F496080
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1930 | 773 | 1725 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300003354|JGI25160J50197_1001001|JGI25160J50197_10010017 |
| Length | 170 |
| Sequence | MALGRFCSVMALVCTWLTATVGPSHSAKEATPQTASGLPVPRYVSLKSDHVNVRAGPTKDNDVAWVYVEITAEFENWRRVRDSEGAEGWVYXSLLSGRRTAVVTMKHKDELAPIYDRADPDSAVAAKLQAGVVTQVKKCAANWCRVTGNGFDGWIQQERLWGVYSDEQVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 45 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 46 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 47 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 48 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 53 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 54 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 55 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 56 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 57 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 58 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 59 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 60 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 61 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 62 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 63 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 64 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 65 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 66 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 67 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 68 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 69 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 70 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 71 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 72 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 73 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 74 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 75 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 76 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 77 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 78 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 79 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 80 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 81 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 82 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 83 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 84 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 85 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 86 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 87 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 88 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 89 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 90 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 91 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 92 | 2904699407 | |||
| 93 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 94 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 95 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 96 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 97 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 98 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 99 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 100 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 101 | 2922368715 | |||
| 102 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 103 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 104 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 105 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 106 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 107 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 108 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 109 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 110 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 111 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 112 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 113 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 114 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 115 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 116 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 117 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 118 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 119 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 120 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 121 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 122 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 123 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 124 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 125 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 126 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 127 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 128 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 129 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 130 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 131 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 132 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 133 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 134 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 135 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 136 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 137 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 138 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 139 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 140 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 141 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 142 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 143 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 144 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 145 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 146 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 147 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 148 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 149 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 150 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 151 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 152 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 153 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 154 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 155 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 156 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 157 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 158 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 159 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 160 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 161 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 162 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 163 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 164 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 165 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 166 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 167 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 168 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 169 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 170 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 171 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 172 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 173 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 174 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 175 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 176 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 177 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 178 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 179 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 180 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 181 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 182 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 183 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 184 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 185 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 186 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 187 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 188 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 191 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 192 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 194 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 195 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 196 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 197 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 199 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 210 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 222 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 223 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 231 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 233 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 237 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 238 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 240 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 241 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 242 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 247 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 248 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 249 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 250 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 251 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 252 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 253 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 254 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 255 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 256 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 257 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 259 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 260 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 261 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 262 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 263 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 264 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 265 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 266 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 267 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 268 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 269 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 271 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 272 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 273 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 274 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 275 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 277 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 278 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 279 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 280 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 281 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 296 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 299 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 311 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 314 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 316 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 317 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 318 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 319 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 320 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 321 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 322 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 323 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 324 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 326 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 331 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 332 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 334 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 401 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 402 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 403 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 404 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 407 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 411 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 412 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 413 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 414 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 415 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 416 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 417 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 418 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 419 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 420 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 423 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 424 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 425 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 426 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 427 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 428 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 429 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 430 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 431 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 432 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 433 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 434 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 435 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 436 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 437 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 438 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 439 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 440 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 441 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 442 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 443 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 444 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 445 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 446 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 447 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 448 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 449 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 450 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 451 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 452 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 453 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 454 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 455 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 456 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 457 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 458 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 459 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 460 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 461 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 462 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 463 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 464 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 465 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 466 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 467 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 468 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 469 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 470 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 471 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 472 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 473 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 474 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 475 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 476 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 477 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 478 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 479 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 480 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 481 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 482 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 483 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 484 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 485 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 486 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 487 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 488 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 489 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 490 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 491 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 492 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 493 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 494 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 495 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 496 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 497 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 498 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 499 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 500 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 501 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 502 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 503 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 504 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 505 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 506 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 507 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 508 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 509 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 510 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 511 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 512 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 513 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 514 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 604 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 605 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 606 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 607 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 608 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 609 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 610 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 611 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 612 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 613 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 614 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 615 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 616 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 617 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 618 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 619 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 620 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 621 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 622 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 623 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 624 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 625 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 626 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 627 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 628 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 629 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 633 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 636 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 637 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 638 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 640 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 641 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 644 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 645 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 646 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 658 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 659 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 660 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 661 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 662 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 663 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 664 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 665 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 666 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 668 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 669 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 670 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 671 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 672 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 675 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 679 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 680 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 681 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 682 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 683 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 684 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 685 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 686 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 687 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 688 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 689 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 690 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 691 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 692 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 693 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 694 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 695 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 696 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 697 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 698 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 699 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 700 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 701 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 702 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 703 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 704 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 705 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 706 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 707 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 708 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 709 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 710 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 711 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 712 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 713 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 714 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 715 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 716 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 717 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 718 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 719 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 720 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 721 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 722 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 723 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 724 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 725 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 726 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 727 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 728 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 729 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 730 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 731 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 732 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 733 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 734 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 735 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 736 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 737 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 738 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 739 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 740 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 741 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 742 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 743 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 744 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 745 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 746 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 747 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 748 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 749 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 750 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 751 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 752 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 753 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 754 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 755 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 756 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 757 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 758 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 759 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 760 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 761 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 762 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 763 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 764 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 765 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 766 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 767 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 768 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 769 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 770 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 771 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 772 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 773 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.36 |
| Metatranscriptomes | 0.16 |
| Isolates | 10.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.42 |
| Nodule | 8.45 |
| Rhizoplane | 6.17 |
| Rhizosphere | 62.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003115 | 3300000549 | Bacteria | 2242 |
| 2 | JGI24739J22299_10000950 | 3300001989 | Bacteria | 10788 |
| 3 | JGI24737J22298_10003390 | 3300001990 | Bacteria | 5636 |
| 4 | JGI24735J21928_10007692 | 3300002067 | Bacteria | 3506 |
| 5 | JGI24750J21931_1011487 | 3300002070 | Bacteria | 1165 |
| 6 | JGI24738J21930_10006447 | 3300002075 | Bacteria | 2751 |
| 7 | JGI24742J22300_10006916 | 3300002244 | Bacteria | 1871 |
| 8 | JGI25406J46586_10000015 | 3300003203 | Bacteria | 91406 |
| 9 | JGI25406J46586_10013868 | 3300003203 | Bacteria | 3443 |
| 10 | JGI25165J46597_1006926 | 3300003214 | Bacteria | 1952 |
| 11 | JGI25153J46596_10004444 | 3300003215 | Bacteria | 7562 |
| 12 | JGI25153J46596_10016721 | 3300003215 | Bacteria | 2924 |
| 13 | JGI25153J46596_10018333 | 3300003215 | Bacteria | 2724 |
| 14 | JGI25153J46596_10046570 | 3300003215 | Bacteria | 1284 |
| 15 | JGI25160J50197_1001001 | 3300003354 | Bacteria | 14647 |
| 16 | JGI25160J50197_1006880 | 3300003354 | Bacteria | 4537 |
| 17 | JGI25404J52841_10003238 | 3300003659 | Bacteria | 3192 |
| 18 | JGI25404J52841_10011196 | 3300003659 | Bacteria | 1932 |
| 19 | Ga0055539_1008601 | 3300003752 | Bacteria | 1276 |
| 20 | Ga0055529_1010850 | 3300003763 | Bacteria | 1179 |
| 21 | Ga0055529_1013822 | 3300003763 | Bacteria | 1026 |
| 22 | Ga0055526_1044030 | 3300003771 | Bacteria | 1081 |
| 23 | Ga0055543_1003105 | 3300004625 | Bacteria | 5088 |
| 24 | Ga0065165_1001886 | 3300005262 | Bacteria | 20226 |
| 25 | Ga0065165_1041874 | 3300005262 | Bacteria | 1356 |
| 26 | Ga0065707_10017090 | 3300005295 | Bacteria | 1557 |
| 27 | Ga0070658_10116952 | 3300005327 | Bacteria | 2213 |
| 28 | Ga0070658_10178918 | 3300005327 | Bacteria | 1784 |
| 29 | Ga0070676_10158273 | 3300005328 | Bacteria | 1456 |
| 30 | Ga0070676_10360655 | 3300005328 | Bacteria | 1001 |
| 31 | Ga0070683_100299149 | 3300005329 | Bacteria | 1531 |
| 32 | Ga0070683_100894143 | 3300005329 | Bacteria | 852 |
| 33 | Ga0070690_100292355 | 3300005330 | Bacteria | 1166 |
| 34 | Ga0070690_100505583 | 3300005330 | Bacteria | 905 |
| 35 | Ga0070670_100240073 | 3300005331 | Bacteria | 1577 |
| 36 | Ga0068869_100160569 | 3300005334 | Bacteria | 1749 |
| 37 | Ga0068869_100168960 | 3300005334 | Bacteria | 1707 |
| 38 | Ga0070680_100009352 | 3300005336 | Bacteria | 7530 |
| 39 | Ga0070680_100109995 | 3300005336 | Bacteria | 2293 |
| 40 | Ga0070680_100123724 | 3300005336 | Bacteria | 2160 |
| 41 | Ga0070682_100289367 | 3300005337 | Bacteria | 1198 |
| 42 | Ga0070682_100594443 | 3300005337 | Bacteria | 873 |
| 43 | Ga0068868_101049560 | 3300005338 | Bacteria | 748 |
| 44 | Ga0068868_101102029 | 3300005338 | Bacteria | 730 |
| 45 | Ga0070660_100018794 | 3300005339 | Bacteria | 5056 |
| 46 | Ga0070660_100173282 | 3300005339 | Bacteria | 1743 |
| 47 | Ga0070660_100351557 | 3300005339 | Bacteria | 1214 |
| 48 | Ga0070660_100581880 | 3300005339 | Bacteria | 935 |
| 49 | Ga0070660_100707779 | 3300005339 | Bacteria | 845 |
| 50 | Ga0070689_100539710 | 3300005340 | Bacteria | 1003 |
| 51 | Ga0070691_10005991 | 3300005341 | Bacteria | 5548 |
| 52 | Ga0070691_10409577 | 3300005341 | Bacteria | 766 |
| 53 | Ga0070687_100643881 | 3300005343 | Bacteria | 734 |
| 54 | Ga0070661_100209415 | 3300005344 | Bacteria | 1492 |
| 55 | Ga0070661_100322031 | 3300005344 | Bacteria | 1207 |
| 56 | Ga0070661_100486758 | 3300005344 | Bacteria | 986 |
| 57 | Ga0070692_10173375 | 3300005345 | Bacteria | 1245 |
| 58 | Ga0070668_100012224 | 3300005347 | Bacteria | 6396 |
| 59 | Ga0070668_100074858 | 3300005347 | Bacteria | 2642 |
| 60 | Ga0070668_100122443 | 3300005347 | Bacteria | 2080 |
| 61 | Ga0070668_100246887 | 3300005347 | Bacteria | 1480 |
| 62 | Ga0070668_100262224 | 3300005347 | Bacteria | 1437 |
| 63 | Ga0070668_100302191 | 3300005347 | Bacteria | 1342 |
| 64 | Ga0070668_100348033 | 3300005347 | Bacteria | 1253 |
| 65 | Ga0070669_100099323 | 3300005353 | Bacteria | 2193 |
| 66 | Ga0070669_100136605 | 3300005353 | Bacteria | 1886 |
| 67 | Ga0070669_100188041 | 3300005353 | Bacteria | 1619 |
| 68 | Ga0070669_100440211 | 3300005353 | Bacteria | 1073 |
| 69 | Ga0070675_100554306 | 3300005354 | Bacteria | 1040 |
| 70 | Ga0070671_100096306 | 3300005355 | Bacteria | 2482 |
| 71 | Ga0070671_100737593 | 3300005355 | Bacteria | 856 |
| 72 | Ga0070674_100087142 | 3300005356 | Bacteria | 2244 |
| 73 | Ga0070674_100155154 | 3300005356 | Bacteria | 1731 |
| 74 | Ga0070674_101303673 | 3300005356 | Bacteria | 648 |
| 75 | Ga0070673_100358039 | 3300005364 | Bacteria | 1296 |
| 76 | Ga0070688_100222632 | 3300005365 | Bacteria | 1330 |
| 77 | Ga0070659_100039074 | 3300005366 | Bacteria | 3703 |
| 78 | Ga0070659_100069607 | 3300005366 | Bacteria | 2793 |
| 79 | Ga0070659_100986191 | 3300005366 | Bacteria | 739 |
| 80 | Ga0070667_100229055 | 3300005367 | Bacteria | 1656 |
| 81 | Ga0070709_10002011 | 3300005434 | Bacteria | 11061 |
| 82 | Ga0070709_10057722 | 3300005434 | Bacteria | 2459 |
| 83 | Ga0070709_10539826 | 3300005434 | Bacteria | 891 |
| 84 | Ga0070714_100065139 | 3300005435 | Bacteria | 3138 |
| 85 | Ga0070714_100073637 | 3300005435 | Bacteria | 2960 |
| 86 | Ga0070714_100171751 | 3300005435 | Bacteria | 1967 |
| 87 | Ga0070714_100422521 | 3300005435 | Bacteria | 1263 |
| 88 | Ga0070713_100041608 | 3300005436 | Bacteria | 3745 |
| 89 | Ga0070713_100078712 | 3300005436 | Bacteria | 2807 |
| 90 | Ga0070713_100119880 | 3300005436 | Bacteria | 2306 |
| 91 | Ga0070713_100264896 | 3300005436 | Bacteria | 1572 |
| 92 | Ga0070713_100267066 | 3300005436 | Bacteria | 1566 |
| 93 | Ga0070713_100322207 | 3300005436 | Bacteria | 1428 |
| 94 | Ga0070710_10000872 | 3300005437 | Bacteria | 14419 |
| 95 | Ga0070710_10013092 | 3300005437 | Bacteria | 4141 |
| 96 | Ga0070710_10028873 | 3300005437 | Bacteria | 2971 |
| 97 | Ga0070710_10195934 | 3300005437 | Bacteria | 1273 |
| 98 | Ga0070710_10320347 | 3300005437 | Bacteria | 1018 |
| 99 | Ga0070710_10504055 | 3300005437 | Bacteria | 829 |
| 100 | Ga0070710_10539740 | 3300005437 | Bacteria | 804 |
| 101 | Ga0070711_100008236 | 3300005439 | Bacteria | 6377 |
| 102 | Ga0070711_100043404 | 3300005439 | Bacteria | 3045 |
| 103 | Ga0070711_100090510 | 3300005439 | Bacteria | 2204 |
| 104 | Ga0070711_100122058 | 3300005439 | Bacteria | 1929 |
| 105 | Ga0070711_100187446 | 3300005439 | Bacteria | 1587 |
| 106 | Ga0070711_100559012 | 3300005439 | Bacteria | 950 |
| 107 | Ga0070711_100750453 | 3300005439 | Bacteria | 825 |
| 108 | Ga0070700_100537694 | 3300005441 | Bacteria | 906 |
| 109 | Ga0070663_100013673 | 3300005455 | Bacteria | 5185 |
| 110 | Ga0070663_100018768 | 3300005455 | Bacteria | 4542 |
| 111 | Ga0070663_100023522 | 3300005455 | Bacteria | 4131 |
| 112 | Ga0070663_100077368 | 3300005455 | Bacteria | 2435 |
| 113 | Ga0070663_100092535 | 3300005455 | Bacteria | 2242 |
