175
967 3300025913 Ga0207695_10000107 Ga0207695_1000010772 175
968 3300025913 Ga0207695_10048603 Ga0207695_100486031 175
969 3300025913 Ga0207695_10089217 Ga0207695_100892173 175
970 3300025913 Ga0207695_10090447 Ga0207695_100904471 175
971 3300025913 Ga0207695_10217187 Ga0207695_102171871 175
972 3300025914 Ga0207671_10004749 Ga0207671_100047497 175
973 3300025914 Ga0207671_10091185 Ga0207671_100911853 175
974 3300025914 Ga0207671_10097153 Ga0207671_100971532 175
975 3300025914 Ga0207671_10125116 Ga0207671_101251162 175
976 3300025914 Ga0207671_10172137 Ga0207671_101721372 175
977 3300025914 Ga0207671_10253575 Ga0207671_102535752 175
978 3300025914 Ga0207671_10306080 Ga0207671_103060802 175
979 3300025915 Ga0207693_10009900 Ga0207693_100099008 175
980 3300025915 Ga0207693_10046531 Ga0207693_100465313 175
981 3300025915 Ga0207693_10183839 Ga0207693_101838392 175
982 3300025915 Ga0207693_10336257 Ga0207693_103362572 175
983 3300025915 Ga0207693_10483784 Ga0207693_104837841 175
984 3300025915 Ga0207693_10541136 Ga0207693_105411361 175
985 3300025916 Ga0207663_10010958 Ga0207663_100109584 175
986 3300025916 Ga0207663_10085686 Ga0207663_100856862 175
987 3300025916 Ga0207663_10356544 Ga0207663_103565442 175
988 3300025916 Ga0207663_10517897 Ga0207663_105178971 175
989 3300025917 Ga0207660_10005316 Ga0207660_100053166 175
990 3300025917 Ga0207660_10091304 Ga0207660_100913042 175
991 3300025917 Ga0207660_10153953 Ga0207660_101539531 175
992 3300025918 Ga0207662_10313203 Ga0207662_103132032 175
993 3300025919 Ga0207657_10011015 Ga0207657_100110154 175
994 3300025919 Ga0207657_10035461 Ga0207657_100354614 175
995 3300025919 Ga0207657_10310633 Ga0207657_103106332 175
996 3300025919 Ga0207657_10530153 Ga0207657_105301531 175
997 3300025919 Ga0207657_10532778 Ga0207657_105327781 175
998 3300025920 Ga0207649_10156713 Ga0207649_101567131 175
999 3300025920 Ga0207649_10366818 Ga0207649_103668182 175
1000 3300025920 Ga0207649_10654935 Ga0207649_106549351 175
1001 3300025921 Ga0207652_10001692 Ga0207652_1000169213 175
1002 3300025921 Ga0207652_10032926 Ga0207652_100329264 175
1003 3300025921 Ga0207652_10146914 Ga0207652_101469142 175
1004 3300025921 Ga0207652_10213035 Ga0207652_102130352 175
1005 3300025921 Ga0207652_10463384 Ga0207652_104633841 175
1006 3300025923 Ga0207681_10108510 Ga0207681_101085102 175
1007 3300025923 Ga0207681_10492688 Ga0207681_104926881 175
1008 3300025924 Ga0207694_10009782 Ga0207694_100097824 175
1009 3300025924 Ga0207694_10163266 Ga0207694_101632662 175
1010 3300025924 Ga0207694_10206586 Ga0207694_102065862 175
1011 3300025924 Ga0207694_10273247 Ga0207694_102732471 175
1012 3300025924 Ga0207694_10596093 Ga0207694_105960931 175
1013 3300025927 Ga0207687_10021258 Ga0207687_100212582 175
1014 3300025927 Ga0207687_10021407 Ga0207687_100214074 175
1015 3300025927 Ga0207687_10124497 Ga0207687_101244972 175
1016 3300025927 Ga0207687_10793184 Ga0207687_107931841 175
1017 3300025928 Ga0207700_10013486 Ga0207700_100134862 175
1018 3300025928 Ga0207700_10062912 Ga0207700_100629122 175
1019 3300025928 Ga0207700_10148802 Ga0207700_101488022 175
1020 3300025928 Ga0207700_10255803 Ga0207700_102558032 175
1021 3300025928 Ga0207700_10261752 Ga0207700_102617522 175
1022 3300025928 Ga0207700_11162551 Ga0207700_111625511 175
1023 3300025929 Ga0207664_10056391 Ga0207664_100563912 175
1024 3300025929 Ga0207664_10135284 Ga0207664_101352842 175
1025 3300025929 Ga0207664_10304874 Ga0207664_103048741 175
1026 3300025931 Ga0207644_10093046 Ga0207644_100930461 175
1027 3300025931 Ga0207644_10103533 Ga0207644_101035332 175
1028 3300025931 Ga0207644_10607570 Ga0207644_106075701 175
1029 3300025932 Ga0207690_10250673 Ga0207690_102506732 175
1030 3300025932 Ga0207690_10788357 Ga0207690_107883571 175
1031 3300025932 Ga0207690_10844335 Ga0207690_108443351 175
1032 3300025933 Ga0207706_10178663 Ga0207706_101786631 175
1033 3300025933 Ga0207706_10250133 Ga0207706_102501332 175
1034 3300025933 Ga0207706_10294975 Ga0207706_102949752 175
1035 3300025933 Ga0207706_10394640 Ga0207706_103946401 175
1036 3300025933 Ga0207706_10523192 Ga0207706_105231922 175
1037 3300025934 Ga0207686_10141777 Ga0207686_101417772 175
1038 3300025934 Ga0207686_10301473 Ga0207686_103014731 175
1039 3300025934 Ga0207686_10552874 Ga0207686_105528741 175
1040 3300025935 Ga0207709_10108534 Ga0207709_101085341 175
1041 3300025935 Ga0207709_10232503 Ga0207709_102325032 175
1042 3300025936 Ga0207670_10042390 Ga0207670_100423904 175
1043 3300025937 Ga0207669_10097050 Ga0207669_100970501 175
1044 3300025937 Ga0207669_10176913 Ga0207669_101769132 175
1045 3300025937 Ga0207669_10411326 Ga0207669_104113262 175
1046 3300025937 Ga0207669_10655678 Ga0207669_106556782 175
1047 3300025938 Ga0207704_10040225 Ga0207704_100402252 175
1048 3300025938 Ga0207704_10104493 Ga0207704_101044932 175
1049 3300025938 Ga0207704_10161752 Ga0207704_101617522 175
1050 3300025938 Ga0207704_10976450 Ga0207704_109764501 175
1051 3300025939 Ga0207665_10085667 Ga0207665_100856672 175
1052 3300025939 Ga0207665_10160132 Ga0207665_101601322 175
1053 3300025939 Ga0207665_10166950 Ga0207665_101669501 175
1054 3300025939 Ga0207665_10545960 Ga0207665_105459601 175
1055 3300025939 Ga0207665_10926395 Ga0207665_109263951 175
1056 3300025940 Ga0207691_10359523 Ga0207691_103595231 175
1057 3300025940 Ga0207691_10736296 Ga0207691_107362961 175
1058 3300025941 Ga0207711_10040386 Ga0207711_100403865 175
1059 3300025941 Ga0207711_10051750 Ga0207711_100517501 175
1060 3300025941 Ga0207711_10145914 Ga0207711_101459142 175
1061 3300025941 Ga0207711_10623864 Ga0207711_106238641 175
1062 3300025942 Ga0207689_10120540 Ga0207689_101205403 175
1063 3300025942 Ga0207689_10300753 Ga0207689_103007531 175
1064 3300025944 Ga0207661_10000579 Ga0207661_1000057911 175
1065 3300025944 Ga0207661_10154209 Ga0207661_101542092 175
1066 3300025944 Ga0207661_10163164 Ga0207661_101631642 175
1067 3300025945 Ga0207679_10035086 Ga0207679_100350864 175
1068 3300025945 Ga0207679_10590918 Ga0207679_105909182 175
1069 3300025945 Ga0207679_10735724 Ga0207679_107357242 175
1070 3300025945 Ga0207679_11461799 Ga0207679_114617991 175
1071 3300025949 Ga0207667_10003118 Ga0207667_1000311814 175
1072 3300025949 Ga0207667_10040447 Ga0207667_100404471 175
1073 3300025949 Ga0207667_10075301 Ga0207667_100753011 175
1074 3300025949 Ga0207667_10122850 Ga0207667_101228502 175
1075 3300025949 Ga0207667_10146401 Ga0207667_101464012 175
1076 3300025949 Ga0207667_10252241 Ga0207667_102522411 175
1077 3300025949 Ga0207667_10946284 Ga0207667_109462841 175
1078 3300025960 Ga0207651_10104110 Ga0207651_101041103 175
1079 3300025960 Ga0207651_11315938 Ga0207651_113159381 175
1080 3300025961 Ga0207712_10041791 Ga0207712_100417914 175
1081 3300025961 Ga0207712_10140275 Ga0207712_101402751 175
1082 3300025972 Ga0207668_10075087 Ga0207668_100750872 175
1083 3300025972 Ga0207668_10183978 Ga0207668_101839782 175
1084 3300025972 Ga0207668_10274955 Ga0207668_102749552 175
1085 3300025972 Ga0207668_10284939 Ga0207668_102849392 175
1086 3300025972 Ga0207668_10540088 Ga0207668_105400881 175
1087 3300025981 Ga0207640_10170523 Ga0207640_101705231 175
1088 3300025981 Ga0207640_10326692 Ga0207640_103266922 175
1089 3300025981 Ga0207640_10390890 Ga0207640_103908901 175
1090 3300025981 Ga0207640_10799079 Ga0207640_107990791 175
1091 3300025986 Ga0207658_10365279 Ga0207658_103652792 175
1092 3300025986 Ga0207658_11142151 Ga0207658_111421511 175
1093 3300026023 Ga0207677_10015264 Ga0207677_100152642 175
1094 3300026023 Ga0207677_10483441 Ga0207677_104834411 175
1095 3300026023 Ga0207677_10755698 Ga0207677_107556982 175
1096 3300026035 Ga0207703_10030990 Ga0207703_100309904 175
1097 3300026035 Ga0207703_10109467 Ga0207703_101094672 175
1098 3300026035 Ga0207703_10178944 Ga0207703_101789443 175
1099 3300026035 Ga0207703_10434506 Ga0207703_104345061 175