| 114 | Ga0070663_100204298 | 3300005455 | Bacteria | 1543 |
| 115 | Ga0070663_100219999 | 3300005455 | Bacteria | 1490 |
| 116 | Ga0070663_100335763 | 3300005455 | Bacteria | 1219 |
| 117 | Ga0070663_100467154 | 3300005455 | Bacteria | 1042 |
| 118 | Ga0070663_100640712 | 3300005455 | Bacteria | 898 |
| 119 | Ga0070678_100043263 | 3300005456 | Bacteria | 3206 |
| 120 | Ga0070678_100108302 | 3300005456 | Bacteria | 2168 |
| 121 | Ga0070678_100178862 | 3300005456 | Bacteria | 1734 |
| 122 | Ga0070662_100040180 | 3300005457 | Bacteria | 3330 |
| 123 | Ga0070662_100183100 | 3300005457 | Bacteria | 1653 |
| 124 | Ga0070662_100528446 | 3300005457 | Bacteria | 986 |
| 125 | Ga0070662_100708822 | 3300005457 | Bacteria | 852 |
| 126 | Ga0070662_100882379 | 3300005457 | Bacteria | 763 |
| 127 | Ga0070662_101163248 | 3300005457 | Bacteria | 663 |
| 128 | Ga0070681_10013547 | 3300005458 | Bacteria | 8109 |
| 129 | Ga0070681_10072747 | 3300005458 | Bacteria | 3400 |
| 130 | Ga0070681_10276518 | 3300005458 | Bacteria | 1590 |
| 131 | Ga0070681_10320087 | 3300005458 | Bacteria | 1461 |
| 132 | Ga0070681_10450146 | 3300005458 | Bacteria | 1200 |
| 133 | Ga0068867_100083306 | 3300005459 | Bacteria | 2414 |
| 134 | Ga0068867_100810829 | 3300005459 | Bacteria | 835 |
| 135 | Ga0070685_10162228 | 3300005466 | Bacteria | 1426 |
| 136 | Ga0070706_100224878 | 3300005467 | Bacteria | 1752 |
| 137 | Ga0070706_100552791 | 3300005467 | Bacteria | 1071 |
| 138 | Ga0070698_100128362 | 3300005471 | Bacteria | 2492 |
| 139 | Ga0070698_100569266 | 3300005471 | Bacteria | 1073 |
| 140 | Ga0070699_100131436 | 3300005518 | Bacteria | 2207 |
| 141 | Ga0070679_100041775 | 3300005530 | Bacteria | 4564 |
| 142 | Ga0070679_100206683 | 3300005530 | Bacteria | 1928 |
| 143 | Ga0070679_100220342 | 3300005530 | Bacteria | 1858 |
| 144 | Ga0070679_100246654 | 3300005530 | Bacteria | 1743 |
| 145 | Ga0070679_100346124 | 3300005530 | Bacteria | 1434 |
| 146 | Ga0070679_100433466 | 3300005530 | Bacteria | 1259 |
| 147 | Ga0070684_100066098 | 3300005535 | Bacteria | 3174 |
| 148 | Ga0070684_100127231 | 3300005535 | Bacteria | 2296 |
| 149 | Ga0070684_100433063 | 3300005535 | Bacteria | 1214 |
| 150 | Ga0070684_100518537 | 3300005535 | Bacteria | 1105 |
| 151 | Ga0070697_100076378 | 3300005536 | Bacteria | 2755 |
| 152 | Ga0068853_100010722 | 3300005539 | Bacteria | 7421 |
| 153 | Ga0068853_100058648 | 3300005539 | Bacteria | 3323 |
| 154 | Ga0068853_100063111 | 3300005539 | Bacteria | 3208 |
| 155 | Ga0068853_100135559 | 3300005539 | Bacteria | 2207 |
| 156 | Ga0068853_100307623 | 3300005539 | Bacteria | 1466 |
| 157 | Ga0068853_100908965 | 3300005539 | Bacteria | 846 |
| 158 | Ga0068853_101225955 | 3300005539 | Bacteria | 725 |
| 159 | Ga0068853_101579449 | 3300005539 | Bacteria | 635 |
| 160 | Ga0070672_100051989 | 3300005543 | Bacteria | 3197 |
| 161 | Ga0070672_100223244 | 3300005543 | Bacteria | 1581 |
| 162 | Ga0070686_100082807 | 3300005544 | Bacteria | 2128 |
| 163 | Ga0070696_100811732 | 3300005546 | Bacteria | 771 |
| 164 | Ga0070693_100182519 | 3300005547 | Bacteria | 1352 |
| 165 | Ga0070693_100231614 | 3300005547 | Bacteria | 1216 |
| 166 | Ga0070693_100256793 | 3300005547 | Bacteria | 1161 |
| 167 | Ga0070693_100258217 | 3300005547 | Bacteria | 1158 |
| 168 | Ga0070665_100122323 | 3300005548 | Bacteria | 2604 |
| 169 | Ga0070665_100173976 | 3300005548 | Bacteria | 2154 |
| 170 | Ga0070665_100219984 | 3300005548 | Bacteria | 1899 |
| 171 | Ga0070665_100282652 | 3300005548 | Bacteria | 1661 |
| 172 | Ga0070665_100432308 | 3300005548 | Bacteria | 1325 |
| 173 | Ga0070665_100460944 | 3300005548 | Bacteria | 1281 |
| 174 | Ga0070665_100559060 | 3300005548 | Bacteria | 1156 |
| 175 | Ga0070665_100678299 | 3300005548 | Bacteria | 1043 |
| 176 | Ga0070704_100701181 | 3300005549 | Bacteria | 898 |
| 177 | Ga0068855_100034337 | 3300005563 | Bacteria | 6050 |
| 178 | Ga0068855_100037580 | 3300005563 | Bacteria | 5757 |
| 179 | Ga0068855_100051685 | 3300005563 | Bacteria | 4841 |
| 180 | Ga0068855_100083979 | 3300005563 | Bacteria | 3688 |
| 181 | Ga0068855_100266223 | 3300005563 | Bacteria | 1908 |
| 182 | Ga0068855_100300171 | 3300005563 | Bacteria | 1779 |
| 183 | Ga0068855_100575850 | 3300005563 | Bacteria | 1216 |
| 184 | Ga0068855_101093612 | 3300005563 | Bacteria | 834 |
| 185 | Ga0068855_101390712 | 3300005563 | Bacteria | 724 |
| 186 | Ga0070664_100053626 | 3300005564 | Bacteria | 3419 |
| 187 | Ga0070664_100297206 | 3300005564 | Bacteria | 1458 |
| 188 | Ga0070664_100941790 | 3300005564 | Bacteria | 811 |
| 189 | Ga0068857_100002988 | 3300005577 | Bacteria | 13941 |
| 190 | Ga0068857_100008016 | 3300005577 | Bacteria | 9109 |
| 191 | Ga0068857_100015801 | 3300005577 | Bacteria | 6606 |
| 192 | Ga0068857_100130693 | 3300005577 | Bacteria | 2265 |
| 193 | Ga0068854_100000689 | 3300005578 | Bacteria | 20158 |
| 194 | Ga0068854_100176582 | 3300005578 | Bacteria | 1665 |
| 195 | Ga0068854_100231226 | 3300005578 | Bacteria | 1467 |
| 196 | Ga0068856_100041193 | 3300005614 | Bacteria | 4537 |
| 197 | Ga0068856_100091417 | 3300005614 | Bacteria | 3028 |
| 198 | Ga0068856_100122900 | 3300005614 | Bacteria | 2598 |
| 199 | Ga0068856_100150365 | 3300005614 | Bacteria | 2337 |
| 200 | Ga0068856_100285720 | 3300005614 | Bacteria | 1667 |
| 201 | Ga0068856_100293164 | 3300005614 | Bacteria | 1644 |
| 202 | Ga0068856_100565292 | 3300005614 | Bacteria | 1158 |
| 203 | Ga0068856_100570665 | 3300005614 | Bacteria | 1153 |
| 204 | Ga0068856_100578990 | 3300005614 | Bacteria | 1144 |
| 205 | Ga0068856_100723432 | 3300005614 | Bacteria | 1016 |
| 206 | Ga0068856_100781199 | 3300005614 | Bacteria | 975 |
| 207 | Ga0070702_100164228 | 3300005615 | Bacteria | 1438 |
| 208 | Ga0068852_100040046 | 3300005616 | Bacteria | 3951 |
| 209 | Ga0068852_100052928 | 3300005616 | Bacteria | 3492 |
| 210 | Ga0068852_100121689 | 3300005616 | Bacteria | 2391 |
| 211 | Ga0068852_100295009 | 3300005616 | Bacteria | 1567 |
| 212 | Ga0068852_100347869 | 3300005616 | Bacteria | 1447 |
| 213 | Ga0068852_100450914 | 3300005616 | Bacteria | 1273 |
| 214 | Ga0068852_100451944 | 3300005616 | Bacteria | 1272 |
| 215 | Ga0068852_100999916 | 3300005616 | Bacteria | 855 |
| 216 | Ga0068852_101005432 | 3300005616 | Bacteria | 852 |
| 217 | Ga0068859_100055596 | 3300005617 | Bacteria | 3983 |
| 218 | Ga0068859_100113481 | 3300005617 | Bacteria | 2773 |
| 219 | Ga0068859_100368700 | 3300005617 | Bacteria | 1531 |
| 220 | Ga0068859_100529064 | 3300005617 | Bacteria | 1274 |
| 221 | Ga0068864_100010685 | 3300005618 | Bacteria | 7587 |
| 222 | Ga0068864_100070104 | 3300005618 | Bacteria | 3050 |
| 223 | Ga0068864_100193808 | 3300005618 | Bacteria | 1864 |
| 224 | Ga0068861_100059460 | 3300005719 | Bacteria | 2926 |
| 225 | Ga0068861_100223314 | 3300005719 | Bacteria | 1593 |
| 226 | Ga0068861_100238612 | 3300005719 | Bacteria | 1545 |
| 227 | Ga0068861_100276342 | 3300005719 | Bacteria | 1444 |
| 228 | Ga0068851_10003958 | 3300005834 | Bacteria | 6633 |
| 229 | Ga0068851_10058123 | 3300005834 | Bacteria | 1976 |
| 230 | Ga0068870_10145690 | 3300005840 | Bacteria | 1390 |
| 231 | Ga0068863_100199834 | 3300005841 | Bacteria | 1923 |
| 232 | Ga0068863_100210895 | 3300005841 | Bacteria | 1871 |
| 233 | Ga0068863_101037046 | 3300005841 | Bacteria | 824 |
| 234 | Ga0068858_100019227 | 3300005842 | Bacteria | 6387 |
| 235 | Ga0068858_100024626 | 3300005842 | Bacteria | 5607 |
| 236 | Ga0068858_100133581 | 3300005842 | Bacteria | 2328 |
| 237 | Ga0068858_100274839 | 3300005842 | Bacteria | 1603 |
| 238 | Ga0068858_100430016 | 3300005842 | Bacteria | 1270 |
| 239 | Ga0068858_100453634 | 3300005842 | Bacteria | 1236 |
| 240 | Ga0068858_101191788 | 3300005842 | Bacteria | 748 |
| 241 | Ga0068860_100001623 | 3300005843 | Bacteria | 24139 |
| 242 | Ga0068860_100268252 | 3300005843 | Bacteria | 1665 |
| 243 | Ga0068860_100373600 | 3300005843 | Bacteria | 1406 |
| 244 | Ga0068860_100566113 | 3300005843 | Bacteria | 1139 |
| 245 | Ga0068860_100758112 | 3300005843 | Bacteria | 982 |
| 246 | Ga0068860_100871966 | 3300005843 | Bacteria | 915 |
| 247 | Ga0068862_100118150 | 3300005844 | Bacteria | 2334 |
| 248 | Ga0068862_100383474 | 3300005844 | Bacteria | 1311 |
| 249 | Ga0068862_100392645 | 3300005844 | Bacteria | 1296 |
| 250 | Ga0068862_100486013 | 3300005844 | Bacteria | 1169 |
| 251 | Ga0068862_100513137 | 3300005844 | Bacteria | 1139 |
| 252 | Ga0068862_100531476 | 3300005844 | Bacteria | 1120 |
| 253 | Ga0068862_100574171 | 3300005844 | Bacteria | 1079 |
| 254 | Ga0081455_10011753 | 3300005937 | Bacteria | 8768 |
| 255 | Ga0081455_10030453 | 3300005937 | Bacteria | 4900 |
| 256 | Ga0081455_10044915 | 3300005937 | Bacteria | 3849 |
| 257 | Ga0081455_10065396 | 3300005937 | Bacteria | 3042 |
| 258 | Ga0081538_10026982 | 3300005981 | Bacteria | 3996 |
| 259 | Ga0081538_10081593 | 3300005981 | Bacteria | 1719 |
| 260 | Ga0081538_10096710 | 3300005981 | Bacteria | 1503 |
| 261 | Ga0081540_1000641 | 3300005983 | Bacteria | 33205 |
| 262 | Ga0081540_1002768 | 3300005983 | Bacteria | 14227 |
| 263 | Ga0081540_1004657 | 3300005983 | Bacteria | 10380 |
| 264 | Ga0081540_1012285 | 3300005983 | Bacteria | 5653 |
| 265 | Ga0081540_1019885 | 3300005983 | Bacteria | 4061 |
| 266 | Ga0081540_1022974 | 3300005983 | Bacteria | 3665 |
| 267 | Ga0081540_1030989 | 3300005983 | Bacteria | 2951 |
| 268 | Ga0081540_1091743 | 3300005983 | Bacteria | 1335 |
| 269 | Ga0081540_1116108 | 3300005983 | Bacteria | 1121 |
| 270 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 271 | Ga0081539_10001127 | 3300005985 | Bacteria | 48442 |
| 272 | Ga0081539_10049479 | 3300005985 | Bacteria | 2385 |
| 273 | Ga0070717_10003745 | 3300006028 | Bacteria | 10920 |
| 274 | Ga0070717_10051071 | 3300006028 | Bacteria | 3401 |
| 275 | Ga0070717_10062343 | 3300006028 | Bacteria | 3092 |
| 276 | Ga0070717_10087173 | 3300006028 | Bacteria | 2629 |
| 277 | Ga0070717_10251791 | 3300006028 | Bacteria | 1560 |
| 278 | Ga0070717_10508766 | 3300006028 | Bacteria | 1089 |
| 279 | Ga0070717_10746778 | 3300006028 | Bacteria | 889 |
| 280 | Ga0075365_10009883 | 3300006038 | Bacteria | 5522 |
| 281 | Ga0075365_10017356 | 3300006038 | Bacteria | 4402 |
| 282 | Ga0075365_10061649 | 3300006038 | Bacteria | 2505 |
| 283 | Ga0075365_10113512 | 3300006038 | Bacteria | 1864 |
| 284 | Ga0075365_10156261 | 3300006038 | Bacteria | 1587 |
| 285 | Ga0075365_10234326 | 3300006038 | Bacteria | 1289 |
| 286 | Ga0075365_10514033 | 3300006038 | Bacteria | 847 |
| 287 | Ga0075368_10013479 | 3300006042 | Bacteria | 3003 |
| 288 | Ga0075368_10057272 | 3300006042 | Bacteria | 1556 |
| 289 | Ga0075368_10117836 | 3300006042 | Bacteria | 1098 |
| 290 | Ga0075368_10186706 | 3300006042 | Bacteria | 875 |
| 291 | Ga0075363_100002972 | 3300006048 | Bacteria | 7076 |
| 292 | Ga0075363_100101873 | 3300006048 | Bacteria | 1589 |
| 293 | Ga0075363_100199888 | 3300006048 | Bacteria | 1142 |
| 294 | Ga0075363_100274372 | 3300006048 | Bacteria | 974 |
| 295 | Ga0075363_100516078 | 3300006048 | Bacteria | 711 |
| 296 | Ga0075364_10027868 | 3300006051 | Bacteria | 3611 |
| 297 | Ga0075364_10058333 | 3300006051 | Bacteria | 2530 |
| 298 | Ga0075364_10205722 | 3300006051 | Bacteria | 1335 |
| 299 | Ga0075364_10320528 | 3300006051 | Bacteria | 1055 |
| 300 | Ga0075364_10371178 | 3300006051 | Bacteria | 976 |
| 301 | Ga0070715_10001222 | 3300006163 | Bacteria | 7384 |
| 302 | Ga0070715_10040865 | 3300006163 | Bacteria | 1941 |
| 303 | Ga0070716_100023433 | 3300006173 | Bacteria | 3274 |
| 304 | Ga0070716_100068726 | 3300006173 | Bacteria | 2073 |
| 305 | Ga0070716_100405927 | 3300006173 | Bacteria | 981 |
| 306 | Ga0070716_100443012 | 3300006173 | Bacteria | 945 |
| 307 | Ga0070712_100009491 | 3300006175 | Bacteria | 6134 |
| 308 | Ga0070712_100079979 | 3300006175 | Bacteria | 2364 |
| 309 | Ga0070712_100114364 | 3300006175 | Bacteria | 2020 |
| 310 | Ga0070712_100141178 | 3300006175 | Bacteria | 1838 |
| 311 | Ga0070712_100212311 | 3300006175 | Bacteria | 1527 |
| 312 | Ga0070712_100549527 | 3300006175 | Bacteria | 973 |
| 313 | Ga0070712_100745083 | 3300006175 | Bacteria | 838 |
| 314 | Ga0070712_100807331 | 3300006175 | Bacteria | 805 |
| 315 | Ga0075362_10111361 | 3300006177 | Bacteria | 1289 |
| 316 | Ga0075362_10195098 | 3300006177 | Bacteria | 984 |
| 317 | Ga0075362_10246743 | 3300006177 | Bacteria | 878 |
| 318 | Ga0075362_10318261 | 3300006177 | Bacteria | 774 |
| 319 | Ga0075367_10026926 | 3300006178 | Bacteria | 3266 |
| 320 | Ga0075367_10050636 | 3300006178 | Bacteria | 2453 |
| 321 | Ga0075367_10165437 | 3300006178 | Bacteria | 1376 |
| 322 | Ga0075367_10185763 | 3300006178 | Bacteria | 1296 |
| 323 | Ga0075367_10437204 | 3300006178 | Bacteria | 829 |
| 324 | Ga0075369_10030464 | 3300006186 | Bacteria | 2272 |
| 325 | Ga0075369_10053362 | 3300006186 | Bacteria | 1754 |
| 326 | Ga0075369_10057154 | 3300006186 | Bacteria | 1696 |
| 327 | Ga0075369_10079997 | 3300006186 | Bacteria | 1448 |
| 328 | Ga0075369_10161585 | 3300006186 | Bacteria | 1027 |
| 329 | Ga0075366_10002189 | 3300006195 | Bacteria | 9977 |
| 330 | Ga0075366_10075611 | 3300006195 | Bacteria | 2009 |
| 331 | Ga0097621_100005281 | 3300006237 | Bacteria | 9095 |
| 332 | Ga0097621_100046218 | 3300006237 | Bacteria | 3521 |
| 333 | Ga0097621_100756708 | 3300006237 | Bacteria | 898 |
| 334 | Ga0097621_101213849 | 3300006237 | Bacteria | 711 |
| 335 | Ga0075370_10014282 | 3300006353 | Bacteria | 4235 |
| 336 | Ga0075370_10046269 | 3300006353 | Bacteria | 2462 |
| 337 | Ga0075370_10110178 | 3300006353 | Bacteria | 1598 |
| 338 | Ga0075370_10239912 | 3300006353 | Bacteria | 1073 |
| 339 | Ga0075370_10251878 | 3300006353 | Bacteria | 1047 |
| 340 | Ga0075370_10254275 | 3300006353 | Bacteria | 1041 |
| 341 | Ga0075370_10622119 | 3300006353 | Bacteria | 655 |
| 342 | Ga0068871_100105507 | 3300006358 | Bacteria | 2364 |
| 343 | Ga0068871_100130610 | 3300006358 | Bacteria | 2130 |
| 344 | Ga0075433_10245834 | 3300006852 | Bacteria | 1588 |
| 345 | Ga0075433_10527330 | 3300006852 | Bacteria | 1039 |
| 346 | Ga0075434_100100279 | 3300006871 | Bacteria | 2902 |
| 347 | Ga0075434_100119417 | 3300006871 | Bacteria | 2650 |
| 348 | Ga0075434_100423347 | 3300006871 | Bacteria | 1353 |
| 349 | Ga0068865_100077261 | 3300006881 | Bacteria | 2379 |
| 350 | Ga0068865_100124039 | 3300006881 | Bacteria | 1925 |
| 351 | Ga0068865_100504217 | 3300006881 | Bacteria | 1009 |
| 352 | Ga0097620_100055594 | 3300006931 | Bacteria | 3983 |
| 353 | Ga0097620_100113485 | 3300006931 | Bacteria | 2773 |
| 354 | Ga0097620_100368689 | 3300006931 | Bacteria | 1531 |
| 355 | Ga0097620_100529060 | 3300006931 | Bacteria | 1274 |
| 356 | Ga0099825_1039686 | 3300006941 | Bacteria | 1433 |
| 357 | Ga0099824_1004995 | 3300006942 | Bacteria | 18868 |
| 358 | Ga0099822_1001207 | 3300006943 | Bacteria | 29221 |
| 359 | Ga0099794_10024310 | 3300007265 | Bacteria | 2779 |
| 360 | Ga0099794_10124935 | 3300007265 | Bacteria | 1297 |
| 361 | Ga0099795_10034418 | 3300007788 | Bacteria | 1765 |
| 362 | Ga0099795_10100085 | 3300007788 | Bacteria | 1136 |
| 363 | Ga0099795_10141756 | 3300007788 | Bacteria | 978 |
| 364 | Ga0105251_10130578 | 3300009011 | Bacteria | 1139 |
| 365 | Ga0105251_10298853 | 3300009011 | Bacteria | 730 |
| 366 | Ga0105250_10054952 | 3300009092 | Bacteria | 1598 |
| 367 | Ga0105240_10007562 | 3300009093 | Bacteria | 15748 |
| 368 | Ga0105240_10032680 | 3300009093 | Bacteria | 6734 |
| 369 | Ga0105240_10069048 | 3300009093 | Bacteria | 4375 |
| 370 | Ga0105240_10162542 | 3300009093 | Bacteria | 2651 |
| 371 | Ga0105240_10218258 | 3300009093 | Bacteria | 2223 |
| 372 | Ga0105240_10250981 | 3300009093 | Bacteria | 2046 |
| 373 | Ga0105240_10321140 | 3300009093 | Bacteria | 1765 |
| 374 | Ga0105240_10563251 | 3300009093 | Bacteria | 1259 |
| 375 | Ga0111539_10394179 | 3300009094 | Bacteria | 1613 |
| 376 | Ga0105245_10084813 | 3300009098 | Bacteria | 2903 |
| 377 | Ga0105245_10740899 | 3300009098 | Bacteria | 1018 |
| 378 | Ga0105245_10745722 | 3300009098 | Bacteria | 1015 |
| 379 | Ga0105245_11097571 | 3300009098 | Bacteria | 842 |
| 380 | Ga0105247_10034563 | 3300009101 | Bacteria | 3078 |
| 381 | Ga0105247_10152729 | 3300009101 | Bacteria | 1523 |
| 382 | Ga0105247_10213354 | 3300009101 | Bacteria | 1303 |
| 383 | Ga0105247_10255145 | 3300009101 | Bacteria | 1200 |
| 384 | Ga0105247_10260534 | 3300009101 | Bacteria | 1189 |
| 385 | Ga0105247_10961168 | 3300009101 | Bacteria | 664 |
| 386 | Ga0114129_10752504 | 3300009147 | Bacteria | 1247 |
| 387 | Ga0105243_10222520 | 3300009148 | Bacteria | 1669 |
| 388 | Ga0105243_10301176 | 3300009148 | Bacteria | 1453 |
| 389 | Ga0105243_10673534 | 3300009148 | Bacteria | 1005 |
| 390 | Ga0105243_11024974 | 3300009148 | Bacteria | 829 |
| 391 | Ga0105241_10002823 | 3300009174 | Bacteria | 12985 |
| 392 | Ga0105241_10037835 | 3300009174 | Bacteria | 3636 |
| 393 | Ga0105241_10056298 | 3300009174 | Bacteria | 3015 |
| 394 | Ga0105241_10091921 | 3300009174 | Bacteria | 2395 |
| 395 | Ga0105241_10187570 | 3300009174 | Bacteria | 1719 |
| 396 | Ga0105241_10301968 | 3300009174 | Bacteria | 1374 |
| 397 | Ga0105242_10238466 | 3300009176 | Bacteria | 1634 |
| 398 | Ga0105242_10240184 | 3300009176 | Bacteria | 1628 |
| 399 | Ga0105242_11210465 | 3300009176 | Bacteria | 775 |
| 400 | Ga0105248_10092104 | 3300009177 | Bacteria | 3413 |
| 401 | Ga0105248_10363321 | 3300009177 | Bacteria | 1630 |
| 402 | Ga0105248_10684713 | 3300009177 | Bacteria | 1157 |
| 403 | Ga0105237_10003763 | 3300009545 | Bacteria | 17858 |
| 404 | Ga0105237_10015975 | 3300009545 | Bacteria | 7806 |
| 405 | Ga0105237_10041525 | 3300009545 | Bacteria | 4638 |
| 406 | Ga0105237_10116175 | 3300009545 | Bacteria | 2669 |
| 407 | Ga0105237_10154404 | 3300009545 | Bacteria | 2292 |
| 408 | Ga0105237_10232636 | 3300009545 | Bacteria | 1844 |
| 409 | Ga0105237_10283868 | 3300009545 | Bacteria | 1658 |
| 410 | Ga0105237_10363991 | 3300009545 | Bacteria | 1450 |
| 411 | Ga0105237_10431643 | 3300009545 | Bacteria | 1323 |
| 412 | Ga0105238_10003292 | 3300009551 | Bacteria | 16138 |
| 413 | Ga0105238_10028229 | 3300009551 | Bacteria | 5717 |
| 414 | Ga0105238_10063611 | 3300009551 | Bacteria | 3690 |
| 415 | Ga0105238_10067898 | 3300009551 | Bacteria | 3566 |
| 416 | Ga0105238_10230198 | 3300009551 | Bacteria | 1830 |
| 417 | Ga0105238_10285408 | 3300009551 | Bacteria | 1632 |
| 418 | Ga0105238_10346394 | 3300009551 | Bacteria | 1474 |
| 419 | Ga0105238_10353732 | 3300009551 | Bacteria | 1458 |
| 420 | Ga0105238_10443881 | 3300009551 | Bacteria | 1294 |
| 421 | Ga0105238_10450395 | 3300009551 | Bacteria | 1284 |
| 422 | Ga0105238_10853638 | 3300009551 | Bacteria | 928 |
| 423 | Ga0105238_11359110 | 3300009551 | Bacteria | 737 |
| 424 | Ga0105249_10256296 | 3300009553 | Bacteria | 1736 |
| 425 | Ga0105249_11302373 | 3300009553 | Bacteria | 798 |
| 426 | Ga0105249_11330288 | 3300009553 | Bacteria | 790 |
| 427 | Ga0099796_10001437 | 3300010159 | Bacteria | 4794 |
| 428 | Ga0099796_10095654 | 3300010159 | Bacteria | 1110 |
| 429 | Ga0099796_10170528 | 3300010159 | Bacteria | 868 |
| 430 | Ga0105239_10008866 | 3300010375 | Bacteria | 11385 |
| 431 | Ga0105239_10011356 | 3300010375 | Bacteria | 9936 |
| 432 | Ga0105239_10086297 | 3300010375 | Bacteria | 3459 |
| 433 | Ga0105239_10301128 | 3300010375 | Bacteria | 1806 |
| 434 | Ga0105239_10314020 | 3300010375 | Bacteria | 1767 |
| 435 | Ga0105239_10314283 | 3300010375 | Bacteria | 1766 |
| 436 | Ga0105239_10335428 | 3300010375 | Bacteria | 1706 |
| 437 | Ga0105239_10477319 | 3300010375 | Bacteria | 1416 |
| 438 | Ga0105239_10605626 | 3300010375 | Bacteria | 1250 |
| 439 | Ga0105239_10650730 | 3300010375 | Bacteria | 1204 |
| 440 | Ga0105239_10706011 | 3300010375 | Bacteria | 1153 |
| 441 | Ga0105239_10831249 | 3300010375 | Bacteria | 1059 |
| 442 | Ga0105239_10924833 | 3300010375 | Bacteria | 1001 |
| 443 | Ga0105246_10035926 | 3300011119 | Bacteria | 3315 |
| 444 | Ga0105246_10157351 | 3300011119 | Bacteria | 1727 |
| 445 | Ga0105246_10209134 | 3300011119 | Bacteria | 1522 |
| 446 | Ga0105246_10641415 | 3300011119 | Bacteria | 923 |
| 447 | Ga0105246_10894964 | 3300011119 | Bacteria | 795 |
| 448 | Ga0105246_11716442 | 3300011119 | Bacteria | 597 |
| 449 | Ga0157324_1005979 | 3300012506 | Bacteria | 900 |
| 450 | Ga0157373_10034353 | 3300013100 | Bacteria | 3642 |
| 451 | Ga0157371_10822979 | 3300013102 | Bacteria | 701 |
| 452 | Ga0157370_10089286 | 3300013104 | Bacteria | 2895 |
| 453 | Ga0157370_10138156 | 3300013104 | Bacteria | 2270 |
| 454 | Ga0157370_10149133 | 3300013104 | Bacteria | 2177 |
| 455 | Ga0157370_10387865 | 3300013104 | Bacteria | 1286 |
| 456 | Ga0157370_10796504 | 3300013104 | Bacteria | 860 |
| 457 | Ga0157369_10014541 | 3300013105 | Bacteria | 8880 |
| 458 | Ga0157369_10092228 | 3300013105 | Bacteria | 3232 |
| 459 | Ga0157369_10096129 | 3300013105 | Bacteria | 3161 |
| 460 | Ga0157369_10098106 | 3300013105 | Bacteria | 3125 |
| 461 | Ga0157369_10122600 | 3300013105 | Bacteria | 2757 |
| 462 | Ga0157369_10503057 | 3300013105 | Bacteria | 1254 |
| 463 | Ga0157369_11090462 | 3300013105 | Bacteria | 816 |
| 464 | Ga0157369_11267428 | 3300013105 | Bacteria | 752 |
| 465 | Ga0157374_10003265 | 3300013296 | Bacteria | 13623 |
| 466 | Ga0157374_10232907 | 3300013296 | Bacteria | 1810 |
| 467 | Ga0157374_10278484 | 3300013296 | Bacteria | 1651 |
| 468 | Ga0157378_10125884 | 3300013297 | Bacteria | 2367 |
| 469 | Ga0157378_10202070 | 3300013297 | Bacteria | 1880 |
| 470 | Ga0163162_10087159 | 3300013306 | Bacteria | 3200 |
| 471 | Ga0163162_10175710 | 3300013306 | Bacteria | 2267 |
| 472 | Ga0163162_10776997 | 3300013306 | Bacteria | 1076 |
| 473 | Ga0163162_11344740 | 3300013306 | Bacteria | 812 |
| 474 | Ga0163162_11364441 | 3300013306 | Bacteria | 806 |
| 475 | Ga0157372_10105097 | 3300013307 | Bacteria | 3230 |
| 476 | Ga0157372_10289539 | 3300013307 | Bacteria | 1905 |
| 477 | Ga0157372_10533287 | 3300013307 | Bacteria | 1368 |
| 478 | Ga0157372_10715921 | 3300013307 | Bacteria | 1164 |
| 479 | Ga0157372_10798483 | 3300013307 | Bacteria | 1097 |
| 480 | Ga0157372_10975207 | 3300013307 | Bacteria | 982 |
| 481 | Ga0157372_11294335 | 3300013307 | Bacteria | 841 |
| 482 | Ga0157372_11304815 | 3300013307 | Bacteria | 838 |
| 483 | Ga0157375_10026900 | 3300013308 | Bacteria | 5369 |
| 484 | Ga0157375_10229758 | 3300013308 | Bacteria | 2014 |
| 485 | Ga0157375_10476432 | 3300013308 | Bacteria | 1413 |
| 486 | Ga0157375_10832461 | 3300013308 | Bacteria | 1070 |
| 487 | Ga0163163_10052491 | 3300014325 | Bacteria | 4022 |
| 488 | Ga0163163_10423706 | 3300014325 | Bacteria | 1390 |
| 489 | Ga0163163_10697677 | 3300014325 | Bacteria | 1079 |
| 490 | Ga0163163_11378748 | 3300014325 | Bacteria | 767 |
| 491 | Ga0157380_10857415 | 3300014326 | Bacteria | 931 |
| 492 | Ga0157380_11594667 | 3300014326 | Bacteria | 708 |
| 493 | Ga0182008_10255591 | 3300014497 | Bacteria | 905 |
| 494 | Ga0157379_11195695 | 3300014968 | Bacteria | 731 |
| 495 | Ga0157376_10043730 | 3300014969 | Bacteria | 3677 |
| 496 | Ga0157376_10049317 | 3300014969 | Bacteria | 3486 |
| 497 | Ga0157376_10451447 | 3300014969 | Bacteria | 1254 |
| 498 | Ga0157376_10704411 | 3300014969 | Bacteria | 1015 |
| 499 | Ga0157376_10923548 | 3300014969 | Bacteria | 892 |
| 500 | Ga0182007_10069713 | 3300015262 | Bacteria | 1152 |
| 501 | Ga0163161_10189899 | 3300017792 | Bacteria | 1579 |
| 502 | Ga0206352_10701083 | 3300020078 | Bacteria | 687 |
| 503 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 504 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 505 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 506 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 507 | Ga0213873_10001574 | 3300021358 | Bacteria | 3811 |
| 508 | Ga0213873_10007116 | 3300021358 | Bacteria | 2229 |
| 509 | Ga0213874_10003476 | 3300021377 | Bacteria | 3497 |
| 510 | Ga0213874_10077900 | 3300021377 | Bacteria | 1069 |
| 511 | Ga0213876_10007380 | 3300021384 | Bacteria | 5978 |
| 512 | Ga0213876_10125874 | 3300021384 | Bacteria | 1361 |
| 513 | Ga0213871_10005961 | 3300021441 | Bacteria | 2550 |
| 514 | Ga0209563_104671 | 3300025230 | Bacteria | 2588 |
| 515 | Ga0207425_1019274 | 3300025245 | Bacteria | 1471 |
| 516 | Ga0209677_100313 | 3300025253 | Bacteria | 31691 |
| 517 | Ga0209677_104221 | 3300025253 | Bacteria | 4248 |
| 518 | Ga0209148_1000308 | 3300025254 | Bacteria | 70131 |
| 519 | Ga0209148_1011159 | 3300025254 | Bacteria | 1678 |
| 520 | Ga0209233_1002747 | 3300025261 | Bacteria | 6335 |
| 521 | Ga0209233_1004470 | 3300025261 | Bacteria | 4748 |
| 522 | Ga0209233_1004898 | 3300025261 | Bacteria | 4502 |
| 523 | Ga0209233_1010739 | 3300025261 | Bacteria | 2726 |
| 524 | Ga0209455_1001786 | 3300025272 | Bacteria | 9080 |
| 525 | Ga0209455_1002759 | 3300025272 | Bacteria | 6587 |
| 526 | Ga0209455_1004855 | 3300025272 | Bacteria | 4287 |
| 527 | Ga0209673_1020468 | 3300025273 | Bacteria | 2341 |
| 528 | Ga0209564_1000747 | 3300025295 | Bacteria | 46025 |
| 529 | Ga0209564_1003448 | 3300025295 | Bacteria | 10811 |
| 530 | Ga0209564_1006612 | 3300025295 | Bacteria | 6206 |
| 531 | Ga0209758_1000182 | 3300025297 | Bacteria | 140630 |
| 532 | Ga0209758_1000293 | 3300025297 | Bacteria | 98643 |
| 533 | Ga0209758_1000363 | 3300025297 | Bacteria | 80753 |
| 534 | Ga0209758_1003509 | 3300025297 | Bacteria | 14159 |
| 535 | Ga0209758_1003517 | 3300025297 | Bacteria | 14133 |
| 536 | Ga0209758_1006314 | 3300025297 | Bacteria | 8605 |
| 537 | Ga0209758_1011615 | 3300025297 | Bacteria | 5070 |
| 538 | Ga0209758_1011704 | 3300025297 | Bacteria | 5039 |
| 539 | Ga0209758_1032984 | 3300025297 | Bacteria | 2090 |
| 540 | Ga0209758_1038054 | 3300025297 | Bacteria | 1850 |
| 541 | Ga0209256_1008893 | 3300025299 | Bacteria | 4533 |
| 542 | Ga0209256_1061560 | 3300025299 | Bacteria | 872 |
| 543 | Ga0209256_1101099 | 3300025299 | Bacteria | 596 |
| 544 | Ga0207426_1000628 | 3300025302 | Bacteria | 44820 |
| 545 | Ga0207426_1000992 | 3300025302 | Bacteria | 27820 |
| 546 | Ga0207426_1004958 | 3300025302 | Bacteria | 6274 |
| 547 | Ga0207426_1006404 | 3300025302 | Bacteria | 5129 |
| 548 | Ga0209051_1066456 | 3300025303 | Bacteria | 1107 |
| 549 | Ga0207697_10197271 | 3300025315 | Bacteria | 885 |
| 550 | Ga0207656_10009014 | 3300025321 | Bacteria | 3698 |
| 551 | Ga0207696_1064733 | 3300025711 | Bacteria | 1024 |
| 552 | Ga0207653_10092156 | 3300025885 | Bacteria | 1062 |
| 553 | Ga0207692_10001137 | 3300025898 | Bacteria | 9787 |
| 554 | Ga0207692_10010103 | 3300025898 | Bacteria | 3965 |
| 555 | Ga0207692_10013707 | 3300025898 | Bacteria | 3523 |
| 556 | Ga0207692_10264037 | 3300025898 | Bacteria | 1036 |
| 557 | Ga0207642_10332300 | 3300025899 | Bacteria | 891 |
| 558 | Ga0207710_10042271 | 3300025900 | Bacteria | 2024 |
| 559 | Ga0207710_10078848 | 3300025900 | Bacteria | 1524 |
| 560 | Ga0207710_10137713 | 3300025900 | Bacteria | 1177 |
| 561 | Ga0207710_10156366 | 3300025900 | Bacteria | 1108 |
| 562 | Ga0207710_10188126 | 3300025900 | Bacteria | 1016 |
| 563 | Ga0207688_10012485 | 3300025901 | Bacteria | 4623 |
| 564 | Ga0207688_10068049 | 3300025901 | Bacteria | 2016 |
| 565 | Ga0207688_10072092 | 3300025901 | Bacteria | 1962 |
| 566 | Ga0207688_10220535 | 3300025901 | Bacteria | 1142 |
| 567 | Ga0207680_10099180 | 3300025903 | Bacteria | 1868 |
| 568 | Ga0207680_10116114 | 3300025903 | Bacteria | 1744 |
| 569 | Ga0207680_10146184 | 3300025903 | Bacteria | 1572 |
| 570 | Ga0207680_10160065 | 3300025903 | Bacteria | 1508 |
| 571 | Ga0207647_10006453 | 3300025904 | Bacteria | 8524 |
| 572 | Ga0207647_10099975 | 3300025904 | Bacteria | 1722 |
| 573 | Ga0207685_10026807 | 3300025905 | Bacteria | 2009 |
| 574 | Ga0207685_10038670 | 3300025905 | Bacteria | 1765 |
| 575 | Ga0207699_10000995 | 3300025906 | Bacteria | 13422 |
| 576 | Ga0207699_10017718 | 3300025906 | Bacteria | 3758 |
| 577 | Ga0207699_10066296 | 3300025906 | Bacteria | 2191 |
| 578 | Ga0207699_10133590 | 3300025906 | Bacteria | 1622 |
| 579 | Ga0207699_10691017 | 3300025906 | Bacteria | 746 |
| 580 | Ga0207645_10278514 | 3300025907 | Bacteria | 1110 |
| 581 | Ga0207645_10701827 | 3300025907 | Bacteria | 688 |
| 582 | Ga0207643_10021166 | 3300025908 | Bacteria | 3571 |
| 583 | Ga0207643_10251924 | 3300025908 | Bacteria | 1088 |
| 584 | Ga0207705_10151296 | 3300025909 | Bacteria | 1739 |
| 585 | Ga0207705_10461067 | 3300025909 | Bacteria | 986 |
| 586 | Ga0207654_10000250 | 3300025911 | Bacteria | 32514 |
| 587 | Ga0207654_10020214 | 3300025911 | Bacteria | 3526 |
| 588 | Ga0207654_10024384 | 3300025911 | Bacteria | 3251 |
| 589 | Ga0207654_10069183 | 3300025911 | Bacteria | 2091 |
| 590 | Ga0207654_10110387 | 3300025911 | Bacteria | 1710 |
| 591 | Ga0207654_10223849 | 3300025911 | Bacteria | 1249 |
| 592 | Ga0207707_10000526 | 3300025912 | Bacteria | 39289 |
| 593 | Ga0207707_10001497 | 3300025912 | Bacteria | 21565 |
| 594 | Ga0207707_10034652 | 3300025912 | Bacteria | 4417 |
| 595 | Ga0207707_10125242 | 3300025912 | Bacteria | 2247 |
| 596 | Ga0207707_10352931 | 3300025912 | Bacteria | 1267 |
| 597 | Ga0207707_10464788 | 3300025912 | Bacteria | 1082 |
| 598 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 599 | Ga0207695_10000479 | 3300025913 | Bacteria | 85874 |
| 600 | Ga0207695_10001357 | 3300025913 | Bacteria | 41521 |
| 601 | Ga0207695_10005090 | 3300025913 | Bacteria | 17617 |
| 602 | Ga0207695_10048603 | 3300025913 | Bacteria | 4479 |
| 603 | Ga0207695_10089217 | 3300025913 | Bacteria | 3101 |
| 604 | Ga0207695_10090447 | 3300025913 | Bacteria | 3076 |
| 605 | Ga0207695_10217187 | 3300025913 | Bacteria | 1820 |
| 606 | Ga0207671_10004749 | 3300025914 | Bacteria | 12824 |
| 607 | Ga0207671_10041272 | 3300025914 | Bacteria | 3415 |
| 608 | Ga0207671_10091185 | 3300025914 | Bacteria | 2296 |
| 609 | Ga0207671_10094823 | 3300025914 | Bacteria | 2252 |
| 610 | Ga0207671_10097153 | 3300025914 | Bacteria | 2227 |
| 611 | Ga0207671_10125116 | 3300025914 | Bacteria | 1968 |
| 612 | Ga0207671_10172137 | 3300025914 | Bacteria | 1682 |
| 613 | Ga0207671_10253575 | 3300025914 | Bacteria | 1383 |
| 614 | Ga0207671_10306080 | 3300025914 | Bacteria | 1256 |
| 615 | Ga0207693_10000156 | 3300025915 | Bacteria | 63230 |
| 616 | Ga0207693_10009900 | 3300025915 | Bacteria | 7752 |
| 617 | Ga0207693_10046531 | 3300025915 | Bacteria | 3408 |
| 618 | Ga0207693_10183839 | 3300025915 | Bacteria | 1645 |
| 619 | Ga0207693_10336257 | 3300025915 | Bacteria | 1182 |
| 620 | Ga0207693_10483784 | 3300025915 | Bacteria | 967 |
| 621 | Ga0207693_10541136 | 3300025915 | Bacteria | 908 |
| 622 | Ga0207663_10000158 | 3300025916 | Bacteria | 31459 |
| 623 | Ga0207663_10010958 | 3300025916 | Bacteria | 4846 |
| 624 | Ga0207663_10085686 | 3300025916 | Bacteria | 2075 |
| 625 | Ga0207663_10356544 | 3300025916 | Bacteria | 1108 |
| 626 | Ga0207663_10366692 | 3300025916 | Bacteria | 1094 |
| 627 | Ga0207663_10517897 | 3300025916 | Bacteria | 928 |
| 628 | Ga0207660_10005316 | 3300025917 | Bacteria | 8367 |
| 629 | Ga0207660_10091304 | 3300025917 | Bacteria | 2258 |
| 630 | Ga0207660_10153953 | 3300025917 | Bacteria | 1769 |
| 631 | Ga0207662_10313203 | 3300025918 | Bacteria | 1046 |
| 632 | Ga0207657_10004389 | 3300025919 | Bacteria | 14926 |
| 633 | Ga0207657_10011015 | 3300025919 | Bacteria | 8988 |
| 634 | Ga0207657_10035461 | 3300025919 | Bacteria | 4473 |
| 635 | Ga0207657_10310633 | 3300025919 | Bacteria | 1248 |
| 636 | Ga0207657_10365074 | 3300025919 | Bacteria | 1138 |
| 637 | Ga0207657_10530153 | 3300025919 | Bacteria | 921 |
| 638 | Ga0207657_10532778 | 3300025919 | Bacteria | 919 |
| 639 | Ga0207649_10156713 | 3300025920 | Bacteria | 1574 |
| 640 | Ga0207649_10366818 | 3300025920 | Bacteria | 1070 |
| 641 | Ga0207649_10654935 | 3300025920 | Bacteria | 812 |
| 642 | Ga0207652_10001692 | 3300025921 | Bacteria | 19294 |
| 643 | Ga0207652_10032926 | 3300025921 | Bacteria | 4362 |
| 644 | Ga0207652_10146914 | 3300025921 | Bacteria | 2110 |
| 645 | Ga0207652_10213035 | 3300025921 | Bacteria | 1740 |
| 646 | Ga0207652_10463384 | 3300025921 | Bacteria | 1142 |
| 647 | Ga0207681_10108510 | 3300025923 | Bacteria | 2015 |
| 648 | Ga0207681_10492688 | 3300025923 | Bacteria | 1002 |
| 649 | Ga0207694_10000662 | 3300025924 | Bacteria | 31000 |
| 650 | Ga0207694_10009782 | 3300025924 | Bacteria | 7236 |
| 651 | Ga0207694_10016406 | 3300025924 | Bacteria | 5592 |
| 652 | Ga0207694_10055826 | 3300025924 | Bacteria | 3066 |
| 653 | Ga0207694_10163266 | 3300025924 | Bacteria | 1800 |
| 654 | Ga0207694_10206586 | 3300025924 | Bacteria | 1599 |
| 655 | Ga0207694_10213773 | 3300025924 | Bacteria | 1571 |
| 656 | Ga0207694_10273247 | 3300025924 | Bacteria | 1387 |
| 657 | Ga0207694_10596093 | 3300025924 | Bacteria | 929 |
| 658 | Ga0207687_10021258 | 3300025927 | Bacteria | 4310 |
| 659 | Ga0207687_10021407 | 3300025927 | Bacteria | 4296 |
| 660 | Ga0207687_10124497 | 3300025927 | Bacteria | 1933 |
| 661 | Ga0207687_10793184 | 3300025927 | Bacteria | 808 |
| 662 | Ga0207700_10013486 | 3300025928 | Bacteria | 5321 |
| 663 | Ga0207700_10062912 | 3300025928 | Bacteria | 2820 |
| 664 | Ga0207700_10148802 | 3300025928 | Bacteria | 1933 |
| 665 | Ga0207700_10255803 | 3300025928 | Bacteria | 1498 |
| 666 | Ga0207700_10261752 | 3300025928 | Bacteria | 1481 |
| 667 | Ga0207700_10608878 | 3300025928 | Bacteria | 972 |
| 668 | Ga0207700_11162551 | 3300025928 | Bacteria | 689 |
| 669 | Ga0207664_10023882 | 3300025929 | Bacteria | 4588 |
| 670 | Ga0207664_10056391 | 3300025929 | Bacteria | 3120 |
| 671 | Ga0207664_10066338 | 3300025929 | Bacteria | 2893 |
| 672 | Ga0207664_10135284 | 3300025929 | Bacteria | 2079 |
| 673 | Ga0207664_10176417 | 3300025929 | Bacteria | 1832 |
| 674 | Ga0207664_10304874 | 3300025929 | Bacteria | 1402 |
| 675 | Ga0207644_10093046 | 3300025931 | Bacteria | 2250 |
| 676 | Ga0207644_10103533 | 3300025931 | Bacteria | 2142 |
| 677 | Ga0207644_10607570 | 3300025931 | Bacteria | 908 |
| 678 | Ga0207644_10901776 | 3300025931 | Bacteria | 741 |
| 679 | Ga0207690_10250673 | 3300025932 | Bacteria | 1367 |
| 680 | Ga0207690_10338842 | 3300025932 | Bacteria | 1186 |
| 681 | Ga0207690_10788357 | 3300025932 | Bacteria | 785 |
| 682 | Ga0207690_10844335 | 3300025932 | Bacteria | 758 |
| 683 | Ga0207706_10031400 | 3300025933 | Bacteria | 4732 |
| 684 | Ga0207706_10178663 | 3300025933 | Bacteria | 1864 |
| 685 | Ga0207706_10250133 | 3300025933 | Bacteria | 1548 |
| 686 | Ga0207706_10294975 | 3300025933 | Bacteria | 1413 |
| 687 | Ga0207706_10394640 | 3300025933 | Bacteria | 1200 |
| 688 | Ga0207706_10523192 | 3300025933 | Bacteria | 1023 |
| 689 | Ga0207686_10141777 | 3300025934 | Bacteria | 1662 |
| 690 | Ga0207686_10301473 | 3300025934 | Bacteria | 1190 |
| 691 | Ga0207686_10552874 | 3300025934 | Bacteria | 900 |
| 692 | Ga0207709_10108534 | 3300025935 | Bacteria | 1851 |
| 693 | Ga0207709_10232503 | 3300025935 | Bacteria | 1336 |
| 694 | Ga0207670_10042390 | 3300025936 | Bacteria | 2998 |
| 695 | Ga0207669_10097050 | 3300025937 | Bacteria | 1937 |
| 696 | Ga0207669_10176913 | 3300025937 | Bacteria | 1525 |
| 697 | Ga0207669_10411326 | 3300025937 | Bacteria | 1062 |
| 698 | Ga0207669_10655678 | 3300025937 | Bacteria | 859 |
| 699 | Ga0207704_10040225 | 3300025938 | Bacteria | 2730 |
| 700 | Ga0207704_10104493 | 3300025938 | Bacteria | 1897 |
| 701 | Ga0207704_10161752 | 3300025938 | Bacteria | 1594 |
| 702 | Ga0207704_10976450 | 3300025938 | Bacteria | 715 |
| 703 | Ga0207665_10000767 | 3300025939 | Bacteria | 21619 |
| 704 | Ga0207665_10085667 | 3300025939 | Bacteria | 2176 |
| 705 | Ga0207665_10160132 | 3300025939 | Bacteria | 1618 |
| 706 | Ga0207665_10166950 | 3300025939 | Bacteria | 1587 |
| 707 | Ga0207665_10545960 | 3300025939 | Bacteria | 900 |
| 708 | Ga0207665_10926395 | 3300025939 | Bacteria | 692 |
| 709 | Ga0207691_10359523 | 3300025940 | Bacteria | 1245 |
| 710 | Ga0207691_10736296 | 3300025940 | Bacteria | 830 |
| 711 | Ga0207711_10040386 | 3300025941 | Bacteria | 3970 |
| 712 | Ga0207711_10051750 | 3300025941 | Bacteria | 3518 |
| 713 | Ga0207711_10145914 | 3300025941 | Bacteria | 2132 |
| 714 | Ga0207711_10623864 | 3300025941 | Bacteria | 1006 |
| 715 | Ga0207689_10120540 | 3300025942 | Bacteria | 2158 |
| 716 | Ga0207689_10300753 | 3300025942 | Bacteria | 1330 |
| 717 | Ga0207661_10000579 | 3300025944 | Bacteria | 23347 |
| 718 | Ga0207661_10154209 | 3300025944 | Bacteria | 1988 |
| 719 | Ga0207661_10163164 | 3300025944 | Bacteria | 1934 |
| 720 | Ga0207679_10035086 | 3300025945 | Bacteria | 3545 |
| 721 | Ga0207679_10590918 | 3300025945 | Bacteria | 999 |
| 722 | Ga0207679_10735724 | 3300025945 | Bacteria | 896 |
| 723 | Ga0207679_11461799 | 3300025945 | Bacteria | 627 |
| 724 | Ga0207667_10003118 | 3300025949 | Bacteria | 20511 |
| 725 | Ga0207667_10004639 | 3300025949 | Bacteria | 16858 |
| 726 | Ga0207667_10006730 | 3300025949 | Bacteria | 13883 |
| 727 | Ga0207667_10040447 | 3300025949 | Bacteria | 4964 |
| 728 | Ga0207667_10075301 | 3300025949 | Bacteria | 3505 |
| 729 | Ga0207667_10122850 | 3300025949 | Bacteria | 2675 |
| 730 | Ga0207667_10146401 | 3300025949 | Bacteria | 2432 |
| 731 | Ga0207667_10192016 | 3300025949 | Bacteria | 2095 |
| 732 | Ga0207667_10233206 | 3300025949 | Bacteria | 1884 |
| 733 | Ga0207667_10252241 | 3300025949 | Bacteria | 1805 |
| 734 | Ga0207667_10707297 | 3300025949 | Bacteria | 1010 |
| 735 | Ga0207667_10946284 | 3300025949 | Bacteria | 851 |
| 736 | Ga0207651_10104110 | 3300025960 | Bacteria | 2114 |
| 737 | Ga0207651_11315938 | 3300025960 | Bacteria | 650 |
| 738 | Ga0207712_10041791 | 3300025961 | Bacteria | 3153 |
| 739 | Ga0207712_10140275 | 3300025961 | Bacteria | 1854 |
| 740 | Ga0207712_10281049 | 3300025961 | Bacteria | 1358 |
| 741 | Ga0207668_10075087 | 3300025972 | Bacteria | 2429 |
| 742 | Ga0207668_10183978 | 3300025972 | Bacteria | 1650 |
| 743 | Ga0207668_10274955 | 3300025972 | Bacteria | 1378 |
| 744 | Ga0207668_10284939 | 3300025972 | Bacteria | 1356 |
| 745 | Ga0207668_10540088 | 3300025972 | Bacteria | 1008 |
| 746 | Ga0207640_10002370 | 3300025981 | Bacteria | 10102 |
| 747 | Ga0207640_10170523 | 3300025981 | Bacteria | 1621 |
| 748 | Ga0207640_10236314 | 3300025981 | Bacteria | 1409 |
| 749 | Ga0207640_10326692 | 3300025981 | Bacteria | 1223 |
| 750 | Ga0207640_10390890 | 3300025981 | Bacteria | 1130 |
| 751 | Ga0207640_10799079 | 3300025981 | Bacteria | 817 |
| 752 | Ga0207658_10365279 | 3300025986 | Bacteria | 1260 |
| 753 | Ga0207658_11142151 | 3300025986 | Bacteria | 712 |
| 754 | Ga0207677_10015264 | 3300026023 | Bacteria | 4511 |
| 755 | Ga0207677_10483441 | 3300026023 | Bacteria | 1067 |
| 756 | Ga0207677_10755698 | 3300026023 | Bacteria | 867 |
| 757 | Ga0207703_10030990 | 3300026035 | Bacteria | 4228 |
| 758 | Ga0207703_10109467 | 3300026035 | Bacteria | 2355 |
| 759 | Ga0207703_10178944 | 3300026035 | Bacteria | 1870 |
| 760 | Ga0207703_10434506 | 3300026035 | Bacteria | 1224 |
| 761 | Ga0207703_10473550 | 3300026035 | Bacteria | 1173 |
| 762 | Ga0207703_11016565 | 3300026035 | Bacteria | 795 |
| 763 | Ga0207639_10011004 | 3300026041 | Bacteria | 6272 |
| 764 | Ga0207639_10126847 | 3300026041 | Bacteria | 2106 |
| 765 | Ga0207639_10181091 | 3300026041 | Bacteria | 1792 |
| 766 | Ga0207639_10181850 | 3300026041 | Bacteria | 1789 |
| 767 | Ga0207639_10269308 | 3300026041 | Bacteria | 1493 |
| 768 | Ga0207639_10545268 | 3300026041 | Bacteria | 1064 |
| 769 | Ga0207639_10639565 | 3300026041 | Bacteria | 983 |
| 770 | Ga0207639_10690944 | 3300026041 | Bacteria | 946 |
| 771 | Ga0207678_10004742 | 3300026067 | Bacteria | 12216 |
| 772 | Ga0207678_10005908 | 3300026067 | Bacteria | 10905 |
| 773 | Ga0207678_10027619 | 3300026067 | Bacteria | 4952 |
| 774 | Ga0207678_10034302 | 3300026067 | Bacteria | 4420 |
| 775 | Ga0207678_10045103 | 3300026067 | Bacteria | 3812 |
| 776 | Ga0207678_10183024 | 3300026067 | Bacteria | 1789 |
| 777 | Ga0207678_10281965 | 3300026067 | Bacteria | 1426 |
| 778 | Ga0207678_10354436 | 3300026067 | Bacteria | 1266 |
| 779 | Ga0207678_10708466 | 3300026067 | Bacteria | 886 |
| 780 | Ga0207708_10103418 | 3300026075 | Bacteria | 2206 |
| 781 | Ga0207708_10479217 | 3300026075 | Bacteria | 1040 |
| 782 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 783 | Ga0207702_10000350 | 3300026078 | Bacteria | 52867 |
| 784 | Ga0207702_10127898 | 3300026078 | Bacteria | 2283 |
| 785 | Ga0207702_10328969 | 3300026078 | Bacteria | 1457 |
| 786 | Ga0207702_10625072 | 3300026078 | Bacteria | 1058 |
| 787 | Ga0207702_10972214 | 3300026078 | Bacteria | 842 |
| 788 | Ga0207641_10309494 | 3300026088 | Bacteria | 1495 |
| 789 | Ga0207641_10401860 | 3300026088 | Bacteria | 1315 |
| 790 | Ga0207641_10687156 | 3300026088 | Bacteria | 1007 |
| 791 | Ga0207648_10322652 | 3300026089 | Bacteria | 1388 |
| 792 | Ga0207676_10325356 | 3300026095 | Bacteria | 1413 |
| 793 | Ga0207676_10547084 | 3300026095 | Bacteria | 1105 |
| 794 | Ga0207676_10941712 | 3300026095 | Bacteria | 849 |
| 795 | Ga0207674_10002413 | 3300026116 | Bacteria | 23592 |
| 796 | Ga0207674_10003431 | 3300026116 | Bacteria | 19400 |
| 797 | Ga0207674_10027875 | 3300026116 | Bacteria | 5967 |
| 798 | Ga0207674_10137096 | 3300026116 | Bacteria | 2408 |
| 799 | Ga0207674_10231139 | 3300026116 | Bacteria | 1797 |
| 800 | Ga0207674_10309256 | 3300026116 | Bacteria | 1529 |
| 801 | Ga0207674_10430133 | 3300026116 | Bacteria | 1276 |
| 802 | Ga0207674_10667099 | 3300026116 | Bacteria | 1004 |
| 803 | Ga0207675_100393016 | 3300026118 | Bacteria | 1365 |
| 804 | Ga0207675_100488708 | 3300026118 | Bacteria | 1224 |
| 805 | Ga0207675_100520210 | 3300026118 | Bacteria | 1186 |
| 806 | Ga0207683_10019572 | 3300026121 | Bacteria | 5781 |
| 807 | Ga0207683_10106094 | 3300026121 | Bacteria | 2512 |
| 808 | Ga0207683_10195500 | 3300026121 | Bacteria | 1838 |
| 809 | Ga0207683_10499216 | 3300026121 | Bacteria | 1124 |
| 810 | Ga0207683_10594973 | 3300026121 | Bacteria | 1024 |
| 811 | Ga0207698_10072550 | 3300026142 | Bacteria | 2737 |
| 812 | Ga0207698_10400702 | 3300026142 | Bacteria | 1311 |
| 813 | Ga0207698_10448893 | 3300026142 | Bacteria | 1244 |
| 814 | Ga0207698_10875539 | 3300026142 | Bacteria | 904 |
| 815 | Ga0207698_10933570 | 3300026142 | Bacteria | 876 |
| 816 | Ga0207698_12036979 | 3300026142 | Bacteria | 588 |
| 817 | Ga0209389_1000208 | 3300027296 | Bacteria | 42287 |
| 818 | Ga0209389_1000217 | 3300027296 | Bacteria | 39758 |
| 819 | Ga0209589_1000032 | 3300027357 | Bacteria | 141881 |
| 820 | Ga0209589_1000046 | 3300027357 | Bacteria | 118780 |
| 821 | Ga0209489_100106 | 3300027361 | Bacteria | 118780 |
| 822 | Ga0209489_101970 | 3300027361 | Bacteria | 42287 |
| 823 | Ga0209489_102214 | 3300027361 | Bacteria | 39758 |
| 824 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 825 | Ga0209700_100105 | 3300027363 | Bacteria | 118780 |
| 826 | Ga0209588_1022329 | 3300027671 | Bacteria | 1991 |
| 827 | Ga0209813_10024260 | 3300027866 | Bacteria | 1733 |
| 828 | Ga0209813_10076547 | 3300027866 | Bacteria | 1098 |
| 829 | Ga0207428_10081696 | 3300027907 | Bacteria | 2523 |
| 830 | Ga0207428_10158335 | 3300027907 | Bacteria | 1721 |
| 831 | Ga0268266_10001794 | 3300028379 | Bacteria | 24326 |
| 832 | Ga0268266_10003485 | 3300028379 | Bacteria | 15669 |
| 833 | Ga0268266_10052016 | 3300028379 | Bacteria | 3516 |
| 834 | Ga0268266_10080260 | 3300028379 | Bacteria | 2842 |
| 835 | Ga0268266_10157851 | 3300028379 | Bacteria | 2050 |
| 836 | Ga0268266_10273320 | 3300028379 | Bacteria | 1569 |
| 837 | Ga0268266_10323404 | 3300028379 | Bacteria | 1444 |
| 838 | Ga0268266_10434976 | 3300028379 | Bacteria | 1245 |
| 839 | Ga0268266_10459317 | 3300028379 | Bacteria | 1211 |
| 840 | Ga0268266_10635027 | 3300028379 | Bacteria | 1027 |
| 841 | Ga0268266_10897475 | 3300028379 | Bacteria | 857 |
| 842 | Ga0268266_11144245 | 3300028379 | Bacteria | 753 |
| 843 | Ga0268265_10031179 | 3300028380 | Bacteria | 3848 |
| 844 | Ga0268265_10035766 | 3300028380 | Bacteria | 3632 |
| 845 | Ga0268265_10098352 | 3300028380 | Bacteria | 2356 |
| 846 | Ga0268265_10499866 | 3300028380 | Bacteria | 1145 |
| 847 | Ga0268265_10717526 | 3300028380 | Bacteria | 967 |
| 848 | Ga0268265_11088052 | 3300028380 | Bacteria | 793 |
| 849 | Ga0268264_10000227 | 3300028381 | Bacteria | 109454 |
| 850 | Ga0268264_10146612 | 3300028381 | Bacteria | 2111 |
| 851 | Ga0265319_1075277 | 3300028563 | Bacteria | 1077 |
| 852 | Ga0265334_10005796 | 3300028573 | Bacteria | 5381 |
| 853 | Ga0265318_10024584 | 3300028577 | Bacteria | 2388 |
| 854 | Ga0265323_10001243 | 3300028653 | Bacteria | 12808 |
| 855 | Ga0307517_10000748 | 3300028786 | Bacteria | 56107 |
| 856 | Ga0307517_10247128 | 3300028786 | Bacteria | 1051 |
| 857 | Ga0307517_10311345 | 3300028786 | Bacteria | 877 |
| 858 | Ga0307515_10033584 | 3300028794 | Bacteria | 8437 |
| 859 | Ga0307515_10549312 | 3300028794 | Bacteria | 765 |
| 860 | Ga0265338_10000277 | 3300028800 | Bacteria | 93095 |
| 861 | Ga0265338_10380167 | 3300028800 | Bacteria | 1010 |
| 862 | Ga0265324_10032056 | 3300029957 | Bacteria | 1838 |
| 863 | Ga0307511_10119296 | 3300030521 | Bacteria | 1639 |
| 864 | Ga0307511_10321736 | 3300030521 | Bacteria | 683 |
| 865 | Ga0307512_10180268 | 3300030522 | Bacteria | 1189 |
| 866 | Ga0265770_1059654 | 3300030878 | Bacteria | 707 |
| 867 | Ga0265760_10043486 | 3300031090 | Bacteria | 1343 |
| 868 | Ga0265332_10050779 | 3300031238 | Bacteria | 1782 |
| 869 | Ga0265328_10068047 | 3300031239 | Bacteria | 1308 |
| 870 | Ga0265325_10016892 | 3300031241 | Bacteria | 4069 |
| 871 | Ga0265340_10030891 | 3300031247 | Bacteria | 2683 |
| 872 | Ga0265340_10155031 | 3300031247 | Bacteria | 1042 |
| 873 | Ga0265339_10000971 | 3300031249 | Bacteria | 21969 |
| 874 | Ga0265339_10154419 | 3300031249 | Bacteria | 1158 |
| 875 | Ga0265339_10212781 | 3300031249 | Bacteria | 949 |
| 876 | Ga0265339_10219204 | 3300031249 | Bacteria | 931 |
| 877 | Ga0265339_10226465 | 3300031249 | Bacteria | 912 |
| 878 | Ga0265316_10193756 | 3300031344 | Bacteria | 1509 |
| 879 | Ga0307513_10104424 | 3300031456 | Bacteria | 2847 |
| 880 | Ga0307513_10411605 | 3300031456 | Bacteria | 1084 |
| 881 | Ga0307509_10109929 | 3300031507 | Bacteria | 2764 |
| 882 | Ga0307509_10327048 | 3300031507 | Bacteria | 1266 |
| 883 | Ga0307509_10338960 | 3300031507 | Bacteria | 1231 |
| 884 | Ga0307509_10457314 | 3300031507 | Bacteria | 969 |
| 885 | Ga0307408_100239629 | 3300031548 | Bacteria | 1490 |
| 886 | Ga0307408_100926523 | 3300031548 | Bacteria | 799 |
| 887 | Ga0265313_10105838 | 3300031595 | Bacteria | 1243 |
| 888 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 889 | Ga0307508_10069065 | 3300031616 | Bacteria | 3104 |
| 890 | Ga0307508_10122470 | 3300031616 | Bacteria | 2203 |
| 891 | Ga0307508_10277054 | 3300031616 | Bacteria | 1271 |
| 892 | Ga0307514_10349235 | 3300031649 | Bacteria | 790 |
| 893 | Ga0265314_10002643 | 3300031711 | Bacteria | 18036 |
| 894 | Ga0265342_10025508 | 3300031712 | Bacteria | 3714 |
| 895 | Ga0265342_10296689 | 3300031712 | Bacteria | 852 |
| 896 | Ga0307516_10010347 | 3300031730 | Bacteria | 10269 |
| 897 | Ga0307516_10057865 | 3300031730 | Bacteria | 3775 |
| 898 | Ga0307516_10080348 | 3300031730 | Bacteria | 3104 |
| 899 | Ga0307516_10194781 | 3300031730 | Bacteria | 1750 |
| 900 | Ga0307516_10206258 | 3300031730 | Bacteria | 1682 |
| 901 | Ga0307516_10254949 | 3300031730 | Bacteria | 1447 |
| 902 | Ga0307516_10368644 | 3300031730 | Bacteria | 1099 |
| 903 | Ga0307405_10397902 | 3300031731 | Bacteria | 1077 |
| 904 | Ga0307405_10480557 | 3300031731 | Bacteria | 992 |
| 905 | Ga0307405_10524171 | 3300031731 | Bacteria | 954 |
| 906 | Ga0307413_10131084 | 3300031824 | Bacteria | 1716 |
| 907 | Ga0307518_10446350 | 3300031838 | Bacteria | 695 |
| 908 | Ga0307406_10300621 | 3300031901 | Bacteria | 1233 |
| 909 | Ga0307406_10833496 | 3300031901 | Bacteria | 781 |
| 910 | Ga0307407_11008579 | 3300031903 | Bacteria | 643 |
| 911 | Ga0307412_10047890 | 3300031911 | Bacteria | 2809 |
| 912 | Ga0307412_10212569 | 3300031911 | Bacteria | 1477 |
| 913 | Ga0307412_10611833 | 3300031911 | Bacteria | 924 |
| 914 | Ga0307409_100719317 | 3300031995 | Bacteria | 999 |
| 915 | Ga0307409_101144653 | 3300031995 | Bacteria | 800 |
| 916 | Ga0307409_101680384 | 3300031995 | Bacteria | 664 |
| 917 | Ga0307416_100286049 | 3300032002 | Bacteria | 1629 |
| 918 | Ga0307416_101286121 | 3300032002 | Bacteria | 837 |
| 919 | Ga0307411_10043818 | 3300032005 | Bacteria | 2865 |
| 920 | Ga0307411_10356706 | 3300032005 | Bacteria | 1194 |
| 921 | Ga0307415_100120643 | 3300032126 | Bacteria | 1965 |
| 922 | Ga0307415_100409367 | 3300032126 | Bacteria | 1160 |
| 923 | Ga0307415_100459188 | 3300032126 | Bacteria | 1103 |
| 924 | Ga0307415_101066138 | 3300032126 | Bacteria | 755 |
| 925 | Ga0307507_10019880 | 3300033179 | Bacteria | 7544 |
| 926 | Ga0307510_10006388 | 3300033180 | Bacteria | 14055 |
| 927 | Ga0307510_10060535 | 3300033180 | Bacteria | 3895 |
| 928 | Ga0307510_10098029 | 3300033180 | Bacteria | 2737 |
| 929 | Ga0307510_10158713 | 3300033180 | Bacteria | 1863 |
| 930 | Ga0307510_10263364 | 3300033180 | Bacteria | 1204 |
| 931 | Ga0307510_10351245 | 3300033180 | Bacteria | 925 |
| 932 | Ga0373926_0204760 | 3300035083 | Bacteria | 760 |
| 933 | Ga0373929_0013219 | 3300035085 | Bacteria | 1580 |
| 934 | Ga0373934_0403326 | 3300035086 | Bacteria | 571 |
| 935 | Ga0373952_0036440 | 3300035092 | Bacteria | 1118 |
| 936 | Ga0373936_0175848 | 3300035113 | Bacteria | 937 |
| 937 | Ga0373941_0051773 | 3300035115 | Bacteria | 1308 |
| 938 | Ga0373945_0012397 | 3300035116 | Bacteria | 2831 |
| 939 | Ga0373953_0003462 | 3300035117 | Bacteria | 4921 |
| 940 | Ga0373953_0020246 | 3300035117 | Bacteria | 2485 |
| 941 | Ga0373954_0022141 | 3300035118 | Bacteria | 2881 |
| 942 | Ga0373956_0021820 | 3300035119 | Bacteria | 2733 |
| 943 | Ga0373960_0083787 | 3300035121 | Bacteria | 1009 |
| 944 | Ga0373943_0166696 | 3300035170 | Bacteria | 1203 |
| 945 | Ga0373946_0015222 | 3300035171 | Bacteria | 2913 |
| 946 | Ga0373946_0059994 | 3300035171 | Bacteria | 1616 |
| 947 | Ga0373946_0082896 | 3300035171 | Bacteria | 1407 |
| 948 | Ga0373955_0355612 | 3300035172 | Bacteria | 887 |
| 949 | Ga0373942_0087315 | 3300035207 | Bacteria | 935 |
| 950 | Ga0373942_0093267 | 3300035207 | Bacteria | 910 |
| 951 | Ga0373924_0012332 | 3300035410 | Bacteria | 3191 |
| 952 | Ga0373924_0339503 | 3300035410 | Bacteria | 669 |
| 953 | Ga0373931_0021852 | 3300035691 | Bacteria | 3214 |
| 954 | Ga0373931_0459360 | 3300035691 | Bacteria | 816 |
| 955 | Ga0373931_0590294 | 3300035691 | Bacteria | 725 |
| 956 | Ga0373935_0195807 | 3300035692 | Bacteria | 1394 |
| 957 | Ga0373935_0413105 | 3300035692 | Bacteria | 970 |
| 958 | Ga0373935_0483323 | 3300035692 | Bacteria | 898 |
| 959 | Ga0373935_0614193 | 3300035692 | Bacteria | 796 |
| 960 | Ga0373927_0009105 | 3300035695 | Bacteria | 6662 |
| 961 | Ga0373927_0031979 | 3300035695 | Bacteria | 3427 |
| 962 | Ga0373927_0080808 | 3300035695 | Bacteria | 2106 |
| 963 | Ga0373927_0184881 | 3300035695 | Bacteria | 1367 |
| 964 | Ga0373927_0571068 | 3300035695 | Bacteria | 747 |
| 965 | Ga0373933_0000698 | 3300035724 | Bacteria | 20659 |
| 966 | Ga0373947_0063009 | 3300035725 | Bacteria | 2258 |
| 967 | Ga0373947_0110883 | 3300035725 | Bacteria | 1733 |
| 968 | Ga0373947_0663986 | 3300035725 | Bacteria | 711 |
| 969 | Ga0373937_1502319 | 3300036401 | Bacteria | 621 |
| 970 | Ga0373925_0068982 | 3300037068 | Bacteria | 2670 |
| 971 | Ga0373925_0071521 | 3300037068 | Bacteria | 2624 |
| 972 | Ga0373925_0074104 | 3300037068 | Bacteria | 2578 |
| 973 | Ga0373925_0105854 | 3300037068 | Bacteria | 2168 |
| 974 | Ga0373925_0113109 | 3300037068 | Bacteria | 2099 |
| 975 | Ga0373925_0348751 | 3300037068 | Bacteria | 1202 |
| 976 | Ga0373925_0400676 | 3300037068 | Bacteria | 1119 |
| 977 | Ga0373925_0863353 | 3300037068 | Bacteria | 746 |
| 978 | Ga0395899_0090738 | 3300037312 | Bacteria | 2215 |
| 979 | Ga0395899_0611421 | 3300037312 | Bacteria | 693 |
| 980 | Ga0395900_0001316 | 3300037418 | Bacteria | 30150 |
| 981 | Ga0395900_0093150 | 3300037418 | Bacteria | 3095 |
| 982 | Ga0395900_0196580 | 3300037418 | Bacteria | 2043 |
| 983 | Ga0395900_1203688 | 3300037418 | Bacteria | 673 |
| 984 | Ga0395898_0010275 | 3300037466 | Bacteria | 9797 |
| 985 | Ga0395898_0094798 | 3300037466 | Bacteria | 2868 |
| 986 | Ga0395898_0293021 | 3300037466 | Bacteria | 1552 |
| 987 | Ga0395898_0821870 | 3300037466 | Bacteria | 869 |
| 988 | Ga0395905_0032556 | 3300037471 | Bacteria | 4903 |
| 989 | Ga0395905_0100478 | 3300037471 | Bacteria | 2716 |
| 990 | Ga0395905_0583893 | 3300037471 | Bacteria | 1019 |
| 991 | Ga0395905_0584936 | 3300037471 | Bacteria | 1018 |
| 992 | Ga0436364_0479711 | 3300037853 | Bacteria | 1525 |
| 993 | Ga0395901_0002762 | 3300038443 | Bacteria | 17695 |
| 994 | Ga0395901_0024984 | 3300038443 | Bacteria | 6132 |
| 995 | Ga0395901_0428126 | 3300038443 | Bacteria | 1356 |
| 996 | Ga0395901_0681119 | 3300038443 | Bacteria | 1028 |
| 997 | Ga0436365_0115121 | 3300039437 | Bacteria | 3034 |
| 998 | Ga0436365_0758504 | 3300039437 | Bacteria | 12855 |
| 999 | Ga0436365_0852398 | 3300039437 | Bacteria | 1509 |
| 1000 | Ga0436365_1046572 | 3300039437 | Bacteria | 1742 |
| 1001 | Ga0436365_1677482 | 3300039437 | Bacteria | 1688 |
| 1002 | Ga0436365_1928398 | 3300039437 | Bacteria | 1915 |
| 1003 | Ga0436360_0118011 | 3300039438 | Bacteria | 982 |
| 1004 | Ga0436360_0578760 | 3300039438 | Bacteria | 3555 |
| 1005 | Ga0436360_0758305 | 3300039438 | Bacteria | 899 |
| 1006 | Ga0436361_0310662 | 3300039447 | Bacteria | 631 |
| 1007 | Ga0436361_0944908 | 3300039447 | Bacteria | 1757 |
| 1008 | Ga0436363_0519627 | 3300039450 | Bacteria | 1750 |
| 1009 | Ga0436363_0768792 | 3300039450 | Bacteria | 1870 |
| 1010 | Ga0436363_1259985 | 3300039450 | Bacteria | 767 |
| 1011 | Ga0436363_1333239 | 3300039450 | Bacteria | 674 |
| 1012 | Ga0436362_0646312 | 3300039453 | Bacteria | 4312 |
| 1013 | Ga0436362_0683872 | 3300039453 | Bacteria | 1478 |
| 1014 | Ga0436362_1179571 | 3300039453 | Bacteria | 864 |
| 1015 | Ga0439465_0044053 | 3300041413 | Bacteria | 1449 |
| 1016 | Ga0439465_0305056 | 3300041413 | Bacteria | 596 |
| 1017 | Ga0451787_690731 | 3300041441 | Bacteria | 633 |
| 1018 | Ga0451789_0739197 | 3300041443 | Bacteria | 782 |
| 1019 | Ga0451802_1371081 | 3300041460 | Bacteria | 760 |
| 1020 | Ga0451804_0892439 | 3300041463 | Bacteria | 733 |
| 1021 | Ga0451835_0832063 | 3300041492 | Bacteria | 1673 |
| 1022 | Ga0451837_1147329 | 3300041494 | Bacteria | 751 |
| 1023 | Ga0451841_1120699 | 3300041498 | Bacteria | 928 |
| 1024 | Ga0451847_0064418 | 3300041503 | Bacteria | 651 |
| 1025 | Ga0451849_1286864 | 3300041505 | Bacteria | 609 |
| 1026 | Ga0451855_0776935 | 3300041511 | Bacteria | 801 |
| 1027 | Ga0451853_0660391 | 3300041512 | Bacteria | 1135 |
| 1028 | Ga0439431_0086864 | 3300041997 | Bacteria | 849 |
| 1029 | Ga0439432_062685 | 3300042006 | Bacteria | 1144 |
| 1030 | Ga0439455_0115184 | 3300042012 | Bacteria | 750 |
| 1031 | Ga0439459_0010127 | 3300042438 | Bacteria | 1639 |
| 1032 | Ga0466969_0051658 | 3300044656 | Bacteria | 2022 |
| 1033 | Ga0466969_0161890 | 3300044656 | Bacteria | 1028 |
| 1034 | Ga0466969_0233157 | 3300044656 | Bacteria | 836 |
| 1035 | Ga0466972_0000233 | 3300044658 | Bacteria | 38493 |
| 1036 | Ga0466972_0159983 | 3300044658 | Bacteria | 1058 |
| 1037 | Ga0466965_0036463 | 3300044683 | Bacteria | 2412 |
| 1038 | Ga0466965_0310190 | 3300044683 | Bacteria | 858 |
| 1039 | Ga0466966_0002503 | 3300044684 | Bacteria | 12045 |
| 1040 | Ga0466966_0034745 | 3300044684 | Bacteria | 3259 |
| 1041 | Ga0466961_0082983 | 3300044693 | Bacteria | 2027 |
| 1042 | Ga0466963_0244298 | 3300044694 | Bacteria | 1259 |
| 1043 | Ga0466963_0547362 | 3300044694 | Bacteria | 817 |
| 1044 | Ga0466964_0085037 | 3300044706 | Bacteria | 1365 |
| 1045 | Ga0466964_0095512 | 3300044706 | Bacteria | 1301 |
| 1046 | Ga0466971_0197001 | 3300044719 | Bacteria | 950 |
| 1047 | Ga0466968_0039562 | 3300044735 | Bacteria | 1985 |
| 1048 | Ga0466968_0137252 | 3300044735 | Bacteria | 1116 |
| 1049 | Ga0466968_0151835 | 3300044735 | Bacteria | 1065 |
| 1050 | Ga0466968_0262932 | 3300044735 | Bacteria | 822 |
| 1051 | Ga0466970_0198420 | 3300044765 | Bacteria | 1116 |
| 1052 | Ga0466970_0475710 | 3300044765 | Bacteria | 718 |
| 1053 | Ga0466957_0100843 | 3300044842 | Bacteria | 1820 |
| 1054 | Ga0466957_0114068 | 3300044842 | Bacteria | 1716 |
| 1055 | Ga0466960_0007069 | 3300044901 | Bacteria | 4538 |
| 1056 | Ga0466960_0194318 | 3300044901 | Bacteria | 1106 |
| 1057 | Ga0466959_0002845 | 3300045049 | Bacteria | 11154 |
| 1058 | Ga0466959_0116366 | 3300045049 | Bacteria | 1904 |
| 1059 | Ga0466959_0137990 | 3300045049 | Bacteria | 1725 |
| 1060 | Ga0466959_0400247 | 3300045049 | Bacteria | 933 |
| 1061 | Ga0466958_0216963 | 3300045836 | Bacteria | 1220 |
| 1062 | Ga0466958_0619762 | 3300045836 | Bacteria | 704 |
| 1063 | Ga0466967_0011377 | 3300045976 | Bacteria | 6736 |
| 1064 | Ga0466967_0041810 | 3300045976 | Bacteria | 3956 |
| 1065 | Ga0466967_0244800 | 3300045976 | Bacteria | 1711 |
| 1066 | Ga0466967_0382066 | 3300045976 | Bacteria | 1367 |
| 1067 | Ga0466967_1828536 | 3300045976 | Bacteria | 604 |
| 1068 | Ga0495617_044432 | 3300046452 | Bacteria | 1482 |
| 1069 | Ga0495592_0008192 | 3300046454 | Bacteria | 7850 |
| 1070 | Ga0495592_0316684 | 3300046454 | Bacteria | 1009 |
| 1071 | Ga0495603_0003601 | 3300046455 | Bacteria | 9207 |
| 1072 | Ga0495603_0034333 | 3300046455 | Bacteria | 3049 |
| 1073 | Ga0495603_0067820 | 3300046455 | Bacteria | 2099 |
| 1074 | Ga0495603_0074844 | 3300046455 | Bacteria | 1988 |
| 1075 | Ga0495603_0117159 | 3300046455 | Bacteria | 1553 |
| 1076 | Ga0495590_0061425 | 3300046457 | Bacteria | 1316 |
| 1077 | Ga0495590_0085742 | 3300046457 | Bacteria | 1111 |
| 1078 | Ga0495591_107810 | 3300046458 | Bacteria | 686 |
| 1079 | Ga0495629_0028838 | 3300046459 | Bacteria | 3939 |
| 1080 | Ga0495629_0415907 | 3300046459 | Bacteria | 913 |
| 1081 | Ga0495629_0705026 | 3300046459 | Bacteria | 670 |
| 1082 | Ga0495638_0268296 | 3300046460 | Bacteria | 933 |
| 1083 | Ga0495651_0024936 | 3300046462 | Bacteria | 4653 |
| 1084 | Ga0495651_0037559 | 3300046462 | Bacteria | 3771 |
| 1085 | Ga0495651_0074998 | 3300046462 | Bacteria | 2565 |
| 1086 | Ga0495651_0134806 | 3300046462 | Bacteria | 1798 |
| 1087 | Ga0495653_0034538 | 3300046463 | Bacteria | 3999 |
| 1088 | Ga0495653_0672185 | 3300046463 | Bacteria | 631 |
| 1089 | Ga0495650_0079005 | 3300046471 | Bacteria | 1273 |
| 1090 | Ga0495650_0079623 | 3300046471 | Bacteria | 1266 |
| 1091 | Ga0495650_0142071 | 3300046471 | Bacteria | 868 |
| 1092 | Ga0495580_0006567 | 3300046472 | Bacteria | 9456 |
| 1093 | Ga0495580_0094095 | 3300046472 | Bacteria | 2085 |
| 1094 | Ga0495582_0033966 | 3300046473 | Bacteria | 2804 |
| 1095 | Ga0495605_0225723 | 3300046474 | Bacteria | 808 |
| 1096 | Ga0495605_0230476 | 3300046474 | Bacteria | 798 |
| 1097 | Ga0495639_0020941 | 3300046475 | Bacteria | 2860 |
| 1098 | Ga0495639_0057837 | 3300046475 | Bacteria | 1772 |
| 1099 | Ga0495639_0082570 | 3300046475 | Bacteria | 1498 |
| 1100 | Ga0495639_0135593 | 3300046475 | Bacteria | 1181 |
| 1101 | Ga0495662_0124296 | 3300046476 | Bacteria | 1267 |
| 1102 | Ga0495662_0298728 | 3300046476 | Bacteria | 792 |
| 1103 | Ga0495664_0006504 | 3300046477 | Bacteria | 6457 |
| 1104 | Ga0495664_0024055 | 3300046477 | Bacteria | 3538 |
| 1105 | Ga0495664_0173613 | 3300046477 | Bacteria | 1307 |
| 1106 | Ga0495664_0389133 | 3300046477 | Bacteria | 838 |
| 1107 | Ga0495584_0039293 | 3300046491 | Bacteria | 2390 |
| 1108 | Ga0495584_0129400 | 3300046491 | Bacteria | 1280 |
| 1109 | Ga0495584_0130957 | 3300046491 | Bacteria | 1272 |
| 1110 | Ga0495584_0348863 | 3300046491 | Bacteria | 752 |
| 1111 | Ga0495585_0031581 | 3300046492 | Bacteria | 3005 |
| 1112 | Ga0495594_0194338 | 3300046499 | Bacteria | 1156 |
| 1113 | Ga0495583_0153022 | 3300046506 | Bacteria | 955 |
| 1114 | Ga0495606_0000676 | 3300046507 | Bacteria | 53366 |
| 1115 | Ga0495606_0033273 | 3300046507 | Bacteria | 3557 |
| 1116 | Ga0495606_0088388 | 3300046507 | Bacteria | 1910 |
| 1117 | Ga0495606_0272482 | 3300046507 | Bacteria | 929 |
| 1118 | Ga0495606_0490660 | 3300046507 | Bacteria | 622 |
| 1119 | Ga0495608_0010097 | 3300046511 | Bacteria | 6586 |
| 1120 | Ga0495608_0174182 | 3300046511 | Bacteria | 1363 |
| 1121 | Ga0495608_0382367 | 3300046511 | Bacteria | 863 |
| 1122 | Ga0495608_0496713 | 3300046511 | Bacteria | 739 |
| 1123 | Ga0495610_0089160 | 3300046512 | Bacteria | 1401 |
| 1124 | Ga0495610_0089593 | 3300046512 | Bacteria | 1397 |
| 1125 | Ga0495610_0090623 | 3300046512 | Bacteria | 1387 |
| 1126 | Ga0495616_0071091 | 3300046513 | Bacteria | 1683 |
| 1127 | Ga0495616_0305896 | 3300046513 | Bacteria | 670 |
| 1128 | Ga0495620_0047663 | 3300046515 | Bacteria | 1843 |
| 1129 | Ga0495628_0028701 | 3300046516 | Bacteria | 4519 |
| 1130 | Ga0495630_0070146 | 3300046517 | Bacteria | 2637 |
| 1131 | Ga0495631_0098781 | 3300046518 | Bacteria | 1256 |
| 1132 | Ga0495631_0141639 | 3300046518 | Bacteria | 1032 |
| 1133 | Ga0495632_0044136 | 3300046519 | Bacteria | 2225 |
| 1134 | Ga0495632_0117916 | 3300046519 | Bacteria | 1242 |
| 1135 | Ga0495632_0361282 | 3300046519 | Bacteria | 637 |
| 1136 | Ga0495637_0078251 | 3300046520 | Bacteria | 1322 |
| 1137 | Ga0495643_0141446 | 3300046522 | Bacteria | 1199 |
| 1138 | Ga0495643_0148335 | 3300046522 | Bacteria | 1163 |
| 1139 | Ga0495644_0051982 | 3300046523 | Bacteria | 1538 |
| 1140 | Ga0495648_0001769 | 3300046524 | Bacteria | 20843 |
| 1141 | Ga0495648_0009771 | 3300046524 | Bacteria | 7389 |
| 1142 | Ga0495648_0020469 | 3300046524 | Bacteria | 4613 |
| 1143 | Ga0495648_0098576 | 3300046524 | Bacteria | 1618 |
| 1144 | Ga0495663_0081736 | 3300046525 | Bacteria | 1041 |
| 1145 | Ga0495666_0057764 | 3300046526 | Bacteria | 1857 |
| 1146 | Ga0495666_0125275 | 3300046526 | Bacteria | 1202 |
| 1147 | Ga0495652_0030851 | 3300046529 | Bacteria | 4697 |
| 1148 | Ga0495652_0190426 | 3300046529 | Bacteria | 1566 |
| 1149 | Ga0495652_0202016 | 3300046529 | Bacteria | 1507 |
| 1150 | Ga0495652_0494276 | 3300046529 | Bacteria | 849 |
| 1151 | Ga0495665_0145730 | 3300046531 | Bacteria | 1237 |
| 1152 | Ga0495640_0017649 | 3300046533 | Bacteria | 5312 |
| 1153 | Ga0495640_0046403 | 3300046533 | Bacteria | 3010 |
| 1154 | Ga0495640_0047669 | 3300046533 | Bacteria | 2965 |
| 1155 | Ga0495587_0047806 | 3300046536 | Bacteria | 2536 |
| 1156 | Ga0495587_0066525 | 3300046536 | Bacteria | 2102 |
| 1157 | Ga0495598_0015535 | 3300046537 | Bacteria | 1924 |
| 1158 | Ga0495609_0037202 | 3300046538 | Bacteria | 2195 |
| 1159 | Ga0495609_0142683 | 3300046538 | Bacteria | 1021 |
| 1160 | Ga0495621_0051267 | 3300046539 | Bacteria | 1476 |
| 1161 | Ga0495621_0273617 | 3300046539 | Bacteria | 694 |
| 1162 | Ga0495597_0110496 | 3300046542 | Bacteria | 1153 |
| 1163 | Ga0495597_0137156 | 3300046542 | Bacteria | 1011 |
| 1164 | Ga0495645_0005927 | 3300046543 | Bacteria | 8442 |
| 1165 | Ga0495645_0113696 | 3300046543 | Bacteria | 1913 |
| 1166 | Ga0495645_0147846 | 3300046543 | Bacteria | 1635 |
| 1167 | Ga0495622_0104771 | 3300046557 | Bacteria | 1295 |
| 1168 | Ga0495622_0117725 | 3300046557 | Bacteria | 1214 |
| 1169 | Ga0495622_0303296 | 3300046557 | Bacteria | 696 |
| 1170 | Ga0495622_0312049 | 3300046557 | Bacteria | 684 |
| 1171 | Ga0495633_0067378 | 3300046558 | Bacteria | 1671 |
| 1172 | Ga0495633_0151909 | 3300046558 | Bacteria | 1069 |
| 1173 | Ga0495667_0056925 | 3300046559 | Bacteria | 2570 |
| 1174 | Ga0495667_0195123 | 3300046559 | Bacteria | 1297 |
| 1175 | Ga0495656_0071471 | 3300046615 | Bacteria | 1542 |
| 1176 | Ga0495656_0096498 | 3300046615 | Bacteria | 1360 |
| 1177 | Ga0495668_0043654 | 3300046616 | Bacteria | 2492 |
| 1178 | Ga0495668_0056113 | 3300046616 | Bacteria | 2174 |
| 1179 | Ga0495668_0065418 | 3300046616 | Bacteria | 2001 |
| 1180 | Ga0495668_0086722 | 3300046616 | Bacteria | 1717 |
| 1181 | Ga0495668_0089744 | 3300046616 | Bacteria | 1684 |
| 1182 | Ga0495668_0122408 | 3300046616 | Bacteria | 1423 |
| 1183 | Ga0495668_0262593 | 3300046616 | Bacteria | 945 |
| 1184 | Ga0495668_0314981 | 3300046616 | Bacteria | 858 |
| 1185 | Ga0495668_0372149 | 3300046616 | Bacteria | 784 |
| 1186 | Ga0495634_0117269 | 3300046642 | Bacteria | 1707 |
| 1187 | Ga0495611_0116671 | 3300046648 | Bacteria | 1244 |
| 1188 | Ga0495611_0298937 | 3300046648 | Bacteria | 742 |
| 1189 | Ga0495611_0329279 | 3300046648 | Bacteria | 702 |
| 1190 | Ga0495625_0071902 | 3300046660 | Bacteria | 2426 |
| 1191 | Ga0495625_0215516 | 3300046660 | Bacteria | 1260 |
| 1192 | Ga0495625_0352750 | 3300046660 | Bacteria | 929 |
| 1193 | Ga0495635_0136556 | 3300046663 | Bacteria | 1671 |
| 1194 | Ga0495635_0159202 | 3300046663 | Bacteria | 1536 |
| 1195 | Ga0495635_0231601 | 3300046663 | Bacteria | 1248 |
| 1196 | Ga0495659_0028980 | 3300046664 | Bacteria | 1919 |
| 1197 | Ga0495661_0371113 | 3300046665 | Bacteria | 701 |
| 1198 | Ga0495588_0020225 | 3300046674 | Bacteria | 3268 |
| 1199 | Ga0495588_0265036 | 3300046674 | Bacteria | 905 |
| 1200 | Ga0495588_0272805 | 3300046674 | Bacteria | 891 |
| 1201 | Ga0495657_0002607 | 3300046675 | Bacteria | 15083 |
| 1202 | Ga0495657_0011477 | 3300046675 | Bacteria | 6622 |
| 1203 | Ga0495599_0171310 | 3300046678 | Bacteria | 1339 |
| 1204 | Ga0495623_0055634 | 3300046679 | Bacteria | 2493 |
| 1205 | Ga0495623_0174201 | 3300046679 | Bacteria | 1255 |
| 1206 | Ga0495623_0197848 | 3300046679 | Bacteria | 1157 |
| 1207 | Ga0495646_0044662 | 3300046680 | Bacteria | 2709 |
| 1208 | Ga0495646_0129781 | 3300046680 | Bacteria | 1420 |
| 1209 | Ga0495647_0021934 | 3300046681 | Bacteria | 2304 |
| 1210 | Ga0495658_0061625 | 3300046683 | Bacteria | 2154 |
| 1211 | Ga0495669_0030344 | 3300046684 | Bacteria | 2373 |
| 1212 | Ga0495669_0159733 | 3300046684 | Bacteria | 1069 |
| 1213 | Ga0495669_0240688 | 3300046684 | Bacteria | 868 |
| 1214 | Ga0495669_0340417 | 3300046684 | Bacteria | 725 |
| 1215 | Ga0495613_0148244 | 3300046689 | Bacteria | 1674 |
| 1216 | Ga0495613_0264477 | 3300046689 | Bacteria | 1197 |
| 1217 | Ga0495624_0051457 | 3300046690 | Bacteria | 2606 |
| 1218 | Ga0495624_0283639 | 3300046690 | Bacteria | 1000 |
| 1219 | Ga0495624_0415619 | 3300046690 | Bacteria | 807 |
| 1220 | Ga0495670_0171586 | 3300046691 | Bacteria | 1142 |
| 1221 | Ga0495671_0044453 | 3300046692 | Bacteria | 2227 |
| 1222 | Ga0495671_0278107 | 3300046692 | Bacteria | 806 |
| 1223 | Ga0495671_0439866 | 3300046692 | Bacteria | 623 |
| 1224 | Ga0495649_0002747 | 3300046694 | Bacteria | 12249 |
| 1225 | Ga0495649_0156285 | 3300046694 | Bacteria | 1196 |
| 1226 | Ga0495649_0356621 | 3300046694 | Bacteria | 738 |
| 1227 | Ga0495589_0063551 | 3300046794 | Bacteria | 1811 |
| 1228 | Ga0495589_0085016 | 3300046794 | Bacteria | 1537 |
| 1229 | Ga0495589_0229217 | 3300046794 | Bacteria | 871 |
| 1230 | Ga0495600_0004076 | 3300046809 | Bacteria | 8690 |
| 1231 | Ga0495600_0051028 | 3300046809 | Bacteria | 2700 |
| 1232 | Ga0495600_0053596 | 3300046809 | Bacteria | 2634 |
| 1233 | Ga0495600_0248931 | 3300046809 | Bacteria | 1131 |
| 1234 | Ga0495581_0032284 | 3300047315 | Bacteria | 3033 |
| 1235 | Ga0495581_0080363 | 3300047315 | Bacteria | 1887 |
| 1236 | Ga0495581_0507569 | 3300047315 | Bacteria | 701 |
| 1237 | Ga0495604_0017042 | 3300047317 | Bacteria | 5811 |
| 1238 | Ga0495604_0107040 | 3300047317 | Bacteria | 2044 |
| 1239 | Ga0495604_0174913 | 3300047317 | Bacteria | 1506 |
| 1240 | Ga0495604_0306912 | 3300047317 | Bacteria | 1064 |
| 1241 | Ga0495636_0080836 | 3300047318 | Bacteria | 1399 |
| 1242 | Ga0495636_0136043 | 3300047318 | Bacteria | 1095 |
| 1243 | Ga0495674_0011448 | 3300047319 | Bacteria | 8369 |
| 1244 | Ga0495674_0252779 | 3300047319 | Bacteria | 1450 |
| 1245 | Ga0495674_0787159 | 3300047319 | Bacteria | 741 |
| 1246 | Ga0495672_0014389 | 3300047320 | Bacteria | 5420 |