1100 3300026035 Ga0207703_10473550 Ga0207703_104735501 175
1101 3300026035 Ga0207703_11016565 Ga0207703_110165651 175
1102 3300026041 Ga0207639_10126847 Ga0207639_101268473 175
1103 3300026041 Ga0207639_10181091 Ga0207639_101810912 175
1104 3300026041 Ga0207639_10545268 Ga0207639_105452681 175
1105 3300026041 Ga0207639_10639565 Ga0207639_106395652 175
1106 3300026041 Ga0207639_10690944 Ga0207639_106909442 175
1107 3300026067 Ga0207678_10004742 Ga0207678_100047429 175
1108 3300026067 Ga0207678_10005908 Ga0207678_1000590811 175
1109 3300026067 Ga0207678_10027619 Ga0207678_100276192 175
1110 3300026067 Ga0207678_10045103 Ga0207678_100451034 175
1111 3300026067 Ga0207678_10183024 Ga0207678_101830241 175
1112 3300026067 Ga0207678_10281965 Ga0207678_102819652 175
1113 3300026067 Ga0207678_10354436 Ga0207678_103544361 175
1114 3300026067 Ga0207678_10708466 Ga0207678_107084661 175
1115 3300026075 Ga0207708_10103418 Ga0207708_101034182 175
1116 3300026075 Ga0207708_10479217 Ga0207708_104792172 175
1117 3300026078 Ga0207702_10000350 Ga0207702_1000035031 175
1118 3300026078 Ga0207702_10328969 Ga0207702_103289692 175
1119 3300026078 Ga0207702_10972214 Ga0207702_109722141 175
1120 3300026088 Ga0207641_10309494 Ga0207641_103094942 175
1121 3300026088 Ga0207641_10401860 Ga0207641_104018602 175
1122 3300026088 Ga0207641_10687156 Ga0207641_106871562 175
1123 3300026089 Ga0207648_10322652 Ga0207648_103226521 175
1124 3300026095 Ga0207676_10325356 Ga0207676_103253562 175
1125 3300026095 Ga0207676_10547084 Ga0207676_105470841 175
1126 3300026095 Ga0207676_10941712 Ga0207676_109417121 175
1127 3300026116 Ga0207674_10027875 Ga0207674_100278752 175
1128 3300026116 Ga0207674_10137096 Ga0207674_101370962 175
1129 3300026116 Ga0207674_10231139 Ga0207674_102311392 175
1130 3300026116 Ga0207674_10309256 Ga0207674_103092562 175
1131 3300026116 Ga0207674_10430133 Ga0207674_104301331 175
1132 3300026116 Ga0207674_10667099 Ga0207674_106670991 175
1133 3300026118 Ga0207675_100393016 Ga0207675_1003930162 175
1134 3300026118 Ga0207675_100488708 Ga0207675_1004887081 175
1135 3300026118 Ga0207675_100520210 Ga0207675_1005202102 175
1136 3300026121 Ga0207683_10019572 Ga0207683_100195727 175
1137 3300026121 Ga0207683_10106094 Ga0207683_101060942 175
1138 3300026121 Ga0207683_10195500 Ga0207683_101955002 175
1139 3300026121 Ga0207683_10499216 Ga0207683_104992161 175
1140 3300026121 Ga0207683_10594973 Ga0207683_105949731 175
1141 3300026142 Ga0207698_10072550 Ga0207698_100725501 175
1142 3300026142 Ga0207698_10400702 Ga0207698_104007021 175
1143 3300026142 Ga0207698_10448893 Ga0207698_104488932 175
1144 3300026142 Ga0207698_10875539 Ga0207698_108755392 175
1145 3300026142 Ga0207698_10933570 Ga0207698_109335701 175
1146 3300026142 Ga0207698_12036979 Ga0207698_120369791 175
1147 3300027296 Ga0209389_1000208 Ga0209389_100020812 175
1148 3300027296 Ga0209389_1000217 Ga0209389_100021710 175
1149 3300027357 Ga0209589_1000032 Ga0209589_100003272 175
1150 3300027361 Ga0209489_101970 Ga0209489_10197012 175
1151 3300027361 Ga0209489_102214 Ga0209489_10221410 175
1152 3300027363 Ga0209700_100011 Ga0209700_10001156 175
1153 3300027671 Ga0209588_1022329 Ga0209588_10223291 175
1154 3300027866 Ga0209813_10024260 Ga0209813_100242601 175
1155 3300027907 Ga0207428_10081696 Ga0207428_100816962 175
1156 3300027907 Ga0207428_10158335 Ga0207428_101583352 175
1157 3300028379 Ga0268266_10001794 Ga0268266_1000179416 175
1158 3300028379 Ga0268266_10003485 Ga0268266_1000348511 175
1159 3300028379 Ga0268266_10052016 Ga0268266_100520162 175
1160 3300028379 Ga0268266_10080260 Ga0268266_100802602 175
1161 3300028379 Ga0268266_10157851 Ga0268266_101578512 175
1162 3300028379 Ga0268266_10273320 Ga0268266_102733202 175
1163 3300028379 Ga0268266_10323404 Ga0268266_103234042 175
1164 3300028379 Ga0268266_10434976 Ga0268266_104349762 175
1165 3300028379 Ga0268266_10635027 Ga0268266_106350272 175
1166 3300028379 Ga0268266_11144245 Ga0268266_111442451 175
1167 3300028380 Ga0268265_10031179 Ga0268265_100311794 175
1168 3300028380 Ga0268265_10035766 Ga0268265_100357663 175
1169 3300028380 Ga0268265_10098352 Ga0268265_100983523 175
1170 3300028380 Ga0268265_10499866 Ga0268265_104998661 175
1171 3300028380 Ga0268265_10717526 Ga0268265_107175261 175
1172 3300028380 Ga0268265_11088052 Ga0268265_110880521 175
1173 3300028381 Ga0268264_10146612 Ga0268264_101466121 175
1174 3300028563 Ga0265319_1075277 Ga0265319_10752771 175
1175 3300028573 Ga0265334_10005796 Ga0265334_100057962 175
1176 3300028577 Ga0265318_10024584 Ga0265318_100245842 175
1177 3300028653 Ga0265323_10001243 Ga0265323_100012439 175
1178 3300028786 Ga0307517_10247128 Ga0307517_102471282 175
1179 3300028786 Ga0307517_10311345 Ga0307517_103113451 175
1180 3300028794 Ga0307515_10549312 Ga0307515_105493122 175
1181 3300028800 Ga0265338_10000277 Ga0265338_1000027769 175
1182 3300028800 Ga0265338_10380167 Ga0265338_103801672 175
1183 3300029957 Ga0265324_10032056 Ga0265324_100320562 175
1184 3300030521 Ga0307511_10119296 Ga0307511_101192962 175
1185 3300030521 Ga0307511_10321736 Ga0307511_103217361 175
1186 3300030522 Ga0307512_10180268 Ga0307512_101802682 175
1187 3300030878 Ga0265770_1059654 Ga0265770_10596541 175
1188 3300031238 Ga0265332_10050779 Ga0265332_100507792 175
1189 3300031239 Ga0265328_10068047 Ga0265328_100680472 175
1190 3300031241 Ga0265325_10016892 Ga0265325_100168925 175
1191 3300031247 Ga0265340_10030891 Ga0265340_100308912 175
1192 3300031247 Ga0265340_10155031 Ga0265340_101550311 175
1193 3300031249 Ga0265339_10000971 Ga0265339_1000097119 175
1194 3300031249 Ga0265339_10212781 Ga0265339_102127811 175
1195 3300031249 Ga0265339_10219204 Ga0265339_102192042 175
1196 3300031249 Ga0265339_10226465 Ga0265339_102264651 175
1197 3300031344 Ga0265316_10193756 Ga0265316_101937561 175
1198 3300031456 Ga0307513_10104424 Ga0307513_101044243 175
1199 3300031507 Ga0307509_10109929 Ga0307509_101099292 175
1200 3300031507 Ga0307509_10327048 Ga0307509_103270482 175
1201 3300031507 Ga0307509_10338960 Ga0307509_103389601 175
1202 3300031507 Ga0307509_10457314 Ga0307509_104573141 175
1203 3300031548 Ga0307408_100239629 Ga0307408_1002396292 175
1204 3300031548 Ga0307408_100926523 Ga0307408_1009265232 175
1205 3300031595 Ga0265313_10105838 Ga0265313_101058382 175
1206 3300031616 Ga0307508_10000002 Ga0307508_10000002199 175
1207 3300031616 Ga0307508_10069065 Ga0307508_100690651 175
1208 3300031616 Ga0307508_10122470 Ga0307508_101224702 175
1209 3300031616 Ga0307508_10277054 Ga0307508_102770542 175
1210 3300031649 Ga0307514_10349235 Ga0307514_103492351 175
1211 3300031711 Ga0265314_10002643 Ga0265314_100026432 175
1212 3300031712 Ga0265342_10025508 Ga0265342_100255083 175
1213 3300031730 Ga0307516_10010347 Ga0307516_100103474 175
1214 3300031730 Ga0307516_10057865 Ga0307516_100578652 175
1215 3300031730 Ga0307516_10080348 Ga0307516_100803483 175
1216 3300031730 Ga0307516_10194781 Ga0307516_101947812 175
1217 3300031730 Ga0307516_10206258 Ga0307516_102062581 175
1218 3300031730 Ga0307516_10254949 Ga0307516_102549492 175
1219 3300031730 Ga0307516_10368644 Ga0307516_103686441 175
1220 3300031731 Ga0307405_10397902 Ga0307405_103979021 175
1221 3300031731 Ga0307405_10480557 Ga0307405_104805572 175
1222 3300031824 Ga0307413_10131084 Ga0307413_101310842 175
1223 3300031838 Ga0307518_10446350 Ga0307518_104463501 175
1224 3300031901 Ga0307406_10833496 Ga0307406_108334961 175
1225 3300031903 Ga0307407_11008579 Ga0307407_110085791 175
1226 3300031911 Ga0307412_10047890 Ga0307412_100478904 175
1227 3300031911 Ga0307412_10212569 Ga0307412_102125692 175
1228 3300031911 Ga0307412_10611833 Ga0307412_106118332 175
1229 3300031995 Ga0307409_100719317 Ga0307409_1007193171 175
1230 3300031995 Ga0307409_101144653 Ga0307409_1011446531 175
1231 3300031995 Ga0307409_101680384 Ga0307409_1016803841 175
1232 3300032002 Ga0307416_100286049 Ga0307416_1002860492 175