| 1247 | Ga0495672_0017769 | 3300047320 | Bacteria | 4746 |
| 1248 | Ga0495672_0371852 | 3300047320 | Bacteria | 659 |
| 1249 | Ga0495676_0060257 | 3300047321 | Bacteria | 2976 |
| 1250 | Ga0495676_0095841 | 3300047321 | Bacteria | 2207 |
| 1251 | Ga0495676_0325583 | 3300047321 | Bacteria | 1032 |
| 1252 | Ga0495676_0369370 | 3300047321 | Bacteria | 956 |
| 1253 | Ga0495676_0435803 | 3300047321 | Bacteria | 866 |
| 1254 | Ga0495680_0040840 | 3300047322 | Bacteria | 3692 |
| 1255 | Ga0495683_0025892 | 3300047323 | Bacteria | 3004 |
| 1256 | Ga0495683_0329099 | 3300047323 | Bacteria | 649 |
| 1257 | Ga0495687_031675 | 3300047443 | Bacteria | 2423 |
| 1258 | Ga0495675_0002941 | 3300047444 | Bacteria | 10234 |
| 1259 | Ga0495685_207736 | 3300047447 | Bacteria | 627 |
| 1260 | Ga0495673_0061080 | 3300047469 | Bacteria | 1615 |
| 1261 | Ga0495673_0186320 | 3300047469 | Bacteria | 783 |
| 1262 | Ga0495681_0081383 | 3300047470 | Bacteria | 1445 |
| 1263 | Ga0495684_0033429 | 3300047471 | Bacteria | 3944 |
| 1264 | Ga0495684_0098483 | 3300047471 | Bacteria | 2211 |
| 1265 | Ga0495686_0082026 | 3300047472 | Bacteria | 1968 |
| 1266 | Ga0495686_0100852 | 3300047472 | Bacteria | 1741 |
| 1267 | Ga0495686_0148202 | 3300047472 | Bacteria | 1379 |
| 1268 | Ga0495686_0222536 | 3300047472 | Bacteria | 1073 |
| 1269 | Ga0495686_0238766 | 3300047472 | Bacteria | 1026 |
| 1270 | Ga0495686_0314023 | 3300047472 | Bacteria | 861 |
| 1271 | Ga0495602_0021964 | 3300048088 | Bacteria | 6258 |
| 1272 | Ga0495602_0409516 | 3300048088 | Bacteria | 965 |
| 1273 | Ga0495615_0007906 | 3300048090 | Bacteria | 2036 |
| 1274 | Ga0495626_0109357 | 3300048091 | Bacteria | 1198 |
| 1275 | Ga0496100_0028315 | 3300048903 | Bacteria | 3455 |
| 1276 | Ga0496100_0140332 | 3300048903 | Bacteria | 1712 |
| 1277 | Ga0496100_0650342 | 3300048903 | Bacteria | 821 |
| 1278 | Ga0496100_0870388 | 3300048903 | Bacteria | 707 |
| 1279 | Ga0496101_0003628 | 3300048904 | Bacteria | 9636 |
| 1280 | Ga0496101_0070733 | 3300048904 | Bacteria | 2556 |
| 1281 | Ga0496102_0004361 | 3300048905 | Bacteria | 11953 |
| 1282 | Ga0496102_0129771 | 3300048905 | Bacteria | 2358 |
| 1283 | Ga0496102_0375761 | 3300048905 | Bacteria | 1337 |
| 1284 | Ga0496102_0433977 | 3300048905 | Bacteria | 1233 |
| 1285 | Ga0496102_0584517 | 3300048905 | Bacteria | 1040 |
| 1286 | Ga0496102_0975554 | 3300048905 | Bacteria | 768 |
| 1287 | Ga0496103_0130167 | 3300048906 | Bacteria | 1607 |
| 1288 | Ga0496103_0137613 | 3300048906 | Bacteria | 1561 |
| 1289 | Ga0496103_0599734 | 3300048906 | Bacteria | 701 |
| 1290 | Ga0496104_0020661 | 3300048907 | Bacteria | 6039 |
| 1291 | Ga0496104_0118046 | 3300048907 | Bacteria | 2546 |
| 1292 | Ga0496104_0131500 | 3300048907 | Bacteria | 2404 |
| 1293 | Ga0496104_0199944 | 3300048907 | Bacteria | 1910 |
| 1294 | Ga0496104_0222785 | 3300048907 | Bacteria | 1798 |
| 1295 | Ga0496104_0255091 | 3300048907 | Bacteria | 1666 |
| 1296 | Ga0496104_0321739 | 3300048907 | Bacteria | 1459 |
| 1297 | Ga0496104_1388885 | 3300048907 | Bacteria | 605 |
| 1298 | Ga0496105_0000647 | 3300048908 | Bacteria | 23344 |
| 1299 | Ga0496105_0023303 | 3300048908 | Bacteria | 5018 |
| 1300 | Ga0496105_0279500 | 3300048908 | Bacteria | 1346 |
| 1301 | Ga0496105_0356569 | 3300048908 | Bacteria | 1167 |
| 1302 | Ga0496105_0393931 | 3300048908 | Bacteria | 1100 |
| 1303 | Ga0496105_0502624 | 3300048908 | Bacteria | 951 |
| 1304 | Ga0496106_0000960 | 3300048909 | Bacteria | 21012 |
| 1305 | Ga0496106_0011693 | 3300048909 | Bacteria | 6482 |
| 1306 | Ga0496106_0026408 | 3300048909 | Bacteria | 4325 |
| 1307 | Ga0496106_0046946 | 3300048909 | Bacteria | 3248 |
| 1308 | Ga0496106_0077578 | 3300048909 | Bacteria | 2548 |
| 1309 | Ga0496106_0144123 | 3300048909 | Bacteria | 1875 |
| 1310 | Ga0496106_0229713 | 3300048909 | Bacteria | 1481 |
| 1311 | Ga0496106_0321360 | 3300048909 | Bacteria | 1242 |
| 1312 | Ga0496106_0500551 | 3300048909 | Bacteria | 976 |
| 1313 | Ga0496106_0810702 | 3300048909 | Bacteria | 742 |
| 1314 | Ga0496107_0003437 | 3300048910 | Bacteria | 10586 |
| 1315 | Ga0496107_0018143 | 3300048910 | Bacteria | 4951 |
| 1316 | Ga0496107_0018169 | 3300048910 | Bacteria | 4948 |
| 1317 | Ga0496107_0051167 | 3300048910 | Bacteria | 2979 |
| 1318 | Ga0496107_0168176 | 3300048910 | Bacteria | 1626 |
| 1319 | Ga0496107_0266274 | 3300048910 | Bacteria | 1275 |
| 1320 | Ga0496107_0985019 | 3300048910 | Bacteria | 612 |
| 1321 | Ga0496108_0000803 | 3300048911 | Bacteria | 24388 |
| 1322 | Ga0496108_0029498 | 3300048911 | Bacteria | 4543 |
| 1323 | Ga0496108_0038906 | 3300048911 | Bacteria | 3964 |
| 1324 | Ga0496108_0105623 | 3300048911 | Bacteria | 2404 |
| 1325 | Ga0496108_0153998 | 3300048911 | Bacteria | 1984 |
| 1326 | Ga0496108_0233495 | 3300048911 | Bacteria | 1599 |
| 1327 | Ga0496108_0293029 | 3300048911 | Bacteria | 1417 |
| 1328 | Ga0496108_0664449 | 3300048911 | Bacteria | 905 |
| 1329 | Ga0496108_0695171 | 3300048911 | Bacteria | 882 |
| 1330 | Ga0496108_0974966 | 3300048911 | Bacteria | 725 |
| 1331 | Ga0496108_1154650 | 3300048911 | Bacteria | 656 |
| 1332 | Ga0496109_0001236 | 3300048912 | Bacteria | 21235 |
| 1333 | Ga0496109_0017599 | 3300048912 | Bacteria | 6268 |
| 1334 | Ga0496109_0033008 | 3300048912 | Bacteria | 4656 |
| 1335 | Ga0496109_0128689 | 3300048912 | Bacteria | 2362 |
| 1336 | Ga0496109_0228190 | 3300048912 | Bacteria | 1751 |
| 1337 | Ga0496109_0321310 | 3300048912 | Bacteria | 1461 |
| 1338 | Ga0496109_0933745 | 3300048912 | Bacteria | 805 |
| 1339 | Ga0496110_0027403 | 3300048913 | Bacteria | 4884 |
| 1340 | Ga0496110_0078125 | 3300048913 | Bacteria | 2946 |
| 1341 | Ga0496110_0155677 | 3300048913 | Bacteria | 2070 |
| 1342 | Ga0496110_0171333 | 3300048913 | Bacteria | 1969 |
| 1343 | Ga0496110_0231296 | 3300048913 | Bacteria | 1681 |
| 1344 | Ga0496110_0372681 | 3300048913 | Bacteria | 1301 |
| 1345 | Ga0496110_0621048 | 3300048913 | Bacteria | 979 |
| 1346 | Ga0496110_0664355 | 3300048913 | Bacteria | 942 |
| 1347 | Ga0496110_1075367 | 3300048913 | Bacteria | 712 |
| 1348 | Ga0496111_0049775 | 3300048914 | Bacteria | 3021 |
| 1349 | Ga0496111_0072278 | 3300048914 | Bacteria | 2511 |
| 1350 | Ga0496111_0144636 | 3300048914 | Bacteria | 1762 |
| 1351 | Ga0496111_0153009 | 3300048914 | Bacteria | 1711 |
| 1352 | Ga0496111_0180632 | 3300048914 | Bacteria | 1568 |
| 1353 | Ga0496111_0345559 | 3300048914 | Bacteria | 1101 |
| 1354 | Ga0496111_0612502 | 3300048914 | Bacteria | 796 |
| 1355 | Ga0496112_0000015 | 3300048915 | Bacteria | 206423 |
| 1356 | Ga0496112_0002678 | 3300048915 | Bacteria | 14403 |
| 1357 | Ga0496112_0019376 | 3300048915 | Bacteria | 6422 |
| 1358 | Ga0496112_0024342 | 3300048915 | Bacteria | 5795 |
| 1359 | Ga0496112_0029519 | 3300048915 | Bacteria | 5303 |
| 1360 | Ga0496112_0067611 | 3300048915 | Bacteria | 3527 |
| 1361 | Ga0496112_0167136 | 3300048915 | Bacteria | 2165 |
| 1362 | Ga0496112_0230887 | 3300048915 | Bacteria | 1805 |
| 1363 | Ga0496112_0390282 | 3300048915 | Bacteria | 1332 |
| 1364 | Ga0496112_0413932 | 3300048915 | Bacteria | 1287 |
| 1365 | Ga0496112_0515023 | 3300048915 | Bacteria | 1131 |
| 1366 | Ga0496113_0006745 | 3300048916 | Bacteria | 7318 |
| 1367 | Ga0496113_0042625 | 3300048916 | Bacteria | 3354 |
| 1368 | Ga0496113_0058775 | 3300048916 | Bacteria | 2894 |
| 1369 | Ga0496113_0125174 | 3300048916 | Bacteria | 2012 |
| 1370 | Ga0496113_0357593 | 3300048916 | Bacteria | 1171 |
| 1371 | Ga0496113_0444029 | 3300048916 | Bacteria | 1042 |
| 1372 | Ga0496113_0835532 | 3300048916 | Bacteria | 730 |
| 1373 | Ga0496114_0030749 | 3300048917 | Bacteria | 4418 |
| 1374 | Ga0496114_0095732 | 3300048917 | Bacteria | 2527 |
| 1375 | Ga0496114_0104240 | 3300048917 | Bacteria | 2425 |
| 1376 | Ga0496114_0175899 | 3300048917 | Bacteria | 1867 |
| 1377 | Ga0496114_0293444 | 3300048917 | Bacteria | 1435 |
| 1378 | Ga0496115_0009727 | 3300048918 | Bacteria | 7160 |
| 1379 | Ga0496115_0034663 | 3300048918 | Bacteria | 3989 |
| 1380 | Ga0496115_0044070 | 3300048918 | Bacteria | 3557 |
| 1381 | Ga0496115_0064821 | 3300048918 | Bacteria | 2950 |
| 1382 | Ga0496115_0098472 | 3300048918 | Bacteria | 2395 |
| 1383 | Ga0496115_0158782 | 3300048918 | Bacteria | 1868 |
| 1384 | Ga0496115_0160537 | 3300048918 | Bacteria | 1857 |
| 1385 | Ga0496115_0197494 | 3300048918 | Bacteria | 1662 |
| 1386 | Ga0496115_0351997 | 3300048918 | Bacteria | 1201 |
| 1387 | Ga0496115_0442544 | 3300048918 | Bacteria | 1051 |
| 1388 | Ga0496115_0476550 | 3300048918 | Bacteria | 1005 |
| 1389 | Ga0496116_0345004 | 3300048919 | Bacteria | 685 |
| 1390 | Ga0496117_0027401 | 3300048920 | Bacteria | 4442 |
| 1391 | Ga0496117_0065431 | 3300048920 | Bacteria | 2472 |
| 1392 | Ga0496117_0122059 | 3300048920 | Bacteria | 1598 |
| 1393 | Ga0496117_0125366 | 3300048920 | Bacteria | 1569 |
| 1394 | Ga0496118_0004286 | 3300048921 | Bacteria | 17065 |
| 1395 | Ga0496118_0040381 | 3300048921 | Bacteria | 3711 |
| 1396 | Ga0496118_0053221 | 3300048921 | Bacteria | 3080 |
| 1397 | Ga0496118_0057571 | 3300048921 | Bacteria | 2912 |
| 1398 | Ga0496118_0093693 | 3300048921 | Bacteria | 2056 |
| 1399 | Ga0496118_0137032 | 3300048921 | Bacteria | 1560 |
| 1400 | Ga0496118_0179735 | 3300048921 | Bacteria | 1280 |
| 1401 | Ga0496118_0287439 | 3300048921 | Bacteria | 911 |
| 1402 | Ga0496118_0291127 | 3300048921 | Bacteria | 902 |
| 1403 | Ga0496119_0183306 | 3300048922 | Bacteria | 1096 |
| 1404 | Ga0496119_0312083 | 3300048922 | Bacteria | 772 |
| 1405 | Ga0496120_0029227 | 3300048923 | Bacteria | 3366 |
| 1406 | Ga0496120_0113881 | 3300048923 | Bacteria | 1409 |
| 1407 | Ga0496121_0000423 | 3300048924 | Bacteria | 83271 |
| 1408 | Ga0496121_0000865 | 3300048924 | Bacteria | 54663 |
| 1409 | Ga0496121_0016177 | 3300048924 | Bacteria | 7722 |
| 1410 | Ga0496121_0066527 | 3300048924 | Bacteria | 2925 |
| 1411 | Ga0496121_0071616 | 3300048924 | Bacteria | 2787 |
| 1412 | Ga0496121_0088411 | 3300048924 | Bacteria | 2429 |
| 1413 | Ga0496121_0109860 | 3300048924 | Bacteria | 2105 |
| 1414 | Ga0496121_0133830 | 3300048924 | Bacteria | 1850 |
| 1415 | Ga0496121_0226364 | 3300048924 | Bacteria | 1313 |
| 1416 | Ga0496121_0277560 | 3300048924 | Bacteria | 1148 |
| 1417 | Ga0496121_0290060 | 3300048924 | Bacteria | 1115 |
| 1418 | Ga0496121_0422065 | 3300048924 | Bacteria | 867 |
| 1419 | Ga0496121_0673464 | 3300048924 | Bacteria | 627 |
| 1420 | Ga0496122_0014922 | 3300048925 | Bacteria | 7477 |
| 1421 | Ga0496122_0108994 | 3300048925 | Bacteria | 1824 |
| 1422 | Ga0496122_0119135 | 3300048925 | Bacteria | 1708 |
| 1423 | Ga0496123_0250282 | 3300048926 | Bacteria | 874 |
| 1424 | Ga0496124_0005449 | 3300048927 | Bacteria | 14303 |
| 1425 | Ga0496124_0134487 | 3300048927 | Bacteria | 1959 |
| 1426 | Ga0496124_0199703 | 3300048927 | Bacteria | 1522 |
| 1427 | Ga0496124_0249923 | 3300048927 | Bacteria | 1312 |
| 1428 | Ga0496124_0351733 | 3300048927 | Bacteria | 1042 |
| 1429 | Ga0496124_0370637 | 3300048927 | Bacteria | 1005 |
| 1430 | Ga0496125_0000136 | 3300048928 | Bacteria | 160544 |
| 1431 | Ga0496125_0049468 | 3300048928 | Bacteria | 3493 |
| 1432 | Ga0496125_0063927 | 3300048928 | Bacteria | 2930 |
| 1433 | Ga0496125_0064445 | 3300048928 | Bacteria | 2912 |
| 1434 | Ga0496125_0066903 | 3300048928 | Bacteria | 2835 |
| 1435 | Ga0496125_0148114 | 3300048928 | Bacteria | 1618 |
| 1436 | Ga0496125_0191802 | 3300048928 | Bacteria | 1348 |
| 1437 | Ga0496125_0329748 | 3300048928 | Bacteria | 921 |
| 1438 | Ga0496125_0621598 | 3300048928 | Bacteria | 586 |
| 1439 | Ga0496126_0007880 | 3300048929 | Bacteria | 11599 |
| 1440 | Ga0496126_0008016 | 3300048929 | Bacteria | 11461 |
| 1441 | Ga0496126_0013800 | 3300048929 | Bacteria | 8192 |
| 1442 | Ga0496126_0018058 | 3300048929 | Bacteria | 7007 |
| 1443 | Ga0496126_0046719 | 3300048929 | Bacteria | 3967 |
| 1444 | Ga0496126_0074875 | 3300048929 | Bacteria | 3006 |
| 1445 | Ga0496126_0107865 | 3300048929 | Bacteria | 2428 |
| 1446 | Ga0496126_0173191 | 3300048929 | Bacteria | 1837 |
| 1447 | Ga0496126_0185006 | 3300048929 | Bacteria | 1767 |
| 1448 | Ga0496126_0214651 | 3300048929 | Bacteria | 1619 |
| 1449 | Ga0496126_0235647 | 3300048929 | Bacteria | 1531 |
| 1450 | Ga0496126_0249024 | 3300048929 | Bacteria | 1481 |
| 1451 | Ga0496126_0253838 | 3300048929 | Bacteria | 1464 |
| 1452 | Ga0496126_0382430 | 3300048929 | Bacteria | 1145 |
| 1453 | Ga0496126_0430013 | 3300048929 | Bacteria | 1066 |
| 1454 | Ga0496126_0453361 | 3300048929 | Bacteria | 1032 |
| 1455 | Ga0496126_0887244 | 3300048929 | Bacteria | 677 |
| 1456 | Ga0495682_0016334 | 3300049460 | Bacteria | 2810 |
| 1457 | Ga0495682_0118667 | 3300049460 | Bacteria | 947 |
| 1458 | Ga0495682_0146685 | 3300049460 | Bacteria | 842 |
| 1459 | Ga0501031_0000390 | 3300049568 | Bacteria | 25691 |
| 1460 | Ga0501032_0014322 | 3300049569 | Bacteria | 5617 |
| 1461 | Ga0501032_0146640 | 3300049569 | Bacteria | 1553 |
| 1462 | Ga0501032_0354299 | 3300049569 | Bacteria | 945 |
| 1463 | Ga0501033_0000205 | 3300049570 | Bacteria | 56697 |
| 1464 | Ga0501033_0202584 | 3300049570 | Bacteria | 1417 |
| 1465 | Ga0501033_0431645 | 3300049570 | Bacteria | 916 |
| 1466 | Ga0501034_0044925 | 3300049571 | Bacteria | 4465 |
| 1467 | Ga0501034_0149277 | 3300049571 | Bacteria | 2314 |
| 1468 | Ga0501034_0530731 | 3300049571 | Bacteria | 1088 |
| 1469 | Ga0501036_0111918 | 3300049572 | Bacteria | 2307 |
| 1470 | Ga0501036_0227538 | 3300049572 | Bacteria | 1565 |
| 1471 | Ga0501036_0229541 | 3300049572 | Bacteria | 1558 |
| 1472 | Ga0501036_0388014 | 3300049572 | Bacteria | 1165 |
| 1473 | Ga0501036_0613038 | 3300049572 | Bacteria | 902 |
| 1474 | Ga0501037_0001134 | 3300049573 | Bacteria | 19732 |
| 1475 | Ga0501037_0213237 | 3300049573 | Bacteria | 1361 |
| 1476 | Ga0501037_0299844 | 3300049573 | Bacteria | 1116 |
| 1477 | Ga0501037_0818210 | 3300049573 | Bacteria | 614 |
| 1478 | Ga0501038_0083624 | 3300049574 | Bacteria | 2686 |
| 1479 | Ga0501038_0095343 | 3300049574 | Bacteria | 2485 |
| 1480 | Ga0501038_0718608 | 3300049574 | Bacteria | 747 |
| 1481 | Ga0501039_0005007 | 3300049575 | Bacteria | 10055 |
| 1482 | Ga0501039_0283593 | 3300049575 | Bacteria | 1302 |
| 1483 | Ga0501041_0219230 | 3300049577 | Bacteria | 1194 |
| 1484 | Ga0501042_0041282 | 3300049578 | Bacteria | 3280 |
| 1485 | Ga0501042_0443671 | 3300049578 | Bacteria | 941 |
| 1486 | Ga0501043_0013802 | 3300049579 | Bacteria | 6322 |
| 1487 | Ga0501046_0005064 | 3300049580 | Bacteria | 11815 |
| 1488 | Ga0501046_0113933 | 3300049580 | Bacteria | 2063 |
| 1489 | Ga0501046_0191270 | 3300049580 | Bacteria | 1526 |
| 1490 | Ga0501047_0010641 | 3300049581 | Bacteria | 8696 |
| 1491 | Ga0501047_0289630 | 3300049581 | Bacteria | 1481 |
| 1492 | Ga0501047_0884414 | 3300049581 | Bacteria | 707 |
| 1493 | Ga0501047_1106736 | 3300049581 | Bacteria | 605 |
| 1494 | Ga0501067_0112428 | 3300049583 | Bacteria | 1515 |
| 1495 | Ga0501067_0293368 | 3300049583 | Bacteria | 905 |
| 1496 | Ga0501068_0531206 | 3300049584 | Bacteria | 764 |
| 1497 | Ga0501068_0627946 | 3300049584 | Bacteria | 701 |
| 1498 | Ga0501069_0157932 | 3300049585 | Bacteria | 1305 |
| 1499 | Ga0501070_0052132 | 3300049586 | Bacteria | 3396 |
| 1500 | Ga0501070_0106087 | 3300049586 | Bacteria | 2322 |
| 1501 | Ga0501070_0226875 | 3300049586 | Bacteria | 1531 |
| 1502 | Ga0501070_0370610 | 3300049586 | Bacteria | 1161 |
| 1503 | Ga0501070_0754677 | 3300049586 | Bacteria | 766 |
| 1504 | Ga0501071_0119488 | 3300049587 | Bacteria | 1953 |
| 1505 | Ga0501071_0151756 | 3300049587 | Bacteria | 1729 |
| 1506 | Ga0501073_0067728 | 3300049589 | Bacteria | 2489 |
| 1507 | Ga0501073_0650660 | 3300049589 | Bacteria | 727 |
| 1508 | Ga0501074_0031492 | 3300049590 | Bacteria | 3842 |
| 1509 | Ga0501074_0072286 | 3300049590 | Bacteria | 2478 |
| 1510 | Ga0501074_0563924 | 3300049590 | Bacteria | 806 |
| 1511 | Ga0501076_0629471 | 3300049592 | Bacteria | 885 |
| 1512 | Ga0501077_0045897 | 3300049593 | Bacteria | 2776 |
| 1513 | Ga0501079_0361197 | 3300049741 | Bacteria | 1138 |
| 1514 | Ga0501080_0082585 | 3300049742 | Bacteria | 2984 |
| 1515 | Ga0501080_0238244 | 3300049742 | Bacteria | 1661 |
| 1516 | Ga0501080_0242107 | 3300049742 | Bacteria | 1646 |
| 1517 | Ga0501080_0856556 | 3300049742 | Bacteria | 794 |
| 1518 | Ga0501083_0236285 | 3300049744 | Bacteria | 1190 |
| 1519 | Ga0501035_0029757 | 3300049822 | Bacteria | 4980 |
| 1520 | Ga0501035_0074363 | 3300049822 | Bacteria | 3006 |
| 1521 | Ga0501035_0089143 | 3300049822 | Bacteria | 2717 |
| 1522 | Ga0501035_0106217 | 3300049822 | Bacteria | 2462 |
| 1523 | Ga0501035_0344564 | 3300049822 | Bacteria | 1248 |
| 1524 | Ga0501035_0575158 | 3300049822 | Bacteria | 920 |
| 1525 | Ga0501044_0005118 | 3300049823 | Bacteria | 14626 |
| 1526 | Ga0501044_0059132 | 3300049823 | Bacteria | 3928 |
| 1527 | Ga0501044_0153987 | 3300049823 | Bacteria | 2279 |
| 1528 | Ga0501044_0197223 | 3300049823 | Bacteria | 1972 |
| 1529 | Ga0501044_0271780 | 3300049823 | Bacteria | 1630 |
| 1530 | Ga0501044_0338311 | 3300049823 | Bacteria | 1426 |
| 1531 | Ga0501044_0401313 | 3300049823 | Bacteria | 1283 |
| 1532 | Ga0501044_0662829 | 3300049823 | Bacteria | 931 |
| 1533 | Ga0501044_0926597 | 3300049823 | Bacteria | 745 |
| 1534 | Ga0501044_1269418 | 3300049823 | Bacteria | 603 |
| 1535 | Ga0501045_0080700 | 3300049824 | Bacteria | 2399 |
| 1536 | Ga0501045_0270674 | 3300049824 | Bacteria | 1265 |
| 1537 | nmdc:mga03683_164689_c1 | 3300050489 | Bacteria | 1006 |
| 1538 | nmdc:mga03683_40505_c1 | 3300050489 | Bacteria | 1911 |
| 1539 | nmdc:mga03683_41994_c1 | 3300050489 | Bacteria | 1880 |
| 1540 | nmdc:mga03683_94550_c1 | 3300050489 | Bacteria | 1307 |
| 1541 | nmdc:mga03n38_1418_c1 | 3300050490 | Bacteria | 6843 |
| 1542 | nmdc:mga03n38_453607_c1 | 3300050490 | Bacteria | 714 |
| 1543 | nmdc:mga03n38_662521_c1 | 3300050490 | Bacteria | 599 |
| 1544 | nmdc:mga00v17_186268_c1 | 3300050491 | Bacteria | 1340 |
| 1545 | nmdc:mga00v17_227627_c1 | 3300050491 | Bacteria | 1208 |
| 1546 | nmdc:mga00v17_43893_c1 | 3300050491 | Bacteria | 2694 |
| 1547 | nmdc:mga00v17_81611_c2 | 3300050491 | Bacteria | 937 |
| 1548 | nmdc:mga00v17_91466_c1 | 3300050491 | Bacteria | 1911 |
| 1549 | nmdc:mga0yw44_111921_c1 | 3300050492 | Bacteria | 1750 |
| 1550 | nmdc:mga0yw44_125363_c1 | 3300050492 | Bacteria | 1658 |
| 1551 | nmdc:mga0yw44_168244_c1 | 3300050492 | Bacteria | 1062 |
| 1552 | nmdc:mga0yw44_20997_c1 | 3300050492 | Bacteria | 3636 |
| 1553 | nmdc:mga0yw44_278456_c1 | 3300050492 | Bacteria | 1118 |
| 1554 | nmdc:mga0yw44_338777_c1 | 3300050492 | Bacteria | 1011 |
| 1555 | nmdc:mga0yw44_363451_c1 | 3300050492 | Bacteria | 976 |
| 1556 | nmdc:mga0yw44_365091_c1 | 3300050492 | Bacteria | 973 |
| 1557 | nmdc:mga0yw44_41212_c1 | 3300050492 | Bacteria | 2748 |
| 1558 | nmdc:mga0yw44_471048_c1 | 3300050492 | Bacteria | 852 |
| 1559 | nmdc:mga0yw44_496868_c1 | 3300050492 | Bacteria | 828 |
| 1560 | nmdc:mga0yw44_74121_c1 | 3300050492 | Bacteria | 2120 |
| 1561 | nmdc:mga0k408_154685_c1 | 3300050493 | Bacteria | 1366 |
| 1562 | nmdc:mga0k408_177588_c1 | 3300050493 | Bacteria | 1270 |
| 1563 | nmdc:mga0k408_346773_c1 | 3300050493 | Bacteria | 885 |
| 1564 | nmdc:mga0k408_748444_c1 | 3300050493 | Bacteria | 571 |
| 1565 | nmdc:mga06z11_123724_c1 | 3300050494 | Bacteria | 1446 |
| 1566 | nmdc:mga06z11_13229_c1 | 3300050494 | Bacteria | 3616 |
| 1567 | nmdc:mga06z11_148848_c1 | 3300050494 | Bacteria | 1329 |
| 1568 | nmdc:mga06z11_27037_c1 | 3300050494 | Bacteria | 2739 |
| 1569 | nmdc:mga06z11_282116_c1 | 3300050494 | Bacteria | 984 |
| 1570 | nmdc:mga06z11_604492_c1 | 3300050494 | Bacteria | 667 |
| 1571 | nmdc:mga04h51_38193_c1 | 3300050495 | Bacteria | 1553 |
| 1572 | nmdc:mga04h51_41658_c1 | 3300050495 | Bacteria | 1502 |
| 1573 | nmdc:mga04h51_7254_c1 | 3300050495 | Bacteria | 2916 |
| 1574 | nmdc:mga04h51_91102_c1 | 3300050495 | Bacteria | 1097 |
| 1575 | nmdc:mga07m45_152587_c1 | 3300050496 | Bacteria | 1340 |
| 1576 | nmdc:mga07m45_1693_c2 | 3300050496 | Bacteria | 8663 |
| 1577 | nmdc:mga05p37_106683_c1 | 3300050507 | Bacteria | 3446 |
| 1578 | nmdc:mga09592_275182_c1 | 3300050508 | Bacteria | 1460 |
| 1579 | nmdc:mga08y16_139088_c1 | 3300050511 | Bacteria | 2524 |
| 1580 | nmdc:mga08y16_50901_c1 | 3300050511 | Bacteria | 4334 |
| 1581 | nmdc:mga0n895_1294201_c1 | 3300050512 | Bacteria | 700 |
| 1582 | nmdc:mga0n895_286526_c1 | 3300050512 | Bacteria | 1670 |
| 1583 | nmdc:mga0n895_37552_c1 | 3300050512 | Bacteria | 4687 |
| 1584 | nmdc:mga0rr50_162398_c1 | 3300050513 | Bacteria | 1814 |
| 1585 | nmdc:mga0rr50_320662_c1 | 3300050513 | Bacteria | 1299 |
| 1586 | nmdc:mga0sz30_247978_c1 | 3300050516 | Bacteria | 793 |
| 1587 | nmdc:mga0sz30_26227_c1 | 3300050516 | Bacteria | 2388 |
| 1588 | nmdc:mga0sz30_307336_c1 | 3300050516 | Bacteria | 707 |
| 1589 | Ga0495601_0097467 | 3300053077 | Bacteria | 1897 |
| 1590 | Ga0495601_0154442 | 3300053077 | Bacteria | 1499 |
| 1591 | Ga0495601_0193554 | 3300053077 | Bacteria | 1329 |
| 1592 | Ga0495601_0476604 | 3300053077 | Bacteria | 806 |
| 1593 | Ga0495612_0268675 | 3300053078 | Bacteria | 761 |
| 1594 | Ga0500635_0011591 | 3300053080 | Bacteria | 2510 |
| 1595 | Ga0500635_0014644 | 3300053080 | Bacteria | 2302 |
| 1596 | Ga0500635_0323379 | 3300053080 | Bacteria | 610 |
| 1597 | Ga0495655_0037102 | 3300053083 | Bacteria | 1222 |
| 1598 | Ga0495655_0240072 | 3300053083 | Bacteria | 606 |
| 1599 | Ga0495595_0035717 | 3300053084 | Bacteria | 2252 |
| 1600 | Ga0495595_0302820 | 3300053084 | Bacteria | 804 |
| 1601 | Ga0495619_0012457 | 3300053085 | Bacteria | 5356 |
| 1602 | Ga0495619_0193105 | 3300053085 | Bacteria | 1409 |
| 1603 | Ga0495619_0845653 | 3300053085 | Bacteria | 617 |
| 1604 | Ga0500578_0140390 | 3300053086 | Bacteria | 1510 |
| 1605 | Ga0500578_0213772 | 3300053086 | Bacteria | 1175 |
| 1606 | Ga0500578_0238191 | 3300053086 | Bacteria | 1100 |
| 1607 | Ga0500643_000049 | 3300053087 | Bacteria | 147107 |
| 1608 | Ga0500643_046171 | 3300053087 | Bacteria | 1259 |
| 1609 | Ga0500644_0030836 | 3300053088 | Bacteria | 1700 |
| 1610 | Ga0500644_0073119 | 3300053088 | Bacteria | 1241 |
| 1611 | Ga0500644_0182254 | 3300053088 | Bacteria | 860 |
| 1612 | Ga0500646_0069815 | 3300053090 | Bacteria | 1051 |
| 1613 | Ga0500647_0220604 | 3300053091 | Bacteria | 849 |
| 1614 | Ga0500647_0261086 | 3300053091 | Bacteria | 757 |
| 1615 | Ga0500583_0173891 | 3300053092 | Bacteria | 1072 |
| 1616 | Ga0500651_0041180 | 3300053093 | Bacteria | 2911 |
| 1617 | Ga0500651_0072214 | 3300053093 | Bacteria | 2146 |
| 1618 | Ga0500651_0092244 | 3300053093 | Bacteria | 1863 |
| 1619 | Ga0500651_0255144 | 3300053093 | Bacteria | 1018 |
| 1620 | Ga0500651_0449324 | 3300053093 | Bacteria | 717 |
| 1621 | Ga0500566_0000054 | 3300053094 | Bacteria | 54975 |
| 1622 | Ga0500566_0000055 | 3300053094 | Bacteria | 54414 |
| 1623 | Ga0500566_0002813 | 3300053094 | Bacteria | 10360 |
| 1624 | Ga0500566_0006619 | 3300053094 | Bacteria | 6862 |
| 1625 | Ga0500640_024388 | 3300053095 | Bacteria | 2627 |
| 1626 | Ga0500641_0013558 | 3300053096 | Bacteria | 2995 |
| 1627 | Ga0500641_0031164 | 3300053096 | Bacteria | 2101 |
| 1628 | Ga0500650_0097072 | 3300053098 | Bacteria | 1380 |
| 1629 | Ga0500650_0144159 | 3300053098 | Bacteria | 1103 |
| 1630 | Ga0500554_003653 | 3300053102 | Bacteria | 3170 |
| 1631 | Ga0500554_010329 | 3300053102 | Bacteria | 2271 |
| 1632 | Ga0500555_005493 | 3300053103 | Bacteria | 3595 |
| 1633 | Ga0500556_0031759 | 3300053104 | Bacteria | 1799 |
| 1634 | Ga0500557_000118 | 3300053105 | Bacteria | 22375 |
| 1635 | Ga0500562_015483 | 3300053108 | Bacteria | 1956 |
| 1636 | Ga0500569_002326 | 3300053109 | Bacteria | 3728 |
| 1637 | Ga0500572_000348 | 3300053111 | Bacteria | 16528 |
| 1638 | Ga0500572_047110 | 3300053111 | Bacteria | 1272 |
| 1639 | Ga0500572_224846 | 3300053111 | Bacteria | 613 |
| 1640 | Ga0500591_086602 | 3300053115 | Bacteria | 1378 |
| 1641 | Ga0500594_0002633 | 3300053118 | Bacteria | 3901 |
| 1642 | Ga0500594_0038553 | 3300053118 | Bacteria | 1295 |
| 1643 | Ga0500595_000345 | 3300053119 | Bacteria | 30235 |
| 1644 | Ga0500595_005080 | 3300053119 | Bacteria | 5781 |
| 1645 | Ga0500595_038392 | 3300053119 | Bacteria | 1557 |
| 1646 | Ga0500595_046350 | 3300053119 | Bacteria | 1367 |
| 1647 | Ga0500595_120872 | 3300053119 | Bacteria | 740 |
| 1648 | Ga0500595_153644 | 3300053119 | Bacteria | 642 |
| 1649 | Ga0500597_093367 | 3300053120 | Bacteria | 1308 |
| 1650 | Ga0500597_108020 | 3300053120 | Bacteria | 1209 |
| 1651 | Ga0500597_141879 | 3300053120 | Bacteria | 1035 |
| 1652 | Ga0500597_331800 | 3300053120 | Bacteria | 598 |
| 1653 | Ga0500608_002697 | 3300053122 | Bacteria | 6513 |
| 1654 | Ga0500608_130969 | 3300053122 | Bacteria | 1125 |
| 1655 | Ga0500614_008371 | 3300053123 | Bacteria | 2192 |
| 1656 | Ga0500617_216891 | 3300053124 | Bacteria | 684 |
| 1657 | Ga0500618_006151 | 3300053125 | Bacteria | 3553 |
| 1658 | Ga0500618_014579 | 3300053125 | Bacteria | 2004 |
| 1659 | Ga0500618_022546 | 3300053125 | Bacteria | 1530 |
| 1660 | Ga0500626_092159 | 3300053128 | Bacteria | 1329 |
| 1661 | Ga0500642_0000164 | 3300053130 | Bacteria | 27497 |
| 1662 | Ga0500642_0039763 | 3300053130 | Bacteria | 2025 |
| 1663 | Ga0500642_0048319 | 3300053130 | Bacteria | 1868 |
| 1664 | Ga0500642_0049160 | 3300053130 | Bacteria | 1855 |
| 1665 | Ga0500658_0193656 | 3300053134 | Bacteria | 928 |
| 1666 | Ga0500658_0314249 | 3300053134 | Bacteria | 720 |
| 1667 | Ga0500559_0000305 | 3300053136 | Bacteria | 37260 |
| 1668 | Ga0500559_0000362 | 3300053136 | Bacteria | 33750 |
| 1669 | Ga0500559_0003633 | 3300053136 | Bacteria | 7546 |
| 1670 | Ga0500559_0028894 | 3300053136 | Bacteria | 2371 |
| 1671 | Ga0500559_0058557 | 3300053136 | Bacteria | 1713 |
| 1672 | Ga0500564_149111 | 3300053138 | Bacteria | 998 |
| 1673 | Ga0500568_0006864 | 3300053139 | Bacteria | 5666 |
| 1674 | Ga0500568_0026181 | 3300053139 | Bacteria | 2450 |
| 1675 | Ga0500568_0051625 | 3300053139 | Bacteria | 1617 |
| 1676 | Ga0500568_0052897 | 3300053139 | Bacteria | 1593 |
| 1677 | Ga0500573_0007866 | 3300053140 | Bacteria | 5843 |
| 1678 | Ga0500577_0001673 | 3300053142 | Bacteria | 5679 |
| 1679 | Ga0500577_0102862 | 3300053142 | Bacteria | 1170 |
| 1680 | Ga0500577_0128432 | 3300053142 | Bacteria | 1060 |
| 1681 | Ga0500577_0262329 | 3300053142 | Bacteria | 751 |
| 1682 | Ga0500590_246553 | 3300053148 | Bacteria | 714 |
| 1683 | Ga0500590_315644 | 3300053148 | Bacteria | 579 |
| 1684 | Ga0500603_011062 | 3300053150 | Bacteria | 2046 |
| 1685 | Ga0500603_060652 | 3300053150 | Bacteria | 1057 |
| 1686 | Ga0500604_0049689 | 3300053151 | Bacteria | 1290 |
| 1687 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1688 | Ga0500616_0022311 | 3300053153 | Bacteria | 3536 |
| 1689 | Ga0500619_092377 | 3300053154 | Bacteria | 1023 |
| 1690 | Ga0500619_189488 | 3300053154 | Bacteria | 692 |
| 1691 | Ga0500622_0005919 | 3300053156 | Bacteria | 7207 |
| 1692 | Ga0500622_0114950 | 3300053156 | Bacteria | 1311 |
| 1693 | Ga0500627_0148942 | 3300053158 | Bacteria | 1057 |
| 1694 | Ga0500627_0155805 | 3300053158 | Bacteria | 1031 |
| 1695 | Ga0500627_0168435 | 3300053158 | Bacteria | 987 |
| 1696 | Ga0500634_0158147 | 3300053161 | Bacteria | 1049 |
| 1697 | Ga0500638_027148 | 3300053162 | Bacteria | 2746 |
| 1698 | Ga0500638_050485 | 3300053162 | Bacteria | 2011 |
| 1699 | Ga0500638_295936 | 3300053162 | Bacteria | 627 |
| 1700 | Ga0500639_005653 | 3300053163 | Bacteria | 6412 |
| 1701 | Ga0500639_165395 | 3300053163 | Bacteria | 1000 |
| 1702 | Ga0500639_188864 | 3300053163 | Bacteria | 900 |
| 1703 | Ga0500636_0042723 | 3300053177 | Bacteria | 2678 |
| 1704 | Ga0500636_0077320 | 3300053177 | Bacteria | 1922 |
| 1705 | Ga0500637_0000053 | 3300053178 | Bacteria | 42767 |
| 1706 | Ga0500567_134325 | 3300053723 | Bacteria | 961 |
| 1707 | Ga0500570_048356 | 3300053724 | Bacteria | 2163 |
| 1708 | Ga0500657_212671 | 3300053728 | Bacteria | 625 |
| 1709 | Ga0500625_144878 | 3300053729 | Bacteria | 906 |
| 1710 | Ga0500645_079033 | 3300053730 | Bacteria | 939 |
| 1711 | Ga0500609_020309 | 3300053731 | Bacteria | 905 |
| 1712 | Ga0500656_032456 | 3300053732 | Bacteria | 701 |
| 1713 | Ga0500656_049629 | 3300053732 | Bacteria | 608 |
| 1714 | Ga0500552_006359 | 3300053733 | Bacteria | 1323 |
| 1715 | Ga0500596_000229 | 3300053735 | Bacteria | 9555 |
| 1716 | Ga0500596_006628 | 3300053735 | Bacteria | 1945 |
| 1717 | Ga0500596_029926 | 3300053735 | Bacteria | 841 |
| 1718 | Ga0500599_006308 | 3300053736 | Bacteria | 1510 |
| 1719 | Ga0500601_000388 | 3300053737 | Bacteria | 7571 |
| 1720 | Ga0500661_000122 | 3300055283 | Bacteria | 12922 |
| 1721 | Ga0500661_007332 | 3300055283 | Bacteria | 2043 |
| 1722 | Ga0501082_0547170 | 3300060353 | Bacteria | 1012 |
| 1723 | Ga0466962_0053071 | 3300061719 | Bacteria | 1937 |
| 1724 | Ga0466962_0056426 | 3300061719 | Bacteria | 1876 |
| 1725 | Ga0466962_0122178 | 3300061719 | Bacteria | 1257 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2671180139 | 2671693532 | 167 |
| 2 | 3300003354 | JGI25160J50197_1001001 | JGI25160J50197_10010017 | 169 |
| 3 | 3300025900 | Ga0207710_10078848 | Ga0207710_100788482 | 169 |
| 4 | 3300025903 | Ga0207680_10116114 | Ga0207680_101161143 | 169 |
| 5 | 3300028379 | Ga0268266_10897475 | Ga0268266_108974751 | 169 |
| 6 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_41681_42208 | 169 |
| 7 | 3300007265 | Ga0099794_10024310 | Ga0099794_100243103 | 170 |
| 8 | 3300010159 | Ga0099796_10095654 | Ga0099796_100956542 | 170 |
| 9 | iso_pu_bacteria | 2617270741 | 2617373608 | 170 |
| 10 | iso_pu_bacteria | 2824746037 | 2824751364 | 170 |
| 11 | iso_pu_bacteria | 8006926726 | 8006929803 | 170 |
| 12 | 3300005327 | Ga0070658_10178918 | Ga0070658_101789182 | 171 |
| 13 | 3300005366 | Ga0070659_100039074 | Ga0070659_1000390745 | 171 |
| 14 | 3300005435 | Ga0070714_100065139 | Ga0070714_1000651392 | 171 |
| 15 | 3300005458 | Ga0070681_10320087 | Ga0070681_103200871 | 171 |
| 16 | 3300005563 | Ga0068855_100083979 | Ga0068855_1000839792 | 171 |
| 17 | 3300005981 | Ga0081538_10026982 | Ga0081538_100269822 | 171 |
| 18 | 3300006038 | Ga0075365_10009883 | Ga0075365_100098834 | 171 |
| 19 | 3300006042 | Ga0075368_10117836 | Ga0075368_101178361 | 171 |
| 20 | 3300006042 | Ga0075368_10186706 | Ga0075368_101867061 | 171 |
| 21 | 3300006048 | Ga0075363_100199888 | Ga0075363_1001998882 | 171 |
| 22 | 3300006051 | Ga0075364_10320528 | Ga0075364_103205282 | 171 |
| 23 | 3300006177 | Ga0075362_10111361 | Ga0075362_101113612 | 171 |
| 24 | 3300006178 | Ga0075367_10026926 | Ga0075367_100269262 | 171 |
| 25 | 3300006178 | Ga0075367_10437204 | Ga0075367_104372041 | 171 |
| 26 | 3300009551 | Ga0105238_10346394 | Ga0105238_103463941 | 171 |
| 27 | 3300009551 | Ga0105238_10853638 | Ga0105238_108536381 | 171 |
| 28 | 3300013100 | Ga0157373_10034353 | Ga0157373_100343534 | 171 |
| 29 | 3300013104 | Ga0157370_10089286 | Ga0157370_100892864 | 171 |
| 30 | 3300013105 | Ga0157369_10503057 | Ga0157369_105030572 | 171 |
| 31 | 3300025919 | Ga0207657_10004389 | Ga0207657_1000438911 | 171 |
| 32 | 3300025924 | Ga0207694_10213773 | Ga0207694_102137732 | 171 |
| 33 | 3300025929 | Ga0207664_10176417 | Ga0207664_101764172 | 171 |
| 34 | 3300025932 | Ga0207690_10338842 | Ga0207690_103388422 | 171 |
| 35 | 3300025949 | Ga0207667_10192016 | Ga0207667_101920161 | 171 |
| 36 | 3300027866 | Ga0209813_10076547 | Ga0209813_100765472 | 171 |
| 37 | 3300039438 | Ga0436360_0758305 | Ga0436360_0758305_298_822 | 171 |
| 38 | 3300041463 | Ga0451804_0892439 | Ga0451804_0892439_43_567 | 171 |
| 39 | 3300046471 | Ga0495650_0079623 | Ga0495650_0079623_117_641 | 171 |
| 40 | 3300048910 | Ga0496107_0018143 | Ga0496107_0018143_2814_3338 | 171 |
| 41 | 3300048924 | Ga0496121_0000865 | Ga0496121_0000865_2200_2724 | 171 |
| 42 | 3300049569 | Ga0501032_0146640 | Ga0501032_0146640_26_550 | 171 |
| 43 | 3300049570 | Ga0501033_0431645 | Ga0501033_0431645_41_565 | 171 |
| 44 | 3300049571 | Ga0501034_0530731 | Ga0501034_0530731_100_624 | 171 |
| 45 | 3300049572 | Ga0501036_0227538 | Ga0501036_0227538_368_901 | 171 |
| 46 | 3300049574 | Ga0501038_0083624 | Ga0501038_0083624_1953_2477 | 171 |
| 47 | 3300049575 | Ga0501039_0283593 | Ga0501039_0283593_67_600 | 171 |
| 48 | 3300049578 | Ga0501042_0443671 | Ga0501042_0443671_44_568 | 171 |
| 49 | 3300049580 | Ga0501046_0113933 | Ga0501046_0113933_1031_1564 | 171 |
| 50 | 3300049580 | Ga0501046_0191270 | Ga0501046_0191270_227_751 | 171 |
| 51 | 3300049581 | Ga0501047_1106736 | Ga0501047_1106736_68_592 | 171 |
| 52 | 3300049584 | Ga0501068_0531206 | Ga0501068_0531206_25_549 | 171 |
| 53 | 3300049586 | Ga0501070_0226875 | Ga0501070_0226875_351_884 | 171 |
| 54 | 3300049587 | Ga0501071_0151756 | Ga0501071_0151756_1025_1549 | 171 |
| 55 | 3300049590 | Ga0501074_0072286 | Ga0501074_0072286_276_800 | 171 |
| 56 | 3300049742 | Ga0501080_0242107 | Ga0501080_0242107_46_570 | 171 |
| 57 | 3300049744 | Ga0501083_0236285 | Ga0501083_0236285_605_1138 | 171 |
| 58 | 3300049822 | Ga0501035_0089143 | Ga0501035_0089143_188_721 | 171 |
| 59 | 3300049822 | Ga0501035_0575158 | Ga0501035_0575158_16_549 | 171 |
| 60 | 3300049823 | Ga0501044_0197223 | Ga0501044_0197223_225_749 | 171 |
| 61 | 3300049823 | Ga0501044_0338311 | Ga0501044_0338311_183_707 | 171 |
| 62 | 3300049823 | Ga0501044_0401313 | Ga0501044_0401313_587_1120 | 171 |
| 63 | 3300049823 | Ga0501044_0662829 | Ga0501044_0662829_225_749 | 171 |
| 64 | 3300049823 | Ga0501044_1269418 | Ga0501044_1269418_34_567 | 171 |
| 65 | 3300049824 | Ga0501045_0080700 | Ga0501045_0080700_858_1382 | 171 |
| 66 | 3300050489 | nmdc:mga03683_94550_c1 | nmdc:mga03683_94550_c1_773_1297 | 171 |
| 67 | 3300050491 | nmdc:mga00v17_227627_c1 | nmdc:mga00v17_227627_c1_184_708 | 171 |
| 68 | 3300050492 | nmdc:mga0yw44_365091_c1 | nmdc:mga0yw44_365091_c1_320_844 | 171 |
| 69 | 3300050492 | nmdc:mga0yw44_41212_c1 | nmdc:mga0yw44_41212_c1_1546_2070 | 171 |
| 70 | 3300050493 | nmdc:mga0k408_346773_c1 | nmdc:mga0k408_346773_c1_320_844 | 171 |
| 71 | 3300050494 | nmdc:mga06z11_27037_c1 | nmdc:mga06z11_27037_c1_1256_1780 | 171 |
| 72 | 3300050494 | nmdc:mga06z11_282116_c1 | nmdc:mga06z11_282116_c1_111_635 | 171 |
| 73 | 3300050495 | nmdc:mga04h51_38193_c1 | nmdc:mga04h51_38193_c1_1018_1542 | 171 |
| 74 | 3300050495 | nmdc:mga04h51_91102_c1 | nmdc:mga04h51_91102_c1_485_1009 | 171 |
| 75 | 3300053087 | Ga0500643_046171 | Ga0500643_046171_26_547 | 171 |
| 76 | 3300053139 | Ga0500568_0006864 | Ga0500568_0006864_3314_3832 | 171 |
| 77 | 3300053139 | Ga0500568_0051625 | Ga0500568_0051625_242_766 | 171 |
| 78 | 3300060353 | Ga0501082_0547170 | Ga0501082_0547170_450_983 | 171 |
| 79 | iso_pu_bacteria | 2507262055 | 2507505089 | 171 |
| 80 | iso_pu_bacteria | 2508501009 | 2508539024 | 171 |
| 81 | iso_pu_bacteria | 2508501042 | 2508695341 | 171 |
| 82 | iso_pu_bacteria | 2511231028 | 2511394518 | 171 |
| 83 | iso_pu_bacteria | 2513237092 | 2513623246 | 171 |
| 84 | iso_pu_bacteria | 2513237094 | 2513639773 | 171 |
| 85 | iso_pu_bacteria | 2513237095 | 2513647737 | 171 |
| 86 | iso_pu_bacteria | 2513237098 | 2513677549 | 171 |
| 87 | iso_pu_bacteria | 2513237101 | 2513694255 | 171 |
| 88 | iso_pu_bacteria | 2513237102 | 2513699299 | 171 |
| 89 | iso_pu_bacteria | 2513237104 | 2513719838 | 171 |
| 90 | iso_pu_bacteria | 2513237139 | 2513873686 | 171 |
| 91 | iso_pu_bacteria | 2513237141 | 2513888896 | 171 |
| 92 | iso_pu_bacteria | 2513237161 | 2514012329 | 171 |
| 93 | iso_pu_bacteria | 2515154112 | 2515625643 | 171 |
| 94 | iso_pu_bacteria | 2517093001 | 2517102130 | 171 |
| 95 | iso_pu_bacteria | 2524023205 | 2524435946 | 171 |
| 96 | iso_pu_bacteria | 2524023210 | 2524467362 | 171 |
| 97 | iso_pu_bacteria | 2528768022 | 2528852492 | 171 |
| 98 | iso_pu_bacteria | 2602042107 | 2603858652 | 171 |
| 99 | iso_pu_bacteria | 2617270735 | 2617350953 | 171 |
| 100 | iso_pu_bacteria | 2721755755 | 2723841492 | 171 |
| 101 | iso_pu_bacteria | 2744054633 | 2745081542 | 171 |
| 102 | iso_pu_bacteria | 2791355196 | 2793064937 | 171 |
| 103 | iso_pu_bacteria | 2791355199 | 2793079274 | 171 |
| 104 | iso_pu_bacteria | 2802429603 | 2805915769 | 171 |
| 105 | iso_pu_bacteria | 2816332527 | 2818237508 | 171 |
| 106 | iso_pu_bacteria | 2824600985 | 2824608245 | 171 |
| 107 | iso_pu_bacteria | 2824609381 | 2824612181 | 171 |
| 108 | iso_pu_bacteria | 2824617872 | 2824620662 | 171 |
| 109 | iso_pu_bacteria | 2824626560 | 2824629911 | 171 |
| 110 | iso_pu_bacteria | 2824635225 | 2824640567 | 171 |
| 111 | iso_pu_bacteria | 2824644064 | 2824647490 | 171 |
| 112 | iso_pu_bacteria | 2824653114 | 2824655562 | 171 |
| 113 | iso_pu_bacteria | 2824661429 | 2824668992 | 171 |
| 114 | iso_pu_bacteria | 2824671348 | 2824675777 | 171 |
| 115 | iso_pu_bacteria | 2824679649 | 2824683791 | 171 |
| 116 | iso_pu_bacteria | 2824687955 | 2824691899 | 171 |
| 117 | iso_pu_bacteria | 2824696289 | 2824701030 | 171 |
| 118 | iso_pu_bacteria | 2824704595 | 2824711021 | 171 |
| 119 | iso_pu_bacteria | 2824714736 | 2824718270 | 171 |
| 120 | iso_pu_bacteria | 2824723954 | 2824728540 | 171 |
| 121 | iso_pu_bacteria | 2824732956 | 2824736201 | 171 |
| 122 | iso_pu_bacteria | 2824753945 | 2824760393 | 171 |
| 123 | iso_pu_bacteria | 2824763712 | 2824770843 | 171 |
| 124 | iso_pu_bacteria | 2824773399 | 2824775669 | 171 |
| 125 | iso_pu_bacteria | 2838122688 | 2838124353 | 171 |
| 126 | iso_pu_bacteria | 2841941048 | 2841945046 | 171 |
| 127 | iso_pu_bacteria | 2841949485 | 2841951832 | 171 |
| 128 | iso_pu_bacteria | 2841957949 | 2841964768 | 171 |
| 129 | iso_pu_bacteria | 2841966195 | 2841973792 | 171 |
| 130 | iso_pu_bacteria | 2841974524 | 2841980118 | 171 |
| 131 | iso_pu_bacteria | 2841983080 | 2841985301 | 171 |
| 132 | iso_pu_bacteria | 2842038055 | 2842043651 | 171 |
| 133 | iso_pu_bacteria | 2842045827 | 2842052359 | 171 |
| 134 | iso_pu_bacteria | 2844315083 | 2844315146 | 171 |
| 135 | iso_pu_bacteria | 2847930680 | 2847930931 | 171 |
| 136 | iso_pu_bacteria | 2847939898 | 2847941987 | 171 |
| 137 | iso_pu_bacteria | 2849076700 | 2849082895 | 171 |
| 138 | iso_pu_bacteria | 2874590934 | 2874597088 | 171 |
| 139 | iso_pu_bacteria | 2874612657 | 2874616674 | 171 |
| 140 | iso_pu_bacteria | 2874620515 | 2874624639 | 171 |
| 141 | iso_pu_bacteria | 2874628541 | 2874628961 | 171 |
| 142 | iso_pu_bacteria | 2874645413 | 2874648064 | 171 |
| 143 | iso_pu_bacteria | 2876761206 | 2876765591 | 171 |
| 144 | iso_pu_bacteria | 2876771140 | 2876777552 | 171 |
| 145 | iso_pu_bacteria | 2876808645 | 2876813429 | 171 |
| 146 | iso_pu_bacteria | 2876818435 | 2876825634 | 171 |
| 147 | iso_pu_bacteria | 2879074833 | 2879077752 | 171 |
| 148 | iso_pu_bacteria | 2879083081 | 2879089812 | 171 |
| 149 | iso_pu_bacteria | 2879099564 | 2879108720 | 171 |
| 150 | iso_pu_bacteria | 2879110137 | 2879113022 | 171 |
| 151 | iso_pu_bacteria | 2879127579 | 2879130918 | 171 |
| 152 | iso_pu_bacteria | 2879142872 | 2879148847 | 171 |
| 153 | iso_pu_bacteria | 2881364244 | 2881365823 | 171 |
| 154 | iso_pu_bacteria | 2881665667 | 2881665920 | 171 |
| 155 | iso_pu_bacteria | 2885366525 | 2885371185 | 171 |
| 156 | iso_pu_bacteria | 2885383462 | 2885389744 | 171 |
| 157 | iso_pu_bacteria | 2888378607 | 2888379736 | 171 |
| 158 | iso_pu_bacteria | 2888388044 | 2888390823 | 171 |
| 159 | iso_pu_bacteria | 2888419890 | 2888420459 | 171 |
| 160 | iso_pu_bacteria | 2889033259 | 2889035660 | 171 |
| 161 | iso_pu_bacteria | 2903727486 | 2903732047 | 171 |
| 162 | iso_pu_bacteria | 2903768456 | 2903773394 | 171 |
| 163 | iso_pu_bacteria | 2904666416 | 2904670406 | 171 |
| 164 | iso_pu_bacteria | 2904711408 | 2904715732 | 171 |
| 165 | iso_pu_bacteria | 2906602504 | 2906603095 | 171 |
| 166 | iso_pu_bacteria | 2906643746 | 2906648672 | 171 |
| 167 | iso_pu_bacteria | 2908775508 | 2908776082 | 171 |
| 168 | iso_pu_bacteria | 2922361189 | 2922364136 | 171 |
| 169 | iso_pu_bacteria | 2922368715 | 2922368782 | 171 |
| 170 | iso_pu_bacteria | 2922386360 | 2922392712 | 171 |
| 171 | iso_pu_bacteria | 2922393267 | 2922396289 | 171 |
| 172 | iso_pu_bacteria | 2929615660 | 2929618425 | 171 |
| 173 | iso_pu_bacteria | 2929624759 | 2929628890 | 171 |
| 174 | iso_pu_bacteria | 2932784394 | 2932786603 | 171 |
| 175 | iso_pu_bacteria | 2932794094 | 2932794471 | 171 |
| 176 | iso_pu_bacteria | 2932801729 | 2932806752 | 171 |
| 177 | iso_pu_bacteria | 2932809354 | 2932812337 | 171 |
| 178 | iso_pu_bacteria | 2932818245 | 2932823329 | 171 |
| 179 | iso_pu_bacteria | 2932828146 | 2932829831 | 171 |
| 180 | iso_pu_bacteria | 2933577622 | 2933580862 | 171 |
| 181 | iso_pu_bacteria | 2935608549 | 2935615335 | 171 |
| 182 | iso_pu_bacteria | 2935616580 | 2935618349 | 171 |
| 183 | iso_pu_bacteria | 2935638405 | 2935641253 | 171 |
| 184 | iso_pu_bacteria | 2935648319 | 2935654842 | 171 |
| 185 | iso_pu_bacteria | 2935656913 | 2935663725 | 171 |
| 186 | iso_pu_bacteria | 2935665750 | 2935670169 | 171 |
| 187 | iso_pu_bacteria | 2935675223 | 2935680833 | 171 |
| 188 | iso_pu_bacteria | 2935684952 | 2935689851 | 171 |
| 189 | iso_pu_bacteria | 2935694250 | 2935698372 | 171 |
| 190 | iso_pu_bacteria | 2935703347 | 2935707514 | 171 |
| 191 | iso_pu_bacteria | 2935713505 | 2935717371 | 171 |
| 192 | iso_pu_bacteria | 2935722832 | 2935723960 | 171 |
| 193 | iso_pu_bacteria | 2935732158 | 2935740169 | 171 |
| 194 | iso_pu_bacteria | 2935741537 | 2935749432 | 171 |
| 195 | iso_pu_bacteria | 2935750917 | 2935757205 | 171 |
| 196 | iso_pu_bacteria | 2935760218 | 2935763707 | 171 |
| 197 | iso_pu_bacteria | 2935769743 | 2935773399 | 171 |
| 198 | iso_pu_bacteria | 2935777560 | 2935782272 | 171 |
| 199 | iso_pu_bacteria | 2935785616 | 2935789225 | 171 |
| 200 | iso_pu_bacteria | 2935793552 | 2935797162 | 171 |
| 201 | iso_pu_bacteria | 2935801545 | 2935804108 | 171 |
| 202 | iso_pu_bacteria | 2935810662 | 2935815192 | 171 |
| 203 | iso_pu_bacteria | 2935819856 | 2935825287 | 171 |
| 204 | iso_pu_bacteria | 2935827899 | 2935830984 | 171 |
| 205 | iso_pu_bacteria | 2935837841 | 2935841595 | 171 |
| 206 | iso_pu_bacteria | 2935847175 | 2935853121 | 171 |
| 207 | iso_pu_bacteria | 2935855204 | 2935862556 | 171 |
| 208 | iso_pu_bacteria | 2935864058 | 2935866516 | 171 |
| 209 | iso_pu_bacteria | 2935873716 | 2935874823 | 171 |
| 210 | iso_pu_bacteria | 2935883170 | 2935888523 | 171 |
| 211 | iso_pu_bacteria | 2935908558 | 2935910131 | 171 |
| 212 | iso_pu_bacteria | 2935916978 | 2935918572 | 171 |
| 213 | iso_pu_bacteria | 2935926038 | 2935927958 | 171 |
| 214 | iso_pu_bacteria | 2935934488 | 2935936170 | 171 |
| 215 | iso_pu_bacteria | 2935942939 | 2935944277 | 171 |
| 216 | iso_pu_bacteria | 2935951376 | 2935952714 | 171 |
| 217 | iso_pu_bacteria | 2935959822 | 2935962493 | 171 |
| 218 | iso_pu_bacteria | 2935967501 | 2935969554 | 171 |
| 219 | iso_pu_bacteria | 2935975950 | 2935977685 | 171 |
| 220 | iso_pu_bacteria | 2935984226 | 2935984999 | 171 |
| 221 | iso_pu_bacteria | 2935992306 | 2935994329 | 171 |
| 222 | iso_pu_bacteria | 2936002035 | 2936004693 | 171 |
| 223 | iso_pu_bacteria | 2936011229 | 2936017878 | 171 |
| 224 | iso_pu_bacteria | 2936019824 | 2936026381 | 171 |
| 225 | iso_pu_bacteria | 2936028420 | 2936031571 | 171 |
| 226 | iso_pu_bacteria | 2936037263 | 2936043259 | 171 |
| 227 | iso_pu_bacteria | 2936046547 | 2936053357 | 171 |
| 228 | iso_pu_bacteria | 2936055302 | 2936056168 | 171 |
| 229 | iso_pu_bacteria | 2940556831 | 2940563119 | 171 |
| 230 | iso_pu_bacteria | 2941531003 | 2941532542 | 171 |
| 231 | iso_pu_bacteria | 2941538514 | 2941543035 | 171 |
| 232 | iso_pu_bacteria | 3005483717 | 3005486755 | 171 |
| 233 | iso_pu_bacteria | 3005506211 | 3005509327 | 171 |
| 234 | iso_pu_bacteria | 3005587118 | 3005594054 | 171 |
| 235 | iso_pu_bacteria | 3005594810 | 3005594870 | 171 |
| 236 | iso_pu_bacteria | 3005710791 | 3005710852 | 171 |
| 237 | iso_pu_bacteria | 3005718088 | 3005718148 | 171 |
| 238 | iso_pu_bacteria | 8006964411 | 8006969481 | 171 |
| 239 | iso_pu_bacteria | 8006984368 | 8006990775 | 171 |
| 240 | iso_pu_bacteria | 8006994254 | 8006996735 | 171 |
| 241 | iso_pu_bacteria | 8016511872 | 8016518367 | 171 |
| 242 | iso_pu_bacteria | 8016522445 | 8016525987 | 171 |
| 243 | iso_pu_bacteria | 8016530956 | 8016539590 | 171 |
| 244 | iso_pu_bacteria | 8016539877 | 8016543887 | 171 |
| 245 | iso_pu_bacteria | 8016548790 | 8016549417 | 171 |
| 246 | iso_pu_bacteria | 8016557553 | 8016557840 | 171 |
| 247 | iso_pu_bacteria | 8016575299 | 8016581917 | 171 |
| 248 | iso_pu_bacteria | 8016583857 | 8016586536 | 171 |
| 249 | iso_pu_bacteria | 8016595262 | 8016595859 | 171 |
| 250 | iso_pu_bacteria | 8016603502 | 8016606724 | 171 |
| 251 | iso_pu_bacteria | 8016613128 | 8016618624 | 171 |
| 252 | iso_pu_bacteria | 8016622563 | 8016623370 | 171 |
| 253 | iso_pu_bacteria | 8016630954 | 8016635828 | 171 |
| 254 | iso_pu_bacteria | 8017057580 | 8017058293 | 171 |
| 255 | iso_pu_bacteria | 8019530166 | 8019530871 | 171 |
| 256 | iso_pu_bacteria | 8019547302 | 8019550391 | 171 |
| 257 | iso_pu_bacteria | 8019576017 | 8019577416 | 171 |
| 258 | iso_pu_bacteria | 8019586578 | 8019595507 | 171 |
| 259 | iso_pu_bacteria | 8019597564 | 8019606256 | 171 |
| 260 | iso_pu_bacteria | 8019608314 | 8019612274 | 171 |
| 261 | iso_pu_bacteria | 8019619141 | 8019622808 | 171 |
| 262 | iso_pu_bacteria | 8019638758 | 8019640308 | 171 |
| 263 | iso_pu_bacteria | 8019648815 | 8019652637 | 171 |
| 264 | iso_pu_bacteria | 8019668869 | 8019676916 | 171 |
| 265 | iso_pu_bacteria | 8019678201 | 8019679074 | 171 |
| 266 | iso_pu_bacteria | 8019687851 | 8019696452 | 171 |
| 267 | iso_pu_bacteria | 8055742211 | 8055742276 | 171 |
| 268 | iso_pu_bacteria | 8056673599 | 8056675591 | 171 |
| 269 | iso_pu_bacteria | 8056681323 | 8056687539 | 171 |
| 270 | iso_pu_bacteria | 8056967851 | 8056971130 | 171 |
| 271 | 3300005467 | Ga0070706_100552791 | Ga0070706_1005527911 | 172 |
| 272 | 3300005471 | Ga0070698_100128362 | Ga0070698_1001283623 | 172 |
| 273 | 3300053080 | Ga0500635_0014644 | Ga0500635_0014644_1185_1703 | 172 |
| 274 | 3300053094 | Ga0500566_0000054 | Ga0500566_0000054_25640_26158 | 172 |
| 275 | 3300053095 | Ga0500640_024388 | Ga0500640_024388_1421_1939 | 172 |
| 276 | 3300053111 | Ga0500572_047110 | Ga0500572_047110_141_659 | 172 |
| 277 | 3300053115 | Ga0500591_086602 | Ga0500591_086602_441_959 | 172 |
| 278 | 3300053122 | Ga0500608_130969 | Ga0500608_130969_380_898 | 172 |
| 279 | 3300053123 | Ga0500614_008371 | Ga0500614_008371_42_560 | 172 |
| 280 | 3300053163 | Ga0500639_005653 | Ga0500639_005653_358_876 | 172 |
| 281 | 3300053735 | Ga0500596_006628 | Ga0500596_006628_884_1402 | 172 |
| 282 | iso_pu_bacteria | 2513237137 | 2513863563 | 172 |
| 283 | iso_pu_bacteria | 2524023228 | 2524538778 | 172 |
| 284 | iso_pu_bacteria | 2904690495 | 2904690653 | 172 |
| 285 | iso_pu_bacteria | 2904699407 | 2904708896 | 172 |
| 286 | iso_pu_bacteria | 2906635258 | 2906637383 | 172 |
| 287 | iso_pu_bacteria | 2906660503 | 2906668213 | 172 |
| 288 | iso_pu_bacteria | 2908756301 | 2908756357 | 172 |
| 289 | iso_pu_bacteria | 8006933436 | 8006936418 | 172 |
| 290 | iso_pu_bacteria | 8006973647 | 8006976388 | 172 |
| 291 | 3300001989 | JGI24739J22299_10000950 | JGI24739J22299_100009503 | 173 |
| 292 | 3300001990 | JGI24737J22298_10003390 | JGI24737J22298_100033906 | 173 |
| 293 | 3300002067 | JGI24735J21928_10007692 | JGI24735J21928_100076923 | 173 |
| 294 | 3300005339 | Ga0070660_100581880 | Ga0070660_1005818801 | 173 |
| 295 | 3300005437 | Ga0070710_10195934 | Ga0070710_101959342 | 173 |
| 296 | 3300005455 | Ga0070663_100219999 | Ga0070663_1002199991 | 173 |
| 297 | 3300005455 | Ga0070663_100335763 | Ga0070663_1003357632 | 173 |
| 298 | 3300005457 | Ga0070662_100040180 | Ga0070662_1000401804 | 173 |
| 299 | 3300005539 | Ga0068853_100063111 | Ga0068853_1000631113 | 173 |
| 300 | 3300005539 | Ga0068853_100307623 | Ga0068853_1003076233 | 173 |
| 301 | 3300005563 | Ga0068855_100266223 | Ga0068855_1002662231 | 173 |
| 302 | 3300005577 | Ga0068857_100002988 | Ga0068857_1000029882 | 173 |
| 303 | 3300005577 | Ga0068857_100008016 | Ga0068857_1000080165 | 173 |
| 304 | 3300005578 | Ga0068854_100000689 | Ga0068854_1000006895 | 173 |
| 305 | 3300005614 | Ga0068856_100091417 | Ga0068856_1000914173 | 173 |
| 306 | 3300005614 | Ga0068856_100150365 | Ga0068856_1001503653 | 173 |
| 307 | 3300005616 | Ga0068852_100052928 | Ga0068852_1000529282 | 173 |
| 308 | 3300005834 | Ga0068851_10003958 | Ga0068851_100039582 | 173 |
| 309 | 3300009093 | Ga0105240_10007562 | Ga0105240_100075625 | 173 |
| 310 | 3300009093 | Ga0105240_10032680 | Ga0105240_100326805 | 173 |
| 311 | 3300009174 | Ga0105241_10002823 | Ga0105241_100028233 | 173 |
| 312 | 3300009545 | Ga0105237_10154404 | Ga0105237_101544043 | 173 |
| 313 | 3300009551 | Ga0105238_10003292 | Ga0105238_100032928 | 173 |
| 314 | 3300010375 | Ga0105239_10008866 | Ga0105239_100088662 | 173 |
| 315 | 3300010375 | Ga0105239_10011356 | Ga0105239_100113563 | 173 |
| 316 | 3300025295 | Ga0209564_1000747 | Ga0209564_100074735 | 173 |
| 317 | 3300025321 | Ga0207656_10009014 | Ga0207656_100090142 | 173 |
| 318 | 3300025904 | Ga0207647_10006453 | Ga0207647_100064532 | 173 |
| 319 | 3300025911 | Ga0207654_10000250 | Ga0207654_1000025024 | 173 |
| 320 | 3300025913 | Ga0207695_10000479 | Ga0207695_1000047924 | 173 |
| 321 | 3300025913 | Ga0207695_10001357 | Ga0207695_100013578 | 173 |
| 322 | 3300025913 | Ga0207695_10005090 | Ga0207695_100050907 | 173 |
| 323 | 3300025914 | Ga0207671_10041272 | Ga0207671_100412724 | 173 |
| 324 | 3300025914 | Ga0207671_10094823 | Ga0207671_100948232 | 173 |
| 325 | 3300025919 | Ga0207657_10365074 | Ga0207657_103650742 | 173 |
| 326 | 3300025924 | Ga0207694_10000662 | Ga0207694_1000066224 | 173 |
| 327 | 3300025924 | Ga0207694_10016406 | Ga0207694_100164062 | 173 |
| 328 | 3300025933 | Ga0207706_10031400 | Ga0207706_100314002 | 173 |
| 329 | 3300025949 | Ga0207667_10004639 | Ga0207667_100046391 | 173 |
| 330 | 3300025949 | Ga0207667_10006730 | Ga0207667_100067305 | 173 |
| 331 | 3300025981 | Ga0207640_10002370 | Ga0207640_100023704 | 173 |
| 332 | 3300025981 | Ga0207640_10236314 | Ga0207640_102363141 | 173 |
| 333 | 3300026041 | Ga0207639_10011004 | Ga0207639_100110047 | 173 |
| 334 | 3300026041 | Ga0207639_10269308 | Ga0207639_102693082 | 173 |
| 335 | 3300026067 | Ga0207678_10034302 | Ga0207678_100343024 | 173 |
| 336 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004355 | 173 |
| 337 | 3300026078 | Ga0207702_10127898 | Ga0207702_101278983 | 173 |
| 338 | 3300026116 | Ga0207674_10002413 | Ga0207674_1000241310 | 173 |
| 339 | 3300026116 | Ga0207674_10003431 | Ga0207674_100034318 | 173 |
| 340 | 3300044684 | Ga0466966_0034745 | Ga0466966_0034745_2596_3117 | 173 |
| 341 | 3300046462 | Ga0495651_0037559 | Ga0495651_0037559_3016_3537 | 173 |
| 342 | 3300046511 | Ga0495608_0496713 | Ga0495608_0496713_196_717 | 173 |
| 343 | 3300046679 | Ga0495623_0197848 | Ga0495623_0197848_47_568 | 173 |
| 344 | 3300047320 | Ga0495672_0014389 | Ga0495672_0014389_1144_1671 | 173 |
| 345 | 3300047320 | Ga0495672_0371852 | Ga0495672_0371852_37_564 | 173 |
| 346 | 3300048088 | Ga0495602_0409516 | Ga0495602_0409516_181_702 | 173 |
| 347 | 3300048909 | Ga0496106_0500551 | Ga0496106_0500551_24_596 | 173 |
| 348 | 3300048911 | Ga0496108_0293029 | Ga0496108_0293029_64_636 | 173 |
| 349 | 3300048912 | Ga0496109_0321310 | Ga0496109_0321310_624_1196 | 173 |
| 350 | 3300048915 | Ga0496112_0067611 | Ga0496112_0067611_1329_1901 | 173 |
| 351 | 3300048916 | Ga0496113_0835532 | Ga0496113_0835532_104_676 | 173 |
| 352 | 3300048925 | Ga0496122_0108994 | Ga0496122_0108994_1182_1706 | 173 |
| 353 | 3300048926 | Ga0496123_0250282 | Ga0496123_0250282_14_562 | 173 |
| 354 | 3300048927 | Ga0496124_0370637 | Ga0496124_0370637_24_572 | 173 |
| 355 | 3300048929 | Ga0496126_0887244 | Ga0496126_0887244_97_621 | 173 |
| 356 | 3300003659 | JGI25404J52841_10003238 | JGI25404J52841_100032383 | 174 |
| 357 | 3300005437 | Ga0070710_10000872 | Ga0070710_100008724 | 174 |
| 358 | 3300005439 | Ga0070711_100750453 | Ga0070711_1007504531 | 174 |
| 359 | 3300005539 | Ga0068853_100135559 | Ga0068853_1001355592 | 174 |
| 360 | 3300005614 | Ga0068856_100723432 | Ga0068856_1007234322 | 174 |
| 361 | 3300005843 | Ga0068860_100001623 | Ga0068860_10000162315 | 174 |
| 362 | 3300005981 | Ga0081538_10081593 | Ga0081538_100815932 | 174 |
| 363 | 3300005983 | Ga0081540_1004657 | Ga0081540_100465710 | 174 |
| 364 | 3300006028 | Ga0070717_10051071 | Ga0070717_100510712 | 174 |
| 365 | 3300006028 | Ga0070717_10062343 | Ga0070717_100623432 | 174 |
| 366 | 3300006028 | Ga0070717_10251791 | Ga0070717_102517911 | 174 |
| 367 | 3300006163 | Ga0070715_10001222 | Ga0070715_100012223 | 174 |
| 368 | 3300006173 | Ga0070716_100023433 | Ga0070716_1000234333 | 174 |
| 369 | 3300006175 | Ga0070712_100079979 | Ga0070712_1000799792 | 174 |
| 370 | 3300006941 | Ga0099825_1039686 | Ga0099825_10396862 | 174 |
| 371 | 3300006942 | Ga0099824_1004995 | Ga0099824_10049958 | 174 |
| 372 | 3300006943 | Ga0099822_1001207 | Ga0099822_100120715 | 174 |
| 373 | 3300007788 | Ga0099795_10141756 | Ga0099795_101417562 | 174 |
| 374 | 3300009551 | Ga0105238_10063611 | Ga0105238_100636114 | 174 |
| 375 | 3300009551 | Ga0105238_10443881 | Ga0105238_104438811 | 174 |
| 376 | 3300010375 | Ga0105239_10924833 | Ga0105239_109248331 | 174 |
| 377 | 3300013296 | Ga0157374_10232907 | Ga0157374_102329072 | 174 |
| 378 | 3300013306 | Ga0163162_10776997 | Ga0163162_107769972 | 174 |
| 379 | 3300014325 | Ga0163163_11378748 | Ga0163163_113787481 | 174 |
| 380 | 3300021377 | Ga0213874_10003476 | Ga0213874_100034764 | 174 |
| 381 | 3300025261 | Ga0209233_1002747 | Ga0209233_10027474 | 174 |
| 382 | 3300025297 | Ga0209758_1011615 | Ga0209758_10116152 | 174 |
| 383 | 3300025898 | Ga0207692_10010103 | Ga0207692_100101032 | 174 |
| 384 | 3300025905 | Ga0207685_10026807 | Ga0207685_100268073 | 174 |
| 385 | 3300025906 | Ga0207699_10017718 | Ga0207699_100177181 | 174 |
| 386 | 3300025915 | Ga0207693_10000156 | Ga0207693_1000015631 | 174 |
| 387 | 3300025916 | Ga0207663_10000158 | Ga0207663_100001587 | 174 |
| 388 | 3300025916 | Ga0207663_10366692 | Ga0207663_103666921 | 174 |
| 389 | 3300025924 | Ga0207694_10055826 | Ga0207694_100558263 | 174 |
| 390 | 3300025928 | Ga0207700_10608878 | Ga0207700_106088781 | 174 |
| 391 | 3300025929 | Ga0207664_10023882 | Ga0207664_100238821 | 174 |
| 392 | 3300025929 | Ga0207664_10066338 | Ga0207664_100663382 | 174 |
| 393 | 3300025931 | Ga0207644_10901776 | Ga0207644_109017761 | 174 |
| 394 | 3300025939 | Ga0207665_10000767 | Ga0207665_1000076714 | 174 |
| 395 | 3300025949 | Ga0207667_10233206 | Ga0207667_102332062 | 174 |
| 396 | 3300025949 | Ga0207667_10707297 | Ga0207667_107072971 | 174 |
| 397 | 3300025961 | Ga0207712_10281049 | Ga0207712_102810491 | 174 |
| 398 | 3300026041 | Ga0207639_10181850 | Ga0207639_101818502 | 174 |
| 399 | 3300026078 | Ga0207702_10625072 | Ga0207702_106250721 | 174 |
| 400 | 3300027357 | Ga0209589_1000046 | Ga0209589_100004679 | 174 |
| 401 | 3300027361 | Ga0209489_100106 | Ga0209489_10010679 | 174 |
| 402 | 3300027363 | Ga0209700_100105 | Ga0209700_10010579 | 174 |
| 403 | 3300028379 | Ga0268266_10459317 | Ga0268266_104593172 | 174 |
| 404 | 3300028381 | Ga0268264_10000227 | Ga0268264_100002278 | 174 |
| 405 | 3300028786 | Ga0307517_10000748 | Ga0307517_1000074844 | 174 |
| 406 | 3300028794 | Ga0307515_10033584 | Ga0307515_100335848 | 174 |
| 407 | 3300031090 | Ga0265760_10043486 | Ga0265760_100434862 | 174 |
| 408 | 3300031249 | Ga0265339_10154419 | Ga0265339_101544192 | 174 |
| 409 | 3300031456 | Ga0307513_10411605 | Ga0307513_104116052 | 174 |
| 410 | 3300031712 | Ga0265342_10296689 | Ga0265342_102966891 | 174 |
| 411 | 3300031731 | Ga0307405_10524171 | Ga0307405_105241711 | 174 |
| 412 | 3300031901 | Ga0307406_10300621 | Ga0307406_103006212 | 174 |
| 413 | 3300035724 | Ga0373933_0000698 | Ga0373933_0000698_6235_6759 | 174 |
| 414 | 3300037466 | Ga0395898_0293021 | Ga0395898_0293021_712_1236 | 174 |
| 415 | 3300039437 | Ga0436365_0852398 | Ga0436365_0852398_932_1456 | 174 |
| 416 | 3300039437 | Ga0436365_1677482 | Ga0436365_1677482_915_1439 | 174 |
| 417 | 3300039437 | Ga0436365_1928398 | Ga0436365_1928398_1263_1787 | 174 |
| 418 | 3300039450 | Ga0436363_1333239 | Ga0436363_1333239_99_623 | 174 |
| 419 | 3300045976 | Ga0466967_0041810 | Ga0466967_0041810_3032_3556 | 174 |
| 420 | 3300046460 | Ga0495638_0268296 | Ga0495638_0268296_35_559 | 174 |
| 421 | 3300046491 | Ga0495584_0129400 | Ga0495584_0129400_229_753 | 174 |
| 422 | 3300046506 | Ga0495583_0153022 | Ga0495583_0153022_369_893 | 174 |
| 423 | 3300046519 | Ga0495632_0361282 | Ga0495632_0361282_80_604 | 174 |
| 424 | 3300046524 | Ga0495648_0020469 | Ga0495648_0020469_3266_3793 | 174 |
| 425 | 3300046616 | Ga0495668_0086722 | Ga0495668_0086722_70_594 | 174 |
| 426 | 3300047470 | Ga0495681_0081383 | Ga0495681_0081383_73_597 | 174 |
| 427 | 3300048911 | Ga0496108_0974966 | Ga0496108_0974966_10_534 | 174 |
| 428 | 3300048915 | Ga0496112_0230887 | Ga0496112_0230887_1191_1715 | 174 |
| 429 | 3300048917 | Ga0496114_0104240 | Ga0496114_0104240_1508_2080 | 174 |
| 430 | 3300048918 | Ga0496115_0009727 | Ga0496115_0009727_3506_4078 | 174 |
| 431 | 3300048918 | Ga0496115_0158782 | Ga0496115_0158782_870_1394 | 174 |
| 432 | 3300048921 | Ga0496118_0137032 | Ga0496118_0137032_304_828 | 174 |
| 433 | 3300048921 | Ga0496118_0287439 | Ga0496118_0287439_276_800 | 174 |
| 434 | 3300048924 | Ga0496121_0088411 | Ga0496121_0088411_1830_2357 | 174 |
| 435 | 3300048929 | Ga0496126_0018058 | Ga0496126_0018058_341_865 | 174 |
| 436 | 3300049460 | Ga0495682_0118667 | Ga0495682_0118667_308_832 | 174 |
| 437 | 3300049571 | Ga0501034_0149277 | Ga0501034_0149277_824_1351 | 174 |
| 438 | 3300049583 | Ga0501067_0293368 | Ga0501067_0293368_243_767 | 174 |
| 439 | 3300049593 | Ga0501077_0045897 | Ga0501077_0045897_1750_2277 | 174 |
| 440 | 3300049822 | Ga0501035_0344564 | Ga0501035_0344564_549_1076 | 174 |
| 441 | 3300050494 | nmdc:mga06z11_604492_c1 | nmdc:mga06z11_604492_c1_11_535 | 174 |
| 442 | 3300053088 | Ga0500644_0030836 | Ga0500644_0030836_456_980 | 174 |
| 443 | 3300053093 | Ga0500651_0041180 | Ga0500651_0041180_1870_2394 | 174 |
| 444 | 3300053098 | Ga0500650_0144159 | Ga0500650_0144159_538_1062 | 174 |
| 445 | 3300053118 | Ga0500594_0002633 | Ga0500594_0002633_2085_2609 | 174 |
| 446 | 3300053119 | Ga0500595_038392 | Ga0500595_038392_193_717 | 174 |
| 447 | 3300053125 | Ga0500618_014579 | Ga0500618_014579_364_900 | 174 |
| 448 | 3300053130 | Ga0500642_0039763 | Ga0500642_0039763_1241_1765 | 174 |
| 449 | 3300053136 | Ga0500559_0028894 | Ga0500559_0028894_1214_1750 | 174 |
| 450 | 3300053139 | Ga0500568_0052897 | Ga0500568_0052897_281_805 | 174 |
| 451 | 3300053142 | Ga0500577_0001673 | Ga0500577_0001673_3876_4412 | 174 |
| 452 | 3300053142 | Ga0500577_0102862 | Ga0500577_0102862_183_707 | 174 |
| 453 | 3300053177 | Ga0500636_0042723 | Ga0500636_0042723_1418_1945 | 174 |
| 454 | 3300053724 | Ga0500570_048356 | Ga0500570_048356_85_609 | 174 |
| 455 | 3300000549 | LJQas_1003115 | LJQas_10031151 | 175 |
| 456 | 3300002070 | JGI24750J21931_1011487 | JGI24750J21931_10114871 | 175 |
| 457 | 3300002075 | JGI24738J21930_10006447 | JGI24738J21930_100064471 | 175 |
| 458 | 3300002244 | JGI24742J22300_10006916 | JGI24742J22300_100069162 | 175 |
| 459 | 3300003203 | JGI25406J46586_10000015 | JGI25406J46586_1000001524 | 175 |
| 460 | 3300003203 | JGI25406J46586_10013868 | JGI25406J46586_100138683 | 175 |
| 461 | 3300003214 | JGI25165J46597_1006926 | JGI25165J46597_10069262 | 175 |
| 462 | 3300003215 | JGI25153J46596_10004444 | JGI25153J46596_100044444 | 175 |
| 463 | 3300003215 | JGI25153J46596_10016721 | JGI25153J46596_100167212 | 175 |
| 464 | 3300003215 | JGI25153J46596_10018333 | JGI25153J46596_100183334 | 175 |
| 465 | 3300003215 | JGI25153J46596_10046570 | JGI25153J46596_100465701 | 175 |
| 466 | 3300003354 | JGI25160J50197_1006880 | JGI25160J50197_10068804 | 175 |
| 467 | 3300003659 | JGI25404J52841_10011196 | JGI25404J52841_100111962 | 175 |
| 468 | 3300003752 | Ga0055539_1008601 | Ga0055539_10086011 | 175 |
| 469 | 3300003763 | Ga0055529_1010850 | Ga0055529_10108503 | 175 |
| 470 | 3300003763 | Ga0055529_1013822 | Ga0055529_10138222 | 175 |
| 471 | 3300003771 | Ga0055526_1044030 | Ga0055526_10440302 | 175 |
| 472 | 3300004625 | Ga0055543_1003105 | Ga0055543_10031052 | 175 |
| 473 | 3300005262 | Ga0065165_1001886 | Ga0065165_10018863 | 175 |
| 474 | 3300005262 | Ga0065165_1041874 | Ga0065165_10418742 | 175 |
| 475 | 3300005295 | Ga0065707_10017090 | Ga0065707_100170901 | 175 |
| 476 | 3300005327 | Ga0070658_10116952 | Ga0070658_101169522 | 175 |
| 477 | 3300005328 | Ga0070676_10158273 | Ga0070676_101582732 | 175 |
| 478 | 3300005328 | Ga0070676_10360655 | Ga0070676_103606551 | 175 |
| 479 | 3300005329 | Ga0070683_100299149 | Ga0070683_1002991491 | 175 |
| 480 | 3300005329 | Ga0070683_100894143 | Ga0070683_1008941431 | 175 |
| 481 | 3300005330 | Ga0070690_100292355 | Ga0070690_1002923552 | 175 |
| 482 | 3300005330 | Ga0070690_100505583 | Ga0070690_1005055832 | 175 |
| 483 | 3300005331 | Ga0070670_100240073 | Ga0070670_1002400731 | 175 |
| 484 | 3300005334 | Ga0068869_100160569 | Ga0068869_1001605692 | 175 |
| 485 | 3300005334 | Ga0068869_100168960 | Ga0068869_1001689602 | 175 |
| 486 | 3300005336 | Ga0070680_100009352 | Ga0070680_1000093526 | 175 |
| 487 | 3300005336 | Ga0070680_100109995 | Ga0070680_1001099951 | 175 |
| 488 | 3300005336 | Ga0070680_100123724 | Ga0070680_1001237243 | 175 |
| 489 | 3300005337 | Ga0070682_100289367 | Ga0070682_1002893672 | 175 |
| 490 | 3300005337 | Ga0070682_100594443 | Ga0070682_1005944431 | 175 |
| 491 | 3300005338 | Ga0068868_101049560 | Ga0068868_1010495601 | 175 |
| 492 | 3300005338 | Ga0068868_101102029 | Ga0068868_1011020291 | 175 |
| 493 | 3300005339 | Ga0070660_100018794 | Ga0070660_1000187944 | 175 |
| 494 | 3300005339 | Ga0070660_100173282 | Ga0070660_1001732821 | 175 |
| 495 | 3300005339 | Ga0070660_100351557 | Ga0070660_1003515571 | 175 |
| 496 | 3300005339 | Ga0070660_100707779 | Ga0070660_1007077791 | 175 |
| 497 | 3300005340 | Ga0070689_100539710 | Ga0070689_1005397101 | 175 |
| 498 | 3300005341 | Ga0070691_10005991 | Ga0070691_100059913 | 175 |
| 499 | 3300005341 | Ga0070691_10409577 | Ga0070691_104095771 | 175 |
| 500 | 3300005343 | Ga0070687_100643881 | Ga0070687_1006438811 | 175 |
| 501 | 3300005344 | Ga0070661_100209415 | Ga0070661_1002094151 | 175 |
| 502 | 3300005344 | Ga0070661_100322031 | Ga0070661_1003220312 | 175 |
| 503 | 3300005344 | Ga0070661_100486758 | Ga0070661_1004867582 | 175 |
| 504 | 3300005345 | Ga0070692_10173375 | Ga0070692_101733752 | 175 |
| 505 | 3300005347 | Ga0070668_100012224 | Ga0070668_1000122242 | 175 |
| 506 | 3300005347 | Ga0070668_100074858 | Ga0070668_1000748583 | 175 |
| 507 | 3300005347 | Ga0070668_100122443 | Ga0070668_1001224431 | 175 |
| 508 | 3300005347 | Ga0070668_100246887 | Ga0070668_1002468872 | 175 |
| 509 | 3300005347 | Ga0070668_100262224 | Ga0070668_1002622242 | 175 |
| 510 | 3300005347 | Ga0070668_100302191 | Ga0070668_1003021912 | 175 |
| 511 | 3300005347 | Ga0070668_100348033 | Ga0070668_1003480331 | 175 |
| 512 | 3300005353 | Ga0070669_100099323 | Ga0070669_1000993231 | 175 |
| 513 | 3300005353 | Ga0070669_100136605 | Ga0070669_1001366051 | 175 |
| 514 | 3300005353 | Ga0070669_100188041 | Ga0070669_1001880412 | 175 |
| 515 | 3300005353 | Ga0070669_100440211 | Ga0070669_1004402111 | 175 |
| 516 | 3300005354 | Ga0070675_100554306 | Ga0070675_1005543062 | 175 |
| 517 | 3300005355 | Ga0070671_100096306 | Ga0070671_1000963061 | 175 |
| 518 | 3300005355 | Ga0070671_100737593 | Ga0070671_1007375931 | 175 |
| 519 | 3300005356 | Ga0070674_100087142 | Ga0070674_1000871423 | 175 |
| 520 | 3300005356 | Ga0070674_100155154 | Ga0070674_1001551542 | 175 |
| 521 | 3300005356 | Ga0070674_101303673 | Ga0070674_1013036731 | 175 |
| 522 | 3300005364 | Ga0070673_100358039 | Ga0070673_1003580391 | 175 |
| 523 | 3300005365 | Ga0070688_100222632 | Ga0070688_1002226321 | 175 |
| 524 | 3300005366 | Ga0070659_100069607 | Ga0070659_1000696072 | 175 |
| 525 | 3300005366 | Ga0070659_100986191 | Ga0070659_1009861911 | 175 |
| 526 | 3300005367 | Ga0070667_100229055 | Ga0070667_1002290551 | 175 |
| 527 | 3300005434 | Ga0070709_10002011 | Ga0070709_100020116 | 175 |
| 528 | 3300005434 | Ga0070709_10057722 | Ga0070709_100577222 | 175 |
| 529 | 3300005434 | Ga0070709_10539826 | Ga0070709_105398261 | 175 |
| 530 | 3300005435 | Ga0070714_100073637 | Ga0070714_1000736372 | 175 |
| 531 | 3300005435 | Ga0070714_100171751 | Ga0070714_1001717512 | 175 |
| 532 | 3300005435 | Ga0070714_100422521 | Ga0070714_1004225211 | 175 |
| 533 | 3300005436 | Ga0070713_100041608 | Ga0070713_1000416085 | 175 |
| 534 | 3300005436 | Ga0070713_100078712 | Ga0070713_1000787122 | 175 |
| 535 | 3300005436 | Ga0070713_100119880 | Ga0070713_1001198802 | 175 |
| 536 | 3300005436 | Ga0070713_100264896 | Ga0070713_1002648962 | 175 |
| 537 | 3300005436 | Ga0070713_100267066 | Ga0070713_1002670661 | 175 |
| 538 | 3300005436 | Ga0070713_100322207 | Ga0070713_1003222071 | 175 |
| 539 | 3300005437 | Ga0070710_10013092 | Ga0070710_100130924 | 175 |
| 540 | 3300005437 | Ga0070710_10028873 | Ga0070710_100288733 | 175 |
| 541 | 3300005437 | Ga0070710_10320347 | Ga0070710_103203471 | 175 |
| 542 | 3300005437 | Ga0070710_10504055 | Ga0070710_105040551 | 175 |
| 543 | 3300005437 | Ga0070710_10539740 | Ga0070710_105397401 | 175 |
| 544 | 3300005439 | Ga0070711_100008236 | Ga0070711_1000082363 | 175 |
| 545 | 3300005439 | Ga0070711_100043404 | Ga0070711_1000434043 | 175 |
| 546 | 3300005439 | Ga0070711_100090510 | Ga0070711_1000905101 | 175 |
| 547 | 3300005439 | Ga0070711_100122058 | Ga0070711_1001220582 | 175 |
| 548 | 3300005439 | Ga0070711_100187446 | Ga0070711_1001874461 | 175 |
| 549 | 3300005439 | Ga0070711_100559012 | Ga0070711_1005590121 | 175 |
| 550 | 3300005441 | Ga0070700_100537694 | Ga0070700_1005376941 | 175 |
| 551 | 3300005455 | Ga0070663_100013673 | Ga0070663_1000136735 | 175 |
| 552 | 3300005455 | Ga0070663_100018768 | Ga0070663_1000187681 | 175 |
| 553 | 3300005455 | Ga0070663_100023522 | Ga0070663_1000235222 | 175 |
| 554 | 3300005455 | Ga0070663_100077368 | Ga0070663_1000773682 | 175 |
| 555 | 3300005455 | Ga0070663_100092535 | Ga0070663_1000925352 | 175 |
| 556 | 3300005455 | Ga0070663_100204298 | Ga0070663_1002042981 | 175 |
| 557 | 3300005455 | Ga0070663_100467154 | Ga0070663_1004671541 | 175 |
| 558 | 3300005455 | Ga0070663_100640712 | Ga0070663_1006407121 | 175 |
| 559 | 3300005456 | Ga0070678_100043263 | Ga0070678_1000432631 | 175 |
| 560 | 3300005456 | Ga0070678_100108302 | Ga0070678_1001083022 | 175 |
| 561 | 3300005456 | Ga0070678_100178862 | Ga0070678_1001788622 | 175 |
| 562 | 3300005457 | Ga0070662_100183100 | Ga0070662_1001831002 | 175 |
| 563 | 3300005457 | Ga0070662_100528446 | Ga0070662_1005284461 | 175 |
| 564 | 3300005457 | Ga0070662_100708822 | Ga0070662_1007088221 | 175 |
| 565 | 3300005457 | Ga0070662_100882379 | Ga0070662_1008823791 | 175 |
| 566 | 3300005457 | Ga0070662_101163248 | Ga0070662_1011632481 | 175 |
| 567 | 3300005458 | Ga0070681_10013547 | Ga0070681_100135471 | 175 |
| 568 | 3300005458 | Ga0070681_10072747 | Ga0070681_100727475 | 175 |
| 569 | 3300005458 | Ga0070681_10276518 | Ga0070681_102765182 | 175 |
| 570 | 3300005458 | Ga0070681_10450146 | Ga0070681_104501462 | 175 |
| 571 | 3300005459 | Ga0068867_100083306 | Ga0068867_1000833063 | 175 |
| 572 | 3300005459 | Ga0068867_100810829 | Ga0068867_1008108291 | 175 |
| 573 | 3300005466 | Ga0070685_10162228 | Ga0070685_101622282 | 175 |
| 574 | 3300005467 | Ga0070706_100224878 | Ga0070706_1002248783 | 175 |
| 575 | 3300005471 | Ga0070698_100569266 | Ga0070698_1005692661 | 175 |
| 576 | 3300005518 | Ga0070699_100131436 | Ga0070699_1001314361 | 175 |
| 577 | 3300005530 | Ga0070679_100041775 | Ga0070679_1000417753 | 175 |