1233 3300032002 Ga0307416_101286121 Ga0307416_1012861211 175
1234 3300032005 Ga0307411_10043818 Ga0307411_100438181 175
1235 3300032005 Ga0307411_10356706 Ga0307411_103567062 175
1236 3300032126 Ga0307415_100120643 Ga0307415_1001206432 175
1237 3300032126 Ga0307415_100409367 Ga0307415_1004093672 175
1238 3300032126 Ga0307415_100459188 Ga0307415_1004591882 175
1239 3300032126 Ga0307415_101066138 Ga0307415_1010661381 175
1240 3300033179 Ga0307507_10019880 Ga0307507_100198802 175
1241 3300033180 Ga0307510_10006388 Ga0307510_100063888 175
1242 3300033180 Ga0307510_10060535 Ga0307510_100605354 175
1243 3300033180 Ga0307510_10098029 Ga0307510_100980294 175
1244 3300033180 Ga0307510_10158713 Ga0307510_101587132 175
1245 3300033180 Ga0307510_10263364 Ga0307510_102633642 175
1246 3300033180 Ga0307510_10351245 Ga0307510_103512451 175
1247 3300035083 Ga0373926_0204760 Ga0373926_0204760_145_672 175
1248 3300035085 Ga0373929_0013219 Ga0373929_0013219_771_1298 175
1249 3300035086 Ga0373934_0403326 Ga0373934_0403326_19_546 175
1250 3300035092 Ga0373952_0036440 Ga0373952_0036440_92_619 175
1251 3300035113 Ga0373936_0175848 Ga0373936_0175848_118_645 175
1252 3300035115 Ga0373941_0051773 Ga0373941_0051773_87_614 175
1253 3300035116 Ga0373945_0012397 Ga0373945_0012397_1827_2354 175
1254 3300035117 Ga0373953_0003462 Ga0373953_0003462_2383_2910 175
1255 3300035117 Ga0373953_0020246 Ga0373953_0020246_1561_2088 175
1256 3300035118 Ga0373954_0022141 Ga0373954_0022141_619_1146 175
1257 3300035119 Ga0373956_0021820 Ga0373956_0021820_1339_1866 175
1258 3300035121 Ga0373960_0083787 Ga0373960_0083787_88_615 175
1259 3300035170 Ga0373943_0166696 Ga0373943_0166696_309_836 175
1260 3300035171 Ga0373946_0015222 Ga0373946_0015222_1076_1603 175
1261 3300035171 Ga0373946_0059994 Ga0373946_0059994_360_887 175
1262 3300035171 Ga0373946_0082896 Ga0373946_0082896_832_1359 175
1263 3300035172 Ga0373955_0355612 Ga0373955_0355612_87_614 175
1264 3300035207 Ga0373942_0087315 Ga0373942_0087315_92_619 175
1265 3300035207 Ga0373942_0093267 Ga0373942_0093267_139_666 175
1266 3300035410 Ga0373924_0012332 Ga0373924_0012332_13_540 175
1267 3300035410 Ga0373924_0339503 Ga0373924_0339503_23_550 175
1268 3300035691 Ga0373931_0021852 Ga0373931_0021852_1175_1702 175
1269 3300035691 Ga0373931_0459360 Ga0373931_0459360_46_576 175
1270 3300035691 Ga0373931_0590294 Ga0373931_0590294_153_680 175
1271 3300035692 Ga0373935_0195807 Ga0373935_0195807_584_1111 175
1272 3300035692 Ga0373935_0413105 Ga0373935_0413105_193_720 175
1273 3300035692 Ga0373935_0483323 Ga0373935_0483323_15_542 175
1274 3300035692 Ga0373935_0614193 Ga0373935_0614193_116_643 175
1275 3300035695 Ga0373927_0009105 Ga0373927_0009105_3029_3556 175
1276 3300035695 Ga0373927_0031979 Ga0373927_0031979_2062_2589 175
1277 3300035695 Ga0373927_0080808 Ga0373927_0080808_1434_1961 175
1278 3300035695 Ga0373927_0184881 Ga0373927_0184881_647_1174 175
1279 3300035695 Ga0373927_0571068 Ga0373927_0571068_25_552 175
1280 3300035725 Ga0373947_0063009 Ga0373947_0063009_1277_1804 175
1281 3300035725 Ga0373947_0110883 Ga0373947_0110883_909_1436 175
1282 3300035725 Ga0373947_0663986 Ga0373947_0663986_109_636 175
1283 3300036401 Ga0373937_1502319 Ga0373937_1502319_36_563 175
1284 3300037068 Ga0373925_0068982 Ga0373925_0068982_1743_2270 175
1285 3300037068 Ga0373925_0071521 Ga0373925_0071521_97_627 175
1286 3300037068 Ga0373925_0074104 Ga0373925_0074104_1920_2447 175
1287 3300037068 Ga0373925_0105854 Ga0373925_0105854_273_800 175
1288 3300037068 Ga0373925_0113109 Ga0373925_0113109_705_1232 175
1289 3300037068 Ga0373925_0348751 Ga0373925_0348751_209_736 175
1290 3300037068 Ga0373925_0400676 Ga0373925_0400676_527_1054 175
1291 3300037068 Ga0373925_0863353 Ga0373925_0863353_11_538 175
1292 3300037312 Ga0395899_0090738 Ga0395899_0090738_77_607 175
1293 3300037312 Ga0395899_0611421 Ga0395899_0611421_56_583 175
1294 3300037418 Ga0395900_0001316 Ga0395900_0001316_25598_26128 175
1295 3300037418 Ga0395900_0093150 Ga0395900_0093150_1756_2283 175
1296 3300037418 Ga0395900_0196580 Ga0395900_0196580_1291_1821 175
1297 3300037418 Ga0395900_1203688 Ga0395900_1203688_128_658 175
1298 3300037466 Ga0395898_0010275 Ga0395898_0010275_3682_4212 175
1299 3300037466 Ga0395898_0094798 Ga0395898_0094798_370_897 175
1300 3300037466 Ga0395898_0821870 Ga0395898_0821870_277_807 175
1301 3300037471 Ga0395905_0032556 Ga0395905_0032556_2786_3316 175
1302 3300037471 Ga0395905_0100478 Ga0395905_0100478_2031_2561 175
1303 3300037471 Ga0395905_0583893 Ga0395905_0583893_366_896 175
1304 3300037471 Ga0395905_0584936 Ga0395905_0584936_440_967 175
1305 3300037853 Ga0436364_0479711 Ga0436364_0479711_930_1457 175
1306 3300038443 Ga0395901_0002762 Ga0395901_0002762_8059_8589 175
1307 3300038443 Ga0395901_0024984 Ga0395901_0024984_2152_2679 175
1308 3300038443 Ga0395901_0428126 Ga0395901_0428126_409_939 175
1309 3300038443 Ga0395901_0681119 Ga0395901_0681119_53_583 175
1310 3300039437 Ga0436365_0115121 Ga0436365_0115121_1052_1579 175
1311 3300039437 Ga0436365_0758504 Ga0436365_0758504_7310_7837 175
1312 3300039437 Ga0436365_1046572 Ga0436365_1046572_1143_1670 175
1313 3300039438 Ga0436360_0118011 Ga0436360_0118011_294_821 175
1314 3300039438 Ga0436360_0578760 Ga0436360_0578760_764_1291 175
1315 3300039447 Ga0436361_0310662 Ga0436361_0310662_16_543 175
1316 3300039447 Ga0436361_0944908 Ga0436361_0944908_1035_1562 175
1317 3300039450 Ga0436363_0519627 Ga0436363_0519627_891_1418 175
1318 3300039450 Ga0436363_0768792 Ga0436363_0768792_493_1020 175
1319 3300039450 Ga0436363_1259985 Ga0436363_1259985_100_630 175
1320 3300039453 Ga0436362_0646312 Ga0436362_0646312_2387_2914 175
1321 3300039453 Ga0436362_0683872 Ga0436362_0683872_85_612 175
1322 3300039453 Ga0436362_1179571 Ga0436362_1179571_164_691 175
1323 3300041413 Ga0439465_0044053 Ga0439465_0044053_209_736 175
1324 3300041413 Ga0439465_0305056 Ga0439465_0305056_43_570 175
1325 3300041441 Ga0451787_690731 Ga0451787_690731_16_543 175
1326 3300041443 Ga0451789_0739197 Ga0451789_0739197_117_647 175
1327 3300041460 Ga0451802_1371081 Ga0451802_1371081_170_700 175
1328 3300041492 Ga0451835_0832063 Ga0451835_0832063_966_1496 175
1329 3300041494 Ga0451837_1147329 Ga0451837_1147329_171_698 175
1330 3300041498 Ga0451841_1120699 Ga0451841_1120699_93_620 175
1331 3300041503 Ga0451847_0064418 Ga0451847_0064418_95_625 175
1332 3300041505 Ga0451849_1286864 Ga0451849_1286864_45_572 175
1333 3300041511 Ga0451855_0776935 Ga0451855_0776935_33_563 175
1334 3300041512 Ga0451853_0660391 Ga0451853_0660391_112_642 175
1335 3300041997 Ga0439431_0086864 Ga0439431_0086864_225_752 175
1336 3300042006 Ga0439432_062685 Ga0439432_062685_117_644 175
1337 3300042012 Ga0439455_0115184 Ga0439455_0115184_200_730 175
1338 3300042438 Ga0439459_0010127 Ga0439459_0010127_264_791 175
1339 3300044656 Ga0466969_0051658 Ga0466969_0051658_949_1476 175
1340 3300044656 Ga0466969_0161890 Ga0466969_0161890_91_621 175
1341 3300044656 Ga0466969_0233157 Ga0466969_0233157_22_549 175
1342 3300044658 Ga0466972_0000233 Ga0466972_0000233_10383_10913 175
1343 3300044658 Ga0466972_0159983 Ga0466972_0159983_484_1014 175
1344 3300044683 Ga0466965_0036463 Ga0466965_0036463_358_888 175
1345 3300044683 Ga0466965_0310190 Ga0466965_0310190_284_814 175
1346 3300044684 Ga0466966_0002503 Ga0466966_0002503_7463_7993 175
1347 3300044693 Ga0466961_0082983 Ga0466961_0082983_760_1293 175
1348 3300044694 Ga0466963_0244298 Ga0466963_0244298_582_1109 175
1349 3300044694 Ga0466963_0547362 Ga0466963_0547362_194_727 175
1350 3300044706 Ga0466964_0085037 Ga0466964_0085037_184_711 175
1351 3300044706 Ga0466964_0095512 Ga0466964_0095512_345_875 175
1352 3300044719 Ga0466971_0197001 Ga0466971_0197001_224_754 175
1353 3300044735 Ga0466968_0039562 Ga0466968_0039562_1307_1837 175
1354 3300044735 Ga0466968_0137252 Ga0466968_0137252_42_575 175
1355 3300044735 Ga0466968_0151835 Ga0466968_0151835_505_1038 175
1356 3300044735 Ga0466968_0262932 Ga0466968_0262932_65_592 175
1357 3300044765 Ga0466970_0198420 Ga0466970_0198420_511_1038 175
1358 3300044765 Ga0466970_0475710 Ga0466970_0475710_117_647 175
1359 3300044842 Ga0466957_0100843 Ga0466957_0100843_1092_1625 175
1360 3300044842 Ga0466957_0114068 Ga0466957_0114068_43_573 175
1361 3300044901 Ga0466960_0007069 Ga0466960_0007069_676_1206 175
1362 3300044901 Ga0466960_0194318 Ga0466960_0194318_143_673 175
1363 3300045049 Ga0466959_0002845 Ga0466959_0002845_6152_6682 175
1364 3300045049 Ga0466959_0116366 Ga0466959_0116366_584_1114 175
1365 3300045049 Ga0466959_0137990 Ga0466959_0137990_29_562 175
1366 3300045049 Ga0466959_0400247 Ga0466959_0400247_269_796 175
1367 3300045836 Ga0466958_0216963 Ga0466958_0216963_343_876 175
1368 3300045836 Ga0466958_0619762 Ga0466958_0619762_119_649 175
1369 3300045976 Ga0466967_0011377 Ga0466967_0011377_2022_2552 175
1370 3300045976 Ga0466967_0244800 Ga0466967_0244800_669_1196 175
1371 3300045976 Ga0466967_0382066 Ga0466967_0382066_827_1354 175
1372 3300045976 Ga0466967_1828536 Ga0466967_1828536_13_540 175
1373 3300046452 Ga0495617_044432 Ga0495617_044432_202_729 175
1374 3300046454 Ga0495592_0008192 Ga0495592_0008192_2803_3336 175
1375 3300046454 Ga0495592_0316684 Ga0495592_0316684_356_886 175
1376 3300046455 Ga0495603_0003601 Ga0495603_0003601_2190_2717 175
1377 3300046455 Ga0495603_0034333 Ga0495603_0034333_2066_2593 175
1378 3300046455 Ga0495603_0067820 Ga0495603_0067820_1306_1833 175
1379 3300046455 Ga0495603_0074844 Ga0495603_0074844_1277_1804 175
1380 3300046455 Ga0495603_0117159 Ga0495603_0117159_52_579 175
1381 3300046457 Ga0495590_0061425 Ga0495590_0061425_72_602 175
1382 3300046457 Ga0495590_0085742 Ga0495590_0085742_34_561 175
1383 3300046458 Ga0495591_107810 Ga0495591_107810_31_558 175
1384 3300046459 Ga0495629_0028838 Ga0495629_0028838_1895_2425 175
1385 3300046459 Ga0495629_0415907 Ga0495629_0415907_311_838 175
1386 3300046459 Ga0495629_0705026 Ga0495629_0705026_73_600 175
1387 3300046462 Ga0495651_0024936 Ga0495651_0024936_2068_2595 175
1388 3300046462 Ga0495651_0074998 Ga0495651_0074998_1958_2485 175
1389 3300046462 Ga0495651_0134806 Ga0495651_0134806_414_944 175
1390 3300046463 Ga0495653_0034538 Ga0495653_0034538_2657_3190 175
1391 3300046463 Ga0495653_0672185 Ga0495653_0672185_59_586 175
1392 3300046471 Ga0495650_0079005 Ga0495650_0079005_248_778 175
1393 3300046471 Ga0495650_0142071 Ga0495650_0142071_279_806 175
1394 3300046472 Ga0495580_0006567 Ga0495580_0006567_3211_3738 175
1395 3300046472 Ga0495580_0094095 Ga0495580_0094095_1272_1799 175
1396 3300046473 Ga0495582_0033966 Ga0495582_0033966_953_1480 175
1397 3300046474 Ga0495605_0225723 Ga0495605_0225723_68_595 175
1398 3300046474 Ga0495605_0230476 Ga0495605_0230476_170_700 175
1399 3300046475 Ga0495639_0020941 Ga0495639_0020941_2119_2646 175
1400 3300046475 Ga0495639_0057837 Ga0495639_0057837_574_1101 175
1401 3300046475 Ga0495639_0082570 Ga0495639_0082570_171_698 175
1402 3300046475 Ga0495639_0135593 Ga0495639_0135593_622_1149 175
1403 3300046476 Ga0495662_0124296 Ga0495662_0124296_694_1221 175
1404 3300046476 Ga0495662_0298728 Ga0495662_0298728_48_575 175
1405 3300046477 Ga0495664_0006504 Ga0495664_0006504_170_697 175
1406 3300046477 Ga0495664_0024055 Ga0495664_0024055_336_869 175
1407 3300046477 Ga0495664_0173613 Ga0495664_0173613_10_537 175
1408 3300046477 Ga0495664_0389133 Ga0495664_0389133_100_627 175
1409 3300046491 Ga0495584_0039293 Ga0495584_0039293_1033_1560 175
1410 3300046491 Ga0495584_0130957 Ga0495584_0130957_55_582 175
1411 3300046491 Ga0495584_0348863 Ga0495584_0348863_158_685 175
1412 3300046492 Ga0495585_0031581 Ga0495585_0031581_1585_2112 175
1413 3300046499 Ga0495594_0194338 Ga0495594_0194338_550_1077 175
1414 3300046507 Ga0495606_0000676 Ga0495606_0000676_45336_45863 175
1415 3300046507 Ga0495606_0033273 Ga0495606_0033273_1128_1658 175
1416 3300046507 Ga0495606_0088388 Ga0495606_0088388_1323_1850 175
1417 3300046507 Ga0495606_0272482 Ga0495606_0272482_239_766 175
1418 3300046507 Ga0495606_0490660 Ga0495606_0490660_15_542 175
1419 3300046511 Ga0495608_0010097 Ga0495608_0010097_692_1225 175
1420 3300046511 Ga0495608_0174182 Ga0495608_0174182_25_552 175
1421 3300046511 Ga0495608_0382367 Ga0495608_0382367_296_823 175
1422 3300046512 Ga0495610_0089160 Ga0495610_0089160_621_1151 175
1423 3300046512 Ga0495610_0089593 Ga0495610_0089593_168_695 175
1424 3300046512 Ga0495610_0090623 Ga0495610_0090623_175_702 175
1425 3300046513 Ga0495616_0071091 Ga0495616_0071091_1089_1616 175
1426 3300046513 Ga0495616_0305896 Ga0495616_0305896_19_549 175
1427 3300046515 Ga0495620_0047663 Ga0495620_0047663_1113_1643 175
1428 3300046516 Ga0495628_0028701 Ga0495628_0028701_866_1399 175
1429 3300046517 Ga0495630_0070146 Ga0495630_0070146_525_1058 175
1430 3300046518 Ga0495631_0098781 Ga0495631_0098781_24_551 175
1431 3300046518 Ga0495631_0141639 Ga0495631_0141639_278_805 175
1432 3300046519 Ga0495632_0044136 Ga0495632_0044136_514_1041 175
1433 3300046519 Ga0495632_0117916 Ga0495632_0117916_679_1206 175
1434 3300046520 Ga0495637_0078251 Ga0495637_0078251_157_684 175
1435 3300046522 Ga0495643_0141446 Ga0495643_0141446_13_540 175
1436 3300046522 Ga0495643_0148335 Ga0495643_0148335_35_565 175
1437 3300046523 Ga0495644_0051982 Ga0495644_0051982_460_987 175
1438 3300046524 Ga0495648_0001769 Ga0495648_0001769_3987_4514 175
1439 3300046524 Ga0495648_0009771 Ga0495648_0009771_2683_3213 175
1440 3300046524 Ga0495648_0098576 Ga0495648_0098576_98_628 175
1441 3300046525 Ga0495663_0081736 Ga0495663_0081736_79_606 175
1442 3300046526 Ga0495666_0057764 Ga0495666_0057764_1305_1832 175
1443 3300046526 Ga0495666_0125275 Ga0495666_0125275_577_1107 175
1444 3300046529 Ga0495652_0030851 Ga0495652_0030851_2184_2717 175
1445 3300046529 Ga0495652_0190426 Ga0495652_0190426_875_1402 175
1446 3300046529 Ga0495652_0202016 Ga0495652_0202016_345_875 175
1447 3300046529 Ga0495652_0494276 Ga0495652_0494276_139_666 175
1448 3300046531 Ga0495665_0145730 Ga0495665_0145730_92_619 175
1449 3300046533 Ga0495640_0017649 Ga0495640_0017649_3137_3670 175
1450 3300046533 Ga0495640_0046403 Ga0495640_0046403_32_562 175
1451 3300046533 Ga0495640_0047669 Ga0495640_0047669_1184_1711 175
1452 3300046536 Ga0495587_0047806 Ga0495587_0047806_1296_1829 175
1453 3300046536 Ga0495587_0066525 Ga0495587_0066525_1478_2008 175
1454 3300046537 Ga0495598_0015535 Ga0495598_0015535_1237_1764 175
1455 3300046538 Ga0495609_0037202 Ga0495609_0037202_324_851 175
1456 3300046538 Ga0495609_0142683 Ga0495609_0142683_216_743 175
1457 3300046539 Ga0495621_0051267 Ga0495621_0051267_166_693 175
1458 3300046539 Ga0495621_0273617 Ga0495621_0273617_39_566 175
1459 3300046542 Ga0495597_0110496 Ga0495597_0110496_52_579 175
1460 3300046542 Ga0495597_0137156 Ga0495597_0137156_439_969 175
1461 3300046543 Ga0495645_0005927 Ga0495645_0005927_1924_2451 175
1462 3300046543 Ga0495645_0113696 Ga0495645_0113696_485_1018 175
1463 3300046543 Ga0495645_0147846 Ga0495645_0147846_1054_1581 175
1464 3300046557 Ga0495622_0104771 Ga0495622_0104771_191_721 175
1465 3300046557 Ga0495622_0117725 Ga0495622_0117725_311_838 175
1466 3300046557 Ga0495622_0303296 Ga0495622_0303296_67_594 175
1467 3300046557 Ga0495622_0312049 Ga0495622_0312049_97_624 175
1468 3300046558 Ga0495633_0067378 Ga0495633_0067378_1044_1571 175
1469 3300046558 Ga0495633_0151909 Ga0495633_0151909_310_837 175
1470 3300046559 Ga0495667_0056925 Ga0495667_0056925_656_1189 175
1471 3300046559 Ga0495667_0195123 Ga0495667_0195123_521_1048 175
1472 3300046615 Ga0495656_0071471 Ga0495656_0071471_690_1217 175
1473 3300046615 Ga0495656_0096498 Ga0495656_0096498_332_859 175
1474 3300046616 Ga0495668_0043654 Ga0495668_0043654_1778_2308 175
1475 3300046616 Ga0495668_0056113 Ga0495668_0056113_303_830 175
1476 3300046616 Ga0495668_0065418 Ga0495668_0065418_1020_1547 175
1477 3300046616 Ga0495668_0089744 Ga0495668_0089744_127_654 175