| 578 | 3300005530 | Ga0070679_100206683 | Ga0070679_1002066832 | 175 |
| 579 | 3300005530 | Ga0070679_100220342 | Ga0070679_1002203421 | 175 |
| 580 | 3300005530 | Ga0070679_100246654 | Ga0070679_1002466543 | 175 |
| 581 | 3300005530 | Ga0070679_100346124 | Ga0070679_1003461242 | 175 |
| 582 | 3300005530 | Ga0070679_100433466 | Ga0070679_1004334661 | 175 |
| 583 | 3300005535 | Ga0070684_100066098 | Ga0070684_1000660983 | 175 |
| 584 | 3300005535 | Ga0070684_100127231 | Ga0070684_1001272313 | 175 |
| 585 | 3300005535 | Ga0070684_100433063 | Ga0070684_1004330632 | 175 |
| 586 | 3300005535 | Ga0070684_100518537 | Ga0070684_1005185371 | 175 |
| 587 | 3300005536 | Ga0070697_100076378 | Ga0070697_1000763782 | 175 |
| 588 | 3300005539 | Ga0068853_100010722 | Ga0068853_1000107226 | 175 |
| 589 | 3300005539 | Ga0068853_100058648 | Ga0068853_1000586484 | 175 |
| 590 | 3300005539 | Ga0068853_100908965 | Ga0068853_1009089652 | 175 |
| 591 | 3300005539 | Ga0068853_101225955 | Ga0068853_1012259551 | 175 |
| 592 | 3300005539 | Ga0068853_101579449 | Ga0068853_1015794491 | 175 |
| 593 | 3300005543 | Ga0070672_100051989 | Ga0070672_1000519892 | 175 |
| 594 | 3300005543 | Ga0070672_100223244 | Ga0070672_1002232442 | 175 |
| 595 | 3300005544 | Ga0070686_100082807 | Ga0070686_1000828072 | 175 |
| 596 | 3300005546 | Ga0070696_100811732 | Ga0070696_1008117321 | 175 |
| 597 | 3300005547 | Ga0070693_100182519 | Ga0070693_1001825191 | 175 |
| 598 | 3300005547 | Ga0070693_100231614 | Ga0070693_1002316142 | 175 |
| 599 | 3300005547 | Ga0070693_100256793 | Ga0070693_1002567931 | 175 |
| 600 | 3300005547 | Ga0070693_100258217 | Ga0070693_1002582172 | 175 |
| 601 | 3300005548 | Ga0070665_100122323 | Ga0070665_1001223234 | 175 |
| 602 | 3300005548 | Ga0070665_100173976 | Ga0070665_1001739761 | 175 |
| 603 | 3300005548 | Ga0070665_100219984 | Ga0070665_1002199842 | 175 |
| 604 | 3300005548 | Ga0070665_100282652 | Ga0070665_1002826522 | 175 |
| 605 | 3300005548 | Ga0070665_100432308 | Ga0070665_1004323082 | 175 |
| 606 | 3300005548 | Ga0070665_100460944 | Ga0070665_1004609442 | 175 |
| 607 | 3300005548 | Ga0070665_100559060 | Ga0070665_1005590601 | 175 |
| 608 | 3300005548 | Ga0070665_100678299 | Ga0070665_1006782991 | 175 |
| 609 | 3300005549 | Ga0070704_100701181 | Ga0070704_1007011811 | 175 |
| 610 | 3300005563 | Ga0068855_100034337 | Ga0068855_1000343375 | 175 |
| 611 | 3300005563 | Ga0068855_100037580 | Ga0068855_1000375804 | 175 |
| 612 | 3300005563 | Ga0068855_100051685 | Ga0068855_1000516855 | 175 |
| 613 | 3300005563 | Ga0068855_100300171 | Ga0068855_1003001712 | 175 |
| 614 | 3300005563 | Ga0068855_100575850 | Ga0068855_1005758501 | 175 |
| 615 | 3300005563 | Ga0068855_101093612 | Ga0068855_1010936121 | 175 |
| 616 | 3300005563 | Ga0068855_101390712 | Ga0068855_1013907121 | 175 |
| 617 | 3300005564 | Ga0070664_100053626 | Ga0070664_1000536262 | 175 |
| 618 | 3300005564 | Ga0070664_100297206 | Ga0070664_1002972061 | 175 |
| 619 | 3300005564 | Ga0070664_100941790 | Ga0070664_1009417901 | 175 |
| 620 | 3300005577 | Ga0068857_100015801 | Ga0068857_1000158012 | 175 |
| 621 | 3300005577 | Ga0068857_100130693 | Ga0068857_1001306932 | 175 |
| 622 | 3300005578 | Ga0068854_100176582 | Ga0068854_1001765821 | 175 |
| 623 | 3300005578 | Ga0068854_100231226 | Ga0068854_1002312262 | 175 |
| 624 | 3300005614 | Ga0068856_100041193 | Ga0068856_1000411934 | 175 |
| 625 | 3300005614 | Ga0068856_100122900 | Ga0068856_1001229002 | 175 |
| 626 | 3300005614 | Ga0068856_100285720 | Ga0068856_1002857202 | 175 |
| 627 | 3300005614 | Ga0068856_100293164 | Ga0068856_1002931643 | 175 |
| 628 | 3300005614 | Ga0068856_100565292 | Ga0068856_1005652921 | 175 |
| 629 | 3300005614 | Ga0068856_100570665 | Ga0068856_1005706652 | 175 |
| 630 | 3300005614 | Ga0068856_100578990 | Ga0068856_1005789901 | 175 |
| 631 | 3300005614 | Ga0068856_100781199 | Ga0068856_1007811992 | 175 |
| 632 | 3300005615 | Ga0070702_100164228 | Ga0070702_1001642282 | 175 |
| 633 | 3300005616 | Ga0068852_100040046 | Ga0068852_1000400462 | 175 |
| 634 | 3300005616 | Ga0068852_100121689 | Ga0068852_1001216892 | 175 |
| 635 | 3300005616 | Ga0068852_100295009 | Ga0068852_1002950092 | 175 |
| 636 | 3300005616 | Ga0068852_100347869 | Ga0068852_1003478692 | 175 |
| 637 | 3300005616 | Ga0068852_100450914 | Ga0068852_1004509142 | 175 |
| 638 | 3300005616 | Ga0068852_100451944 | Ga0068852_1004519442 | 175 |
| 639 | 3300005616 | Ga0068852_100999916 | Ga0068852_1009999161 | 175 |
| 640 | 3300005616 | Ga0068852_101005432 | Ga0068852_1010054321 | 175 |
| 641 | 3300005617 | Ga0068859_100055596 | Ga0068859_1000555962 | 175 |
| 642 | 3300005617 | Ga0068859_100113481 | Ga0068859_1001134811 | 175 |
| 643 | 3300005617 | Ga0068859_100368700 | Ga0068859_1003687001 | 175 |
| 644 | 3300005617 | Ga0068859_100529064 | Ga0068859_1005290642 | 175 |
| 645 | 3300005618 | Ga0068864_100010685 | Ga0068864_1000106855 | 175 |
| 646 | 3300005618 | Ga0068864_100070104 | Ga0068864_1000701041 | 175 |
| 647 | 3300005618 | Ga0068864_100193808 | Ga0068864_1001938083 | 175 |
| 648 | 3300005719 | Ga0068861_100059460 | Ga0068861_1000594602 | 175 |
| 649 | 3300005719 | Ga0068861_100223314 | Ga0068861_1002233141 | 175 |
| 650 | 3300005719 | Ga0068861_100238612 | Ga0068861_1002386122 | 175 |
| 651 | 3300005719 | Ga0068861_100276342 | Ga0068861_1002763421 | 175 |
| 652 | 3300005834 | Ga0068851_10058123 | Ga0068851_100581232 | 175 |
| 653 | 3300005840 | Ga0068870_10145690 | Ga0068870_101456902 | 175 |
| 654 | 3300005841 | Ga0068863_100199834 | Ga0068863_1001998342 | 175 |
| 655 | 3300005841 | Ga0068863_100210895 | Ga0068863_1002108952 | 175 |
| 656 | 3300005841 | Ga0068863_101037046 | Ga0068863_1010370461 | 175 |
| 657 | 3300005842 | Ga0068858_100019227 | Ga0068858_1000192274 | 175 |
| 658 | 3300005842 | Ga0068858_100024626 | Ga0068858_1000246265 | 175 |
| 659 | 3300005842 | Ga0068858_100133581 | Ga0068858_1001335813 | 175 |
| 660 | 3300005842 | Ga0068858_100274839 | Ga0068858_1002748391 | 175 |
| 661 | 3300005842 | Ga0068858_100430016 | Ga0068858_1004300162 | 175 |
| 662 | 3300005842 | Ga0068858_100453634 | Ga0068858_1004536342 | 175 |
| 663 | 3300005842 | Ga0068858_101191788 | Ga0068858_1011917881 | 175 |
| 664 | 3300005843 | Ga0068860_100268252 | Ga0068860_1002682523 | 175 |
| 665 | 3300005843 | Ga0068860_100373600 | Ga0068860_1003736001 | 175 |
| 666 | 3300005843 | Ga0068860_100566113 | Ga0068860_1005661132 | 175 |
| 667 | 3300005843 | Ga0068860_100758112 | Ga0068860_1007581121 | 175 |
| 668 | 3300005843 | Ga0068860_100871966 | Ga0068860_1008719661 | 175 |
| 669 | 3300005844 | Ga0068862_100118150 | Ga0068862_1001181502 | 175 |
| 670 | 3300005844 | Ga0068862_100383474 | Ga0068862_1003834741 | 175 |
| 671 | 3300005844 | Ga0068862_100392645 | Ga0068862_1003926452 | 175 |
| 672 | 3300005844 | Ga0068862_100486013 | Ga0068862_1004860132 | 175 |
| 673 | 3300005844 | Ga0068862_100513137 | Ga0068862_1005131371 | 175 |
| 674 | 3300005844 | Ga0068862_100531476 | Ga0068862_1005314761 | 175 |
| 675 | 3300005844 | Ga0068862_100574171 | Ga0068862_1005741711 | 175 |
| 676 | 3300005937 | Ga0081455_10011753 | Ga0081455_100117534 | 175 |
| 677 | 3300005937 | Ga0081455_10030453 | Ga0081455_100304532 | 175 |
| 678 | 3300005937 | Ga0081455_10044915 | Ga0081455_100449154 | 175 |
| 679 | 3300005937 | Ga0081455_10065396 | Ga0081455_100653964 | 175 |
| 680 | 3300005981 | Ga0081538_10096710 | Ga0081538_100967103 | 175 |
| 681 | 3300005983 | Ga0081540_1000641 | Ga0081540_100064120 | 175 |
| 682 | 3300005983 | Ga0081540_1002768 | Ga0081540_10027685 | 175 |
| 683 | 3300005983 | Ga0081540_1012285 | Ga0081540_10122857 | 175 |
| 684 | 3300005983 | Ga0081540_1019885 | Ga0081540_10198852 | 175 |
| 685 | 3300005983 | Ga0081540_1022974 | Ga0081540_10229742 | 175 |
| 686 | 3300005983 | Ga0081540_1030989 | Ga0081540_10309893 | 175 |
| 687 | 3300005983 | Ga0081540_1091743 | Ga0081540_10917432 | 175 |
| 688 | 3300005983 | Ga0081540_1116108 | Ga0081540_11161082 | 175 |
| 689 | 3300005985 | Ga0081539_10000064 | Ga0081539_10000064189 | 175 |
| 690 | 3300005985 | Ga0081539_10001127 | Ga0081539_1000112722 | 175 |
| 691 | 3300005985 | Ga0081539_10049479 | Ga0081539_100494792 | 175 |
| 692 | 3300006028 | Ga0070717_10003745 | Ga0070717_100037459 | 175 |
| 693 | 3300006028 | Ga0070717_10087173 | Ga0070717_100871734 | 175 |
| 694 | 3300006028 | Ga0070717_10508766 | Ga0070717_105087662 | 175 |
| 695 | 3300006028 | Ga0070717_10746778 | Ga0070717_107467781 | 175 |
| 696 | 3300006038 | Ga0075365_10017356 | Ga0075365_100173563 | 175 |
| 697 | 3300006038 | Ga0075365_10061649 | Ga0075365_100616494 | 175 |
| 698 | 3300006038 | Ga0075365_10113512 | Ga0075365_101135123 | 175 |
| 699 | 3300006038 | Ga0075365_10156261 | Ga0075365_101562612 | 175 |
| 700 | 3300006038 | Ga0075365_10234326 | Ga0075365_102343262 | 175 |
| 701 | 3300006038 | Ga0075365_10514033 | Ga0075365_105140331 | 175 |
| 702 | 3300006042 | Ga0075368_10013479 | Ga0075368_100134792 | 175 |
| 703 | 3300006042 | Ga0075368_10057272 | Ga0075368_100572723 | 175 |
| 704 | 3300006048 | Ga0075363_100002972 | Ga0075363_1000029722 | 175 |
| 705 | 3300006048 | Ga0075363_100101873 | Ga0075363_1001018732 | 175 |
| 706 | 3300006048 | Ga0075363_100274372 | Ga0075363_1002743722 | 175 |
| 707 | 3300006048 | Ga0075363_100516078 | Ga0075363_1005160781 | 175 |
| 708 | 3300006051 | Ga0075364_10027868 | Ga0075364_100278682 | 175 |
| 709 | 3300006051 | Ga0075364_10058333 | Ga0075364_100583332 | 175 |
| 710 | 3300006051 | Ga0075364_10205722 | Ga0075364_102057221 | 175 |
| 711 | 3300006051 | Ga0075364_10371178 | Ga0075364_103711782 | 175 |
| 712 | 3300006163 | Ga0070715_10040865 | Ga0070715_100408652 | 175 |
| 713 | 3300006173 | Ga0070716_100068726 | Ga0070716_1000687263 | 175 |
| 714 | 3300006173 | Ga0070716_100405927 | Ga0070716_1004059271 | 175 |
| 715 | 3300006173 | Ga0070716_100443012 | Ga0070716_1004430121 | 175 |
| 716 | 3300006175 | Ga0070712_100009491 | Ga0070712_1000094914 | 175 |
| 717 | 3300006175 | Ga0070712_100114364 | Ga0070712_1001143642 | 175 |
| 718 | 3300006175 | Ga0070712_100141178 | Ga0070712_1001411784 | 175 |
| 719 | 3300006175 | Ga0070712_100212311 | Ga0070712_1002123112 | 175 |
| 720 | 3300006175 | Ga0070712_100549527 | Ga0070712_1005495272 | 175 |
| 721 | 3300006175 | Ga0070712_100745083 | Ga0070712_1007450831 | 175 |
| 722 | 3300006175 | Ga0070712_100807331 | Ga0070712_1008073311 | 175 |
| 723 | 3300006177 | Ga0075362_10195098 | Ga0075362_101950982 | 175 |
| 724 | 3300006177 | Ga0075362_10246743 | Ga0075362_102467431 | 175 |
| 725 | 3300006177 | Ga0075362_10318261 | Ga0075362_103182611 | 175 |
| 726 | 3300006178 | Ga0075367_10050636 | Ga0075367_100506363 | 175 |
| 727 | 3300006178 | Ga0075367_10165437 | Ga0075367_101654372 | 175 |
| 728 | 3300006178 | Ga0075367_10185763 | Ga0075367_101857632 | 175 |
| 729 | 3300006186 | Ga0075369_10030464 | Ga0075369_100304641 | 175 |
| 730 | 3300006186 | Ga0075369_10053362 | Ga0075369_100533622 | 175 |
| 731 | 3300006186 | Ga0075369_10057154 | Ga0075369_100571542 | 175 |
| 732 | 3300006186 | Ga0075369_10079997 | Ga0075369_100799972 | 175 |
| 733 | 3300006186 | Ga0075369_10161585 | Ga0075369_101615851 | 175 |
| 734 | 3300006195 | Ga0075366_10002189 | Ga0075366_1000218911 | 175 |
| 735 | 3300006195 | Ga0075366_10075611 | Ga0075366_100756113 | 175 |
| 736 | 3300006237 | Ga0097621_100005281 | Ga0097621_1000052818 | 175 |
| 737 | 3300006237 | Ga0097621_100046218 | Ga0097621_1000462182 | 175 |
| 738 | 3300006237 | Ga0097621_100756708 | Ga0097621_1007567082 | 175 |
| 739 | 3300006237 | Ga0097621_101213849 | Ga0097621_1012138491 | 175 |
| 740 | 3300006353 | Ga0075370_10014282 | Ga0075370_100142825 | 175 |
| 741 | 3300006353 | Ga0075370_10046269 | Ga0075370_100462693 | 175 |
| 742 | 3300006353 | Ga0075370_10110178 | Ga0075370_101101781 | 175 |
| 743 | 3300006353 | Ga0075370_10239912 | Ga0075370_102399122 | 175 |
| 744 | 3300006353 | Ga0075370_10251878 | Ga0075370_102518781 | 175 |
| 745 | 3300006353 | Ga0075370_10254275 | Ga0075370_102542751 | 175 |
| 746 | 3300006353 | Ga0075370_10622119 | Ga0075370_106221191 | 175 |
| 747 | 3300006358 | Ga0068871_100105507 | Ga0068871_1001055075 | 175 |
| 748 | 3300006358 | Ga0068871_100130610 | Ga0068871_1001306102 | 175 |
| 749 | 3300006852 | Ga0075433_10245834 | Ga0075433_102458342 | 175 |
| 750 | 3300006852 | Ga0075433_10527330 | Ga0075433_105273302 | 175 |
| 751 | 3300006871 | Ga0075434_100100279 | Ga0075434_1001002791 | 175 |
| 752 | 3300006871 | Ga0075434_100119417 | Ga0075434_1001194171 | 175 |
| 753 | 3300006871 | Ga0075434_100423347 | Ga0075434_1004233472 | 175 |
| 754 | 3300006881 | Ga0068865_100077261 | Ga0068865_1000772611 | 175 |
| 755 | 3300006881 | Ga0068865_100124039 | Ga0068865_1001240392 | 175 |
| 756 | 3300006881 | Ga0068865_100504217 | Ga0068865_1005042171 | 175 |
| 757 | 3300006931 | Ga0097620_100055594 | Ga0097620_1000555945 | 175 |
| 758 | 3300006931 | Ga0097620_100113485 | Ga0097620_1001134853 | 175 |
| 759 | 3300006931 | Ga0097620_100368689 | Ga0097620_1003686891 | 175 |
| 760 | 3300006931 | Ga0097620_100529060 | Ga0097620_1005290601 | 175 |
| 761 | 3300007265 | Ga0099794_10124935 | Ga0099794_101249352 | 175 |
| 762 | 3300007788 | Ga0099795_10034418 | Ga0099795_100344182 | 175 |
| 763 | 3300007788 | Ga0099795_10100085 | Ga0099795_101000851 | 175 |
| 764 | 3300009011 | Ga0105251_10130578 | Ga0105251_101305782 | 175 |
| 765 | 3300009011 | Ga0105251_10298853 | Ga0105251_102988531 | 175 |
| 766 | 3300009092 | Ga0105250_10054952 | Ga0105250_100549522 | 175 |
| 767 | 3300009093 | Ga0105240_10069048 | Ga0105240_100690482 | 175 |
| 768 | 3300009093 | Ga0105240_10162542 | Ga0105240_101625424 | 175 |
| 769 | 3300009093 | Ga0105240_10218258 | Ga0105240_102182583 | 175 |
| 770 | 3300009093 | Ga0105240_10250981 | Ga0105240_102509812 | 175 |
| 771 | 3300009093 | Ga0105240_10321140 | Ga0105240_103211402 | 175 |
| 772 | 3300009093 | Ga0105240_10563251 | Ga0105240_105632511 | 175 |
| 773 | 3300009094 | Ga0111539_10394179 | Ga0111539_103941792 | 175 |
| 774 | 3300009098 | Ga0105245_10084813 | Ga0105245_100848133 | 175 |
| 775 | 3300009098 | Ga0105245_10740899 | Ga0105245_107408991 | 175 |
| 776 | 3300009098 | Ga0105245_10745722 | Ga0105245_107457221 | 175 |
| 777 | 3300009098 | Ga0105245_11097571 | Ga0105245_110975711 | 175 |
| 778 | 3300009101 | Ga0105247_10034563 | Ga0105247_100345632 | 175 |
| 779 | 3300009101 | Ga0105247_10152729 | Ga0105247_101527291 | 175 |
| 780 | 3300009101 | Ga0105247_10213354 | Ga0105247_102133542 | 175 |
| 781 | 3300009101 | Ga0105247_10255145 | Ga0105247_102551452 | 175 |
| 782 | 3300009101 | Ga0105247_10260534 | Ga0105247_102605342 | 175 |
| 783 | 3300009101 | Ga0105247_10961168 | Ga0105247_109611681 | 175 |
| 784 | 3300009147 | Ga0114129_10752504 | Ga0114129_107525042 | 175 |
| 785 | 3300009148 | Ga0105243_10222520 | Ga0105243_102225201 | 175 |
| 786 | 3300009148 | Ga0105243_10301176 | Ga0105243_103011762 | 175 |
| 787 | 3300009148 | Ga0105243_10673534 | Ga0105243_106735342 | 175 |
| 788 | 3300009148 | Ga0105243_11024974 | Ga0105243_110249741 | 175 |
| 789 | 3300009174 | Ga0105241_10037835 | Ga0105241_100378352 | 175 |
| 790 | 3300009174 | Ga0105241_10056298 | Ga0105241_100562984 | 175 |
| 791 | 3300009174 | Ga0105241_10091921 | Ga0105241_100919212 | 175 |
| 792 | 3300009174 | Ga0105241_10187570 | Ga0105241_101875701 | 175 |
| 793 | 3300009174 | Ga0105241_10301968 | Ga0105241_103019681 | 175 |
| 794 | 3300009176 | Ga0105242_10238466 | Ga0105242_102384662 | 175 |
| 795 | 3300009176 | Ga0105242_10240184 | Ga0105242_102401842 | 175 |
| 796 | 3300009176 | Ga0105242_11210465 | Ga0105242_112104651 | 175 |
| 797 | 3300009177 | Ga0105248_10092104 | Ga0105248_100921042 | 175 |
| 798 | 3300009177 | Ga0105248_10363321 | Ga0105248_103633212 | 175 |
| 799 | 3300009177 | Ga0105248_10684713 | Ga0105248_106847131 | 175 |
| 800 | 3300009545 | Ga0105237_10003763 | Ga0105237_1000376310 | 175 |
| 801 | 3300009545 | Ga0105237_10015975 | Ga0105237_100159753 | 175 |
| 802 | 3300009545 | Ga0105237_10041525 | Ga0105237_100415254 | 175 |
| 803 | 3300009545 | Ga0105237_10116175 | Ga0105237_101161753 | 175 |
| 804 | 3300009545 | Ga0105237_10232636 | Ga0105237_102326362 | 175 |
| 805 | 3300009545 | Ga0105237_10283868 | Ga0105237_102838682 | 175 |
| 806 | 3300009545 | Ga0105237_10363991 | Ga0105237_103639912 | 175 |
| 807 | 3300009545 | Ga0105237_10431643 | Ga0105237_104316432 | 175 |
| 808 | 3300009551 | Ga0105238_10028229 | Ga0105238_100282296 | 175 |
| 809 | 3300009551 | Ga0105238_10067898 | Ga0105238_100678984 | 175 |
| 810 | 3300009551 | Ga0105238_10230198 | Ga0105238_102301982 | 175 |
| 811 | 3300009551 | Ga0105238_10285408 | Ga0105238_102854081 | 175 |
| 812 | 3300009551 | Ga0105238_10353732 | Ga0105238_103537322 | 175 |
| 813 | 3300009551 | Ga0105238_10450395 | Ga0105238_104503952 | 175 |
| 814 | 3300009551 | Ga0105238_11359110 | Ga0105238_113591101 | 175 |
| 815 | 3300009553 | Ga0105249_10256296 | Ga0105249_102562962 | 175 |
| 816 | 3300009553 | Ga0105249_11302373 | Ga0105249_113023732 | 175 |
| 817 | 3300009553 | Ga0105249_11330288 | Ga0105249_113302881 | 175 |
| 818 | 3300010159 | Ga0099796_10001437 | Ga0099796_100014373 | 175 |
| 819 | 3300010159 | Ga0099796_10170528 | Ga0099796_101705281 | 175 |
| 820 | 3300010375 | Ga0105239_10086297 | Ga0105239_100862972 | 175 |
| 821 | 3300010375 | Ga0105239_10301128 | Ga0105239_103011282 | 175 |
| 822 | 3300010375 | Ga0105239_10314020 | Ga0105239_103140202 | 175 |
| 823 | 3300010375 | Ga0105239_10314283 | Ga0105239_103142831 | 175 |
| 824 | 3300010375 | Ga0105239_10335428 | Ga0105239_103354282 | 175 |
| 825 | 3300010375 | Ga0105239_10477319 | Ga0105239_104773192 | 175 |
| 826 | 3300010375 | Ga0105239_10605626 | Ga0105239_106056261 | 175 |
| 827 | 3300010375 | Ga0105239_10650730 | Ga0105239_106507302 | 175 |
| 828 | 3300010375 | Ga0105239_10706011 | Ga0105239_107060111 | 175 |
| 829 | 3300010375 | Ga0105239_10831249 | Ga0105239_108312491 | 175 |
| 830 | 3300011119 | Ga0105246_10035926 | Ga0105246_100359262 | 175 |
| 831 | 3300011119 | Ga0105246_10157351 | Ga0105246_101573512 | 175 |
| 832 | 3300011119 | Ga0105246_10209134 | Ga0105246_102091342 | 175 |
| 833 | 3300011119 | Ga0105246_10641415 | Ga0105246_106414152 | 175 |
| 834 | 3300011119 | Ga0105246_10894964 | Ga0105246_108949641 | 175 |
| 835 | 3300011119 | Ga0105246_11716442 | Ga0105246_117164421 | 175 |
| 836 | 3300012506 | Ga0157324_1005979 | Ga0157324_10059791 | 175 |
| 837 | 3300013102 | Ga0157371_10822979 | Ga0157371_108229791 | 175 |
| 838 | 3300013104 | Ga0157370_10138156 | Ga0157370_101381562 | 175 |
| 839 | 3300013104 | Ga0157370_10149133 | Ga0157370_101491332 | 175 |
| 840 | 3300013104 | Ga0157370_10387865 | Ga0157370_103878652 | 175 |
| 841 | 3300013104 | Ga0157370_10796504 | Ga0157370_107965041 | 175 |
| 842 | 3300013105 | Ga0157369_10014541 | Ga0157369_100145417 | 175 |
| 843 | 3300013105 | Ga0157369_10092228 | Ga0157369_100922282 | 175 |
| 844 | 3300013105 | Ga0157369_10096129 | Ga0157369_100961294 | 175 |
| 845 | 3300013105 | Ga0157369_10098106 | Ga0157369_100981061 | 175 |
| 846 | 3300013105 | Ga0157369_10122600 | Ga0157369_101226002 | 175 |
| 847 | 3300013105 | Ga0157369_11090462 | Ga0157369_110904621 | 175 |
| 848 | 3300013105 | Ga0157369_11267428 | Ga0157369_112674281 | 175 |
| 849 | 3300013296 | Ga0157374_10003265 | Ga0157374_100032658 | 175 |
| 850 | 3300013296 | Ga0157374_10278484 | Ga0157374_102784842 | 175 |
| 851 | 3300013297 | Ga0157378_10125884 | Ga0157378_101258844 | 175 |
| 852 | 3300013297 | Ga0157378_10202070 | Ga0157378_102020702 | 175 |
| 853 | 3300013306 | Ga0163162_10087159 | Ga0163162_100871593 | 175 |
| 854 | 3300013306 | Ga0163162_10175710 | Ga0163162_101757102 | 175 |
| 855 | 3300013306 | Ga0163162_11344740 | Ga0163162_113447401 | 175 |
| 856 | 3300013306 | Ga0163162_11364441 | Ga0163162_113644411 | 175 |
| 857 | 3300013307 | Ga0157372_10105097 | Ga0157372_101050974 | 175 |
| 858 | 3300013307 | Ga0157372_10289539 | Ga0157372_102895392 | 175 |
| 859 | 3300013307 | Ga0157372_10533287 | Ga0157372_105332872 | 175 |
| 860 | 3300013307 | Ga0157372_10715921 | Ga0157372_107159211 | 175 |
| 861 | 3300013307 | Ga0157372_10798483 | Ga0157372_107984831 | 175 |
| 862 | 3300013307 | Ga0157372_10975207 | Ga0157372_109752071 | 175 |
| 863 | 3300013307 | Ga0157372_11294335 | Ga0157372_112943352 | 175 |
| 864 | 3300013307 | Ga0157372_11304815 | Ga0157372_113048151 | 175 |
| 865 | 3300013308 | Ga0157375_10026900 | Ga0157375_100269005 | 175 |
| 866 | 3300013308 | Ga0157375_10229758 | Ga0157375_102297582 | 175 |
| 867 | 3300013308 | Ga0157375_10476432 | Ga0157375_104764322 | 175 |
| 868 | 3300013308 | Ga0157375_10832461 | Ga0157375_108324611 | 175 |
| 869 | 3300014325 | Ga0163163_10052491 | Ga0163163_100524913 | 175 |
| 870 | 3300014325 | Ga0163163_10423706 | Ga0163163_104237062 | 175 |
| 871 | 3300014325 | Ga0163163_10697677 | Ga0163163_106976772 | 175 |
| 872 | 3300014326 | Ga0157380_10857415 | Ga0157380_108574151 | 175 |
| 873 | 3300014326 | Ga0157380_11594667 | Ga0157380_115946671 | 175 |
| 874 | 3300014497 | Ga0182008_10255591 | Ga0182008_102555912 | 175 |
| 875 | 3300014968 | Ga0157379_11195695 | Ga0157379_111956952 | 175 |
| 876 | 3300014969 | Ga0157376_10043730 | Ga0157376_100437302 | 175 |
| 877 | 3300014969 | Ga0157376_10049317 | Ga0157376_100493172 | 175 |
| 878 | 3300014969 | Ga0157376_10451447 | Ga0157376_104514471 | 175 |
| 879 | 3300014969 | Ga0157376_10704411 | Ga0157376_107044111 | 175 |
| 880 | 3300014969 | Ga0157376_10923548 | Ga0157376_109235481 | 175 |
| 881 | 3300015262 | Ga0182007_10069713 | Ga0182007_100697132 | 175 |
| 882 | 3300017792 | Ga0163161_10189899 | Ga0163161_101898992 | 175 |
| 883 | 3300020078 | Ga0206352_10701083 | Ga0206352_107010831 | 175 |
| 884 | 3300021320 | Ga0214544_1000056 | Ga0214544_100005669 | 175 |
| 885 | 3300021321 | Ga0214542_1000071 | Ga0214542_100007166 | 175 |
| 886 | 3300021324 | Ga0214545_1000033 | Ga0214545_100003356 | 175 |
| 887 | 3300021327 | Ga0214543_1000105 | Ga0214543_100010556 | 175 |
| 888 | 3300021358 | Ga0213873_10001574 | Ga0213873_100015742 | 175 |
| 889 | 3300021358 | Ga0213873_10007116 | Ga0213873_100071162 | 175 |
| 890 | 3300021377 | Ga0213874_10077900 | Ga0213874_100779001 | 175 |
| 891 | 3300021384 | Ga0213876_10007380 | Ga0213876_100073808 | 175 |
| 892 | 3300021384 | Ga0213876_10125874 | Ga0213876_101258742 | 175 |
| 893 | 3300021441 | Ga0213871_10005961 | Ga0213871_100059613 | 175 |
| 894 | 3300025230 | Ga0209563_104671 | Ga0209563_1046712 | 175 |
| 895 | 3300025245 | Ga0207425_1019274 | Ga0207425_10192741 | 175 |
| 896 | 3300025253 | Ga0209677_100313 | Ga0209677_1003132 | 175 |
| 897 | 3300025253 | Ga0209677_104221 | Ga0209677_1042212 | 175 |
| 898 | 3300025254 | Ga0209148_1000308 | Ga0209148_100030814 | 175 |
| 899 | 3300025254 | Ga0209148_1011159 | Ga0209148_10111591 | 175 |
| 900 | 3300025261 | Ga0209233_1004470 | Ga0209233_10044704 | 175 |
| 901 | 3300025261 | Ga0209233_1004898 | Ga0209233_10048982 | 175 |
| 902 | 3300025261 | Ga0209233_1010739 | Ga0209233_10107393 | 175 |
| 903 | 3300025272 | Ga0209455_1001786 | Ga0209455_100178610 | 175 |
| 904 | 3300025272 | Ga0209455_1002759 | Ga0209455_10027597 | 175 |
| 905 | 3300025272 | Ga0209455_1004855 | Ga0209455_10048555 | 175 |
| 906 | 3300025273 | Ga0209673_1020468 | Ga0209673_10204682 | 175 |
| 907 | 3300025295 | Ga0209564_1003448 | Ga0209564_10034484 | 175 |
| 908 | 3300025295 | Ga0209564_1006612 | Ga0209564_10066122 | 175 |
| 909 | 3300025297 | Ga0209758_1000182 | Ga0209758_1000182125 | 175 |
| 910 | 3300025297 | Ga0209758_1000293 | Ga0209758_100029356 | 175 |
| 911 | 3300025297 | Ga0209758_1000363 | Ga0209758_100036340 | 175 |
| 912 | 3300025297 | Ga0209758_1003509 | Ga0209758_10035093 | 175 |
| 913 | 3300025297 | Ga0209758_1003517 | Ga0209758_10035175 | 175 |
| 914 | 3300025297 | Ga0209758_1006314 | Ga0209758_100631410 | 175 |
| 915 | 3300025297 | Ga0209758_1011704 | Ga0209758_10117044 | 175 |
| 916 | 3300025297 | Ga0209758_1032984 | Ga0209758_10329842 | 175 |
| 917 | 3300025297 | Ga0209758_1038054 | Ga0209758_10380542 | 175 |
| 918 | 3300025299 | Ga0209256_1008893 | Ga0209256_10088934 | 175 |
| 919 | 3300025299 | Ga0209256_1061560 | Ga0209256_10615602 | 175 |
| 920 | 3300025299 | Ga0209256_1101099 | Ga0209256_11010991 | 175 |
| 921 | 3300025302 | Ga0207426_1000628 | Ga0207426_10006288 | 175 |
| 922 | 3300025302 | Ga0207426_1000992 | Ga0207426_100099214 | 175 |
| 923 | 3300025302 | Ga0207426_1004958 | Ga0207426_10049589 | 175 |
| 924 | 3300025302 | Ga0207426_1006404 | Ga0207426_10064046 | 175 |
| 925 | 3300025303 | Ga0209051_1066456 | Ga0209051_10664561 | 175 |
| 926 | 3300025315 | Ga0207697_10197271 | Ga0207697_101972711 | 175 |
| 927 | 3300025711 | Ga0207696_1064733 | Ga0207696_10647331 | 175 |
| 928 | 3300025885 | Ga0207653_10092156 | Ga0207653_100921561 | 175 |
| 929 | 3300025898 | Ga0207692_10001137 | Ga0207692_100011377 | 175 |
| 930 | 3300025898 | Ga0207692_10013707 | Ga0207692_100137074 | 175 |
| 931 | 3300025898 | Ga0207692_10264037 | Ga0207692_102640372 | 175 |
| 932 | 3300025899 | Ga0207642_10332300 | Ga0207642_103323002 | 175 |
| 933 | 3300025900 | Ga0207710_10042271 | Ga0207710_100422712 | 175 |
| 934 | 3300025900 | Ga0207710_10137713 | Ga0207710_101377131 | 175 |
| 935 | 3300025900 | Ga0207710_10156366 | Ga0207710_101563662 | 175 |
| 936 | 3300025900 | Ga0207710_10188126 | Ga0207710_101881261 | 175 |
| 937 | 3300025901 | Ga0207688_10012485 | Ga0207688_100124852 | 175 |
| 938 | 3300025901 | Ga0207688_10068049 | Ga0207688_100680492 | 175 |
| 939 | 3300025901 | Ga0207688_10072092 | Ga0207688_100720921 | 175 |
| 940 | 3300025901 | Ga0207688_10220535 | Ga0207688_102205352 | 175 |
| 941 | 3300025903 | Ga0207680_10099180 | Ga0207680_100991801 | 175 |
| 942 | 3300025903 | Ga0207680_10146184 | Ga0207680_101461842 | 175 |
| 943 | 3300025903 | Ga0207680_10160065 | Ga0207680_101600651 | 175 |
| 944 | 3300025904 | Ga0207647_10099975 | Ga0207647_100999752 | 175 |
| 945 | 3300025905 | Ga0207685_10038670 | Ga0207685_100386702 | 175 |
| 946 | 3300025906 | Ga0207699_10000995 | Ga0207699_100009958 | 175 |
| 947 | 3300025906 | Ga0207699_10066296 | Ga0207699_100662962 | 175 |
| 948 | 3300025906 | Ga0207699_10133590 | Ga0207699_101335902 | 175 |
| 949 | 3300025906 | Ga0207699_10691017 | Ga0207699_106910171 | 175 |
| 950 | 3300025907 | Ga0207645_10278514 | Ga0207645_102785141 | 175 |
| 951 | 3300025907 | Ga0207645_10701827 | Ga0207645_107018271 | 175 |
| 952 | 3300025908 | Ga0207643_10021166 | Ga0207643_100211662 | 175 |
| 953 | 3300025908 | Ga0207643_10251924 | Ga0207643_102519241 | 175 |
| 954 | 3300025909 | Ga0207705_10151296 | Ga0207705_101512962 | 175 |
| 955 | 3300025909 | Ga0207705_10461067 | Ga0207705_104610671 | 175 |
| 956 | 3300025911 | Ga0207654_10020214 | Ga0207654_100202145 | 175 |
| 957 | 3300025911 | Ga0207654_10024384 | Ga0207654_100243842 | 175 |
| 958 | 3300025911 | Ga0207654_10069183 | Ga0207654_100691832 | 175 |
| 959 | 3300025911 | Ga0207654_10110387 | Ga0207654_101103871 | 175 |
| 960 | 3300025911 | Ga0207654_10223849 | Ga0207654_102238491 | 175 |
| 961 | 3300025912 | Ga0207707_10000526 | Ga0207707_1000052628 | 175 |
| 962 | 3300025912 | Ga0207707_10001497 | Ga0207707_1000149713 | 175 |
| 963 | 3300025912 | Ga0207707_10034652 | Ga0207707_100346522 | 175 |
| 964 | 3300025912 | Ga0207707_10125242 | Ga0207707_101252422 | 175 |
| 965 | 3300025912 | Ga0207707_10352931 | Ga0207707_103529312 | 175 |
| 966 | 3300025912 | Ga0207707_10464788 | Ga0207707_104647882 | 175 |
| 967 | 3300025913 | Ga0207695_10000107 | Ga0207695_1000010772 | 175 |
| 968 | 3300025913 | Ga0207695_10048603 | Ga0207695_100486031 | 175 |
| 969 | 3300025913 | Ga0207695_10089217 | Ga0207695_100892173 | 175 |
| 970 | 3300025913 | Ga0207695_10090447 | Ga0207695_100904471 | 175 |
| 971 | 3300025913 | Ga0207695_10217187 | Ga0207695_102171871 | 175 |
| 972 | 3300025914 | Ga0207671_10004749 | Ga0207671_100047497 | 175 |
| 973 | 3300025914 | Ga0207671_10091185 | Ga0207671_100911853 | 175 |
| 974 | 3300025914 | Ga0207671_10097153 | Ga0207671_100971532 | 175 |
| 975 | 3300025914 | Ga0207671_10125116 | Ga0207671_101251162 | 175 |
| 976 | 3300025914 | Ga0207671_10172137 | Ga0207671_101721372 | 175 |
| 977 | 3300025914 | Ga0207671_10253575 | Ga0207671_102535752 | 175 |
| 978 | 3300025914 | Ga0207671_10306080 | Ga0207671_103060802 | 175 |
| 979 | 3300025915 | Ga0207693_10009900 | Ga0207693_100099008 | 175 |
| 980 | 3300025915 | Ga0207693_10046531 | Ga0207693_100465313 | 175 |
| 981 | 3300025915 | Ga0207693_10183839 | Ga0207693_101838392 | 175 |
| 982 | 3300025915 | Ga0207693_10336257 | Ga0207693_103362572 | 175 |
| 983 | 3300025915 | Ga0207693_10483784 | Ga0207693_104837841 | 175 |
| 984 | 3300025915 | Ga0207693_10541136 | Ga0207693_105411361 | 175 |
| 985 | 3300025916 | Ga0207663_10010958 | Ga0207663_100109584 | 175 |
| 986 | 3300025916 | Ga0207663_10085686 | Ga0207663_100856862 | 175 |
| 987 | 3300025916 | Ga0207663_10356544 | Ga0207663_103565442 | 175 |
| 988 | 3300025916 | Ga0207663_10517897 | Ga0207663_105178971 | 175 |
| 989 | 3300025917 | Ga0207660_10005316 | Ga0207660_100053166 | 175 |
| 990 | 3300025917 | Ga0207660_10091304 | Ga0207660_100913042 | 175 |
| 991 | 3300025917 | Ga0207660_10153953 | Ga0207660_101539531 | 175 |
| 992 | 3300025918 | Ga0207662_10313203 | Ga0207662_103132032 | 175 |
| 993 | 3300025919 | Ga0207657_10011015 | Ga0207657_100110154 | 175 |
| 994 | 3300025919 | Ga0207657_10035461 | Ga0207657_100354614 | 175 |
| 995 | 3300025919 | Ga0207657_10310633 | Ga0207657_103106332 | 175 |
| 996 | 3300025919 | Ga0207657_10530153 | Ga0207657_105301531 | 175 |
| 997 | 3300025919 | Ga0207657_10532778 | Ga0207657_105327781 | 175 |
| 998 | 3300025920 | Ga0207649_10156713 | Ga0207649_101567131 | 175 |
| 999 | 3300025920 | Ga0207649_10366818 | Ga0207649_103668182 | 175 |
| 1000 | 3300025920 | Ga0207649_10654935 | Ga0207649_106549351 | 175 |
| 1001 | 3300025921 | Ga0207652_10001692 | Ga0207652_1000169213 | 175 |
| 1002 | 3300025921 | Ga0207652_10032926 | Ga0207652_100329264 | 175 |
| 1003 | 3300025921 | Ga0207652_10146914 | Ga0207652_101469142 | 175 |
| 1004 | 3300025921 | Ga0207652_10213035 | Ga0207652_102130352 | 175 |
| 1005 | 3300025921 | Ga0207652_10463384 | Ga0207652_104633841 | 175 |
| 1006 | 3300025923 | Ga0207681_10108510 | Ga0207681_101085102 | 175 |
| 1007 | 3300025923 | Ga0207681_10492688 | Ga0207681_104926881 | 175 |
| 1008 | 3300025924 | Ga0207694_10009782 | Ga0207694_100097824 | 175 |
| 1009 | 3300025924 | Ga0207694_10163266 | Ga0207694_101632662 | 175 |
| 1010 | 3300025924 | Ga0207694_10206586 | Ga0207694_102065862 | 175 |
| 1011 | 3300025924 | Ga0207694_10273247 | Ga0207694_102732471 | 175 |
| 1012 | 3300025924 | Ga0207694_10596093 | Ga0207694_105960931 | 175 |
| 1013 | 3300025927 | Ga0207687_10021258 | Ga0207687_100212582 | 175 |
| 1014 | 3300025927 | Ga0207687_10021407 | Ga0207687_100214074 | 175 |
| 1015 | 3300025927 | Ga0207687_10124497 | Ga0207687_101244972 | 175 |
| 1016 | 3300025927 | Ga0207687_10793184 | Ga0207687_107931841 | 175 |
| 1017 | 3300025928 | Ga0207700_10013486 | Ga0207700_100134862 | 175 |
| 1018 | 3300025928 | Ga0207700_10062912 | Ga0207700_100629122 | 175 |
| 1019 | 3300025928 | Ga0207700_10148802 | Ga0207700_101488022 | 175 |
| 1020 | 3300025928 | Ga0207700_10255803 | Ga0207700_102558032 | 175 |
| 1021 | 3300025928 | Ga0207700_10261752 | Ga0207700_102617522 | 175 |
| 1022 | 3300025928 | Ga0207700_11162551 | Ga0207700_111625511 | 175 |
| 1023 | 3300025929 | Ga0207664_10056391 | Ga0207664_100563912 | 175 |
| 1024 | 3300025929 | Ga0207664_10135284 | Ga0207664_101352842 | 175 |
| 1025 | 3300025929 | Ga0207664_10304874 | Ga0207664_103048741 | 175 |
| 1026 | 3300025931 | Ga0207644_10093046 | Ga0207644_100930461 | 175 |
| 1027 | 3300025931 | Ga0207644_10103533 | Ga0207644_101035332 | 175 |
| 1028 | 3300025931 | Ga0207644_10607570 | Ga0207644_106075701 | 175 |
| 1029 | 3300025932 | Ga0207690_10250673 | Ga0207690_102506732 | 175 |
| 1030 | 3300025932 | Ga0207690_10788357 | Ga0207690_107883571 | 175 |
| 1031 | 3300025932 | Ga0207690_10844335 | Ga0207690_108443351 | 175 |
| 1032 | 3300025933 | Ga0207706_10178663 | Ga0207706_101786631 | 175 |
| 1033 | 3300025933 | Ga0207706_10250133 | Ga0207706_102501332 | 175 |
| 1034 | 3300025933 | Ga0207706_10294975 | Ga0207706_102949752 | 175 |
| 1035 | 3300025933 | Ga0207706_10394640 | Ga0207706_103946401 | 175 |
| 1036 | 3300025933 | Ga0207706_10523192 | Ga0207706_105231922 | 175 |
| 1037 | 3300025934 | Ga0207686_10141777 | Ga0207686_101417772 | 175 |
| 1038 | 3300025934 | Ga0207686_10301473 | Ga0207686_103014731 | 175 |
| 1039 | 3300025934 | Ga0207686_10552874 | Ga0207686_105528741 | 175 |
| 1040 | 3300025935 | Ga0207709_10108534 | Ga0207709_101085341 | 175 |
| 1041 | 3300025935 | Ga0207709_10232503 | Ga0207709_102325032 | 175 |
| 1042 | 3300025936 | Ga0207670_10042390 | Ga0207670_100423904 | 175 |
| 1043 | 3300025937 | Ga0207669_10097050 | Ga0207669_100970501 | 175 |
| 1044 | 3300025937 | Ga0207669_10176913 | Ga0207669_101769132 | 175 |
| 1045 | 3300025937 | Ga0207669_10411326 | Ga0207669_104113262 | 175 |
| 1046 | 3300025937 | Ga0207669_10655678 | Ga0207669_106556782 | 175 |
| 1047 | 3300025938 | Ga0207704_10040225 | Ga0207704_100402252 | 175 |
| 1048 | 3300025938 | Ga0207704_10104493 | Ga0207704_101044932 | 175 |
| 1049 | 3300025938 | Ga0207704_10161752 | Ga0207704_101617522 | 175 |
| 1050 | 3300025938 | Ga0207704_10976450 | Ga0207704_109764501 | 175 |
| 1051 | 3300025939 | Ga0207665_10085667 | Ga0207665_100856672 | 175 |
| 1052 | 3300025939 | Ga0207665_10160132 | Ga0207665_101601322 | 175 |
| 1053 | 3300025939 | Ga0207665_10166950 | Ga0207665_101669501 | 175 |
| 1054 | 3300025939 | Ga0207665_10545960 | Ga0207665_105459601 | 175 |
| 1055 | 3300025939 | Ga0207665_10926395 | Ga0207665_109263951 | 175 |
| 1056 | 3300025940 | Ga0207691_10359523 | Ga0207691_103595231 | 175 |
| 1057 | 3300025940 | Ga0207691_10736296 | Ga0207691_107362961 | 175 |
| 1058 | 3300025941 | Ga0207711_10040386 | Ga0207711_100403865 | 175 |
| 1059 | 3300025941 | Ga0207711_10051750 | Ga0207711_100517501 | 175 |
| 1060 | 3300025941 | Ga0207711_10145914 | Ga0207711_101459142 | 175 |
| 1061 | 3300025941 | Ga0207711_10623864 | Ga0207711_106238641 | 175 |
| 1062 | 3300025942 | Ga0207689_10120540 | Ga0207689_101205403 | 175 |
| 1063 | 3300025942 | Ga0207689_10300753 | Ga0207689_103007531 | 175 |
| 1064 | 3300025944 | Ga0207661_10000579 | Ga0207661_1000057911 | 175 |
| 1065 | 3300025944 | Ga0207661_10154209 | Ga0207661_101542092 | 175 |
| 1066 | 3300025944 | Ga0207661_10163164 | Ga0207661_101631642 | 175 |
| 1067 | 3300025945 | Ga0207679_10035086 | Ga0207679_100350864 | 175 |
| 1068 | 3300025945 | Ga0207679_10590918 | Ga0207679_105909182 | 175 |
| 1069 | 3300025945 | Ga0207679_10735724 | Ga0207679_107357242 | 175 |
| 1070 | 3300025945 | Ga0207679_11461799 | Ga0207679_114617991 | 175 |
| 1071 | 3300025949 | Ga0207667_10003118 | Ga0207667_1000311814 | 175 |
| 1072 | 3300025949 | Ga0207667_10040447 | Ga0207667_100404471 | 175 |
| 1073 | 3300025949 | Ga0207667_10075301 | Ga0207667_100753011 | 175 |
| 1074 | 3300025949 | Ga0207667_10122850 | Ga0207667_101228502 | 175 |
| 1075 | 3300025949 | Ga0207667_10146401 | Ga0207667_101464012 | 175 |
| 1076 | 3300025949 | Ga0207667_10252241 | Ga0207667_102522411 | 175 |
| 1077 | 3300025949 | Ga0207667_10946284 | Ga0207667_109462841 | 175 |
| 1078 | 3300025960 | Ga0207651_10104110 | Ga0207651_101041103 | 175 |
| 1079 | 3300025960 | Ga0207651_11315938 | Ga0207651_113159381 | 175 |
| 1080 | 3300025961 | Ga0207712_10041791 | Ga0207712_100417914 | 175 |
| 1081 | 3300025961 | Ga0207712_10140275 | Ga0207712_101402751 | 175 |
| 1082 | 3300025972 | Ga0207668_10075087 | Ga0207668_100750872 | 175 |
| 1083 | 3300025972 | Ga0207668_10183978 | Ga0207668_101839782 | 175 |
| 1084 | 3300025972 | Ga0207668_10274955 | Ga0207668_102749552 | 175 |
| 1085 | 3300025972 | Ga0207668_10284939 | Ga0207668_102849392 | 175 |
| 1086 | 3300025972 | Ga0207668_10540088 | Ga0207668_105400881 | 175 |
| 1087 | 3300025981 | Ga0207640_10170523 | Ga0207640_101705231 | 175 |
| 1088 | 3300025981 | Ga0207640_10326692 | Ga0207640_103266922 | 175 |
| 1089 | 3300025981 | Ga0207640_10390890 | Ga0207640_103908901 | 175 |
| 1090 | 3300025981 | Ga0207640_10799079 | Ga0207640_107990791 | 175 |
| 1091 | 3300025986 | Ga0207658_10365279 | Ga0207658_103652792 | 175 |
| 1092 | 3300025986 | Ga0207658_11142151 | Ga0207658_111421511 | 175 |
| 1093 | 3300026023 | Ga0207677_10015264 | Ga0207677_100152642 | 175 |
| 1094 | 3300026023 | Ga0207677_10483441 | Ga0207677_104834411 | 175 |
| 1095 | 3300026023 | Ga0207677_10755698 | Ga0207677_107556982 | 175 |
| 1096 | 3300026035 | Ga0207703_10030990 | Ga0207703_100309904 | 175 |
| 1097 | 3300026035 | Ga0207703_10109467 | Ga0207703_101094672 | 175 |
| 1098 | 3300026035 | Ga0207703_10178944 | Ga0207703_101789443 | 175 |
| 1099 | 3300026035 | Ga0207703_10434506 | Ga0207703_104345061 | 175 |
| 1100 | 3300026035 | Ga0207703_10473550 | Ga0207703_104735501 | 175 |
| 1101 | 3300026035 | Ga0207703_11016565 | Ga0207703_110165651 | 175 |
| 1102 | 3300026041 | Ga0207639_10126847 | Ga0207639_101268473 | 175 |
| 1103 | 3300026041 | Ga0207639_10181091 | Ga0207639_101810912 | 175 |
| 1104 | 3300026041 | Ga0207639_10545268 | Ga0207639_105452681 | 175 |
| 1105 | 3300026041 | Ga0207639_10639565 | Ga0207639_106395652 | 175 |
| 1106 | 3300026041 | Ga0207639_10690944 | Ga0207639_106909442 | 175 |
| 1107 | 3300026067 | Ga0207678_10004742 | Ga0207678_100047429 | 175 |
| 1108 | 3300026067 | Ga0207678_10005908 | Ga0207678_1000590811 | 175 |
| 1109 | 3300026067 | Ga0207678_10027619 | Ga0207678_100276192 | 175 |
| 1110 | 3300026067 | Ga0207678_10045103 | Ga0207678_100451034 | 175 |
| 1111 | 3300026067 | Ga0207678_10183024 | Ga0207678_101830241 | 175 |
| 1112 | 3300026067 | Ga0207678_10281965 | Ga0207678_102819652 | 175 |
| 1113 | 3300026067 | Ga0207678_10354436 | Ga0207678_103544361 | 175 |
| 1114 | 3300026067 | Ga0207678_10708466 | Ga0207678_107084661 | 175 |
| 1115 | 3300026075 | Ga0207708_10103418 | Ga0207708_101034182 | 175 |
| 1116 | 3300026075 | Ga0207708_10479217 | Ga0207708_104792172 | 175 |
| 1117 | 3300026078 | Ga0207702_10000350 | Ga0207702_1000035031 | 175 |
| 1118 | 3300026078 | Ga0207702_10328969 | Ga0207702_103289692 | 175 |
| 1119 | 3300026078 | Ga0207702_10972214 | Ga0207702_109722141 | 175 |
| 1120 | 3300026088 | Ga0207641_10309494 | Ga0207641_103094942 | 175 |
| 1121 | 3300026088 | Ga0207641_10401860 | Ga0207641_104018602 | 175 |
| 1122 | 3300026088 | Ga0207641_10687156 | Ga0207641_106871562 | 175 |
| 1123 | 3300026089 | Ga0207648_10322652 | Ga0207648_103226521 | 175 |
| 1124 | 3300026095 | Ga0207676_10325356 | Ga0207676_103253562 | 175 |
| 1125 | 3300026095 | Ga0207676_10547084 | Ga0207676_105470841 | 175 |
| 1126 | 3300026095 | Ga0207676_10941712 | Ga0207676_109417121 | 175 |
| 1127 | 3300026116 | Ga0207674_10027875 | Ga0207674_100278752 | 175 |
| 1128 | 3300026116 | Ga0207674_10137096 | Ga0207674_101370962 | 175 |
| 1129 | 3300026116 | Ga0207674_10231139 | Ga0207674_102311392 | 175 |
| 1130 | 3300026116 | Ga0207674_10309256 | Ga0207674_103092562 | 175 |
| 1131 | 3300026116 | Ga0207674_10430133 | Ga0207674_104301331 | 175 |
| 1132 | 3300026116 | Ga0207674_10667099 | Ga0207674_106670991 | 175 |
| 1133 | 3300026118 | Ga0207675_100393016 | Ga0207675_1003930162 | 175 |
| 1134 | 3300026118 | Ga0207675_100488708 | Ga0207675_1004887081 | 175 |
| 1135 | 3300026118 | Ga0207675_100520210 | Ga0207675_1005202102 | 175 |
| 1136 | 3300026121 | Ga0207683_10019572 | Ga0207683_100195727 | 175 |
| 1137 | 3300026121 | Ga0207683_10106094 | Ga0207683_101060942 | 175 |
| 1138 | 3300026121 | Ga0207683_10195500 | Ga0207683_101955002 | 175 |
| 1139 | 3300026121 | Ga0207683_10499216 | Ga0207683_104992161 | 175 |
| 1140 | 3300026121 | Ga0207683_10594973 | Ga0207683_105949731 | 175 |
| 1141 | 3300026142 | Ga0207698_10072550 | Ga0207698_100725501 | 175 |
| 1142 | 3300026142 | Ga0207698_10400702 | Ga0207698_104007021 | 175 |
| 1143 | 3300026142 | Ga0207698_10448893 | Ga0207698_104488932 | 175 |
| 1144 | 3300026142 | Ga0207698_10875539 | Ga0207698_108755392 | 175 |
| 1145 | 3300026142 | Ga0207698_10933570 | Ga0207698_109335701 | 175 |
| 1146 | 3300026142 | Ga0207698_12036979 | Ga0207698_120369791 | 175 |
| 1147 | 3300027296 | Ga0209389_1000208 | Ga0209389_100020812 | 175 |
| 1148 | 3300027296 | Ga0209389_1000217 | Ga0209389_100021710 | 175 |
| 1149 | 3300027357 | Ga0209589_1000032 | Ga0209589_100003272 | 175 |
| 1150 | 3300027361 | Ga0209489_101970 | Ga0209489_10197012 | 175 |
| 1151 | 3300027361 | Ga0209489_102214 | Ga0209489_10221410 | 175 |
| 1152 | 3300027363 | Ga0209700_100011 | Ga0209700_10001156 | 175 |
| 1153 | 3300027671 | Ga0209588_1022329 | Ga0209588_10223291 | 175 |
| 1154 | 3300027866 | Ga0209813_10024260 | Ga0209813_100242601 | 175 |
| 1155 | 3300027907 | Ga0207428_10081696 | Ga0207428_100816962 | 175 |
| 1156 | 3300027907 | Ga0207428_10158335 | Ga0207428_101583352 | 175 |
| 1157 | 3300028379 | Ga0268266_10001794 | Ga0268266_1000179416 | 175 |
| 1158 | 3300028379 | Ga0268266_10003485 | Ga0268266_1000348511 | 175 |
| 1159 | 3300028379 | Ga0268266_10052016 | Ga0268266_100520162 | 175 |
| 1160 | 3300028379 | Ga0268266_10080260 | Ga0268266_100802602 | 175 |
| 1161 | 3300028379 | Ga0268266_10157851 | Ga0268266_101578512 | 175 |
| 1162 | 3300028379 | Ga0268266_10273320 | Ga0268266_102733202 | 175 |
| 1163 | 3300028379 | Ga0268266_10323404 | Ga0268266_103234042 | 175 |
| 1164 | 3300028379 | Ga0268266_10434976 | Ga0268266_104349762 | 175 |
| 1165 | 3300028379 | Ga0268266_10635027 | Ga0268266_106350272 | 175 |
| 1166 | 3300028379 | Ga0268266_11144245 | Ga0268266_111442451 | 175 |
| 1167 | 3300028380 | Ga0268265_10031179 | Ga0268265_100311794 | 175 |
| 1168 | 3300028380 | Ga0268265_10035766 | Ga0268265_100357663 | 175 |
| 1169 | 3300028380 | Ga0268265_10098352 | Ga0268265_100983523 | 175 |
| 1170 | 3300028380 | Ga0268265_10499866 | Ga0268265_104998661 | 175 |
| 1171 | 3300028380 | Ga0268265_10717526 | Ga0268265_107175261 | 175 |
| 1172 | 3300028380 | Ga0268265_11088052 | Ga0268265_110880521 | 175 |
| 1173 | 3300028381 | Ga0268264_10146612 | Ga0268264_101466121 | 175 |
| 1174 | 3300028563 | Ga0265319_1075277 | Ga0265319_10752771 | 175 |
| 1175 | 3300028573 | Ga0265334_10005796 | Ga0265334_100057962 | 175 |
| 1176 | 3300028577 | Ga0265318_10024584 | Ga0265318_100245842 | 175 |
| 1177 | 3300028653 | Ga0265323_10001243 | Ga0265323_100012439 | 175 |
| 1178 | 3300028786 | Ga0307517_10247128 | Ga0307517_102471282 | 175 |
| 1179 | 3300028786 | Ga0307517_10311345 | Ga0307517_103113451 | 175 |
| 1180 | 3300028794 | Ga0307515_10549312 | Ga0307515_105493122 | 175 |
| 1181 | 3300028800 | Ga0265338_10000277 | Ga0265338_1000027769 | 175 |
| 1182 | 3300028800 | Ga0265338_10380167 | Ga0265338_103801672 | 175 |
| 1183 | 3300029957 | Ga0265324_10032056 | Ga0265324_100320562 | 175 |
| 1184 | 3300030521 | Ga0307511_10119296 | Ga0307511_101192962 | 175 |
| 1185 | 3300030521 | Ga0307511_10321736 | Ga0307511_103217361 | 175 |
| 1186 | 3300030522 | Ga0307512_10180268 | Ga0307512_101802682 | 175 |
| 1187 | 3300030878 | Ga0265770_1059654 | Ga0265770_10596541 | 175 |
| 1188 | 3300031238 | Ga0265332_10050779 | Ga0265332_100507792 | 175 |
| 1189 | 3300031239 | Ga0265328_10068047 | Ga0265328_100680472 | 175 |
| 1190 | 3300031241 | Ga0265325_10016892 | Ga0265325_100168925 | 175 |
| 1191 | 3300031247 | Ga0265340_10030891 | Ga0265340_100308912 | 175 |
| 1192 | 3300031247 | Ga0265340_10155031 | Ga0265340_101550311 | 175 |
| 1193 | 3300031249 | Ga0265339_10000971 | Ga0265339_1000097119 | 175 |
| 1194 | 3300031249 | Ga0265339_10212781 | Ga0265339_102127811 | 175 |
| 1195 | 3300031249 | Ga0265339_10219204 | Ga0265339_102192042 | 175 |
| 1196 | 3300031249 | Ga0265339_10226465 | Ga0265339_102264651 | 175 |
| 1197 | 3300031344 | Ga0265316_10193756 | Ga0265316_101937561 | 175 |
| 1198 | 3300031456 | Ga0307513_10104424 | Ga0307513_101044243 | 175 |
| 1199 | 3300031507 | Ga0307509_10109929 | Ga0307509_101099292 | 175 |
| 1200 | 3300031507 | Ga0307509_10327048 | Ga0307509_103270482 | 175 |
| 1201 | 3300031507 | Ga0307509_10338960 | Ga0307509_103389601 | 175 |
| 1202 | 3300031507 | Ga0307509_10457314 | Ga0307509_104573141 | 175 |
| 1203 | 3300031548 | Ga0307408_100239629 | Ga0307408_1002396292 | 175 |
| 1204 | 3300031548 | Ga0307408_100926523 | Ga0307408_1009265232 | 175 |
| 1205 | 3300031595 | Ga0265313_10105838 | Ga0265313_101058382 | 175 |
| 1206 | 3300031616 | Ga0307508_10000002 | Ga0307508_10000002199 | 175 |
| 1207 | 3300031616 | Ga0307508_10069065 | Ga0307508_100690651 | 175 |
| 1208 | 3300031616 | Ga0307508_10122470 | Ga0307508_101224702 | 175 |
| 1209 | 3300031616 | Ga0307508_10277054 | Ga0307508_102770542 | 175 |
| 1210 | 3300031649 | Ga0307514_10349235 | Ga0307514_103492351 | 175 |
| 1211 | 3300031711 | Ga0265314_10002643 | Ga0265314_100026432 | 175 |
| 1212 | 3300031712 | Ga0265342_10025508 | Ga0265342_100255083 | 175 |
| 1213 | 3300031730 | Ga0307516_10010347 | Ga0307516_100103474 | 175 |
| 1214 | 3300031730 | Ga0307516_10057865 | Ga0307516_100578652 | 175 |
| 1215 | 3300031730 | Ga0307516_10080348 | Ga0307516_100803483 | 175 |
| 1216 | 3300031730 | Ga0307516_10194781 | Ga0307516_101947812 | 175 |
| 1217 | 3300031730 | Ga0307516_10206258 | Ga0307516_102062581 | 175 |
| 1218 | 3300031730 | Ga0307516_10254949 | Ga0307516_102549492 | 175 |
| 1219 | 3300031730 | Ga0307516_10368644 | Ga0307516_103686441 | 175 |
| 1220 | 3300031731 | Ga0307405_10397902 | Ga0307405_103979021 | 175 |
| 1221 | 3300031731 | Ga0307405_10480557 | Ga0307405_104805572 | 175 |
| 1222 | 3300031824 | Ga0307413_10131084 | Ga0307413_101310842 | 175 |
| 1223 | 3300031838 | Ga0307518_10446350 | Ga0307518_104463501 | 175 |
| 1224 | 3300031901 | Ga0307406_10833496 | Ga0307406_108334961 | 175 |
| 1225 | 3300031903 | Ga0307407_11008579 | Ga0307407_110085791 | 175 |
| 1226 | 3300031911 | Ga0307412_10047890 | Ga0307412_100478904 | 175 |
| 1227 | 3300031911 | Ga0307412_10212569 | Ga0307412_102125692 | 175 |
| 1228 | 3300031911 | Ga0307412_10611833 | Ga0307412_106118332 | 175 |
| 1229 | 3300031995 | Ga0307409_100719317 | Ga0307409_1007193171 | 175 |
| 1230 | 3300031995 | Ga0307409_101144653 | Ga0307409_1011446531 | 175 |
| 1231 | 3300031995 | Ga0307409_101680384 | Ga0307409_1016803841 | 175 |
| 1232 | 3300032002 | Ga0307416_100286049 | Ga0307416_1002860492 | 175 |
| 1233 | 3300032002 | Ga0307416_101286121 | Ga0307416_1012861211 | 175 |
| 1234 | 3300032005 | Ga0307411_10043818 | Ga0307411_100438181 | 175 |
| 1235 | 3300032005 | Ga0307411_10356706 | Ga0307411_103567062 | 175 |
| 1236 | 3300032126 | Ga0307415_100120643 | Ga0307415_1001206432 | 175 |
| 1237 | 3300032126 | Ga0307415_100409367 | Ga0307415_1004093672 | 175 |
| 1238 | 3300032126 | Ga0307415_100459188 | Ga0307415_1004591882 | 175 |
| 1239 | 3300032126 | Ga0307415_101066138 | Ga0307415_1010661381 | 175 |
| 1240 | 3300033179 | Ga0307507_10019880 | Ga0307507_100198802 | 175 |
| 1241 | 3300033180 | Ga0307510_10006388 | Ga0307510_100063888 | 175 |
| 1242 | 3300033180 | Ga0307510_10060535 | Ga0307510_100605354 | 175 |
| 1243 | 3300033180 | Ga0307510_10098029 | Ga0307510_100980294 | 175 |
| 1244 | 3300033180 | Ga0307510_10158713 | Ga0307510_101587132 | 175 |
| 1245 | 3300033180 | Ga0307510_10263364 | Ga0307510_102633642 | 175 |
| 1246 | 3300033180 | Ga0307510_10351245 | Ga0307510_103512451 | 175 |
| 1247 | 3300035083 | Ga0373926_0204760 | Ga0373926_0204760_145_672 | 175 |
| 1248 | 3300035085 | Ga0373929_0013219 | Ga0373929_0013219_771_1298 | 175 |
| 1249 | 3300035086 | Ga0373934_0403326 | Ga0373934_0403326_19_546 | 175 |
| 1250 | 3300035092 | Ga0373952_0036440 | Ga0373952_0036440_92_619 | 175 |
| 1251 | 3300035113 | Ga0373936_0175848 | Ga0373936_0175848_118_645 | 175 |
| 1252 | 3300035115 | Ga0373941_0051773 | Ga0373941_0051773_87_614 | 175 |
| 1253 | 3300035116 | Ga0373945_0012397 | Ga0373945_0012397_1827_2354 | 175 |
| 1254 | 3300035117 | Ga0373953_0003462 | Ga0373953_0003462_2383_2910 | 175 |
| 1255 | 3300035117 | Ga0373953_0020246 | Ga0373953_0020246_1561_2088 | 175 |
| 1256 | 3300035118 | Ga0373954_0022141 | Ga0373954_0022141_619_1146 | 175 |
| 1257 | 3300035119 | Ga0373956_0021820 | Ga0373956_0021820_1339_1866 | 175 |
| 1258 | 3300035121 | Ga0373960_0083787 | Ga0373960_0083787_88_615 | 175 |
| 1259 | 3300035170 | Ga0373943_0166696 | Ga0373943_0166696_309_836 | 175 |
| 1260 | 3300035171 | Ga0373946_0015222 | Ga0373946_0015222_1076_1603 | 175 |
| 1261 | 3300035171 | Ga0373946_0059994 | Ga0373946_0059994_360_887 | 175 |
| 1262 | 3300035171 | Ga0373946_0082896 | Ga0373946_0082896_832_1359 | 175 |
| 1263 | 3300035172 | Ga0373955_0355612 | Ga0373955_0355612_87_614 | 175 |
| 1264 | 3300035207 | Ga0373942_0087315 | Ga0373942_0087315_92_619 | 175 |
| 1265 | 3300035207 | Ga0373942_0093267 | Ga0373942_0093267_139_666 | 175 |
| 1266 | 3300035410 | Ga0373924_0012332 | Ga0373924_0012332_13_540 | 175 |
| 1267 | 3300035410 | Ga0373924_0339503 | Ga0373924_0339503_23_550 | 175 |
| 1268 | 3300035691 | Ga0373931_0021852 | Ga0373931_0021852_1175_1702 | 175 |
| 1269 | 3300035691 | Ga0373931_0459360 | Ga0373931_0459360_46_576 | 175 |
| 1270 | 3300035691 | Ga0373931_0590294 | Ga0373931_0590294_153_680 | 175 |
| 1271 | 3300035692 | Ga0373935_0195807 | Ga0373935_0195807_584_1111 | 175 |
| 1272 | 3300035692 | Ga0373935_0413105 | Ga0373935_0413105_193_720 | 175 |
| 1273 | 3300035692 | Ga0373935_0483323 | Ga0373935_0483323_15_542 | 175 |
| 1274 | 3300035692 | Ga0373935_0614193 | Ga0373935_0614193_116_643 | 175 |
| 1275 | 3300035695 | Ga0373927_0009105 | Ga0373927_0009105_3029_3556 | 175 |
| 1276 | 3300035695 | Ga0373927_0031979 | Ga0373927_0031979_2062_2589 | 175 |
| 1277 | 3300035695 | Ga0373927_0080808 | Ga0373927_0080808_1434_1961 | 175 |
| 1278 | 3300035695 | Ga0373927_0184881 | Ga0373927_0184881_647_1174 | 175 |
| 1279 | 3300035695 | Ga0373927_0571068 | Ga0373927_0571068_25_552 | 175 |
| 1280 | 3300035725 | Ga0373947_0063009 | Ga0373947_0063009_1277_1804 | 175 |
| 1281 | 3300035725 | Ga0373947_0110883 | Ga0373947_0110883_909_1436 | 175 |
| 1282 | 3300035725 | Ga0373947_0663986 | Ga0373947_0663986_109_636 | 175 |
| 1283 | 3300036401 | Ga0373937_1502319 | Ga0373937_1502319_36_563 | 175 |
| 1284 | 3300037068 | Ga0373925_0068982 | Ga0373925_0068982_1743_2270 | 175 |
| 1285 | 3300037068 | Ga0373925_0071521 | Ga0373925_0071521_97_627 | 175 |
| 1286 | 3300037068 | Ga0373925_0074104 | Ga0373925_0074104_1920_2447 | 175 |
| 1287 | 3300037068 | Ga0373925_0105854 | Ga0373925_0105854_273_800 | 175 |
| 1288 | 3300037068 | Ga0373925_0113109 | Ga0373925_0113109_705_1232 | 175 |
| 1289 | 3300037068 | Ga0373925_0348751 | Ga0373925_0348751_209_736 | 175 |
| 1290 | 3300037068 | Ga0373925_0400676 | Ga0373925_0400676_527_1054 | 175 |
| 1291 | 3300037068 | Ga0373925_0863353 | Ga0373925_0863353_11_538 | 175 |
| 1292 | 3300037312 | Ga0395899_0090738 | Ga0395899_0090738_77_607 | 175 |
| 1293 | 3300037312 | Ga0395899_0611421 | Ga0395899_0611421_56_583 | 175 |
| 1294 | 3300037418 | Ga0395900_0001316 | Ga0395900_0001316_25598_26128 | 175 |
| 1295 | 3300037418 | Ga0395900_0093150 | Ga0395900_0093150_1756_2283 | 175 |
| 1296 | 3300037418 | Ga0395900_0196580 | Ga0395900_0196580_1291_1821 | 175 |
| 1297 | 3300037418 | Ga0395900_1203688 | Ga0395900_1203688_128_658 | 175 |
| 1298 | 3300037466 | Ga0395898_0010275 | Ga0395898_0010275_3682_4212 | 175 |
| 1299 | 3300037466 | Ga0395898_0094798 | Ga0395898_0094798_370_897 | 175 |
| 1300 | 3300037466 | Ga0395898_0821870 | Ga0395898_0821870_277_807 | 175 |
| 1301 | 3300037471 | Ga0395905_0032556 | Ga0395905_0032556_2786_3316 | 175 |
| 1302 | 3300037471 | Ga0395905_0100478 | Ga0395905_0100478_2031_2561 | 175 |
| 1303 | 3300037471 | Ga0395905_0583893 | Ga0395905_0583893_366_896 | 175 |
| 1304 | 3300037471 | Ga0395905_0584936 | Ga0395905_0584936_440_967 | 175 |
| 1305 | 3300037853 | Ga0436364_0479711 | Ga0436364_0479711_930_1457 | 175 |
| 1306 | 3300038443 | Ga0395901_0002762 | Ga0395901_0002762_8059_8589 | 175 |
| 1307 | 3300038443 | Ga0395901_0024984 | Ga0395901_0024984_2152_2679 | 175 |
| 1308 | 3300038443 | Ga0395901_0428126 | Ga0395901_0428126_409_939 | 175 |
| 1309 | 3300038443 | Ga0395901_0681119 | Ga0395901_0681119_53_583 | 175 |
| 1310 | 3300039437 | Ga0436365_0115121 | Ga0436365_0115121_1052_1579 | 175 |
| 1311 | 3300039437 | Ga0436365_0758504 | Ga0436365_0758504_7310_7837 | 175 |
| 1312 | 3300039437 | Ga0436365_1046572 | Ga0436365_1046572_1143_1670 | 175 |
| 1313 | 3300039438 | Ga0436360_0118011 | Ga0436360_0118011_294_821 | 175 |
| 1314 | 3300039438 | Ga0436360_0578760 | Ga0436360_0578760_764_1291 | 175 |
| 1315 | 3300039447 | Ga0436361_0310662 | Ga0436361_0310662_16_543 | 175 |
| 1316 | 3300039447 | Ga0436361_0944908 | Ga0436361_0944908_1035_1562 | 175 |
| 1317 | 3300039450 | Ga0436363_0519627 | Ga0436363_0519627_891_1418 | 175 |
| 1318 | 3300039450 | Ga0436363_0768792 | Ga0436363_0768792_493_1020 | 175 |
| 1319 | 3300039450 | Ga0436363_1259985 | Ga0436363_1259985_100_630 | 175 |
| 1320 | 3300039453 | Ga0436362_0646312 | Ga0436362_0646312_2387_2914 | 175 |
| 1321 | 3300039453 | Ga0436362_0683872 | Ga0436362_0683872_85_612 | 175 |
| 1322 | 3300039453 | Ga0436362_1179571 | Ga0436362_1179571_164_691 | 175 |
| 1323 | 3300041413 | Ga0439465_0044053 | Ga0439465_0044053_209_736 | 175 |
| 1324 | 3300041413 | Ga0439465_0305056 | Ga0439465_0305056_43_570 | 175 |
| 1325 | 3300041441 | Ga0451787_690731 | Ga0451787_690731_16_543 | 175 |
| 1326 | 3300041443 | Ga0451789_0739197 | Ga0451789_0739197_117_647 | 175 |
| 1327 | 3300041460 | Ga0451802_1371081 | Ga0451802_1371081_170_700 | 175 |
| 1328 | 3300041492 | Ga0451835_0832063 | Ga0451835_0832063_966_1496 | 175 |
| 1329 | 3300041494 | Ga0451837_1147329 | Ga0451837_1147329_171_698 | 175 |
| 1330 | 3300041498 | Ga0451841_1120699 | Ga0451841_1120699_93_620 | 175 |
| 1331 | 3300041503 | Ga0451847_0064418 | Ga0451847_0064418_95_625 | 175 |
| 1332 | 3300041505 | Ga0451849_1286864 | Ga0451849_1286864_45_572 | 175 |
| 1333 | 3300041511 | Ga0451855_0776935 | Ga0451855_0776935_33_563 | 175 |
| 1334 | 3300041512 | Ga0451853_0660391 | Ga0451853_0660391_112_642 | 175 |
| 1335 | 3300041997 | Ga0439431_0086864 | Ga0439431_0086864_225_752 | 175 |
| 1336 | 3300042006 | Ga0439432_062685 | Ga0439432_062685_117_644 | 175 |
| 1337 | 3300042012 | Ga0439455_0115184 | Ga0439455_0115184_200_730 | 175 |
| 1338 | 3300042438 | Ga0439459_0010127 | Ga0439459_0010127_264_791 | 175 |
| 1339 | 3300044656 | Ga0466969_0051658 | Ga0466969_0051658_949_1476 | 175 |
| 1340 | 3300044656 | Ga0466969_0161890 | Ga0466969_0161890_91_621 | 175 |
| 1341 | 3300044656 | Ga0466969_0233157 | Ga0466969_0233157_22_549 | 175 |
| 1342 | 3300044658 | Ga0466972_0000233 | Ga0466972_0000233_10383_10913 | 175 |
| 1343 | 3300044658 | Ga0466972_0159983 | Ga0466972_0159983_484_1014 | 175 |
| 1344 | 3300044683 | Ga0466965_0036463 | Ga0466965_0036463_358_888 | 175 |
| 1345 | 3300044683 | Ga0466965_0310190 | Ga0466965_0310190_284_814 | 175 |
| 1346 | 3300044684 | Ga0466966_0002503 | Ga0466966_0002503_7463_7993 | 175 |
| 1347 | 3300044693 | Ga0466961_0082983 | Ga0466961_0082983_760_1293 | 175 |
| 1348 | 3300044694 | Ga0466963_0244298 | Ga0466963_0244298_582_1109 | 175 |
| 1349 | 3300044694 | Ga0466963_0547362 | Ga0466963_0547362_194_727 | 175 |
| 1350 | 3300044706 | Ga0466964_0085037 | Ga0466964_0085037_184_711 | 175 |
| 1351 | 3300044706 | Ga0466964_0095512 | Ga0466964_0095512_345_875 | 175 |
| 1352 | 3300044719 | Ga0466971_0197001 | Ga0466971_0197001_224_754 | 175 |
| 1353 | 3300044735 | Ga0466968_0039562 | Ga0466968_0039562_1307_1837 | 175 |
| 1354 | 3300044735 | Ga0466968_0137252 | Ga0466968_0137252_42_575 | 175 |
| 1355 | 3300044735 | Ga0466968_0151835 | Ga0466968_0151835_505_1038 | 175 |
| 1356 | 3300044735 | Ga0466968_0262932 | Ga0466968_0262932_65_592 | 175 |
| 1357 | 3300044765 | Ga0466970_0198420 | Ga0466970_0198420_511_1038 | 175 |
| 1358 | 3300044765 | Ga0466970_0475710 | Ga0466970_0475710_117_647 | 175 |
| 1359 | 3300044842 | Ga0466957_0100843 | Ga0466957_0100843_1092_1625 | 175 |
| 1360 | 3300044842 | Ga0466957_0114068 | Ga0466957_0114068_43_573 | 175 |
| 1361 | 3300044901 | Ga0466960_0007069 | Ga0466960_0007069_676_1206 | 175 |
| 1362 | 3300044901 | Ga0466960_0194318 | Ga0466960_0194318_143_673 | 175 |
| 1363 | 3300045049 | Ga0466959_0002845 | Ga0466959_0002845_6152_6682 | 175 |
| 1364 | 3300045049 | Ga0466959_0116366 | Ga0466959_0116366_584_1114 | 175 |
| 1365 | 3300045049 | Ga0466959_0137990 | Ga0466959_0137990_29_562 | 175 |
| 1366 | 3300045049 | Ga0466959_0400247 | Ga0466959_0400247_269_796 | 175 |
| 1367 | 3300045836 | Ga0466958_0216963 | Ga0466958_0216963_343_876 | 175 |
| 1368 | 3300045836 | Ga0466958_0619762 | Ga0466958_0619762_119_649 | 175 |
| 1369 | 3300045976 | Ga0466967_0011377 | Ga0466967_0011377_2022_2552 | 175 |
| 1370 | 3300045976 | Ga0466967_0244800 | Ga0466967_0244800_669_1196 | 175 |
| 1371 | 3300045976 | Ga0466967_0382066 | Ga0466967_0382066_827_1354 | 175 |
| 1372 | 3300045976 | Ga0466967_1828536 | Ga0466967_1828536_13_540 | 175 |
| 1373 | 3300046452 | Ga0495617_044432 | Ga0495617_044432_202_729 | 175 |
| 1374 | 3300046454 | Ga0495592_0008192 | Ga0495592_0008192_2803_3336 | 175 |
| 1375 | 3300046454 | Ga0495592_0316684 | Ga0495592_0316684_356_886 | 175 |
| 1376 | 3300046455 | Ga0495603_0003601 | Ga0495603_0003601_2190_2717 | 175 |
| 1377 | 3300046455 | Ga0495603_0034333 | Ga0495603_0034333_2066_2593 | 175 |
| 1378 | 3300046455 | Ga0495603_0067820 | Ga0495603_0067820_1306_1833 | 175 |
| 1379 | 3300046455 | Ga0495603_0074844 | Ga0495603_0074844_1277_1804 | 175 |
| 1380 | 3300046455 | Ga0495603_0117159 | Ga0495603_0117159_52_579 | 175 |
| 1381 | 3300046457 | Ga0495590_0061425 | Ga0495590_0061425_72_602 | 175 |
| 1382 | 3300046457 | Ga0495590_0085742 | Ga0495590_0085742_34_561 | 175 |
| 1383 | 3300046458 | Ga0495591_107810 | Ga0495591_107810_31_558 | 175 |
| 1384 | 3300046459 | Ga0495629_0028838 | Ga0495629_0028838_1895_2425 | 175 |
| 1385 | 3300046459 | Ga0495629_0415907 | Ga0495629_0415907_311_838 | 175 |
| 1386 | 3300046459 | Ga0495629_0705026 | Ga0495629_0705026_73_600 | 175 |
| 1387 | 3300046462 | Ga0495651_0024936 | Ga0495651_0024936_2068_2595 | 175 |
| 1388 | 3300046462 | Ga0495651_0074998 | Ga0495651_0074998_1958_2485 | 175 |
| 1389 | 3300046462 | Ga0495651_0134806 | Ga0495651_0134806_414_944 | 175 |
| 1390 | 3300046463 | Ga0495653_0034538 | Ga0495653_0034538_2657_3190 | 175 |
| 1391 | 3300046463 | Ga0495653_0672185 | Ga0495653_0672185_59_586 | 175 |
| 1392 | 3300046471 | Ga0495650_0079005 | Ga0495650_0079005_248_778 | 175 |
| 1393 | 3300046471 | Ga0495650_0142071 | Ga0495650_0142071_279_806 | 175 |
| 1394 | 3300046472 | Ga0495580_0006567 | Ga0495580_0006567_3211_3738 | 175 |
| 1395 | 3300046472 | Ga0495580_0094095 | Ga0495580_0094095_1272_1799 | 175 |
| 1396 | 3300046473 | Ga0495582_0033966 | Ga0495582_0033966_953_1480 | 175 |
| 1397 | 3300046474 | Ga0495605_0225723 | Ga0495605_0225723_68_595 | 175 |
| 1398 | 3300046474 | Ga0495605_0230476 | Ga0495605_0230476_170_700 | 175 |
| 1399 | 3300046475 | Ga0495639_0020941 | Ga0495639_0020941_2119_2646 | 175 |
| 1400 | 3300046475 | Ga0495639_0057837 | Ga0495639_0057837_574_1101 | 175 |
| 1401 | 3300046475 | Ga0495639_0082570 | Ga0495639_0082570_171_698 | 175 |
| 1402 | 3300046475 | Ga0495639_0135593 | Ga0495639_0135593_622_1149 | 175 |
| 1403 | 3300046476 | Ga0495662_0124296 | Ga0495662_0124296_694_1221 | 175 |
| 1404 | 3300046476 | Ga0495662_0298728 | Ga0495662_0298728_48_575 | 175 |
| 1405 | 3300046477 | Ga0495664_0006504 | Ga0495664_0006504_170_697 | 175 |
| 1406 | 3300046477 | Ga0495664_0024055 | Ga0495664_0024055_336_869 | 175 |
| 1407 | 3300046477 | Ga0495664_0173613 | Ga0495664_0173613_10_537 | 175 |
| 1408 | 3300046477 | Ga0495664_0389133 | Ga0495664_0389133_100_627 | 175 |
| 1409 | 3300046491 | Ga0495584_0039293 | Ga0495584_0039293_1033_1560 | 175 |
| 1410 | 3300046491 | Ga0495584_0130957 | Ga0495584_0130957_55_582 | 175 |
| 1411 | 3300046491 | Ga0495584_0348863 | Ga0495584_0348863_158_685 | 175 |
| 1412 | 3300046492 | Ga0495585_0031581 | Ga0495585_0031581_1585_2112 | 175 |
| 1413 | 3300046499 | Ga0495594_0194338 | Ga0495594_0194338_550_1077 | 175 |
| 1414 | 3300046507 | Ga0495606_0000676 | Ga0495606_0000676_45336_45863 | 175 |
| 1415 | 3300046507 | Ga0495606_0033273 | Ga0495606_0033273_1128_1658 | 175 |
| 1416 | 3300046507 | Ga0495606_0088388 | Ga0495606_0088388_1323_1850 | 175 |
| 1417 | 3300046507 | Ga0495606_0272482 | Ga0495606_0272482_239_766 | 175 |
| 1418 | 3300046507 | Ga0495606_0490660 | Ga0495606_0490660_15_542 | 175 |
| 1419 | 3300046511 | Ga0495608_0010097 | Ga0495608_0010097_692_1225 | 175 |
| 1420 | 3300046511 | Ga0495608_0174182 | Ga0495608_0174182_25_552 | 175 |
| 1421 | 3300046511 | Ga0495608_0382367 | Ga0495608_0382367_296_823 | 175 |
| 1422 | 3300046512 | Ga0495610_0089160 | Ga0495610_0089160_621_1151 | 175 |
| 1423 | 3300046512 | Ga0495610_0089593 | Ga0495610_0089593_168_695 | 175 |
| 1424 | 3300046512 | Ga0495610_0090623 | Ga0495610_0090623_175_702 | 175 |
| 1425 | 3300046513 | Ga0495616_0071091 | Ga0495616_0071091_1089_1616 | 175 |
| 1426 | 3300046513 | Ga0495616_0305896 | Ga0495616_0305896_19_549 | 175 |
| 1427 | 3300046515 | Ga0495620_0047663 | Ga0495620_0047663_1113_1643 | 175 |
| 1428 | 3300046516 | Ga0495628_0028701 | Ga0495628_0028701_866_1399 | 175 |
| 1429 | 3300046517 | Ga0495630_0070146 | Ga0495630_0070146_525_1058 | 175 |
| 1430 | 3300046518 | Ga0495631_0098781 | Ga0495631_0098781_24_551 | 175 |
| 1431 | 3300046518 | Ga0495631_0141639 | Ga0495631_0141639_278_805 | 175 |
| 1432 | 3300046519 | Ga0495632_0044136 | Ga0495632_0044136_514_1041 | 175 |
| 1433 | 3300046519 | Ga0495632_0117916 | Ga0495632_0117916_679_1206 | 175 |
| 1434 | 3300046520 | Ga0495637_0078251 | Ga0495637_0078251_157_684 | 175 |
| 1435 | 3300046522 | Ga0495643_0141446 | Ga0495643_0141446_13_540 | 175 |
| 1436 | 3300046522 | Ga0495643_0148335 | Ga0495643_0148335_35_565 | 175 |
| 1437 | 3300046523 | Ga0495644_0051982 | Ga0495644_0051982_460_987 | 175 |
| 1438 | 3300046524 | Ga0495648_0001769 | Ga0495648_0001769_3987_4514 | 175 |
| 1439 | 3300046524 | Ga0495648_0009771 | Ga0495648_0009771_2683_3213 | 175 |
| 1440 | 3300046524 | Ga0495648_0098576 | Ga0495648_0098576_98_628 | 175 |
| 1441 | 3300046525 | Ga0495663_0081736 | Ga0495663_0081736_79_606 | 175 |
| 1442 | 3300046526 | Ga0495666_0057764 | Ga0495666_0057764_1305_1832 | 175 |
| 1443 | 3300046526 | Ga0495666_0125275 | Ga0495666_0125275_577_1107 | 175 |
| 1444 | 3300046529 | Ga0495652_0030851 | Ga0495652_0030851_2184_2717 | 175 |
| 1445 | 3300046529 | Ga0495652_0190426 | Ga0495652_0190426_875_1402 | 175 |
| 1446 | 3300046529 | Ga0495652_0202016 | Ga0495652_0202016_345_875 | 175 |
| 1447 | 3300046529 | Ga0495652_0494276 | Ga0495652_0494276_139_666 | 175 |
| 1448 | 3300046531 | Ga0495665_0145730 | Ga0495665_0145730_92_619 | 175 |
| 1449 | 3300046533 | Ga0495640_0017649 | Ga0495640_0017649_3137_3670 | 175 |
| 1450 | 3300046533 | Ga0495640_0046403 | Ga0495640_0046403_32_562 | 175 |
| 1451 | 3300046533 | Ga0495640_0047669 | Ga0495640_0047669_1184_1711 | 175 |
| 1452 | 3300046536 | Ga0495587_0047806 | Ga0495587_0047806_1296_1829 | 175 |
| 1453 | 3300046536 | Ga0495587_0066525 | Ga0495587_0066525_1478_2008 | 175 |
| 1454 | 3300046537 | Ga0495598_0015535 | Ga0495598_0015535_1237_1764 | 175 |
| 1455 | 3300046538 | Ga0495609_0037202 | Ga0495609_0037202_324_851 | 175 |
| 1456 | 3300046538 | Ga0495609_0142683 | Ga0495609_0142683_216_743 | 175 |
| 1457 | 3300046539 | Ga0495621_0051267 | Ga0495621_0051267_166_693 | 175 |
| 1458 | 3300046539 | Ga0495621_0273617 | Ga0495621_0273617_39_566 | 175 |
| 1459 | 3300046542 | Ga0495597_0110496 | Ga0495597_0110496_52_579 | 175 |
| 1460 | 3300046542 | Ga0495597_0137156 | Ga0495597_0137156_439_969 | 175 |
| 1461 | 3300046543 | Ga0495645_0005927 | Ga0495645_0005927_1924_2451 | 175 |
| 1462 | 3300046543 | Ga0495645_0113696 | Ga0495645_0113696_485_1018 | 175 |
| 1463 | 3300046543 | Ga0495645_0147846 | Ga0495645_0147846_1054_1581 | 175 |
| 1464 | 3300046557 | Ga0495622_0104771 | Ga0495622_0104771_191_721 | 175 |
| 1465 | 3300046557 | Ga0495622_0117725 | Ga0495622_0117725_311_838 | 175 |
| 1466 | 3300046557 | Ga0495622_0303296 | Ga0495622_0303296_67_594 | 175 |
| 1467 | 3300046557 | Ga0495622_0312049 | Ga0495622_0312049_97_624 | 175 |
| 1468 | 3300046558 | Ga0495633_0067378 | Ga0495633_0067378_1044_1571 | 175 |
| 1469 | 3300046558 | Ga0495633_0151909 | Ga0495633_0151909_310_837 | 175 |
| 1470 | 3300046559 | Ga0495667_0056925 | Ga0495667_0056925_656_1189 | 175 |
| 1471 | 3300046559 | Ga0495667_0195123 | Ga0495667_0195123_521_1048 | 175 |
| 1472 | 3300046615 | Ga0495656_0071471 | Ga0495656_0071471_690_1217 | 175 |
| 1473 | 3300046615 | Ga0495656_0096498 | Ga0495656_0096498_332_859 | 175 |
| 1474 | 3300046616 | Ga0495668_0043654 | Ga0495668_0043654_1778_2308 | 175 |
| 1475 | 3300046616 | Ga0495668_0056113 | Ga0495668_0056113_303_830 | 175 |
| 1476 | 3300046616 | Ga0495668_0065418 | Ga0495668_0065418_1020_1547 | 175 |
| 1477 | 3300046616 | Ga0495668_0089744 | Ga0495668_0089744_127_654 | 175 |
| 1478 | 3300046616 | Ga0495668_0122408 | Ga0495668_0122408_338_868 | 175 |
| 1479 | 3300046616 | Ga0495668_0262593 | Ga0495668_0262593_47_574 | 175 |
| 1480 | 3300046616 | Ga0495668_0314981 | Ga0495668_0314981_56_583 | 175 |
| 1481 | 3300046616 | Ga0495668_0372149 | Ga0495668_0372149_49_576 | 175 |
| 1482 | 3300046642 | Ga0495634_0117269 | Ga0495634_0117269_277_804 | 175 |
| 1483 | 3300046648 | Ga0495611_0116671 | Ga0495611_0116671_343_870 | 175 |
| 1484 | 3300046648 | Ga0495611_0298937 | Ga0495611_0298937_158_688 | 175 |
| 1485 | 3300046648 | Ga0495611_0329279 | Ga0495611_0329279_149_676 | 175 |
| 1486 | 3300046660 | Ga0495625_0071902 | Ga0495625_0071902_1353_1880 | 175 |
| 1487 | 3300046660 | Ga0495625_0215516 | Ga0495625_0215516_344_871 | 175 |
| 1488 | 3300046660 | Ga0495625_0352750 | Ga0495625_0352750_232_762 | 175 |
| 1489 | 3300046663 | Ga0495635_0136556 | Ga0495635_0136556_1034_1567 | 175 |
| 1490 | 3300046663 | Ga0495635_0159202 | Ga0495635_0159202_125_655 | 175 |
| 1491 | 3300046663 | Ga0495635_0231601 | Ga0495635_0231601_472_999 | 175 |
| 1492 | 3300046664 | Ga0495659_0028980 | Ga0495659_0028980_1236_1763 | 175 |
| 1493 | 3300046665 | Ga0495661_0371113 | Ga0495661_0371113_14_541 | 175 |
| 1494 | 3300046674 | Ga0495588_0020225 | Ga0495588_0020225_1398_1925 | 175 |
| 1495 | 3300046674 | Ga0495588_0265036 | Ga0495588_0265036_175_702 | 175 |
| 1496 | 3300046674 | Ga0495588_0272805 | Ga0495588_0272805_14_544 | 175 |
| 1497 | 3300046675 | Ga0495657_0002607 | Ga0495657_0002607_2076_2609 | 175 |
| 1498 | 3300046675 | Ga0495657_0011477 | Ga0495657_0011477_3820_4350 | 175 |
| 1499 | 3300046678 | Ga0495599_0171310 | Ga0495599_0171310_60_593 | 175 |
| 1500 | 3300046679 | Ga0495623_0055634 | Ga0495623_0055634_1643_2176 | 175 |
| 1501 | 3300046679 | Ga0495623_0174201 | Ga0495623_0174201_597_1124 | 175 |
| 1502 | 3300046680 | Ga0495646_0044662 | Ga0495646_0044662_1242_1775 | 175 |
| 1503 | 3300046680 | Ga0495646_0129781 | Ga0495646_0129781_217_744 | 175 |
| 1504 | 3300046681 | Ga0495647_0021934 | Ga0495647_0021934_32_559 | 175 |
| 1505 | 3300046683 | Ga0495658_0061625 | Ga0495658_0061625_42_569 | 175 |
| 1506 | 3300046684 | Ga0495669_0030344 | Ga0495669_0030344_380_907 | 175 |
| 1507 | 3300046684 | Ga0495669_0159733 | Ga0495669_0159733_51_578 | 175 |
| 1508 | 3300046684 | Ga0495669_0240688 | Ga0495669_0240688_69_596 | 175 |
| 1509 | 3300046684 | Ga0495669_0340417 | Ga0495669_0340417_53_583 | 175 |
| 1510 | 3300046689 | Ga0495613_0148244 | Ga0495613_0148244_896_1426 | 175 |
| 1511 | 3300046689 | Ga0495613_0264477 | Ga0495613_0264477_578_1111 | 175 |
| 1512 | 3300046690 | Ga0495624_0051457 | Ga0495624_0051457_683_1210 | 175 |
| 1513 | 3300046690 | Ga0495624_0283639 | Ga0495624_0283639_102_629 | 175 |
| 1514 | 3300046690 | Ga0495624_0415619 | Ga0495624_0415619_166_693 | 175 |
| 1515 | 3300046691 | Ga0495670_0171586 | Ga0495670_0171586_70_597 | 175 |