1478 3300046616 Ga0495668_0122408 Ga0495668_0122408_338_868 175
1479 3300046616 Ga0495668_0262593 Ga0495668_0262593_47_574 175
1480 3300046616 Ga0495668_0314981 Ga0495668_0314981_56_583 175
1481 3300046616 Ga0495668_0372149 Ga0495668_0372149_49_576 175
1482 3300046642 Ga0495634_0117269 Ga0495634_0117269_277_804 175
1483 3300046648 Ga0495611_0116671 Ga0495611_0116671_343_870 175
1484 3300046648 Ga0495611_0298937 Ga0495611_0298937_158_688 175
1485 3300046648 Ga0495611_0329279 Ga0495611_0329279_149_676 175
1486 3300046660 Ga0495625_0071902 Ga0495625_0071902_1353_1880 175
1487 3300046660 Ga0495625_0215516 Ga0495625_0215516_344_871 175
1488 3300046660 Ga0495625_0352750 Ga0495625_0352750_232_762 175
1489 3300046663 Ga0495635_0136556 Ga0495635_0136556_1034_1567 175
1490 3300046663 Ga0495635_0159202 Ga0495635_0159202_125_655 175
1491 3300046663 Ga0495635_0231601 Ga0495635_0231601_472_999 175
1492 3300046664 Ga0495659_0028980 Ga0495659_0028980_1236_1763 175
1493 3300046665 Ga0495661_0371113 Ga0495661_0371113_14_541 175
1494 3300046674 Ga0495588_0020225 Ga0495588_0020225_1398_1925 175
1495 3300046674 Ga0495588_0265036 Ga0495588_0265036_175_702 175
1496 3300046674 Ga0495588_0272805 Ga0495588_0272805_14_544 175
1497 3300046675 Ga0495657_0002607 Ga0495657_0002607_2076_2609 175
1498 3300046675 Ga0495657_0011477 Ga0495657_0011477_3820_4350 175
1499 3300046678 Ga0495599_0171310 Ga0495599_0171310_60_593 175
1500 3300046679 Ga0495623_0055634 Ga0495623_0055634_1643_2176 175
1501 3300046679 Ga0495623_0174201 Ga0495623_0174201_597_1124 175
1502 3300046680 Ga0495646_0044662 Ga0495646_0044662_1242_1775 175
1503 3300046680 Ga0495646_0129781 Ga0495646_0129781_217_744 175
1504 3300046681 Ga0495647_0021934 Ga0495647_0021934_32_559 175
1505 3300046683 Ga0495658_0061625 Ga0495658_0061625_42_569 175
1506 3300046684 Ga0495669_0030344 Ga0495669_0030344_380_907 175
1507 3300046684 Ga0495669_0159733 Ga0495669_0159733_51_578 175
1508 3300046684 Ga0495669_0240688 Ga0495669_0240688_69_596 175
1509 3300046684 Ga0495669_0340417 Ga0495669_0340417_53_583 175
1510 3300046689 Ga0495613_0148244 Ga0495613_0148244_896_1426 175
1511 3300046689 Ga0495613_0264477 Ga0495613_0264477_578_1111 175
1512 3300046690 Ga0495624_0051457 Ga0495624_0051457_683_1210 175
1513 3300046690 Ga0495624_0283639 Ga0495624_0283639_102_629 175
1514 3300046690 Ga0495624_0415619 Ga0495624_0415619_166_693 175
1515 3300046691 Ga0495670_0171586 Ga0495670_0171586_70_597 175
1516 3300046692 Ga0495671_0044453 Ga0495671_0044453_1562_2092 175
1517 3300046692 Ga0495671_0278107 Ga0495671_0278107_28_555 175
1518 3300046692 Ga0495671_0439866 Ga0495671_0439866_56_583 175
1519 3300046694 Ga0495649_0002747 Ga0495649_0002747_7233_7763 175
1520 3300046694 Ga0495649_0156285 Ga0495649_0156285_624_1154 175
1521 3300046694 Ga0495649_0356621 Ga0495649_0356621_167_694 175
1522 3300046794 Ga0495589_0063551 Ga0495589_0063551_559_1089 175
1523 3300046794 Ga0495589_0085016 Ga0495589_0085016_787_1314 175
1524 3300046794 Ga0495589_0229217 Ga0495589_0229217_271_798 175
1525 3300046809 Ga0495600_0004076 Ga0495600_0004076_2692_3225 175
1526 3300046809 Ga0495600_0051028 Ga0495600_0051028_366_893 175
1527 3300046809 Ga0495600_0053596 Ga0495600_0053596_744_1274 175
1528 3300046809 Ga0495600_0248931 Ga0495600_0248931_253_780 175
1529 3300047315 Ga0495581_0032284 Ga0495581_0032284_538_1068 175
1530 3300047315 Ga0495581_0080363 Ga0495581_0080363_1108_1635 175
1531 3300047315 Ga0495581_0507569 Ga0495581_0507569_43_576 175
1532 3300047317 Ga0495604_0017042 Ga0495604_0017042_1003_1536 175
1533 3300047317 Ga0495604_0107040 Ga0495604_0107040_639_1169 175
1534 3300047317 Ga0495604_0174913 Ga0495604_0174913_596_1123 175
1535 3300047317 Ga0495604_0306912 Ga0495604_0306912_453_980 175
1536 3300047318 Ga0495636_0080836 Ga0495636_0080836_390_917 175
1537 3300047318 Ga0495636_0136043 Ga0495636_0136043_307_834 175
1538 3300047319 Ga0495674_0011448 Ga0495674_0011448_6072_6599 175
1539 3300047319 Ga0495674_0252779 Ga0495674_0252779_412_939 175
1540 3300047319 Ga0495674_0787159 Ga0495674_0787159_73_600 175
1541 3300047320 Ga0495672_0017769 Ga0495672_0017769_2943_3470 175
1542 3300047321 Ga0495676_0060257 Ga0495676_0060257_56_583 175
1543 3300047321 Ga0495676_0095841 Ga0495676_0095841_746_1273 175
1544 3300047321 Ga0495676_0325583 Ga0495676_0325583_161_688 175
1545 3300047321 Ga0495676_0369370 Ga0495676_0369370_266_793 175
1546 3300047321 Ga0495676_0435803 Ga0495676_0435803_161_688 175
1547 3300047322 Ga0495680_0040840 Ga0495680_0040840_1772_2305 175
1548 3300047323 Ga0495683_0025892 Ga0495683_0025892_1296_1826 175
1549 3300047323 Ga0495683_0329099 Ga0495683_0329099_78_605 175
1550 3300047443 Ga0495687_031675 Ga0495687_031675_1630_2160 175
1551 3300047444 Ga0495675_0002941 Ga0495675_0002941_2471_3004 175
1552 3300047447 Ga0495685_207736 Ga0495685_207736_12_539 175
1553 3300047469 Ga0495673_0061080 Ga0495673_0061080_460_990 175
1554 3300047469 Ga0495673_0186320 Ga0495673_0186320_221_748 175
1555 3300047471 Ga0495684_0033429 Ga0495684_0033429_1890_2417 175
1556 3300047471 Ga0495684_0098483 Ga0495684_0098483_1018_1548 175
1557 3300047472 Ga0495686_0082026 Ga0495686_0082026_1091_1630 175
1558 3300047472 Ga0495686_0100852 Ga0495686_0100852_892_1422 175
1559 3300047472 Ga0495686_0148202 Ga0495686_0148202_689_1219 175
1560 3300047472 Ga0495686_0222536 Ga0495686_0222536_273_800 175
1561 3300047472 Ga0495686_0238766 Ga0495686_0238766_397_924 175
1562 3300047472 Ga0495686_0314023 Ga0495686_0314023_251_778 175
1563 3300048088 Ga0495602_0021964 Ga0495602_0021964_1265_1798 175
1564 3300048090 Ga0495615_0007906 Ga0495615_0007906_310_837 175
1565 3300048091 Ga0495626_0109357 Ga0495626_0109357_610_1137 175
1566 3300048903 Ga0496100_0028315 Ga0496100_0028315_37_564 175
1567 3300048903 Ga0496100_0140332 Ga0496100_0140332_318_845 175
1568 3300048903 Ga0496100_0650342 Ga0496100_0650342_54_581 175
1569 3300048903 Ga0496100_0870388 Ga0496100_0870388_65_595 175
1570 3300048904 Ga0496101_0003628 Ga0496101_0003628_6697_7224 175
1571 3300048904 Ga0496101_0070733 Ga0496101_0070733_95_625 175
1572 3300048905 Ga0496102_0004361 Ga0496102_0004361_9796_10323 175
1573 3300048905 Ga0496102_0129771 Ga0496102_0129771_961_1488 175
1574 3300048905 Ga0496102_0375761 Ga0496102_0375761_326_916 175
1575 3300048905 Ga0496102_0433977 Ga0496102_0433977_492_1019 175
1576 3300048905 Ga0496102_0584517 Ga0496102_0584517_352_879 175
1577 3300048905 Ga0496102_0975554 Ga0496102_0975554_131_661 175
1578 3300048906 Ga0496103_0130167 Ga0496103_0130167_487_1014 175
1579 3300048906 Ga0496103_0137613 Ga0496103_0137613_845_1375 175
1580 3300048906 Ga0496103_0599734 Ga0496103_0599734_153_680 175
1581 3300048907 Ga0496104_0020661 Ga0496104_0020661_4867_5457 175
1582 3300048907 Ga0496104_0118046 Ga0496104_0118046_712_1242 175
1583 3300048907 Ga0496104_0131500 Ga0496104_0131500_1057_1587 175
1584 3300048907 Ga0496104_0199944 Ga0496104_0199944_985_1512 175
1585 3300048907 Ga0496104_0222785 Ga0496104_0222785_1247_1774 175
1586 3300048907 Ga0496104_0255091 Ga0496104_0255091_413_940 175
1587 3300048907 Ga0496104_0321739 Ga0496104_0321739_846_1376 175
1588 3300048907 Ga0496104_1388885 Ga0496104_1388885_38_568 175
1589 3300048908 Ga0496105_0000647 Ga0496105_0000647_155_685 175
1590 3300048908 Ga0496105_0023303 Ga0496105_0023303_3680_4207 175
1591 3300048908 Ga0496105_0279500 Ga0496105_0279500_500_1030 175
1592 3300048908 Ga0496105_0356569 Ga0496105_0356569_106_696 175
1593 3300048908 Ga0496105_0393931 Ga0496105_0393931_90_617 175
1594 3300048908 Ga0496105_0502624 Ga0496105_0502624_322_852 175
1595 3300048909 Ga0496106_0000960 Ga0496106_0000960_9694_10221 175
1596 3300048909 Ga0496106_0011693 Ga0496106_0011693_3775_4302 175
1597 3300048909 Ga0496106_0026408 Ga0496106_0026408_2033_2623 175
1598 3300048909 Ga0496106_0046946 Ga0496106_0046946_189_716 175
1599 3300048909 Ga0496106_0077578 Ga0496106_0077578_1014_1541 175
1600 3300048909 Ga0496106_0144123 Ga0496106_0144123_480_1007 175
1601 3300048909 Ga0496106_0229713 Ga0496106_0229713_910_1437 175
1602 3300048909 Ga0496106_0321360 Ga0496106_0321360_373_900 175
1603 3300048909 Ga0496106_0810702 Ga0496106_0810702_10_540 175
1604 3300048910 Ga0496107_0003437 Ga0496107_0003437_1147_1674 175
1605 3300048910 Ga0496107_0018169 Ga0496107_0018169_1297_1824 175
1606 3300048910 Ga0496107_0051167 Ga0496107_0051167_717_1244 175
1607 3300048910 Ga0496107_0168176 Ga0496107_0168176_846_1373 175
1608 3300048910 Ga0496107_0266274 Ga0496107_0266274_529_1119 175
1609 3300048910 Ga0496107_0985019 Ga0496107_0985019_34_561 175
1610 3300048911 Ga0496108_0000803 Ga0496108_0000803_9745_10272 175
1611 3300048911 Ga0496108_0029498 Ga0496108_0029498_2412_2939 175
1612 3300048911 Ga0496108_0038906 Ga0496108_0038906_668_1195 175
1613 3300048911 Ga0496108_0105623 Ga0496108_0105623_819_1409 175
1614 3300048911 Ga0496108_0153998 Ga0496108_0153998_1426_1953 175
1615 3300048911 Ga0496108_0233495 Ga0496108_0233495_736_1263 175
1616 3300048911 Ga0496108_0664449 Ga0496108_0664449_34_564 175
1617 3300048911 Ga0496108_0695171 Ga0496108_0695171_66_593 175
1618 3300048911 Ga0496108_1154650 Ga0496108_1154650_95_622 175
1619 3300048912 Ga0496109_0001236 Ga0496109_0001236_17270_17797 175
1620 3300048912 Ga0496109_0017599 Ga0496109_0017599_4445_5035 175
1621 3300048912 Ga0496109_0033008 Ga0496109_0033008_3511_4038 175
1622 3300048912 Ga0496109_0128689 Ga0496109_0128689_1308_1835 175
1623 3300048912 Ga0496109_0228190 Ga0496109_0228190_568_1095 175
1624 3300048912 Ga0496109_0933745 Ga0496109_0933745_74_604 175
1625 3300048913 Ga0496110_0027403 Ga0496110_0027403_3730_4257 175
1626 3300048913 Ga0496110_0078125 Ga0496110_0078125_1541_2071 175
1627 3300048913 Ga0496110_0155677 Ga0496110_0155677_292_819 175
1628 3300048913 Ga0496110_0171333 Ga0496110_0171333_991_1518 175
1629 3300048913 Ga0496110_0231296 Ga0496110_0231296_257_784 175
1630 3300048913 Ga0496110_0372681 Ga0496110_0372681_647_1174 175
1631 3300048913 Ga0496110_0621048 Ga0496110_0621048_233_763 175
1632 3300048913 Ga0496110_0664355 Ga0496110_0664355_107_634 175
1633 3300048913 Ga0496110_1075367 Ga0496110_1075367_98_625 175
1634 3300048914 Ga0496111_0049775 Ga0496111_0049775_781_1308 175
1635 3300048914 Ga0496111_0072278 Ga0496111_0072278_1066_1593 175
1636 3300048914 Ga0496111_0144636 Ga0496111_0144636_1104_1634 175
1637 3300048914 Ga0496111_0153009 Ga0496111_0153009_563_1090 175
1638 3300048914 Ga0496111_0180632 Ga0496111_0180632_752_1342 175
1639 3300048914 Ga0496111_0345559 Ga0496111_0345559_116_643 175
1640 3300048914 Ga0496111_0612502 Ga0496111_0612502_69_596 175
1641 3300048915 Ga0496112_0000015 Ga0496112_0000015_168331_168858 175
1642 3300048915 Ga0496112_0002678 Ga0496112_0002678_1550_2077 175
1643 3300048915 Ga0496112_0019376 Ga0496112_0019376_97_624 175
1644 3300048915 Ga0496112_0024342 Ga0496112_0024342_3010_3537 175
1645 3300048915 Ga0496112_0029519 Ga0496112_0029519_163_693 175
1646 3300048915 Ga0496112_0167136 Ga0496112_0167136_619_1146 175
1647 3300048915 Ga0496112_0390282 Ga0496112_0390282_340_870 175
1648 3300048915 Ga0496112_0413932 Ga0496112_0413932_675_1202 175
1649 3300048915 Ga0496112_0515023 Ga0496112_0515023_383_910 175
1650 3300048916 Ga0496113_0006745 Ga0496113_0006745_1570_2097 175
1651 3300048916 Ga0496113_0042625 Ga0496113_0042625_107_637 175
1652 3300048916 Ga0496113_0058775 Ga0496113_0058775_667_1194 175
1653 3300048916 Ga0496113_0125174 Ga0496113_0125174_444_1034 175
1654 3300048916 Ga0496113_0357593 Ga0496113_0357593_178_705 175
1655 3300048916 Ga0496113_0444029 Ga0496113_0444029_115_642 175
1656 3300048917 Ga0496114_0030749 Ga0496114_0030749_237_764 175
1657 3300048917 Ga0496114_0095732 Ga0496114_0095732_1092_1619 175
1658 3300048917 Ga0496114_0175899 Ga0496114_0175899_1278_1805 175
1659 3300048917 Ga0496114_0293444 Ga0496114_0293444_619_1146 175
1660 3300048918 Ga0496115_0034663 Ga0496115_0034663_1517_2044 175
1661 3300048918 Ga0496115_0044070 Ga0496115_0044070_2504_3031 175
1662 3300048918 Ga0496115_0064821 Ga0496115_0064821_1757_2284 175
1663 3300048918 Ga0496115_0098472 Ga0496115_0098472_1801_2331 175
1664 3300048918 Ga0496115_0160537 Ga0496115_0160537_839_1366 175
1665 3300048918 Ga0496115_0197494 Ga0496115_0197494_658_1248 175
1666 3300048918 Ga0496115_0351997 Ga0496115_0351997_211_741 175
1667 3300048918 Ga0496115_0442544 Ga0496115_0442544_502_1029 175
1668 3300048918 Ga0496115_0476550 Ga0496115_0476550_235_762 175
1669 3300048919 Ga0496116_0345004 Ga0496116_0345004_120_650 175
1670 3300048920 Ga0496117_0027401 Ga0496117_0027401_1724_2251 175
1671 3300048920 Ga0496117_0065431 Ga0496117_0065431_1415_1945 175
1672 3300048920 Ga0496117_0122059 Ga0496117_0122059_875_1402 175
1673 3300048920 Ga0496117_0125366 Ga0496117_0125366_792_1319 175
1674 3300048921 Ga0496118_0004286 Ga0496118_0004286_2742_3269 175
1675 3300048921 Ga0496118_0040381 Ga0496118_0040381_1243_1773 175
1676 3300048921 Ga0496118_0053221 Ga0496118_0053221_41_571 175
1677 3300048921 Ga0496118_0057571 Ga0496118_0057571_710_1297 175
1678 3300048921 Ga0496118_0093693 Ga0496118_0093693_205_732 175
1679 3300048921 Ga0496118_0179735 Ga0496118_0179735_152_679 175
1680 3300048921 Ga0496118_0291127 Ga0496118_0291127_341_871 175
1681 3300048922 Ga0496119_0183306 Ga0496119_0183306_429_956 175
1682 3300048922 Ga0496119_0312083 Ga0496119_0312083_203_733 175
1683 3300048923 Ga0496120_0029227 Ga0496120_0029227_269_799 175
1684 3300048923 Ga0496120_0113881 Ga0496120_0113881_763_1290 175
1685 3300048924 Ga0496121_0000423 Ga0496121_0000423_70249_70776 175
1686 3300048924 Ga0496121_0016177 Ga0496121_0016177_473_1003 175
1687 3300048924 Ga0496121_0066527 Ga0496121_0066527_1036_1566 175
1688 3300048924 Ga0496121_0071616 Ga0496121_0071616_1929_2456 175
1689 3300048924 Ga0496121_0109860 Ga0496121_0109860_1330_1917 175
1690 3300048924 Ga0496121_0133830 Ga0496121_0133830_193_720 175
1691 3300048924 Ga0496121_0226364 Ga0496121_0226364_136_663 175
1692 3300048924 Ga0496121_0277560 Ga0496121_0277560_472_999 175
1693 3300048924 Ga0496121_0290060 Ga0496121_0290060_372_899 175
1694 3300048924 Ga0496121_0422065 Ga0496121_0422065_281_811 175
1695 3300048924 Ga0496121_0673464 Ga0496121_0673464_70_600 175
1696 3300048925 Ga0496122_0014922 Ga0496122_0014922_582_1136 175
1697 3300048925 Ga0496122_0119135 Ga0496122_0119135_983_1522 175
1698 3300048927 Ga0496124_0005449 Ga0496124_0005449_5796_6323 175
1699 3300048927 Ga0496124_0134487 Ga0496124_0134487_871_1398 175
1700 3300048927 Ga0496124_0199703 Ga0496124_0199703_81_608 175
1701 3300048927 Ga0496124_0249923 Ga0496124_0249923_41_571 175
1702 3300048927 Ga0496124_0351733 Ga0496124_0351733_56_586 175
1703 3300048928 Ga0496125_0000136 Ga0496125_0000136_110731_111270 175
1704 3300048928 Ga0496125_0049468 Ga0496125_0049468_1305_1835 175
1705 3300048928 Ga0496125_0063927 Ga0496125_0063927_242_772 175
1706 3300048928 Ga0496125_0064445 Ga0496125_0064445_2019_2546 175
1707 3300048928 Ga0496125_0066903 Ga0496125_0066903_2229_2816 175
1708 3300048928 Ga0496125_0148114 Ga0496125_0148114_1041_1568 175
1709 3300048928 Ga0496125_0191802 Ga0496125_0191802_523_1053 175
1710 3300048928 Ga0496125_0329748 Ga0496125_0329748_362_889 175
1711 3300048928 Ga0496125_0621598 Ga0496125_0621598_27_554 175
1712 3300048929 Ga0496126_0007880 Ga0496126_0007880_3947_4474 175
1713 3300048929 Ga0496126_0008016 Ga0496126_0008016_5610_6164 175
1714 3300048929 Ga0496126_0013800 Ga0496126_0013800_4101_4628 175
1715 3300048929 Ga0496126_0046719 Ga0496126_0046719_2386_2913 175
1716 3300048929 Ga0496126_0074875 Ga0496126_0074875_2232_2762 175
1717 3300048929 Ga0496126_0107865 Ga0496126_0107865_1049_1576 175
1718 3300048929 Ga0496126_0173191 Ga0496126_0173191_1001_1528 175
1719 3300048929 Ga0496126_0185006 Ga0496126_0185006_1186_1713 175
1720 3300048929 Ga0496126_0214651 Ga0496126_0214651_40_567 175
1721 3300048929 Ga0496126_0235647 Ga0496126_0235647_302_829 175
1722 3300048929 Ga0496126_0249024 Ga0496126_0249024_27_554 175
1723 3300048929 Ga0496126_0253838 Ga0496126_0253838_632_1162 175
1724 3300048929 Ga0496126_0382430 Ga0496126_0382430_491_1018 175
1725 3300048929 Ga0496126_0430013 Ga0496126_0430013_307_834 175
1726 3300048929 Ga0496126_0453361 Ga0496126_0453361_80_631 175
1727 3300049460 Ga0495682_0016334 Ga0495682_0016334_168_698 175
1728 3300049460 Ga0495682_0146685 Ga0495682_0146685_47_574 175
1729 3300049568 Ga0501031_0000390 Ga0501031_0000390_18024_18554 175
1730 3300049569 Ga0501032_0014322 Ga0501032_0014322_3146_3676 175
1731 3300049569 Ga0501032_0354299 Ga0501032_0354299_171_701 175
1732 3300049570 Ga0501033_0000205 Ga0501033_0000205_18187_18717 175
1733 3300049570 Ga0501033_0202584 Ga0501033_0202584_496_1041 175
1734 3300049571 Ga0501034_0044925 Ga0501034_0044925_1327_1872 175
1735 3300049572 Ga0501036_0111918 Ga0501036_0111918_671_1201 175
1736 3300049572 Ga0501036_0229541 Ga0501036_0229541_746_1273 175
1737 3300049572 Ga0501036_0388014 Ga0501036_0388014_557_1087 175
1738 3300049572 Ga0501036_0613038 Ga0501036_0613038_78_608 175
1739 3300049573 Ga0501037_0001134 Ga0501037_0001134_6047_6577 175
1740 3300049573 Ga0501037_0213237 Ga0501037_0213237_402_929 175
1741 3300049573 Ga0501037_0299844 Ga0501037_0299844_70_615 175
1742 3300049573 Ga0501037_0818210 Ga0501037_0818210_69_599 175
1743 3300049574 Ga0501038_0095343 Ga0501038_0095343_1789_2319 175
1744 3300049574 Ga0501038_0718608 Ga0501038_0718608_39_569 175
1745 3300049575 Ga0501039_0005007 Ga0501039_0005007_677_1207 175
1746 3300049577 Ga0501041_0219230 Ga0501041_0219230_61_588 175
1747 3300049578 Ga0501042_0041282 Ga0501042_0041282_579_1109 175
1748 3300049579 Ga0501043_0013802 Ga0501043_0013802_523_1053 175
1749 3300049580 Ga0501046_0005064 Ga0501046_0005064_1929_2459 175
1750 3300049581 Ga0501047_0010641 Ga0501047_0010641_1396_1941 175
1751 3300049581 Ga0501047_0289630 Ga0501047_0289630_740_1270 175
1752 3300049581 Ga0501047_0884414 Ga0501047_0884414_119_649 175
1753 3300049583 Ga0501067_0112428 Ga0501067_0112428_886_1413 175
1754 3300049584 Ga0501068_0627946 Ga0501068_0627946_153_680 175
1755 3300049585 Ga0501069_0157932 Ga0501069_0157932_71_598 175
1756 3300049586 Ga0501070_0052132 Ga0501070_0052132_18_551 175
1757 3300049586 Ga0501070_0106087 Ga0501070_0106087_287_832 175
1758 3300049586 Ga0501070_0370610 Ga0501070_0370610_173_703 175
1759 3300049586 Ga0501070_0754677 Ga0501070_0754677_109_639 175
1760 3300049587 Ga0501071_0119488 Ga0501071_0119488_141_668 175
1761 3300049589 Ga0501073_0067728 Ga0501073_0067728_1034_1567 175
1762 3300049589 Ga0501073_0650660 Ga0501073_0650660_150_680 175
1763 3300049590 Ga0501074_0031492 Ga0501074_0031492_2588_3121 175
1764 3300049590 Ga0501074_0563924 Ga0501074_0563924_117_647 175
1765 3300049592 Ga0501076_0629471 Ga0501076_0629471_348_875 175
1766 3300049741 Ga0501079_0361197 Ga0501079_0361197_572_1099 175
1767 3300049742 Ga0501080_0082585 Ga0501080_0082585_1707_2240 175
1768 3300049742 Ga0501080_0238244 Ga0501080_0238244_863_1393 175
1769 3300049742 Ga0501080_0856556 Ga0501080_0856556_27_554 175
1770 3300049822 Ga0501035_0029757 Ga0501035_0029757_3318_3848 175
1771 3300049822 Ga0501035_0074363 Ga0501035_0074363_435_980 175
1772 3300049822 Ga0501035_0106217 Ga0501035_0106217_1721_2248 175
1773 3300049823 Ga0501044_0005118 Ga0501044_0005118_8344_8874 175
1774 3300049823 Ga0501044_0059132 Ga0501044_0059132_605_1150 175
1775 3300049823 Ga0501044_0153987 Ga0501044_0153987_473_1003 175
1776 3300049823 Ga0501044_0271780 Ga0501044_0271780_191_724 175
1777 3300049823 Ga0501044_0926597 Ga0501044_0926597_136_666 175
1778 3300049824 Ga0501045_0270674 Ga0501045_0270674_542_1072 175
1779 3300050489 nmdc:mga03683_164689_c1 nmdc:mga03683_164689_c1_158_685 175
1780 3300050489 nmdc:mga03683_40505_c1 nmdc:mga03683_40505_c1_221_748 175
1781 3300050489 nmdc:mga03683_41994_c1 nmdc:mga03683_41994_c1_1210_1737 175
1782 3300050490 nmdc:mga03n38_1418_c1 nmdc:mga03n38_1418_c1_6282_6809 175
1783 3300050490 nmdc:mga03n38_453607_c1 nmdc:mga03n38_453607_c1_25_552 175
1784 3300050490 nmdc:mga03n38_662521_c1 nmdc:mga03n38_662521_c1_52_579 175
1785 3300050491 nmdc:mga00v17_186268_c1 nmdc:mga00v17_186268_c1_665_1192 175
1786 3300050491 nmdc:mga00v17_43893_c1 nmdc:mga00v17_43893_c1_1611_2141 175
1787 3300050491 nmdc:mga00v17_81611_c2 nmdc:mga00v17_81611_c2_233_763 175
1788 3300050491 nmdc:mga00v17_91466_c1 nmdc:mga00v17_91466_c1_328_858 175
1789 3300050492 nmdc:mga0yw44_111921_c1 nmdc:mga0yw44_111921_c1_926_1453 175
1790 3300050492 nmdc:mga0yw44_125363_c1 nmdc:mga0yw44_125363_c1_389_919 175
1791 3300050492 nmdc:mga0yw44_168244_c1 nmdc:mga0yw44_168244_c1_37_564 175
1792 3300050492 nmdc:mga0yw44_20997_c1 nmdc:mga0yw44_20997_c1_381_908 175
1793 3300050492 nmdc:mga0yw44_278456_c1 nmdc:mga0yw44_278456_c1_365_895 175
1794 3300050492 nmdc:mga0yw44_338777_c1 nmdc:mga0yw44_338777_c1_279_806 175
1795 3300050492 nmdc:mga0yw44_363451_c1 nmdc:mga0yw44_363451_c1_62_589 175
1796 3300050492 nmdc:mga0yw44_471048_c1 nmdc:mga0yw44_471048_c1_300_830 175
1797 3300050492 nmdc:mga0yw44_496868_c1 nmdc:mga0yw44_496868_c1_62_589 175
1798 3300050492 nmdc:mga0yw44_74121_c1 nmdc:mga0yw44_74121_c1_1270_1800 175
1799 3300050493 nmdc:mga0k408_154685_c1 nmdc:mga0k408_154685_c1_313_843 175
1800 3300050493 nmdc:mga0k408_177588_c1 nmdc:mga0k408_177588_c1_608_1138 175
1801 3300050493 nmdc:mga0k408_748444_c1 nmdc:mga0k408_748444_c1_34_561 175
1802 3300050494 nmdc:mga06z11_123724_c1 nmdc:mga06z11_123724_c1_478_1005 175
1803 3300050494 nmdc:mga06z11_13229_c1 nmdc:mga06z11_13229_c1_263_790 175
1804 3300050494 nmdc:mga06z11_148848_c1 nmdc:mga06z11_148848_c1_266_793 175
1805 3300050495 nmdc:mga04h51_41658_c1 nmdc:mga04h51_41658_c1_263_790 175
1806 3300050495 nmdc:mga04h51_7254_c1 nmdc:mga04h51_7254_c1_1455_1982 175
1807 3300050496 nmdc:mga07m45_152587_c1 nmdc:mga07m45_152587_c1_374_901 175
1808 3300050496 nmdc:mga07m45_1693_c2 nmdc:mga07m45_1693_c2_4415_4942 175
1809 3300050507 nmdc:mga05p37_106683_c1 nmdc:mga05p37_106683_c1_1753_2280 175
1810 3300050508 nmdc:mga09592_275182_c1 nmdc:mga09592_275182_c1_789_1316 175
1811 3300050511 nmdc:mga08y16_139088_c1 nmdc:mga08y16_139088_c1_505_1032 175
1812 3300050511 nmdc:mga08y16_50901_c1 nmdc:mga08y16_50901_c1_1008_1535 175
1813 3300050512 nmdc:mga0n895_1294201_c1 nmdc:mga0n895_1294201_c1_159_686 175
1814 3300050512 nmdc:mga0n895_286526_c1 nmdc:mga0n895_286526_c1_213_740 175
1815 3300050512 nmdc:mga0n895_37552_c1 nmdc:mga0n895_37552_c1_254_808 175
1816 3300050513 nmdc:mga0rr50_162398_c1 nmdc:mga0rr50_162398_c1_1032_1586 175
1817 3300050513 nmdc:mga0rr50_320662_c1 nmdc:mga0rr50_320662_c1_225_752 175
1818 3300050516 nmdc:mga0sz30_247978_c1 nmdc:mga0sz30_247978_c1_93_620 175
1819 3300050516 nmdc:mga0sz30_26227_c1 nmdc:mga0sz30_26227_c1_1517_2047 175
1820 3300050516 nmdc:mga0sz30_307336_c1 nmdc:mga0sz30_307336_c1_105_632 175
1821 3300053077 Ga0495601_0097467 Ga0495601_0097467_1052_1579 175
1822 3300053077 Ga0495601_0154442 Ga0495601_0154442_662_1189 175
1823 3300053077 Ga0495601_0193554 Ga0495601_0193554_672_1199 175
1824 3300053077 Ga0495601_0476604 Ga0495601_0476604_240_767 175
1825 3300053078 Ga0495612_0268675 Ga0495612_0268675_59_586 175
1826 3300053080 Ga0500635_0011591 Ga0500635_0011591_1229_1756 175
1827 3300053080 Ga0500635_0323379 Ga0500635_0323379_35_562 175
1828 3300053083 Ga0495655_0037102 Ga0495655_0037102_14_544 175
1829 3300053083 Ga0495655_0240072 Ga0495655_0240072_10_540 175
1830 3300053084 Ga0495595_0035717 Ga0495595_0035717_1307_1840 175
1831 3300053084 Ga0495595_0302820 Ga0495595_0302820_13_540 175
1832 3300053085 Ga0495619_0012457 Ga0495619_0012457_4562_5089 175
1833 3300053085 Ga0495619_0193105 Ga0495619_0193105_630_1160 175
1834 3300053085 Ga0495619_0845653 Ga0495619_0845653_67_594 175
1835 3300053086 Ga0500578_0140390 Ga0500578_0140390_305_835 175
1836 3300053086 Ga0500578_0213772 Ga0500578_0213772_109_639 175
1837 3300053086 Ga0500578_0238191 Ga0500578_0238191_91_618 175
1838 3300053087 Ga0500643_000049 Ga0500643_000049_101421_101951 175
1839 3300053088 Ga0500644_0073119 Ga0500644_0073119_591_1121 175
1840 3300053088 Ga0500644_0182254 Ga0500644_0182254_104_634 175
1841 3300053090 Ga0500646_0069815 Ga0500646_0069815_13_540 175
1842 3300053091 Ga0500647_0220604 Ga0500647_0220604_165_692 175
1843 3300053091 Ga0500647_0261086 Ga0500647_0261086_203_733 175
1844 3300053092 Ga0500583_0173891 Ga0500583_0173891_383_913 175
1845 3300053093 Ga0500651_0072214 Ga0500651_0072214_1103_1630 175
1846 3300053093 Ga0500651_0092244 Ga0500651_0092244_287_817 175
1847 3300053093 Ga0500651_0255144 Ga0500651_0255144_46_573 175
1848 3300053093 Ga0500651_0449324 Ga0500651_0449324_63_593 175
1849 3300053094 Ga0500566_0000055 Ga0500566_0000055_27518_28045 175
1850 3300053094 Ga0500566_0002813 Ga0500566_0002813_263_793 175
1851 3300053094 Ga0500566_0006619 Ga0500566_0006619_2098_2625 175
1852 3300053096 Ga0500641_0013558 Ga0500641_0013558_1569_2096 175
1853 3300053096 Ga0500641_0031164 Ga0500641_0031164_784_1314 175
1854 3300053098 Ga0500650_0097072 Ga0500650_0097072_414_941 175
1855 3300053102 Ga0500554_003653 Ga0500554_003653_156_683 175
1856 3300053102 Ga0500554_010329 Ga0500554_010329_1638_2165 175
1857 3300053103 Ga0500555_005493 Ga0500555_005493_1433_1963 175
1858 3300053104 Ga0500556_0031759 Ga0500556_0031759_185_715 175
1859 3300053105 Ga0500557_000118 Ga0500557_000118_14462_14992 175
1860 3300053108 Ga0500562_015483 Ga0500562_015483_143_673 175
1861 3300053109 Ga0500569_002326 Ga0500569_002326_2144_2674 175
1862 3300053111 Ga0500572_000348 Ga0500572_000348_12100_12627 175
1863 3300053111 Ga0500572_224846 Ga0500572_224846_72_599 175
1864 3300053118 Ga0500594_0038553 Ga0500594_0038553_636_1163 175
1865 3300053119 Ga0500595_000345 Ga0500595_000345_7027_7554 175
1866 3300053119 Ga0500595_005080 Ga0500595_005080_3597_4124 175
1867 3300053119 Ga0500595_046350 Ga0500595_046350_265_795 175
1868 3300053119 Ga0500595_120872 Ga0500595_120872_180_707 175
1869 3300053119 Ga0500595_153644 Ga0500595_153644_71_601 175
1870 3300053120 Ga0500597_093367 Ga0500597_093367_664_1194 175
1871 3300053120 Ga0500597_108020 Ga0500597_108020_649_1176 175
1872 3300053120 Ga0500597_141879 Ga0500597_141879_489_1016 175
1873 3300053120 Ga0500597_331800 Ga0500597_331800_20_559 175
1874 3300053122 Ga0500608_002697 Ga0500608_002697_5556_6083 175
1875 3300053124 Ga0500617_216891 Ga0500617_216891_90_617 175
1876 3300053125 Ga0500618_006151 Ga0500618_006151_835_1362 175
1877 3300053125 Ga0500618_022546 Ga0500618_022546_741_1271 175
1878 3300053128 Ga0500626_092159 Ga0500626_092159_617_1147 175
1879 3300053130 Ga0500642_0000164 Ga0500642_0000164_16502_17032 175
1880 3300053130 Ga0500642_0048319 Ga0500642_0048319_268_798 175
1881 3300053130 Ga0500642_0049160 Ga0500642_0049160_81_608 175
1882 3300053134 Ga0500658_0193656 Ga0500658_0193656_169_696 175
1883 3300053134 Ga0500658_0314249 Ga0500658_0314249_22_552 175
1884 3300053136 Ga0500559_0000305 Ga0500559_0000305_30355_30882 175
1885 3300053136 Ga0500559_0000362 Ga0500559_0000362_12697_13224 175
1886 3300053136 Ga0500559_0003633 Ga0500559_0003633_1926_2456 175
1887 3300053136 Ga0500559_0058557 Ga0500559_0058557_968_1495 175
1888 3300053138 Ga0500564_149111 Ga0500564_149111_106_633 175
1889 3300053139 Ga0500568_0026181 Ga0500568_0026181_1085_1615 175
1890 3300053140 Ga0500573_0007866 Ga0500573_0007866_4337_4864 175
1891 3300053142 Ga0500577_0128432 Ga0500577_0128432_91_618 175
1892 3300053142 Ga0500577_0262329 Ga0500577_0262329_101_631 175
1893 3300053148 Ga0500590_246553 Ga0500590_246553_124_651 175
1894 3300053148 Ga0500590_315644 Ga0500590_315644_30_560 175
1895 3300053150 Ga0500603_011062 Ga0500603_011062_539_1066 175
1896 3300053150 Ga0500603_060652 Ga0500603_060652_181_708 175
1897 3300053151 Ga0500604_0049689 Ga0500604_0049689_641_1168 175
1898 3300053153 Ga0500616_0022311 Ga0500616_0022311_543_1073 175
1899 3300053154 Ga0500619_092377 Ga0500619_092377_155_682 175
1900 3300053154 Ga0500619_189488 Ga0500619_189488_56_586 175
1901 3300053156 Ga0500622_0005919 Ga0500622_0005919_3930_4460 175
1902 3300053156 Ga0500622_0114950 Ga0500622_0114950_123_650 175
1903 3300053158 Ga0500627_0148942 Ga0500627_0148942_514_1041 175
1904 3300053158 Ga0500627_0155805 Ga0500627_0155805_352_879 175
1905 3300053158 Ga0500627_0168435 Ga0500627_0168435_273_803 175
1906 3300053161 Ga0500634_0158147 Ga0500634_0158147_34_561 175
1907 3300053162 Ga0500638_027148 Ga0500638_027148_54_584 175
1908 3300053162 Ga0500638_050485 Ga0500638_050485_531_1058 175
1909 3300053162 Ga0500638_295936 Ga0500638_295936_54_581 175
1910 3300053163 Ga0500639_165395 Ga0500639_165395_156_683 175
1911 3300053163 Ga0500639_188864 Ga0500639_188864_28_555 175
1912 3300053177 Ga0500636_0077320 Ga0500636_0077320_442_969 175
1913 3300053178 Ga0500637_0000053 Ga0500637_0000053_8335_8862 175
1914 3300053723 Ga0500567_134325 Ga0500567_134325_307_834 175
1915 3300053728 Ga0500657_212671 Ga0500657_212671_20_547 175
1916 3300053729 Ga0500625_144878 Ga0500625_144878_150_680 175
1917 3300053730 Ga0500645_079033 Ga0500645_079033_188_718 175
1918 3300053731 Ga0500609_020309 Ga0500609_020309_332_862 175
1919 3300053732 Ga0500656_032456 Ga0500656_032456_151_678 175
1920 3300053732 Ga0500656_049629 Ga0500656_049629_40_570 175
1921 3300053733 Ga0500552_006359 Ga0500552_006359_79_606 175
1922 3300053735 Ga0500596_000229 Ga0500596_000229_1862_2389 175
1923 3300053735 Ga0500596_029926 Ga0500596_029926_217_744 175
1924 3300053736 Ga0500599_006308 Ga0500599_006308_795_1325 175
1925 3300053737 Ga0500601_000388 Ga0500601_000388_2773_3303 175
1926 3300055283 Ga0500661_000122 Ga0500661_000122_8182_8709 175
1927 3300055283 Ga0500661_007332 Ga0500661_007332_205_735 175
1928 3300061719 Ga0466962_0053071 Ga0466962_0053071_431_964 175
1929 3300061719 Ga0466962_0056426 Ga0466962_0056426_571_1158 175
1930 3300061719 Ga0466962_0122178 Ga0466962_0122178_71_601 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06347

SH3_4

Bacterial SH3 domain

108

162

0.98

PF06347

SH3_4

Bacterial SH3 domain

47

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2krs-assembly1.cif.gz_A solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a. 0.8033 105 175
2kt8-assembly1.cif.gz_A solution nmr structure of the cpe1231(468-535) protein from clostridium perfringens, northeast structural genomics consortium target cpr82b 0.7761 105 175
2kyb-assembly1.cif.gz_A solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g 0.7712 106 164
7dhw-assembly1.cif.gz_A crystal structure of myosin-xi motor domain in complex with adp-alf4 0.7451 38 100
2kyb-assembly1.cif.gz_A solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g 0.7309 106 164
ID Description Score Start End Superfamily
2krsA01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8776 107 166 2.30.30.40
af_Q2FXU3_37_103_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8731 105 165 2.30.30.40
4krtB03 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8287 105 168 2.30.30.40
2krsA01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.826 107 166 2.30.30.40
4krtA02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7919 107 166 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A3B9IYM3-F1-model_v4 SH3b domain-containing protein 0.9552 105 166
AF-A0A502YEI1-F1-model_v4 SH3 domain-containing protein 0.93 99 174
AF-A0A537NZ88-F1-model_v4 SH3 domain-containing protein 0.9134 102 175
AF-A0A3S0HT46-F1-model_v4 deleted 0.9039 93 175
AF-A0A537NZ88-F1-model_v4 SH3 domain-containing protein 0.8908 102 175

Feature Viewer

pLDDT pTM Quality
75.69 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map