| 1516 | 3300046692 | Ga0495671_0044453 | Ga0495671_0044453_1562_2092 | 175 |
| 1517 | 3300046692 | Ga0495671_0278107 | Ga0495671_0278107_28_555 | 175 |
| 1518 | 3300046692 | Ga0495671_0439866 | Ga0495671_0439866_56_583 | 175 |
| 1519 | 3300046694 | Ga0495649_0002747 | Ga0495649_0002747_7233_7763 | 175 |
| 1520 | 3300046694 | Ga0495649_0156285 | Ga0495649_0156285_624_1154 | 175 |
| 1521 | 3300046694 | Ga0495649_0356621 | Ga0495649_0356621_167_694 | 175 |
| 1522 | 3300046794 | Ga0495589_0063551 | Ga0495589_0063551_559_1089 | 175 |
| 1523 | 3300046794 | Ga0495589_0085016 | Ga0495589_0085016_787_1314 | 175 |
| 1524 | 3300046794 | Ga0495589_0229217 | Ga0495589_0229217_271_798 | 175 |
| 1525 | 3300046809 | Ga0495600_0004076 | Ga0495600_0004076_2692_3225 | 175 |
| 1526 | 3300046809 | Ga0495600_0051028 | Ga0495600_0051028_366_893 | 175 |
| 1527 | 3300046809 | Ga0495600_0053596 | Ga0495600_0053596_744_1274 | 175 |
| 1528 | 3300046809 | Ga0495600_0248931 | Ga0495600_0248931_253_780 | 175 |
| 1529 | 3300047315 | Ga0495581_0032284 | Ga0495581_0032284_538_1068 | 175 |
| 1530 | 3300047315 | Ga0495581_0080363 | Ga0495581_0080363_1108_1635 | 175 |
| 1531 | 3300047315 | Ga0495581_0507569 | Ga0495581_0507569_43_576 | 175 |
| 1532 | 3300047317 | Ga0495604_0017042 | Ga0495604_0017042_1003_1536 | 175 |
| 1533 | 3300047317 | Ga0495604_0107040 | Ga0495604_0107040_639_1169 | 175 |
| 1534 | 3300047317 | Ga0495604_0174913 | Ga0495604_0174913_596_1123 | 175 |
| 1535 | 3300047317 | Ga0495604_0306912 | Ga0495604_0306912_453_980 | 175 |
| 1536 | 3300047318 | Ga0495636_0080836 | Ga0495636_0080836_390_917 | 175 |
| 1537 | 3300047318 | Ga0495636_0136043 | Ga0495636_0136043_307_834 | 175 |
| 1538 | 3300047319 | Ga0495674_0011448 | Ga0495674_0011448_6072_6599 | 175 |
| 1539 | 3300047319 | Ga0495674_0252779 | Ga0495674_0252779_412_939 | 175 |
| 1540 | 3300047319 | Ga0495674_0787159 | Ga0495674_0787159_73_600 | 175 |
| 1541 | 3300047320 | Ga0495672_0017769 | Ga0495672_0017769_2943_3470 | 175 |
| 1542 | 3300047321 | Ga0495676_0060257 | Ga0495676_0060257_56_583 | 175 |
| 1543 | 3300047321 | Ga0495676_0095841 | Ga0495676_0095841_746_1273 | 175 |
| 1544 | 3300047321 | Ga0495676_0325583 | Ga0495676_0325583_161_688 | 175 |
| 1545 | 3300047321 | Ga0495676_0369370 | Ga0495676_0369370_266_793 | 175 |
| 1546 | 3300047321 | Ga0495676_0435803 | Ga0495676_0435803_161_688 | 175 |
| 1547 | 3300047322 | Ga0495680_0040840 | Ga0495680_0040840_1772_2305 | 175 |
| 1548 | 3300047323 | Ga0495683_0025892 | Ga0495683_0025892_1296_1826 | 175 |
| 1549 | 3300047323 | Ga0495683_0329099 | Ga0495683_0329099_78_605 | 175 |
| 1550 | 3300047443 | Ga0495687_031675 | Ga0495687_031675_1630_2160 | 175 |
| 1551 | 3300047444 | Ga0495675_0002941 | Ga0495675_0002941_2471_3004 | 175 |
| 1552 | 3300047447 | Ga0495685_207736 | Ga0495685_207736_12_539 | 175 |
| 1553 | 3300047469 | Ga0495673_0061080 | Ga0495673_0061080_460_990 | 175 |
| 1554 | 3300047469 | Ga0495673_0186320 | Ga0495673_0186320_221_748 | 175 |
| 1555 | 3300047471 | Ga0495684_0033429 | Ga0495684_0033429_1890_2417 | 175 |
| 1556 | 3300047471 | Ga0495684_0098483 | Ga0495684_0098483_1018_1548 | 175 |
| 1557 | 3300047472 | Ga0495686_0082026 | Ga0495686_0082026_1091_1630 | 175 |
| 1558 | 3300047472 | Ga0495686_0100852 | Ga0495686_0100852_892_1422 | 175 |
| 1559 | 3300047472 | Ga0495686_0148202 | Ga0495686_0148202_689_1219 | 175 |
| 1560 | 3300047472 | Ga0495686_0222536 | Ga0495686_0222536_273_800 | 175 |
| 1561 | 3300047472 | Ga0495686_0238766 | Ga0495686_0238766_397_924 | 175 |
| 1562 | 3300047472 | Ga0495686_0314023 | Ga0495686_0314023_251_778 | 175 |
| 1563 | 3300048088 | Ga0495602_0021964 | Ga0495602_0021964_1265_1798 | 175 |
| 1564 | 3300048090 | Ga0495615_0007906 | Ga0495615_0007906_310_837 | 175 |
| 1565 | 3300048091 | Ga0495626_0109357 | Ga0495626_0109357_610_1137 | 175 |
| 1566 | 3300048903 | Ga0496100_0028315 | Ga0496100_0028315_37_564 | 175 |
| 1567 | 3300048903 | Ga0496100_0140332 | Ga0496100_0140332_318_845 | 175 |
| 1568 | 3300048903 | Ga0496100_0650342 | Ga0496100_0650342_54_581 | 175 |
| 1569 | 3300048903 | Ga0496100_0870388 | Ga0496100_0870388_65_595 | 175 |
| 1570 | 3300048904 | Ga0496101_0003628 | Ga0496101_0003628_6697_7224 | 175 |
| 1571 | 3300048904 | Ga0496101_0070733 | Ga0496101_0070733_95_625 | 175 |
| 1572 | 3300048905 | Ga0496102_0004361 | Ga0496102_0004361_9796_10323 | 175 |
| 1573 | 3300048905 | Ga0496102_0129771 | Ga0496102_0129771_961_1488 | 175 |
| 1574 | 3300048905 | Ga0496102_0375761 | Ga0496102_0375761_326_916 | 175 |
| 1575 | 3300048905 | Ga0496102_0433977 | Ga0496102_0433977_492_1019 | 175 |
| 1576 | 3300048905 | Ga0496102_0584517 | Ga0496102_0584517_352_879 | 175 |
| 1577 | 3300048905 | Ga0496102_0975554 | Ga0496102_0975554_131_661 | 175 |
| 1578 | 3300048906 | Ga0496103_0130167 | Ga0496103_0130167_487_1014 | 175 |
| 1579 | 3300048906 | Ga0496103_0137613 | Ga0496103_0137613_845_1375 | 175 |
| 1580 | 3300048906 | Ga0496103_0599734 | Ga0496103_0599734_153_680 | 175 |
| 1581 | 3300048907 | Ga0496104_0020661 | Ga0496104_0020661_4867_5457 | 175 |
| 1582 | 3300048907 | Ga0496104_0118046 | Ga0496104_0118046_712_1242 | 175 |
| 1583 | 3300048907 | Ga0496104_0131500 | Ga0496104_0131500_1057_1587 | 175 |
| 1584 | 3300048907 | Ga0496104_0199944 | Ga0496104_0199944_985_1512 | 175 |
| 1585 | 3300048907 | Ga0496104_0222785 | Ga0496104_0222785_1247_1774 | 175 |
| 1586 | 3300048907 | Ga0496104_0255091 | Ga0496104_0255091_413_940 | 175 |
| 1587 | 3300048907 | Ga0496104_0321739 | Ga0496104_0321739_846_1376 | 175 |
| 1588 | 3300048907 | Ga0496104_1388885 | Ga0496104_1388885_38_568 | 175 |
| 1589 | 3300048908 | Ga0496105_0000647 | Ga0496105_0000647_155_685 | 175 |
| 1590 | 3300048908 | Ga0496105_0023303 | Ga0496105_0023303_3680_4207 | 175 |
| 1591 | 3300048908 | Ga0496105_0279500 | Ga0496105_0279500_500_1030 | 175 |
| 1592 | 3300048908 | Ga0496105_0356569 | Ga0496105_0356569_106_696 | 175 |
| 1593 | 3300048908 | Ga0496105_0393931 | Ga0496105_0393931_90_617 | 175 |
| 1594 | 3300048908 | Ga0496105_0502624 | Ga0496105_0502624_322_852 | 175 |
| 1595 | 3300048909 | Ga0496106_0000960 | Ga0496106_0000960_9694_10221 | 175 |
| 1596 | 3300048909 | Ga0496106_0011693 | Ga0496106_0011693_3775_4302 | 175 |
| 1597 | 3300048909 | Ga0496106_0026408 | Ga0496106_0026408_2033_2623 | 175 |
| 1598 | 3300048909 | Ga0496106_0046946 | Ga0496106_0046946_189_716 | 175 |
| 1599 | 3300048909 | Ga0496106_0077578 | Ga0496106_0077578_1014_1541 | 175 |
| 1600 | 3300048909 | Ga0496106_0144123 | Ga0496106_0144123_480_1007 | 175 |
| 1601 | 3300048909 | Ga0496106_0229713 | Ga0496106_0229713_910_1437 | 175 |
| 1602 | 3300048909 | Ga0496106_0321360 | Ga0496106_0321360_373_900 | 175 |
| 1603 | 3300048909 | Ga0496106_0810702 | Ga0496106_0810702_10_540 | 175 |
| 1604 | 3300048910 | Ga0496107_0003437 | Ga0496107_0003437_1147_1674 | 175 |
| 1605 | 3300048910 | Ga0496107_0018169 | Ga0496107_0018169_1297_1824 | 175 |
| 1606 | 3300048910 | Ga0496107_0051167 | Ga0496107_0051167_717_1244 | 175 |
| 1607 | 3300048910 | Ga0496107_0168176 | Ga0496107_0168176_846_1373 | 175 |
| 1608 | 3300048910 | Ga0496107_0266274 | Ga0496107_0266274_529_1119 | 175 |
| 1609 | 3300048910 | Ga0496107_0985019 | Ga0496107_0985019_34_561 | 175 |
| 1610 | 3300048911 | Ga0496108_0000803 | Ga0496108_0000803_9745_10272 | 175 |
| 1611 | 3300048911 | Ga0496108_0029498 | Ga0496108_0029498_2412_2939 | 175 |
| 1612 | 3300048911 | Ga0496108_0038906 | Ga0496108_0038906_668_1195 | 175 |
| 1613 | 3300048911 | Ga0496108_0105623 | Ga0496108_0105623_819_1409 | 175 |
| 1614 | 3300048911 | Ga0496108_0153998 | Ga0496108_0153998_1426_1953 | 175 |
| 1615 | 3300048911 | Ga0496108_0233495 | Ga0496108_0233495_736_1263 | 175 |
| 1616 | 3300048911 | Ga0496108_0664449 | Ga0496108_0664449_34_564 | 175 |
| 1617 | 3300048911 | Ga0496108_0695171 | Ga0496108_0695171_66_593 | 175 |
| 1618 | 3300048911 | Ga0496108_1154650 | Ga0496108_1154650_95_622 | 175 |
| 1619 | 3300048912 | Ga0496109_0001236 | Ga0496109_0001236_17270_17797 | 175 |
| 1620 | 3300048912 | Ga0496109_0017599 | Ga0496109_0017599_4445_5035 | 175 |
| 1621 | 3300048912 | Ga0496109_0033008 | Ga0496109_0033008_3511_4038 | 175 |
| 1622 | 3300048912 | Ga0496109_0128689 | Ga0496109_0128689_1308_1835 | 175 |
| 1623 | 3300048912 | Ga0496109_0228190 | Ga0496109_0228190_568_1095 | 175 |
| 1624 | 3300048912 | Ga0496109_0933745 | Ga0496109_0933745_74_604 | 175 |
| 1625 | 3300048913 | Ga0496110_0027403 | Ga0496110_0027403_3730_4257 | 175 |
| 1626 | 3300048913 | Ga0496110_0078125 | Ga0496110_0078125_1541_2071 | 175 |
| 1627 | 3300048913 | Ga0496110_0155677 | Ga0496110_0155677_292_819 | 175 |
| 1628 | 3300048913 | Ga0496110_0171333 | Ga0496110_0171333_991_1518 | 175 |
| 1629 | 3300048913 | Ga0496110_0231296 | Ga0496110_0231296_257_784 | 175 |
| 1630 | 3300048913 | Ga0496110_0372681 | Ga0496110_0372681_647_1174 | 175 |
| 1631 | 3300048913 | Ga0496110_0621048 | Ga0496110_0621048_233_763 | 175 |
| 1632 | 3300048913 | Ga0496110_0664355 | Ga0496110_0664355_107_634 | 175 |
| 1633 | 3300048913 | Ga0496110_1075367 | Ga0496110_1075367_98_625 | 175 |
| 1634 | 3300048914 | Ga0496111_0049775 | Ga0496111_0049775_781_1308 | 175 |
| 1635 | 3300048914 | Ga0496111_0072278 | Ga0496111_0072278_1066_1593 | 175 |
| 1636 | 3300048914 | Ga0496111_0144636 | Ga0496111_0144636_1104_1634 | 175 |
| 1637 | 3300048914 | Ga0496111_0153009 | Ga0496111_0153009_563_1090 | 175 |
| 1638 | 3300048914 | Ga0496111_0180632 | Ga0496111_0180632_752_1342 | 175 |
| 1639 | 3300048914 | Ga0496111_0345559 | Ga0496111_0345559_116_643 | 175 |
| 1640 | 3300048914 | Ga0496111_0612502 | Ga0496111_0612502_69_596 | 175 |
| 1641 | 3300048915 | Ga0496112_0000015 | Ga0496112_0000015_168331_168858 | 175 |
| 1642 | 3300048915 | Ga0496112_0002678 | Ga0496112_0002678_1550_2077 | 175 |
| 1643 | 3300048915 | Ga0496112_0019376 | Ga0496112_0019376_97_624 | 175 |
| 1644 | 3300048915 | Ga0496112_0024342 | Ga0496112_0024342_3010_3537 | 175 |
| 1645 | 3300048915 | Ga0496112_0029519 | Ga0496112_0029519_163_693 | 175 |
| 1646 | 3300048915 | Ga0496112_0167136 | Ga0496112_0167136_619_1146 | 175 |
| 1647 | 3300048915 | Ga0496112_0390282 | Ga0496112_0390282_340_870 | 175 |
| 1648 | 3300048915 | Ga0496112_0413932 | Ga0496112_0413932_675_1202 | 175 |
| 1649 | 3300048915 | Ga0496112_0515023 | Ga0496112_0515023_383_910 | 175 |
| 1650 | 3300048916 | Ga0496113_0006745 | Ga0496113_0006745_1570_2097 | 175 |
| 1651 | 3300048916 | Ga0496113_0042625 | Ga0496113_0042625_107_637 | 175 |
| 1652 | 3300048916 | Ga0496113_0058775 | Ga0496113_0058775_667_1194 | 175 |
| 1653 | 3300048916 | Ga0496113_0125174 | Ga0496113_0125174_444_1034 | 175 |
| 1654 | 3300048916 | Ga0496113_0357593 | Ga0496113_0357593_178_705 | 175 |
| 1655 | 3300048916 | Ga0496113_0444029 | Ga0496113_0444029_115_642 | 175 |
| 1656 | 3300048917 | Ga0496114_0030749 | Ga0496114_0030749_237_764 | 175 |
| 1657 | 3300048917 | Ga0496114_0095732 | Ga0496114_0095732_1092_1619 | 175 |
| 1658 | 3300048917 | Ga0496114_0175899 | Ga0496114_0175899_1278_1805 | 175 |
| 1659 | 3300048917 | Ga0496114_0293444 | Ga0496114_0293444_619_1146 | 175 |
| 1660 | 3300048918 | Ga0496115_0034663 | Ga0496115_0034663_1517_2044 | 175 |
| 1661 | 3300048918 | Ga0496115_0044070 | Ga0496115_0044070_2504_3031 | 175 |
| 1662 | 3300048918 | Ga0496115_0064821 | Ga0496115_0064821_1757_2284 | 175 |
| 1663 | 3300048918 | Ga0496115_0098472 | Ga0496115_0098472_1801_2331 | 175 |
| 1664 | 3300048918 | Ga0496115_0160537 | Ga0496115_0160537_839_1366 | 175 |
| 1665 | 3300048918 | Ga0496115_0197494 | Ga0496115_0197494_658_1248 | 175 |
| 1666 | 3300048918 | Ga0496115_0351997 | Ga0496115_0351997_211_741 | 175 |
| 1667 | 3300048918 | Ga0496115_0442544 | Ga0496115_0442544_502_1029 | 175 |
| 1668 | 3300048918 | Ga0496115_0476550 | Ga0496115_0476550_235_762 | 175 |
| 1669 | 3300048919 | Ga0496116_0345004 | Ga0496116_0345004_120_650 | 175 |
| 1670 | 3300048920 | Ga0496117_0027401 | Ga0496117_0027401_1724_2251 | 175 |
| 1671 | 3300048920 | Ga0496117_0065431 | Ga0496117_0065431_1415_1945 | 175 |
| 1672 | 3300048920 | Ga0496117_0122059 | Ga0496117_0122059_875_1402 | 175 |
| 1673 | 3300048920 | Ga0496117_0125366 | Ga0496117_0125366_792_1319 | 175 |
| 1674 | 3300048921 | Ga0496118_0004286 | Ga0496118_0004286_2742_3269 | 175 |
| 1675 | 3300048921 | Ga0496118_0040381 | Ga0496118_0040381_1243_1773 | 175 |
| 1676 | 3300048921 | Ga0496118_0053221 | Ga0496118_0053221_41_571 | 175 |
| 1677 | 3300048921 | Ga0496118_0057571 | Ga0496118_0057571_710_1297 | 175 |
| 1678 | 3300048921 | Ga0496118_0093693 | Ga0496118_0093693_205_732 | 175 |
| 1679 | 3300048921 | Ga0496118_0179735 | Ga0496118_0179735_152_679 | 175 |
| 1680 | 3300048921 | Ga0496118_0291127 | Ga0496118_0291127_341_871 | 175 |
| 1681 | 3300048922 | Ga0496119_0183306 | Ga0496119_0183306_429_956 | 175 |
| 1682 | 3300048922 | Ga0496119_0312083 | Ga0496119_0312083_203_733 | 175 |
| 1683 | 3300048923 | Ga0496120_0029227 | Ga0496120_0029227_269_799 | 175 |
| 1684 | 3300048923 | Ga0496120_0113881 | Ga0496120_0113881_763_1290 | 175 |
| 1685 | 3300048924 | Ga0496121_0000423 | Ga0496121_0000423_70249_70776 | 175 |
| 1686 | 3300048924 | Ga0496121_0016177 | Ga0496121_0016177_473_1003 | 175 |
| 1687 | 3300048924 | Ga0496121_0066527 | Ga0496121_0066527_1036_1566 | 175 |
| 1688 | 3300048924 | Ga0496121_0071616 | Ga0496121_0071616_1929_2456 | 175 |
| 1689 | 3300048924 | Ga0496121_0109860 | Ga0496121_0109860_1330_1917 | 175 |
| 1690 | 3300048924 | Ga0496121_0133830 | Ga0496121_0133830_193_720 | 175 |
| 1691 | 3300048924 | Ga0496121_0226364 | Ga0496121_0226364_136_663 | 175 |
| 1692 | 3300048924 | Ga0496121_0277560 | Ga0496121_0277560_472_999 | 175 |
| 1693 | 3300048924 | Ga0496121_0290060 | Ga0496121_0290060_372_899 | 175 |
| 1694 | 3300048924 | Ga0496121_0422065 | Ga0496121_0422065_281_811 | 175 |
| 1695 | 3300048924 | Ga0496121_0673464 | Ga0496121_0673464_70_600 | 175 |
| 1696 | 3300048925 | Ga0496122_0014922 | Ga0496122_0014922_582_1136 | 175 |
| 1697 | 3300048925 | Ga0496122_0119135 | Ga0496122_0119135_983_1522 | 175 |
| 1698 | 3300048927 | Ga0496124_0005449 | Ga0496124_0005449_5796_6323 | 175 |
| 1699 | 3300048927 | Ga0496124_0134487 | Ga0496124_0134487_871_1398 | 175 |
| 1700 | 3300048927 | Ga0496124_0199703 | Ga0496124_0199703_81_608 | 175 |
| 1701 | 3300048927 | Ga0496124_0249923 | Ga0496124_0249923_41_571 | 175 |
| 1702 | 3300048927 | Ga0496124_0351733 | Ga0496124_0351733_56_586 | 175 |
| 1703 | 3300048928 | Ga0496125_0000136 | Ga0496125_0000136_110731_111270 | 175 |
| 1704 | 3300048928 | Ga0496125_0049468 | Ga0496125_0049468_1305_1835 | 175 |
| 1705 | 3300048928 | Ga0496125_0063927 | Ga0496125_0063927_242_772 | 175 |
| 1706 | 3300048928 | Ga0496125_0064445 | Ga0496125_0064445_2019_2546 | 175 |
| 1707 | 3300048928 | Ga0496125_0066903 | Ga0496125_0066903_2229_2816 | 175 |
| 1708 | 3300048928 | Ga0496125_0148114 | Ga0496125_0148114_1041_1568 | 175 |
| 1709 | 3300048928 | Ga0496125_0191802 | Ga0496125_0191802_523_1053 | 175 |
| 1710 | 3300048928 | Ga0496125_0329748 | Ga0496125_0329748_362_889 | 175 |
| 1711 | 3300048928 | Ga0496125_0621598 | Ga0496125_0621598_27_554 | 175 |
| 1712 | 3300048929 | Ga0496126_0007880 | Ga0496126_0007880_3947_4474 | 175 |
| 1713 | 3300048929 | Ga0496126_0008016 | Ga0496126_0008016_5610_6164 | 175 |
| 1714 | 3300048929 | Ga0496126_0013800 | Ga0496126_0013800_4101_4628 | 175 |
| 1715 | 3300048929 | Ga0496126_0046719 | Ga0496126_0046719_2386_2913 | 175 |
| 1716 | 3300048929 | Ga0496126_0074875 | Ga0496126_0074875_2232_2762 | 175 |
| 1717 | 3300048929 | Ga0496126_0107865 | Ga0496126_0107865_1049_1576 | 175 |
| 1718 | 3300048929 | Ga0496126_0173191 | Ga0496126_0173191_1001_1528 | 175 |
| 1719 | 3300048929 | Ga0496126_0185006 | Ga0496126_0185006_1186_1713 | 175 |
| 1720 | 3300048929 | Ga0496126_0214651 | Ga0496126_0214651_40_567 | 175 |
| 1721 | 3300048929 | Ga0496126_0235647 | Ga0496126_0235647_302_829 | 175 |
| 1722 | 3300048929 | Ga0496126_0249024 | Ga0496126_0249024_27_554 | 175 |
| 1723 | 3300048929 | Ga0496126_0253838 | Ga0496126_0253838_632_1162 | 175 |
| 1724 | 3300048929 | Ga0496126_0382430 | Ga0496126_0382430_491_1018 | 175 |
| 1725 | 3300048929 | Ga0496126_0430013 | Ga0496126_0430013_307_834 | 175 |
| 1726 | 3300048929 | Ga0496126_0453361 | Ga0496126_0453361_80_631 | 175 |
| 1727 | 3300049460 | Ga0495682_0016334 | Ga0495682_0016334_168_698 | 175 |
| 1728 | 3300049460 | Ga0495682_0146685 | Ga0495682_0146685_47_574 | 175 |
| 1729 | 3300049568 | Ga0501031_0000390 | Ga0501031_0000390_18024_18554 | 175 |
| 1730 | 3300049569 | Ga0501032_0014322 | Ga0501032_0014322_3146_3676 | 175 |
| 1731 | 3300049569 | Ga0501032_0354299 | Ga0501032_0354299_171_701 | 175 |
| 1732 | 3300049570 | Ga0501033_0000205 | Ga0501033_0000205_18187_18717 | 175 |
| 1733 | 3300049570 | Ga0501033_0202584 | Ga0501033_0202584_496_1041 | 175 |
| 1734 | 3300049571 | Ga0501034_0044925 | Ga0501034_0044925_1327_1872 | 175 |
| 1735 | 3300049572 | Ga0501036_0111918 | Ga0501036_0111918_671_1201 | 175 |
| 1736 | 3300049572 | Ga0501036_0229541 | Ga0501036_0229541_746_1273 | 175 |
| 1737 | 3300049572 | Ga0501036_0388014 | Ga0501036_0388014_557_1087 | 175 |
| 1738 | 3300049572 | Ga0501036_0613038 | Ga0501036_0613038_78_608 | 175 |
| 1739 | 3300049573 | Ga0501037_0001134 | Ga0501037_0001134_6047_6577 | 175 |
| 1740 | 3300049573 | Ga0501037_0213237 | Ga0501037_0213237_402_929 | 175 |
| 1741 | 3300049573 | Ga0501037_0299844 | Ga0501037_0299844_70_615 | 175 |
| 1742 | 3300049573 | Ga0501037_0818210 | Ga0501037_0818210_69_599 | 175 |
| 1743 | 3300049574 | Ga0501038_0095343 | Ga0501038_0095343_1789_2319 | 175 |
| 1744 | 3300049574 | Ga0501038_0718608 | Ga0501038_0718608_39_569 | 175 |
| 1745 | 3300049575 | Ga0501039_0005007 | Ga0501039_0005007_677_1207 | 175 |
| 1746 | 3300049577 | Ga0501041_0219230 | Ga0501041_0219230_61_588 | 175 |
| 1747 | 3300049578 | Ga0501042_0041282 | Ga0501042_0041282_579_1109 | 175 |
| 1748 | 3300049579 | Ga0501043_0013802 | Ga0501043_0013802_523_1053 | 175 |
| 1749 | 3300049580 | Ga0501046_0005064 | Ga0501046_0005064_1929_2459 | 175 |
| 1750 | 3300049581 | Ga0501047_0010641 | Ga0501047_0010641_1396_1941 | 175 |
| 1751 | 3300049581 | Ga0501047_0289630 | Ga0501047_0289630_740_1270 | 175 |
| 1752 | 3300049581 | Ga0501047_0884414 | Ga0501047_0884414_119_649 | 175 |
| 1753 | 3300049583 | Ga0501067_0112428 | Ga0501067_0112428_886_1413 | 175 |
| 1754 | 3300049584 | Ga0501068_0627946 | Ga0501068_0627946_153_680 | 175 |
| 1755 | 3300049585 | Ga0501069_0157932 | Ga0501069_0157932_71_598 | 175 |
| 1756 | 3300049586 | Ga0501070_0052132 | Ga0501070_0052132_18_551 | 175 |
| 1757 | 3300049586 | Ga0501070_0106087 | Ga0501070_0106087_287_832 | 175 |
| 1758 | 3300049586 | Ga0501070_0370610 | Ga0501070_0370610_173_703 | 175 |
| 1759 | 3300049586 | Ga0501070_0754677 | Ga0501070_0754677_109_639 | 175 |
| 1760 | 3300049587 | Ga0501071_0119488 | Ga0501071_0119488_141_668 | 175 |
| 1761 | 3300049589 | Ga0501073_0067728 | Ga0501073_0067728_1034_1567 | 175 |
| 1762 | 3300049589 | Ga0501073_0650660 | Ga0501073_0650660_150_680 | 175 |
| 1763 | 3300049590 | Ga0501074_0031492 | Ga0501074_0031492_2588_3121 | 175 |
| 1764 | 3300049590 | Ga0501074_0563924 | Ga0501074_0563924_117_647 | 175 |
| 1765 | 3300049592 | Ga0501076_0629471 | Ga0501076_0629471_348_875 | 175 |
| 1766 | 3300049741 | Ga0501079_0361197 | Ga0501079_0361197_572_1099 | 175 |
| 1767 | 3300049742 | Ga0501080_0082585 | Ga0501080_0082585_1707_2240 | 175 |
| 1768 | 3300049742 | Ga0501080_0238244 | Ga0501080_0238244_863_1393 | 175 |
| 1769 | 3300049742 | Ga0501080_0856556 | Ga0501080_0856556_27_554 | 175 |
| 1770 | 3300049822 | Ga0501035_0029757 | Ga0501035_0029757_3318_3848 | 175 |
| 1771 | 3300049822 | Ga0501035_0074363 | Ga0501035_0074363_435_980 | 175 |
| 1772 | 3300049822 | Ga0501035_0106217 | Ga0501035_0106217_1721_2248 | 175 |
| 1773 | 3300049823 | Ga0501044_0005118 | Ga0501044_0005118_8344_8874 | 175 |
| 1774 | 3300049823 | Ga0501044_0059132 | Ga0501044_0059132_605_1150 | 175 |
| 1775 | 3300049823 | Ga0501044_0153987 | Ga0501044_0153987_473_1003 | 175 |
| 1776 | 3300049823 | Ga0501044_0271780 | Ga0501044_0271780_191_724 | 175 |
| 1777 | 3300049823 | Ga0501044_0926597 | Ga0501044_0926597_136_666 | 175 |
| 1778 | 3300049824 | Ga0501045_0270674 | Ga0501045_0270674_542_1072 | 175 |
| 1779 | 3300050489 | nmdc:mga03683_164689_c1 | nmdc:mga03683_164689_c1_158_685 | 175 |
| 1780 | 3300050489 | nmdc:mga03683_40505_c1 | nmdc:mga03683_40505_c1_221_748 | 175 |
| 1781 | 3300050489 | nmdc:mga03683_41994_c1 | nmdc:mga03683_41994_c1_1210_1737 | 175 |
| 1782 | 3300050490 | nmdc:mga03n38_1418_c1 | nmdc:mga03n38_1418_c1_6282_6809 | 175 |
| 1783 | 3300050490 | nmdc:mga03n38_453607_c1 | nmdc:mga03n38_453607_c1_25_552 | 175 |
| 1784 | 3300050490 | nmdc:mga03n38_662521_c1 | nmdc:mga03n38_662521_c1_52_579 | 175 |
| 1785 | 3300050491 | nmdc:mga00v17_186268_c1 | nmdc:mga00v17_186268_c1_665_1192 | 175 |
| 1786 | 3300050491 | nmdc:mga00v17_43893_c1 | nmdc:mga00v17_43893_c1_1611_2141 | 175 |
| 1787 | 3300050491 | nmdc:mga00v17_81611_c2 | nmdc:mga00v17_81611_c2_233_763 | 175 |
| 1788 | 3300050491 | nmdc:mga00v17_91466_c1 | nmdc:mga00v17_91466_c1_328_858 | 175 |
| 1789 | 3300050492 | nmdc:mga0yw44_111921_c1 | nmdc:mga0yw44_111921_c1_926_1453 | 175 |
| 1790 | 3300050492 | nmdc:mga0yw44_125363_c1 | nmdc:mga0yw44_125363_c1_389_919 | 175 |
| 1791 | 3300050492 | nmdc:mga0yw44_168244_c1 | nmdc:mga0yw44_168244_c1_37_564 | 175 |
| 1792 | 3300050492 | nmdc:mga0yw44_20997_c1 | nmdc:mga0yw44_20997_c1_381_908 | 175 |
| 1793 | 3300050492 | nmdc:mga0yw44_278456_c1 | nmdc:mga0yw44_278456_c1_365_895 | 175 |
| 1794 | 3300050492 | nmdc:mga0yw44_338777_c1 | nmdc:mga0yw44_338777_c1_279_806 | 175 |
| 1795 | 3300050492 | nmdc:mga0yw44_363451_c1 | nmdc:mga0yw44_363451_c1_62_589 | 175 |
| 1796 | 3300050492 | nmdc:mga0yw44_471048_c1 | nmdc:mga0yw44_471048_c1_300_830 | 175 |
| 1797 | 3300050492 | nmdc:mga0yw44_496868_c1 | nmdc:mga0yw44_496868_c1_62_589 | 175 |
| 1798 | 3300050492 | nmdc:mga0yw44_74121_c1 | nmdc:mga0yw44_74121_c1_1270_1800 | 175 |
| 1799 | 3300050493 | nmdc:mga0k408_154685_c1 | nmdc:mga0k408_154685_c1_313_843 | 175 |
| 1800 | 3300050493 | nmdc:mga0k408_177588_c1 | nmdc:mga0k408_177588_c1_608_1138 | 175 |
| 1801 | 3300050493 | nmdc:mga0k408_748444_c1 | nmdc:mga0k408_748444_c1_34_561 | 175 |
| 1802 | 3300050494 | nmdc:mga06z11_123724_c1 | nmdc:mga06z11_123724_c1_478_1005 | 175 |
| 1803 | 3300050494 | nmdc:mga06z11_13229_c1 | nmdc:mga06z11_13229_c1_263_790 | 175 |
| 1804 | 3300050494 | nmdc:mga06z11_148848_c1 | nmdc:mga06z11_148848_c1_266_793 | 175 |
| 1805 | 3300050495 | nmdc:mga04h51_41658_c1 | nmdc:mga04h51_41658_c1_263_790 | 175 |
| 1806 | 3300050495 | nmdc:mga04h51_7254_c1 | nmdc:mga04h51_7254_c1_1455_1982 | 175 |
| 1807 | 3300050496 | nmdc:mga07m45_152587_c1 | nmdc:mga07m45_152587_c1_374_901 | 175 |
| 1808 | 3300050496 | nmdc:mga07m45_1693_c2 | nmdc:mga07m45_1693_c2_4415_4942 | 175 |
| 1809 | 3300050507 | nmdc:mga05p37_106683_c1 | nmdc:mga05p37_106683_c1_1753_2280 | 175 |
| 1810 | 3300050508 | nmdc:mga09592_275182_c1 | nmdc:mga09592_275182_c1_789_1316 | 175 |
| 1811 | 3300050511 | nmdc:mga08y16_139088_c1 | nmdc:mga08y16_139088_c1_505_1032 | 175 |
| 1812 | 3300050511 | nmdc:mga08y16_50901_c1 | nmdc:mga08y16_50901_c1_1008_1535 | 175 |
| 1813 | 3300050512 | nmdc:mga0n895_1294201_c1 | nmdc:mga0n895_1294201_c1_159_686 | 175 |
| 1814 | 3300050512 | nmdc:mga0n895_286526_c1 | nmdc:mga0n895_286526_c1_213_740 | 175 |
| 1815 | 3300050512 | nmdc:mga0n895_37552_c1 | nmdc:mga0n895_37552_c1_254_808 | 175 |
| 1816 | 3300050513 | nmdc:mga0rr50_162398_c1 | nmdc:mga0rr50_162398_c1_1032_1586 | 175 |
| 1817 | 3300050513 | nmdc:mga0rr50_320662_c1 | nmdc:mga0rr50_320662_c1_225_752 | 175 |
| 1818 | 3300050516 | nmdc:mga0sz30_247978_c1 | nmdc:mga0sz30_247978_c1_93_620 | 175 |
| 1819 | 3300050516 | nmdc:mga0sz30_26227_c1 | nmdc:mga0sz30_26227_c1_1517_2047 | 175 |
| 1820 | 3300050516 | nmdc:mga0sz30_307336_c1 | nmdc:mga0sz30_307336_c1_105_632 | 175 |
| 1821 | 3300053077 | Ga0495601_0097467 | Ga0495601_0097467_1052_1579 | 175 |
| 1822 | 3300053077 | Ga0495601_0154442 | Ga0495601_0154442_662_1189 | 175 |
| 1823 | 3300053077 | Ga0495601_0193554 | Ga0495601_0193554_672_1199 | 175 |
| 1824 | 3300053077 | Ga0495601_0476604 | Ga0495601_0476604_240_767 | 175 |
| 1825 | 3300053078 | Ga0495612_0268675 | Ga0495612_0268675_59_586 | 175 |
| 1826 | 3300053080 | Ga0500635_0011591 | Ga0500635_0011591_1229_1756 | 175 |
| 1827 | 3300053080 | Ga0500635_0323379 | Ga0500635_0323379_35_562 | 175 |
| 1828 | 3300053083 | Ga0495655_0037102 | Ga0495655_0037102_14_544 | 175 |
| 1829 | 3300053083 | Ga0495655_0240072 | Ga0495655_0240072_10_540 | 175 |
| 1830 | 3300053084 | Ga0495595_0035717 | Ga0495595_0035717_1307_1840 | 175 |
| 1831 | 3300053084 | Ga0495595_0302820 | Ga0495595_0302820_13_540 | 175 |
| 1832 | 3300053085 | Ga0495619_0012457 | Ga0495619_0012457_4562_5089 | 175 |
| 1833 | 3300053085 | Ga0495619_0193105 | Ga0495619_0193105_630_1160 | 175 |
| 1834 | 3300053085 | Ga0495619_0845653 | Ga0495619_0845653_67_594 | 175 |
| 1835 | 3300053086 | Ga0500578_0140390 | Ga0500578_0140390_305_835 | 175 |
| 1836 | 3300053086 | Ga0500578_0213772 | Ga0500578_0213772_109_639 | 175 |
| 1837 | 3300053086 | Ga0500578_0238191 | Ga0500578_0238191_91_618 | 175 |
| 1838 | 3300053087 | Ga0500643_000049 | Ga0500643_000049_101421_101951 | 175 |
| 1839 | 3300053088 | Ga0500644_0073119 | Ga0500644_0073119_591_1121 | 175 |
| 1840 | 3300053088 | Ga0500644_0182254 | Ga0500644_0182254_104_634 | 175 |
| 1841 | 3300053090 | Ga0500646_0069815 | Ga0500646_0069815_13_540 | 175 |
| 1842 | 3300053091 | Ga0500647_0220604 | Ga0500647_0220604_165_692 | 175 |
| 1843 | 3300053091 | Ga0500647_0261086 | Ga0500647_0261086_203_733 | 175 |
| 1844 | 3300053092 | Ga0500583_0173891 | Ga0500583_0173891_383_913 | 175 |
| 1845 | 3300053093 | Ga0500651_0072214 | Ga0500651_0072214_1103_1630 | 175 |
| 1846 | 3300053093 | Ga0500651_0092244 | Ga0500651_0092244_287_817 | 175 |
| 1847 | 3300053093 | Ga0500651_0255144 | Ga0500651_0255144_46_573 | 175 |
| 1848 | 3300053093 | Ga0500651_0449324 | Ga0500651_0449324_63_593 | 175 |
| 1849 | 3300053094 | Ga0500566_0000055 | Ga0500566_0000055_27518_28045 | 175 |
| 1850 | 3300053094 | Ga0500566_0002813 | Ga0500566_0002813_263_793 | 175 |
| 1851 | 3300053094 | Ga0500566_0006619 | Ga0500566_0006619_2098_2625 | 175 |
| 1852 | 3300053096 | Ga0500641_0013558 | Ga0500641_0013558_1569_2096 | 175 |
| 1853 | 3300053096 | Ga0500641_0031164 | Ga0500641_0031164_784_1314 | 175 |
| 1854 | 3300053098 | Ga0500650_0097072 | Ga0500650_0097072_414_941 | 175 |
| 1855 | 3300053102 | Ga0500554_003653 | Ga0500554_003653_156_683 | 175 |
| 1856 | 3300053102 | Ga0500554_010329 | Ga0500554_010329_1638_2165 | 175 |
| 1857 | 3300053103 | Ga0500555_005493 | Ga0500555_005493_1433_1963 | 175 |
| 1858 | 3300053104 | Ga0500556_0031759 | Ga0500556_0031759_185_715 | 175 |
| 1859 | 3300053105 | Ga0500557_000118 | Ga0500557_000118_14462_14992 | 175 |
| 1860 | 3300053108 | Ga0500562_015483 | Ga0500562_015483_143_673 | 175 |
| 1861 | 3300053109 | Ga0500569_002326 | Ga0500569_002326_2144_2674 | 175 |
| 1862 | 3300053111 | Ga0500572_000348 | Ga0500572_000348_12100_12627 | 175 |
| 1863 | 3300053111 | Ga0500572_224846 | Ga0500572_224846_72_599 | 175 |
| 1864 | 3300053118 | Ga0500594_0038553 | Ga0500594_0038553_636_1163 | 175 |
| 1865 | 3300053119 | Ga0500595_000345 | Ga0500595_000345_7027_7554 | 175 |
| 1866 | 3300053119 | Ga0500595_005080 | Ga0500595_005080_3597_4124 | 175 |
| 1867 | 3300053119 | Ga0500595_046350 | Ga0500595_046350_265_795 | 175 |
| 1868 | 3300053119 | Ga0500595_120872 | Ga0500595_120872_180_707 | 175 |
| 1869 | 3300053119 | Ga0500595_153644 | Ga0500595_153644_71_601 | 175 |
| 1870 | 3300053120 | Ga0500597_093367 | Ga0500597_093367_664_1194 | 175 |
| 1871 | 3300053120 | Ga0500597_108020 | Ga0500597_108020_649_1176 | 175 |
| 1872 | 3300053120 | Ga0500597_141879 | Ga0500597_141879_489_1016 | 175 |
| 1873 | 3300053120 | Ga0500597_331800 | Ga0500597_331800_20_559 | 175 |
| 1874 | 3300053122 | Ga0500608_002697 | Ga0500608_002697_5556_6083 | 175 |
| 1875 | 3300053124 | Ga0500617_216891 | Ga0500617_216891_90_617 | 175 |
| 1876 | 3300053125 | Ga0500618_006151 | Ga0500618_006151_835_1362 | 175 |
| 1877 | 3300053125 | Ga0500618_022546 | Ga0500618_022546_741_1271 | 175 |
| 1878 | 3300053128 | Ga0500626_092159 | Ga0500626_092159_617_1147 | 175 |
| 1879 | 3300053130 | Ga0500642_0000164 | Ga0500642_0000164_16502_17032 | 175 |
| 1880 | 3300053130 | Ga0500642_0048319 | Ga0500642_0048319_268_798 | 175 |
| 1881 | 3300053130 | Ga0500642_0049160 | Ga0500642_0049160_81_608 | 175 |
| 1882 | 3300053134 | Ga0500658_0193656 | Ga0500658_0193656_169_696 | 175 |
| 1883 | 3300053134 | Ga0500658_0314249 | Ga0500658_0314249_22_552 | 175 |
| 1884 | 3300053136 | Ga0500559_0000305 | Ga0500559_0000305_30355_30882 | 175 |
| 1885 | 3300053136 | Ga0500559_0000362 | Ga0500559_0000362_12697_13224 | 175 |
| 1886 | 3300053136 | Ga0500559_0003633 | Ga0500559_0003633_1926_2456 | 175 |
| 1887 | 3300053136 | Ga0500559_0058557 | Ga0500559_0058557_968_1495 | 175 |
| 1888 | 3300053138 | Ga0500564_149111 | Ga0500564_149111_106_633 | 175 |
| 1889 | 3300053139 | Ga0500568_0026181 | Ga0500568_0026181_1085_1615 | 175 |
| 1890 | 3300053140 | Ga0500573_0007866 | Ga0500573_0007866_4337_4864 | 175 |
| 1891 | 3300053142 | Ga0500577_0128432 | Ga0500577_0128432_91_618 | 175 |
| 1892 | 3300053142 | Ga0500577_0262329 | Ga0500577_0262329_101_631 | 175 |
| 1893 | 3300053148 | Ga0500590_246553 | Ga0500590_246553_124_651 | 175 |
| 1894 | 3300053148 | Ga0500590_315644 | Ga0500590_315644_30_560 | 175 |
| 1895 | 3300053150 | Ga0500603_011062 | Ga0500603_011062_539_1066 | 175 |
| 1896 | 3300053150 | Ga0500603_060652 | Ga0500603_060652_181_708 | 175 |
| 1897 | 3300053151 | Ga0500604_0049689 | Ga0500604_0049689_641_1168 | 175 |
| 1898 | 3300053153 | Ga0500616_0022311 | Ga0500616_0022311_543_1073 | 175 |
| 1899 | 3300053154 | Ga0500619_092377 | Ga0500619_092377_155_682 | 175 |
| 1900 | 3300053154 | Ga0500619_189488 | Ga0500619_189488_56_586 | 175 |
| 1901 | 3300053156 | Ga0500622_0005919 | Ga0500622_0005919_3930_4460 | 175 |
| 1902 | 3300053156 | Ga0500622_0114950 | Ga0500622_0114950_123_650 | 175 |
| 1903 | 3300053158 | Ga0500627_0148942 | Ga0500627_0148942_514_1041 | 175 |
| 1904 | 3300053158 | Ga0500627_0155805 | Ga0500627_0155805_352_879 | 175 |
| 1905 | 3300053158 | Ga0500627_0168435 | Ga0500627_0168435_273_803 | 175 |
| 1906 | 3300053161 | Ga0500634_0158147 | Ga0500634_0158147_34_561 | 175 |
| 1907 | 3300053162 | Ga0500638_027148 | Ga0500638_027148_54_584 | 175 |
| 1908 | 3300053162 | Ga0500638_050485 | Ga0500638_050485_531_1058 | 175 |
| 1909 | 3300053162 | Ga0500638_295936 | Ga0500638_295936_54_581 | 175 |
| 1910 | 3300053163 | Ga0500639_165395 | Ga0500639_165395_156_683 | 175 |
| 1911 | 3300053163 | Ga0500639_188864 | Ga0500639_188864_28_555 | 175 |
| 1912 | 3300053177 | Ga0500636_0077320 | Ga0500636_0077320_442_969 | 175 |
| 1913 | 3300053178 | Ga0500637_0000053 | Ga0500637_0000053_8335_8862 | 175 |
| 1914 | 3300053723 | Ga0500567_134325 | Ga0500567_134325_307_834 | 175 |
| 1915 | 3300053728 | Ga0500657_212671 | Ga0500657_212671_20_547 | 175 |
| 1916 | 3300053729 | Ga0500625_144878 | Ga0500625_144878_150_680 | 175 |
| 1917 | 3300053730 | Ga0500645_079033 | Ga0500645_079033_188_718 | 175 |
| 1918 | 3300053731 | Ga0500609_020309 | Ga0500609_020309_332_862 | 175 |
| 1919 | 3300053732 | Ga0500656_032456 | Ga0500656_032456_151_678 | 175 |
| 1920 | 3300053732 | Ga0500656_049629 | Ga0500656_049629_40_570 | 175 |
| 1921 | 3300053733 | Ga0500552_006359 | Ga0500552_006359_79_606 | 175 |
| 1922 | 3300053735 | Ga0500596_000229 | Ga0500596_000229_1862_2389 | 175 |
| 1923 | 3300053735 | Ga0500596_029926 | Ga0500596_029926_217_744 | 175 |
| 1924 | 3300053736 | Ga0500599_006308 | Ga0500599_006308_795_1325 | 175 |
| 1925 | 3300053737 | Ga0500601_000388 | Ga0500601_000388_2773_3303 | 175 |
| 1926 | 3300055283 | Ga0500661_000122 | Ga0500661_000122_8182_8709 | 175 |
| 1927 | 3300055283 | Ga0500661_007332 | Ga0500661_007332_205_735 | 175 |
| 1928 | 3300061719 | Ga0466962_0053071 | Ga0466962_0053071_431_964 | 175 |
| 1929 | 3300061719 | Ga0466962_0056426 | Ga0466962_0056426_571_1158 | 175 |
| 1930 | 3300061719 | Ga0466962_0122178 | Ga0466962_0122178_71_601 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2krs-assembly1.cif.gz_A | solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a. | 0.8033 | 105 | 175 |
| 2kt8-assembly1.cif.gz_A | solution nmr structure of the cpe1231(468-535) protein from clostridium perfringens, northeast structural genomics consortium target cpr82b | 0.7761 | 105 | 175 |
| 2kyb-assembly1.cif.gz_A | solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g | 0.7712 | 106 | 164 |
| 7dhw-assembly1.cif.gz_A | crystal structure of myosin-xi motor domain in complex with adp-alf4 | 0.7451 | 38 | 100 |
| 2kyb-assembly1.cif.gz_A | solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g | 0.7309 | 106 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2krsA01 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8776 | 107 | 166 | 2.30.30.40 |
| af_Q2FXU3_37_103_2.30.30.40 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8731 | 105 | 165 | 2.30.30.40 |
| 4krtB03 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.8287 | 105 | 168 | 2.30.30.40 |
| 2krsA01 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.826 | 107 | 166 | 2.30.30.40 |
| 4krtA02 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.7919 | 107 | 166 | 2.30.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9IYM3-F1-model_v4 | SH3b domain-containing protein | 0.9552 | 105 | 166 |
|
| AF-A0A502YEI1-F1-model_v4 | SH3 domain-containing protein | 0.93 | 99 | 174 |
|
| AF-A0A537NZ88-F1-model_v4 | SH3 domain-containing protein | 0.9134 | 102 | 175 |
|
| AF-A0A3S0HT46-F1-model_v4 | deleted | 0.9039 | 93 | 175 |
|
| AF-A0A537NZ88-F1-model_v4 | SH3 domain-containing protein | 0.8908 | 102 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar