F496097
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1936 | 762 | 3872 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300006942|Ga0099824_1031623|Ga0099824_10316233 |
| Length | 204 |
| Sequence | MIRLLFTIIAGVLLGGVVHLVSVLALPSIASQDAYSRLTPMTKLNEVTQLPLADPGNSPMPLMDPAFAMAICRYDLSTGPIKLTVPVSQAYTSVSFYTRQEIAYYAINDRSAGKKVIELDLMTEAQHEDLPEDEEITSADRLIIDSPTTTGLILLKSLAPEPGLMPQAQASLAAAKCKVQSEPTAAKQDAPTPXXXXPPPARKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 103 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 140 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 141 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 142 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 234 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 235 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 252 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 258 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 259 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 260 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 261 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 262 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 263 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 290 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 300 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 301 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 302 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 418 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 419 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 420 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 421 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 482 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 483 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 484 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 485 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 486 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 487 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 489 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 491 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 493 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 494 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 495 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 497 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 498 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 499 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 500 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 501 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 502 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 503 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 504 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 505 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 506 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 510 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 512 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 513 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 514 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 518 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 520 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 521 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 523 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 525 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 527 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 528 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 529 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 530 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 532 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 534 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 535 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 536 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 537 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 538 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 539 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 540 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 541 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 542 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 543 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 544 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 545 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 546 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 547 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 548 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 549 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 550 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 551 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 552 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 553 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 554 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 555 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 556 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 557 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 558 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 559 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 560 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 561 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 562 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 563 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 564 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 565 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 566 | 2791355199 | |||
| 567 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 568 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 569 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 570 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 571 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 572 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 573 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 574 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 575 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 576 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 577 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 578 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 579 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 580 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 581 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 582 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 583 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 584 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 585 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 586 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 587 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 588 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 589 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 590 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 591 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 592 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 593 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 594 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 595 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 596 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 597 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 598 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 599 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 600 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 601 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 602 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 603 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 604 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 605 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 606 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 607 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 608 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 609 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 610 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 611 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 612 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 613 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 614 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 615 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 616 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 617 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 618 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 619 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 620 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 621 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 622 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 623 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 624 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 625 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 626 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 627 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 628 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 629 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 630 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 631 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 632 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 633 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 634 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 635 | 2904699407 | |||
| 636 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 637 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 638 | 2906610324 | |||
| 639 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 640 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 641 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 642 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 643 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 644 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 645 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 646 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 647 | 2922368715 | |||
| 648 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 649 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 650 | 2922425934 | |||
| 651 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 652 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 653 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 654 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 655 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 656 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 657 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 658 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 659 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 660 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 661 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 662 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 663 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 664 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 665 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 666 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 667 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 668 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 669 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 670 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 671 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 672 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 673 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 674 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 675 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 676 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 677 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 678 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 679 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 680 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 681 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 682 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 683 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 684 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 685 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 686 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 687 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 688 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 689 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 690 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 691 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 692 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 693 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 694 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 695 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 696 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 697 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 698 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 699 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 700 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 701 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 702 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 703 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 704 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 705 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 706 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 707 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 708 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 709 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 710 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 711 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 712 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 713 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 714 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 715 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 716 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 717 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 718 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 719 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 720 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 721 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 722 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 723 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 724 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 725 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 726 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 727 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 728 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 729 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 730 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 731 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 732 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 733 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 734 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 735 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 736 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 737 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 738 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 739 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 740 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 741 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 742 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 743 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 744 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 745 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 746 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 747 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 748 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 749 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 750 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 751 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 752 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 753 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 754 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 755 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 756 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 757 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 758 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 759 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 760 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 761 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 762 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.19 |
| Metatranscriptomes | 0.1 |
| Isolates | 11.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.87 |
| Nodule | 9.4 |
| Rhizoplane | 6.25 |
| Rhizosphere | 65.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099824_1031623 | 3300006942 | Bacteria | 1987 |
| 2 | JGI24740J21852_10018161 | 3300001979 | Bacteria | 2502 |
| 3 | JGI24737J22298_10003352 | 3300001990 | Bacteria | 5667 |
| 4 | JGI24750J21931_1014741 | 3300002070 | Bacteria | 1053 |
| 5 | JGI24744J21845_10016348 | 3300002077 | Bacteria | 1477 |
| 6 | JGI25406J46586_10000035 | 3300003203 | Bacteria | 61904 |
| 7 | JGI25406J46586_10019089 | 3300003203 | Bacteria | 2803 |
| 8 | JGI25153J46596_10024636 | 3300003215 | Bacteria | 2166 |
| 9 | JGI25153J46596_10035718 | 3300003215 | Bacteria | 1605 |
| 10 | JGI25153J46596_10046174 | 3300003215 | Bacteria | 1293 |
| 11 | JGI25153J46596_10059871 | 3300003215 | Bacteria | 1040 |
| 12 | JGI25160J50197_1001173 | 3300003354 | Bacteria | 13353 |
| 13 | JGI25160J50197_1001457 | 3300003354 | Bacteria | 11795 |
| 14 | JGI25404J52841_10014189 | 3300003659 | Bacteria | 1728 |
| 15 | JGI25404J52841_10033124 | 3300003659 | Bacteria | 1101 |
| 16 | JGI25404J52841_10063626 | 3300003659 | Bacteria | 772 |
| 17 | Ga0055542_1014783 | 3300003762 | Bacteria | 1271 |
| 18 | Ga0055529_1010903 | 3300003763 | Bacteria | 1176 |
| 19 | Ga0055531_10006944 | 3300003794 | Bacteria | 6304 |
| 20 | Ga0055543_1020979 | 3300004625 | Bacteria | 1195 |
| 21 | Ga0065165_1000662 | 3300005262 | Bacteria | 49679 |
| 22 | Ga0065165_1001742 | 3300005262 | Bacteria | 21704 |
| 23 | Ga0065165_1011291 | 3300005262 | Bacteria | 3747 |
| 24 | Ga0070658_10035694 | 3300005327 | Bacteria | 4006 |
| 25 | Ga0070658_10053521 | 3300005327 | Bacteria | 3276 |
| 26 | Ga0070658_10154030 | 3300005327 | Bacteria | 1926 |
| 27 | Ga0070676_10314006 | 3300005328 | Bacteria | 1067 |
| 28 | Ga0070683_100004896 | 3300005329 | Bacteria | 11103 |
| 29 | Ga0070683_100020769 | 3300005329 | Bacteria | 5850 |
| 30 | Ga0070683_100034308 | 3300005329 | Bacteria | 4634 |
| 31 | Ga0070683_100340228 | 3300005329 | Bacteria | 1429 |
| 32 | Ga0070690_100036445 | 3300005330 | Bacteria | 3091 |
| 33 | Ga0070670_100028360 | 3300005331 | Bacteria | 4818 |
| 34 | Ga0070670_100129579 | 3300005331 | Bacteria | 2178 |
| 35 | Ga0070670_100172802 | 3300005331 | Bacteria | 1874 |
| 36 | Ga0070670_100539679 | 3300005331 | Bacteria | 1040 |
| 37 | Ga0070677_10031918 | 3300005333 | Bacteria | 2017 |
| 38 | Ga0068869_100202046 | 3300005334 | Bacteria | 1567 |
| 39 | Ga0070666_10152531 | 3300005335 | Bacteria | 1612 |
| 40 | Ga0070666_10239875 | 3300005335 | Bacteria | 1282 |
| 41 | Ga0070680_100005549 | 3300005336 | Bacteria | 9548 |
| 42 | Ga0070680_100405937 | 3300005336 | Bacteria | 1162 |
| 43 | Ga0070682_100011716 | 3300005337 | Bacteria | 5013 |
| 44 | Ga0070682_100381378 | 3300005337 | Bacteria | 1060 |
| 45 | Ga0068868_100077925 | 3300005338 | Bacteria | 2652 |
| 46 | Ga0068868_101061450 | 3300005338 | Bacteria | 744 |
| 47 | Ga0070660_100056116 | 3300005339 | Bacteria | 3046 |
| 48 | Ga0070660_100158454 | 3300005339 | Bacteria | 1823 |
| 49 | Ga0070660_100199347 | 3300005339 | Bacteria | 1623 |
| 50 | Ga0070660_100656319 | 3300005339 | Bacteria | 879 |
| 51 | Ga0070689_100188427 | 3300005340 | Bacteria | 1679 |
| 52 | Ga0070689_100399205 | 3300005340 | Bacteria | 1162 |
| 53 | Ga0070691_10033220 | 3300005341 | Bacteria | 2427 |
| 54 | Ga0070661_100114171 | 3300005344 | Bacteria | 2019 |
| 55 | Ga0070692_10283667 | 3300005345 | Bacteria | 1005 |
| 56 | Ga0070668_100041398 | 3300005347 | Bacteria | 3529 |
| 57 | Ga0070669_100400506 | 3300005353 | Bacteria | 1123 |
| 58 | Ga0070675_100082772 | 3300005354 | Bacteria | 2678 |
| 59 | Ga0070671_100000984 | 3300005355 | Bacteria | 20913 |
| 60 | Ga0070671_100066152 | 3300005355 | Bacteria | 3012 |
| 61 | Ga0070671_100412151 | 3300005355 | Bacteria | 1157 |
| 62 | Ga0070671_100781728 | 3300005355 | Bacteria | 831 |
| 63 | Ga0070674_100032222 | 3300005356 | Bacteria | 3479 |
| 64 | Ga0070674_100974457 | 3300005356 | Bacteria | 743 |
| 65 | Ga0070673_100002766 | 3300005364 | Bacteria | 10783 |
| 66 | Ga0070673_100202279 | 3300005364 | Bacteria | 1711 |
| 67 | Ga0070673_100446711 | 3300005364 | Bacteria | 1163 |
| 68 | Ga0070673_100631814 | 3300005364 | Bacteria | 979 |
| 69 | Ga0070688_100014794 | 3300005365 | Bacteria | 4426 |
| 70 | Ga0070688_100372599 | 3300005365 | Bacteria | 1050 |
| 71 | Ga0070659_100575931 | 3300005366 | Bacteria | 965 |
| 72 | Ga0070659_100662072 | 3300005366 | Bacteria | 901 |
| 73 | Ga0070667_100331712 | 3300005367 | Bacteria | 1374 |
| 74 | Ga0070667_100572491 | 3300005367 | Bacteria | 1039 |
| 75 | Ga0070709_10000810 | 3300005434 | Bacteria | 17427 |
| 76 | Ga0070709_10008385 | 3300005434 | Bacteria | 5676 |
| 77 | Ga0070709_10021481 | 3300005434 | Bacteria | 3760 |
| 78 | Ga0070709_10036535 | 3300005434 | Bacteria | 2994 |
| 79 | Ga0070709_10238951 | 3300005434 | Bacteria | 1304 |
| 80 | Ga0070714_100005006 | 3300005435 | Bacteria | 10073 |
| 81 | Ga0070714_100532914 | 3300005435 | Bacteria | 1123 |
| 82 | Ga0070714_101328904 | 3300005435 | Bacteria | 702 |
| 83 | Ga0070713_100027405 | 3300005436 | Bacteria | 4485 |
| 84 | Ga0070713_100084119 | 3300005436 | Bacteria | 2722 |
| 85 | Ga0070713_100135276 | 3300005436 | Bacteria | 2177 |
| 86 | Ga0070713_100662319 | 3300005436 | Bacteria | 995 |
| 87 | Ga0070710_10002889 | 3300005437 | Bacteria | 8186 |
| 88 | Ga0070710_10007545 | 3300005437 | Bacteria | 5268 |
| 89 | Ga0070711_100002400 | 3300005439 | Bacteria | 10678 |
| 90 | Ga0070711_100002918 | 3300005439 | Bacteria | 9851 |
| 91 | Ga0070711_100002976 | 3300005439 | Bacteria | 9779 |
| 92 | Ga0070711_100008785 | 3300005439 | Bacteria | 6198 |
| 93 | Ga0070711_100028567 | 3300005439 | Bacteria | 3671 |
| 94 | Ga0070711_100078853 | 3300005439 | Unclassified | 2341 |
| 95 | Ga0070711_100143512 | 3300005439 | Bacteria | 1793 |
| 96 | Ga0070711_100223921 | 3300005439 | Bacteria | 1464 |
| 97 | Ga0070700_100967635 | 3300005441 | Bacteria | 698 |
| 98 | Ga0070708_100149973 | 3300005445 | Bacteria | 2168 |
| 99 | Ga0070663_100031884 | 3300005455 | Bacteria | 3626 |
| 100 | Ga0070663_100061548 | 3300005455 | Bacteria | 2703 |
| 101 | Ga0070663_100111538 | 3300005455 | Bacteria | 2056 |
| 102 | Ga0070663_100113407 | 3300005455 | Bacteria | 2040 |
| 103 | Ga0070663_100233804 | 3300005455 | Bacteria | 1448 |
| 104 | Ga0070663_100427520 | 3300005455 | Bacteria | 1087 |
| 105 | Ga0070678_100063626 | 3300005456 | Bacteria | 2730 |
| 106 | Ga0070678_100083407 | 3300005456 | Bacteria | 2429 |
| 107 | Ga0070678_101206432 | 3300005456 | Bacteria | 702 |
| 108 | Ga0070662_100116453 | 3300005457 | Bacteria | 2043 |
| 109 | Ga0070662_100581119 | 3300005457 | Bacteria | 941 |
| 110 | Ga0070681_10002285 | 3300005458 | Bacteria | 17518 |
| 111 | Ga0070681_10006739 | 3300005458 | Bacteria | 11177 |
| 112 | Ga0070681_10220323 | 3300005458 | Bacteria | 1812 |
| 113 | Ga0070681_10253419 | 3300005458 | Bacteria | 1672 |
| 114 | Ga0070681_10553110 | 3300005458 | Bacteria | 1065 |
| 115 | Ga0068867_100139372 | 3300005459 | Bacteria | 1894 |
| 116 | Ga0070706_100069425 | 3300005467 | Bacteria | 3258 |
| 117 | Ga0070706_100122952 | 3300005467 | Bacteria | 2420 |
| 118 | Ga0070707_100106166 | 3300005468 | Bacteria | 2724 |
| 119 | Ga0070698_100174586 | 3300005471 | Bacteria | 2089 |
| 120 | Ga0070698_100297164 | 3300005471 | Bacteria | 1546 |
| 121 | Ga0070699_100070554 | 3300005518 | Bacteria | 3037 |
| 122 | Ga0070679_100034939 | 3300005530 | Bacteria | 4985 |
| 123 | Ga0070679_100056755 | 3300005530 | Bacteria | 3902 |
| 124 | Ga0070679_100058880 | 3300005530 | Bacteria | 3828 |
| 125 | Ga0070679_100121327 | 3300005530 | Bacteria | 2598 |
| 126 | Ga0070684_100011247 | 3300005535 | Bacteria | 7125 |
| 127 | Ga0070684_100011751 | 3300005535 | Bacteria | 6984 |
| 128 | Ga0070697_100024320 | 3300005536 | Bacteria | 4821 |
| 129 | Ga0070697_100089871 | 3300005536 | Bacteria | 2538 |
| 130 | Ga0068853_100009591 | 3300005539 | Bacteria | 7801 |
| 131 | Ga0068853_100034597 | 3300005539 | Bacteria | 4289 |
| 132 | Ga0068853_100168464 | 3300005539 | Bacteria | 1981 |
| 133 | Ga0068853_100245522 | 3300005539 | Bacteria | 1642 |
| 134 | Ga0070672_100090823 | 3300005543 | Bacteria | 2464 |
| 135 | Ga0070672_100160866 | 3300005543 | Bacteria | 1863 |
| 136 | Ga0070686_100086954 | 3300005544 | Bacteria | 2083 |
| 137 | Ga0070686_100180391 | 3300005544 | Bacteria | 1500 |
| 138 | Ga0070695_100415911 | 3300005545 | Bacteria | 1023 |
| 139 | Ga0070693_100128317 | 3300005547 | Bacteria | 1582 |
| 140 | Ga0070693_100469629 | 3300005547 | Bacteria | 887 |
| 141 | Ga0070693_100481692 | 3300005547 | Bacteria | 877 |
| 142 | Ga0070665_100031003 | 3300005548 | Bacteria | 5381 |
| 143 | Ga0070665_100046174 | 3300005548 | Bacteria | 4375 |
| 144 | Ga0070665_100083014 | 3300005548 | Bacteria | 3209 |
| 145 | Ga0070665_100102413 | 3300005548 | Bacteria | 2866 |
| 146 | Ga0068855_100023046 | 3300005563 | Bacteria | 7462 |
| 147 | Ga0068855_100027258 | 3300005563 | Bacteria | 6836 |
| 148 | Ga0068855_100141266 | 3300005563 | Bacteria | 2745 |
| 149 | Ga0068855_100149185 | 3300005563 | Bacteria | 2659 |
| 150 | Ga0068855_100180688 | 3300005563 | Bacteria | 2385 |
| 151 | Ga0068855_100251805 | 3300005563 | Bacteria | 1970 |
| 152 | Ga0068855_100642954 | 3300005563 | Bacteria | 1140 |
| 153 | Ga0068855_100852215 | 3300005563 | Bacteria | 965 |
| 154 | Ga0070664_100128043 | 3300005564 | Bacteria | 2228 |
| 155 | Ga0070664_100183059 | 3300005564 | Bacteria | 1863 |
| 156 | Ga0070664_100424242 | 3300005564 | Bacteria | 1218 |
| 157 | Ga0068857_100012550 | 3300005577 | Bacteria | 7378 |
| 158 | Ga0068857_100138352 | 3300005577 | Bacteria | 2200 |
| 159 | Ga0068857_100587736 | 3300005577 | Bacteria | 1052 |
| 160 | Ga0068854_100021565 | 3300005578 | Bacteria | 4373 |
| 161 | Ga0068854_100058673 | 3300005578 | Bacteria | 2779 |
| 162 | Ga0068854_100220964 | 3300005578 | Bacteria | 1499 |
| 163 | Ga0068854_100280717 | 3300005578 | Bacteria | 1341 |
| 164 | Ga0068856_100045010 | 3300005614 | Bacteria | 4344 |
| 165 | Ga0068856_100142886 | 3300005614 | Bacteria | 2401 |
| 166 | Ga0068856_100284390 | 3300005614 | Bacteria | 1671 |
| 167 | Ga0068856_100479637 | 3300005614 | Bacteria | 1264 |
| 168 | Ga0068852_100013998 | 3300005616 | Bacteria | 6155 |
| 169 | Ga0068852_100064307 | 3300005616 | Bacteria | 3197 |
| 170 | Ga0068852_100184620 | 3300005616 | Bacteria | 1963 |
| 171 | Ga0068852_100413376 | 3300005616 | Bacteria | 1329 |
| 172 | Ga0068859_100173073 | 3300005617 | Bacteria | 2241 |
| 173 | Ga0068859_100518474 | 3300005617 | Bacteria | 1287 |
| 174 | Ga0068859_100564724 | 3300005617 | Bacteria | 1232 |
| 175 | Ga0068859_100716678 | 3300005617 | Bacteria | 1090 |
| 176 | Ga0068864_100224304 | 3300005618 | Bacteria | 1735 |
| 177 | Ga0068866_10204966 | 3300005718 | Bacteria | 1180 |
| 178 | Ga0068861_100081648 | 3300005719 | Bacteria | 2531 |
| 179 | Ga0068861_100196656 | 3300005719 | Bacteria | 1689 |
| 180 | Ga0068861_100265523 | 3300005719 | Bacteria | 1471 |
| 181 | Ga0068851_10003388 | 3300005834 | Bacteria | 7093 |
| 182 | Ga0068851_10166813 | 3300005834 | Bacteria | 1213 |
| 183 | Ga0068863_100162223 | 3300005841 | Bacteria | 2142 |
| 184 | Ga0068863_100524463 | 3300005841 | Bacteria | 1168 |
| 185 | Ga0068863_100557660 | 3300005841 | Bacteria | 1132 |
| 186 | Ga0068863_100921560 | 3300005841 | Bacteria | 875 |
| 187 | Ga0068858_100235099 | 3300005842 | Bacteria | 1738 |
| 188 | Ga0068858_100396194 | 3300005842 | Bacteria | 1326 |
| 189 | Ga0068860_100001690 | 3300005843 | Bacteria | 23583 |
| 190 | Ga0068860_100032363 | 3300005843 | Bacteria | 5024 |
| 191 | Ga0068860_100042065 | 3300005843 | Bacteria | 4366 |
| 192 | Ga0068860_100089618 | 3300005843 | Bacteria | 2928 |
| 193 | Ga0068860_100672218 | 3300005843 | Bacteria | 1044 |
| 194 | Ga0068862_100137405 | 3300005844 | Bacteria | 2167 |
| 195 | Ga0068862_100423347 | 3300005844 | Bacteria | 1250 |
| 196 | Ga0068862_100617592 | 3300005844 | Bacteria | 1042 |
| 197 | Ga0068862_100641173 | 3300005844 | Bacteria | 1024 |
| 198 | Ga0068862_100770022 | 3300005844 | Bacteria | 938 |
| 199 | Ga0081455_10011984 | 3300005937 | Bacteria | 8678 |
| 200 | Ga0081455_10016817 | 3300005937 | Bacteria | 7037 |
| 201 | Ga0081455_10019455 | 3300005937 | Bacteria | 6424 |
| 202 | Ga0081455_10296479 | 3300005937 | Bacteria | 1162 |
| 203 | Ga0081538_10090004 | 3300005981 | Bacteria | 1590 |
| 204 | Ga0081540_1005688 | 3300005983 | Bacteria | 9251 |
| 205 | Ga0081540_1012357 | 3300005983 | Bacteria | 5633 |
| 206 | Ga0081540_1020550 | 3300005983 | Bacteria | 3966 |
| 207 | Ga0081540_1026240 | 3300005983 | Bacteria | 3330 |
| 208 | Ga0081540_1028822 | 3300005983 | Bacteria | 3107 |
| 209 | Ga0081540_1034666 | 3300005983 | Bacteria | 2717 |
| 210 | Ga0081540_1038398 | 3300005983 | Bacteria | 2524 |
| 211 | Ga0081540_1041540 | 3300005983 | Bacteria | 2383 |
| 212 | Ga0081540_1110935 | 3300005983 | Bacteria | 1160 |
| 213 | Ga0081540_1149566 | 3300005983 | Bacteria | 924 |
| 214 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 215 | Ga0081539_10011797 | 3300005985 | Bacteria | 6841 |
| 216 | Ga0081539_10019140 | 3300005985 | Bacteria | 4701 |
| 217 | Ga0070717_10004653 | 3300006028 | Bacteria | 9951 |
| 218 | Ga0070717_10005909 | 3300006028 | Bacteria | 8961 |
| 219 | Ga0070717_10008342 | 3300006028 | Bacteria | 7735 |
| 220 | Ga0070717_10829892 | 3300006028 | Bacteria | 841 |
| 221 | Ga0075365_10009994 | 3300006038 | Bacteria | 5497 |
| 222 | Ga0075365_10015440 | 3300006038 | Bacteria | 4621 |
| 223 | Ga0075365_10034054 | 3300006038 | Bacteria | 3287 |
| 224 | Ga0075365_10045206 | 3300006038 | Bacteria | 2888 |
| 225 | Ga0075365_10082617 | 3300006038 | Bacteria | 2178 |
| 226 | Ga0075365_10302740 | 3300006038 | Bacteria | 1125 |
| 227 | Ga0075368_10064053 | 3300006042 | Bacteria | 1475 |
| 228 | Ga0075363_100017002 | 3300006048 | Bacteria | 3601 |
| 229 | Ga0075363_100150679 | 3300006048 | Bacteria | 1313 |
| 230 | Ga0075363_100195753 | 3300006048 | Bacteria | 1154 |
| 231 | Ga0075364_10048183 | 3300006051 | Bacteria | 2776 |
| 232 | Ga0075364_10106118 | 3300006051 | Bacteria | 1872 |
| 233 | Ga0075364_10114187 | 3300006051 | Bacteria | 1804 |
| 234 | Ga0070715_10000568 | 3300006163 | Bacteria | 9736 |
| 235 | Ga0070716_100027743 | 3300006173 | Bacteria | 3045 |
| 236 | Ga0070716_100053060 | 3300006173 | Bacteria | 2310 |
| 237 | Ga0070716_100141523 | 3300006173 | Bacteria | 1535 |
| 238 | Ga0070716_100174613 | 3300006173 | Bacteria | 1405 |
| 239 | Ga0070712_100026768 | 3300006175 | Bacteria | 3846 |
| 240 | Ga0070712_100034498 | 3300006175 | Bacteria | 3430 |
| 241 | Ga0070712_100071104 | 3300006175 | Bacteria | 2489 |
| 242 | Ga0070712_100095274 | 3300006175 | Bacteria | 2189 |
| 243 | Ga0070712_100114728 | 3300006175 | Bacteria | 2017 |
| 244 | Ga0075362_10131061 | 3300006177 | Bacteria | 1193 |
| 245 | Ga0075367_10018473 | 3300006178 | Bacteria | 3848 |
| 246 | Ga0075367_10092940 | 3300006178 | Bacteria | 1837 |
| 247 | Ga0075367_10167575 | 3300006178 | Bacteria | 1367 |
| 248 | Ga0075367_10451517 | 3300006178 | Bacteria | 815 |
| 249 | Ga0075369_10023927 | 3300006186 | Bacteria | 2528 |
| 250 | Ga0075369_10035186 | 3300006186 | Bacteria | 2128 |
| 251 | Ga0075369_10036480 | 3300006186 | Bacteria | 2092 |
| 252 | Ga0075369_10106822 | 3300006186 | Bacteria | 1259 |
| 253 | Ga0075366_10041918 | 3300006195 | Bacteria | 2710 |
| 254 | Ga0075366_10057269 | 3300006195 | Bacteria | 2316 |
| 255 | Ga0097621_100169434 | 3300006237 | Bacteria | 1881 |
| 256 | Ga0075370_10003171 | 3300006353 | Bacteria | 7779 |
| 257 | Ga0075370_10035923 | 3300006353 | Bacteria | 2782 |
| 258 | Ga0075370_10052327 | 3300006353 | Bacteria | 2316 |
| 259 | Ga0075434_100014205 | 3300006871 | Bacteria | 7607 |
| 260 | Ga0075429_100247855 | 3300006880 | Bacteria | 1560 |
| 261 | Ga0075429_100942625 | 3300006880 | Bacteria | 755 |
| 262 | Ga0068865_100082807 | 3300006881 | Bacteria | 2307 |
| 263 | Ga0097620_100173075 | 3300006931 | Bacteria | 2241 |
| 264 | Ga0097620_100518519 | 3300006931 | Bacteria | 1287 |
| 265 | Ga0097620_100564684 | 3300006931 | Bacteria | 1232 |
| 266 | Ga0097620_100716699 | 3300006931 | Bacteria | 1090 |
| 267 | Ga0099825_1021210 | 3300006941 | Bacteria | 4450 |
| 268 | Ga0099822_1000695 | 3300006943 | Bacteria | 34127 |
| 269 | Ga0075435_100238589 | 3300007076 | Bacteria | 1546 |
| 270 | Ga0099794_10039678 | 3300007265 | Bacteria | 2236 |
| 271 | Ga0099795_10016326 | 3300007788 | Bacteria | 2347 |
| 272 | Ga0099795_10018025 | 3300007788 | Bacteria | 2261 |
| 273 | Ga0099795_10021632 | 3300007788 | Bacteria | 2112 |
| 274 | Ga0105250_10025743 | 3300009092 | Bacteria | 2370 |
| 275 | Ga0105240_10004423 | 3300009093 | Bacteria | 21429 |
| 276 | Ga0105240_10007970 | 3300009093 | Bacteria | 15273 |
| 277 | Ga0105240_10011106 | 3300009093 | Bacteria | 12589 |
| 278 | Ga0105240_10017597 | 3300009093 | Bacteria | 9629 |
| 279 | Ga0105240_10086262 | 3300009093 | Bacteria | 3844 |
| 280 | Ga0105240_10658424 | 3300009093 | Bacteria | 1147 |
| 281 | Ga0111539_10080797 | 3300009094 | Bacteria | 3824 |
| 282 | Ga0111539_10233692 | 3300009094 | Bacteria | 2140 |
| 283 | Ga0105245_10045862 | 3300009098 | Bacteria | 3905 |
| 284 | Ga0105245_10550848 | 3300009098 | Bacteria | 1175 |
| 285 | Ga0105245_10921492 | 3300009098 | Bacteria | 916 |
| 286 | Ga0105247_10067243 | 3300009101 | Bacteria | 2232 |
| 287 | Ga0105247_10304881 | 3300009101 | Bacteria | 1106 |
| 288 | Ga0105247_10427647 | 3300009101 | Bacteria | 950 |
| 289 | Ga0105247_10458121 | 3300009101 | Bacteria | 921 |
| 290 | Ga0114129_10003967 | 3300009147 | Bacteria | 20897 |
| 291 | Ga0114129_10818322 | 3300009147 | Bacteria | 1187 |
| 292 | Ga0105243_10783854 | 3300009148 | Bacteria | 938 |
| 293 | Ga0105243_11115315 | 3300009148 | Bacteria | 798 |
| 294 | Ga0105241_10010224 | 3300009174 | Bacteria | 6892 |
| 295 | Ga0105241_10297994 | 3300009174 | Bacteria | 1383 |
| 296 | Ga0105241_10399683 | 3300009174 | Bacteria | 1205 |
| 297 | Ga0105241_10621886 | 3300009174 | Bacteria | 978 |
| 298 | Ga0105242_10772351 | 3300009176 | Bacteria | 948 |
| 299 | Ga0105248_10232607 | 3300009177 | Bacteria | 2075 |
| 300 | Ga0105248_10249434 | 3300009177 | Bacteria | 1998 |
| 301 | Ga0105248_10305554 | 3300009177 | Bacteria | 1791 |
| 302 | Ga0105248_10815198 | 3300009177 | Bacteria | 1053 |
| 303 | Ga0105248_11032157 | 3300009177 | Bacteria | 929 |
| 304 | Ga0105248_11193219 | 3300009177 | Bacteria | 860 |
| 305 | Ga0105237_10019836 | 3300009545 | Bacteria | 6941 |
| 306 | Ga0105237_10020040 | 3300009545 | Bacteria | 6903 |
| 307 | Ga0105237_10030505 | 3300009545 | Bacteria | 5474 |
| 308 | Ga0105237_10032217 | 3300009545 | Bacteria | 5308 |
| 309 | Ga0105237_10063182 | 3300009545 | Bacteria | 3700 |
| 310 | Ga0105237_10072469 | 3300009545 | Bacteria | 3438 |
| 311 | Ga0105237_10110248 | 3300009545 | Bacteria | 2744 |
| 312 | Ga0105237_10139187 | 3300009545 | Bacteria | 2421 |
| 313 | Ga0105237_10330903 | 3300009545 | Bacteria | 1527 |
| 314 | Ga0105237_10356780 | 3300009545 | Bacteria | 1466 |
| 315 | Ga0105238_10007238 | 3300009551 | Bacteria | 11108 |
| 316 | Ga0105238_10012675 | 3300009551 | Bacteria | 8509 |
| 317 | Ga0105238_10029408 | 3300009551 | Bacteria | 5597 |
| 318 | Ga0105238_10310418 | 3300009551 | Bacteria | 1562 |
| 319 | Ga0105238_10564336 | 3300009551 | Bacteria | 1143 |
| 320 | Ga0105249_10493114 | 3300009553 | Bacteria | 1269 |
| 321 | Ga0099796_10019850 | 3300010159 | Bacteria | 2044 |
| 322 | Ga0099796_10159015 | 3300010159 | Bacteria | 894 |
| 323 | Ga0105239_10032630 | 3300010375 | Bacteria | 5722 |
| 324 | Ga0105239_10051708 | 3300010375 | Bacteria | 4504 |
| 325 | Ga0105239_10081556 | 3300010375 | Bacteria | 3560 |
| 326 | Ga0105239_10127663 | 3300010375 | Bacteria | 2827 |
| 327 | Ga0105239_10151068 | 3300010375 | Bacteria | 2592 |
| 328 | Ga0105239_10153794 | 3300010375 | Bacteria | 2568 |
| 329 | Ga0105239_10177458 | 3300010375 | Bacteria | 2383 |
| 330 | Ga0105239_10206757 | 3300010375 | Bacteria | 2200 |
| 331 | Ga0105239_10220331 | 3300010375 | Bacteria | 2128 |
| 332 | Ga0105239_10455235 | 3300010375 | Bacteria | 1452 |
| 333 | Ga0105239_10586434 | 3300010375 | Bacteria | 1271 |
| 334 | Ga0105239_10632834 | 3300010375 | Bacteria | 1221 |
| 335 | Ga0105246_10031447 | 3300011119 | Bacteria | 3513 |
| 336 | Ga0105246_10272038 | 3300011119 | Bacteria | 1355 |
| 337 | Ga0105246_10331566 | 3300011119 | Bacteria | 1240 |
| 338 | Ga0157373_10024137 | 3300013100 | Bacteria | 4407 |
| 339 | Ga0157373_10130168 | 3300013100 | Bacteria | 1770 |
| 340 | Ga0157371_10199131 | 3300013102 | Bacteria | 1435 |
| 341 | Ga0157371_10476570 | 3300013102 | Bacteria | 919 |
| 342 | Ga0157370_10219898 | 3300013104 | Bacteria | 1759 |
| 343 | Ga0157369_10007836 | 3300013105 | Bacteria | 12285 |
| 344 | Ga0157369_10021752 | 3300013105 | Bacteria | 7173 |
| 345 | Ga0157369_10043556 | 3300013105 | Bacteria | 4891 |
| 346 | Ga0157369_10438713 | 3300013105 | Bacteria | 1353 |
| 347 | Ga0157369_10585778 | 3300013105 | Bacteria | 1152 |
| 348 | Ga0157374_10033052 | 3300013296 | Bacteria | 4717 |
| 349 | Ga0157374_10044786 | 3300013296 | Bacteria | 4091 |
| 350 | Ga0157374_11039496 | 3300013296 | Bacteria | 839 |
| 351 | Ga0157378_10013138 | 3300013297 | Bacteria | 7245 |
| 352 | Ga0157378_10122248 | 3300013297 | Bacteria | 2401 |
| 353 | Ga0157378_10193954 | 3300013297 | Bacteria | 1918 |
| 354 | Ga0163162_10209857 | 3300013306 | Bacteria | 2077 |
| 355 | Ga0163162_10279616 | 3300013306 | Bacteria | 1801 |
| 356 | Ga0163162_11093082 | 3300013306 | Bacteria | 903 |
| 357 | Ga0163162_11168695 | 3300013306 | Bacteria | 873 |
| 358 | Ga0157375_10042178 | 3300013308 | Bacteria | 4414 |
| 359 | Ga0157375_10154585 | 3300013308 | Bacteria | 2432 |
| 360 | Ga0157375_10350351 | 3300013308 | Bacteria | 1642 |
| 361 | Ga0157375_10386696 | 3300013308 | Bacteria | 1566 |
| 362 | Ga0157375_10510605 | 3300013308 | Bacteria | 1366 |
| 363 | Ga0157375_10803384 | 3300013308 | Bacteria | 1089 |
| 364 | Ga0163163_10010549 | 3300014325 | Bacteria | 8315 |
| 365 | Ga0163163_10035070 | 3300014325 | Bacteria | 4864 |
| 366 | Ga0163163_10150382 | 3300014325 | Bacteria | 2372 |
| 367 | Ga0163163_10172740 | 3300014325 | Bacteria | 2208 |
| 368 | Ga0163163_10386980 | 3300014325 | Bacteria | 1456 |
| 369 | Ga0157380_10256224 | 3300014326 | Bacteria | 1587 |
| 370 | Ga0157377_10094238 | 3300014745 | Bacteria | 1773 |
| 371 | Ga0157377_10682031 | 3300014745 | Bacteria | 744 |
| 372 | Ga0157379_10071291 | 3300014968 | Bacteria | 3109 |
| 373 | Ga0157379_10179644 | 3300014968 | Bacteria | 1912 |
| 374 | Ga0157379_10403377 | 3300014968 | Bacteria | 1257 |
| 375 | Ga0157379_10474709 | 3300014968 | Bacteria | 1157 |
| 376 | Ga0157379_10583775 | 3300014968 | Bacteria | 1042 |
| 377 | Ga0157379_10588123 | 3300014968 | Bacteria | 1038 |
| 378 | Ga0157376_10046230 | 3300014969 | Bacteria | 3589 |
| 379 | Ga0157376_10080223 | 3300014969 | Bacteria | 2799 |
| 380 | Ga0157376_10373120 | 3300014969 | Bacteria | 1372 |
| 381 | Ga0157376_10459183 | 3300014969 | Bacteria | 1244 |
| 382 | Ga0157376_11006471 | 3300014969 | Bacteria | 856 |
| 383 | Ga0157376_11134715 | 3300014969 | Bacteria | 808 |
| 384 | Ga0157376_11478807 | 3300014969 | Bacteria | 712 |
| 385 | Ga0182007_10049630 | 3300015262 | Bacteria | 1386 |
| 386 | Ga0163161_10022935 | 3300017792 | Bacteria | 4398 |
| 387 | Ga0197907_10618396 | 3300020069 | Bacteria | 980 |
| 388 | Ga0214544_1000004 | 3300021320 | Bacteria | 455869 |
| 389 | Ga0214542_1000442 | 3300021321 | Bacteria | 74244 |
| 390 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 391 | Ga0214543_1000006 | 3300021327 | Bacteria | 443395 |
| 392 | Ga0213872_10030742 | 3300021361 | Bacteria | 2461 |
| 393 | Ga0213874_10038268 | 3300021377 | Bacteria | 1423 |
| 394 | Ga0213874_10044331 | 3300021377 | Bacteria | 1343 |
| 395 | Ga0213876_10000775 | 3300021384 | Bacteria | 21906 |
| 396 | Ga0213876_10045498 | 3300021384 | Bacteria | 2321 |
| 397 | Ga0213875_10149502 | 3300021388 | Bacteria | 1094 |
| 398 | Ga0228598_1001742 | 3300024227 | Bacteria | 4759 |
| 399 | Ga0209563_100564 | 3300025230 | Bacteria | 12366 |
| 400 | Ga0209677_101733 | 3300025253 | Bacteria | 9087 |
| 401 | Ga0209677_103966 | 3300025253 | Bacteria | 4490 |
| 402 | Ga0209148_1000634 | 3300025254 | Bacteria | 30929 |
| 403 | Ga0209233_1001540 | 3300025261 | Bacteria | 9034 |
| 404 | Ga0209233_1001832 | 3300025261 | Bacteria | 8163 |
| 405 | Ga0209455_1001165 | 3300025272 | Bacteria | 12657 |
| 406 | Ga0209455_1004508 | 3300025272 | Bacteria | 4530 |
| 407 | Ga0209455_1007057 | 3300025272 | Bacteria | 3225 |
| 408 | Ga0209564_1001919 | 3300025295 | Bacteria | 18594 |
| 409 | Ga0209564_1031500 | 3300025295 | Bacteria | 1618 |
| 410 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 411 | Ga0209758_1000359 | 3300025297 | Bacteria | 81559 |
| 412 | Ga0209758_1000365 | 3300025297 | Bacteria | 80645 |
| 413 | Ga0209758_1001302 | 3300025297 | Bacteria | 30534 |
| 414 | Ga0209758_1001403 | 3300025297 | Bacteria | 28564 |
| 415 | Ga0209758_1003658 | 3300025297 | Bacteria | 13702 |
| 416 | Ga0209758_1006509 | 3300025297 | Bacteria | 8344 |
| 417 | Ga0209758_1033786 | 3300025297 | Bacteria | 2047 |
| 418 | Ga0209758_1055813 | 3300025297 | Bacteria | 1338 |
| 419 | Ga0209256_1003144 | 3300025299 | Bacteria | 12021 |
| 420 | Ga0209256_1028143 | 3300025299 | Bacteria | 1591 |
| 421 | Ga0209256_1061993 | 3300025299 | Bacteria | 867 |
| 422 | Ga0207426_1000325 | 3300025302 | Bacteria | 91634 |
| 423 | Ga0207426_1002810 | 3300025302 | Bacteria | 10425 |
| 424 | Ga0207426_1028000 | 3300025302 | Bacteria | 1871 |
| 425 | Ga0209257_1001035 | 3300025304 | Bacteria | 37155 |
| 426 | Ga0209257_1019439 | 3300025304 | Bacteria | 2558 |
| 427 | Ga0207656_10025714 | 3300025321 | Bacteria | 2393 |
| 428 | Ga0207656_10028607 | 3300025321 | Bacteria | 2289 |
| 429 | Ga0207656_10045878 | 3300025321 | Bacteria | 1872 |
| 430 | Ga0207656_10130978 | 3300025321 | Bacteria | 1175 |
| 431 | Ga0207682_10068394 | 3300025893 | Bacteria | 1501 |
| 432 | Ga0207692_10000486 | 3300025898 | Bacteria | 14016 |
| 433 | Ga0207692_10018110 | 3300025898 | Bacteria | 3155 |
| 434 | Ga0207692_10235207 | 3300025898 | Bacteria | 1092 |
| 435 | Ga0207642_10392680 | 3300025899 | Bacteria | 828 |
| 436 | Ga0207710_10065950 | 3300025900 | Bacteria | 1651 |
| 437 | Ga0207710_10196601 | 3300025900 | Bacteria | 995 |
| 438 | Ga0207688_10024611 | 3300025901 | Bacteria | 3303 |
| 439 | Ga0207688_10436385 | 3300025901 | Bacteria | 815 |
| 440 | Ga0207647_10000275 | 3300025904 | Bacteria | 41765 |
| 441 | Ga0207647_10007934 | 3300025904 | Bacteria | 7633 |
| 442 | Ga0207647_10058431 | 3300025904 | Bacteria | 2362 |
| 443 | Ga0207699_10001305 | 3300025906 | Bacteria | 11850 |
| 444 | Ga0207699_10007131 | 3300025906 | Bacteria | 5450 |
| 445 | Ga0207699_10030759 | 3300025906 | Bacteria | 3008 |
| 446 | Ga0207699_10076192 | 3300025906 | Bacteria | 2065 |
| 447 | Ga0207643_10430928 | 3300025908 | Bacteria | 837 |
| 448 | Ga0207705_10053050 | 3300025909 | Bacteria | 2920 |
| 449 | Ga0207705_10070090 | 3300025909 | Bacteria | 2540 |
| 450 | Ga0207705_10116889 | 3300025909 | Bacteria | 1975 |
| 451 | Ga0207684_10125074 | 3300025910 | Bacteria | 2206 |
| 452 | Ga0207684_10167040 | 3300025910 | Bacteria | 1896 |
| 453 | Ga0207654_10071633 | 3300025911 | Bacteria | 2061 |
| 454 | Ga0207654_10087291 | 3300025911 | Bacteria | 1893 |
| 455 | Ga0207707_10000404 | 3300025912 | Bacteria | 45123 |
| 456 | Ga0207707_10007729 | 3300025912 | Bacteria | 9359 |
| 457 | Ga0207707_10055228 | 3300025912 | Bacteria | 3455 |
| 458 | Ga0207707_10069843 | 3300025912 | Bacteria | 3061 |
| 459 | Ga0207707_10235212 | 3300025912 | Bacteria | 1594 |
| 460 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 461 | Ga0207695_10004288 | 3300025913 | Bacteria | 19554 |
| 462 | Ga0207695_10048296 | 3300025913 | Bacteria | 4496 |
| 463 | Ga0207695_10212280 | 3300025913 | Bacteria | 1846 |
| 464 | Ga0207695_10470253 | 3300025913 | Bacteria | 1140 |
| 465 | Ga0207695_10716483 | 3300025913 | Bacteria | 881 |
| 466 | Ga0207671_10014923 | 3300025914 | Bacteria | 6109 |
| 467 | Ga0207671_10066737 | 3300025914 | Bacteria | 2678 |
| 468 | Ga0207671_10087744 | 3300025914 | Bacteria | 2340 |
| 469 | Ga0207671_10093294 | 3300025914 | Bacteria | 2271 |
| 470 | Ga0207671_10103908 | 3300025914 | Bacteria | 2155 |
| 471 | Ga0207671_10563056 | 3300025914 | Bacteria | 909 |
| 472 | Ga0207671_10779599 | 3300025914 | Bacteria | 759 |
| 473 | Ga0207693_10000910 | 3300025915 | Bacteria | 26538 |
| 474 | Ga0207693_10002290 | 3300025915 | Bacteria | 16654 |
| 475 | Ga0207693_10060338 | 3300025915 | Bacteria | 2971 |
| 476 | Ga0207693_10061477 | 3300025915 | Bacteria | 2942 |
| 477 | Ga0207693_10190136 | 3300025915 | Bacteria | 1616 |
| 478 | Ga0207663_10001370 | 3300025916 | Bacteria | 11307 |
| 479 | Ga0207663_10037072 | 3300025916 | Bacteria | 2937 |
| 480 | Ga0207663_10062177 | 3300025916 | Bacteria | 2372 |
| 481 | Ga0207663_10134024 | 3300025916 | Bacteria | 1716 |
| 482 | Ga0207663_10168673 | 3300025916 | Unclassified | 1553 |
| 483 | Ga0207663_10359220 | 3300025916 | Bacteria | 1105 |
| 484 | Ga0207660_10002854 | 3300025917 | Bacteria | 11294 |
| 485 | Ga0207660_10389753 | 3300025917 | Bacteria | 1121 |
| 486 | Ga0207657_10004122 | 3300025919 | Bacteria | 15431 |
| 487 | Ga0207657_10011792 | 3300025919 | Bacteria | 8654 |
| 488 | Ga0207657_10055693 | 3300025919 | Bacteria | 3415 |
| 489 | Ga0207657_10104255 | 3300025919 | Bacteria | 2350 |
| 490 | Ga0207657_10286885 | 3300025919 | Bacteria | 1306 |
| 491 | Ga0207649_10083882 | 3300025920 | Bacteria | 2069 |
| 492 | Ga0207652_10002796 | 3300025921 | Bacteria | 14640 |
| 493 | Ga0207652_10222844 | 3300025921 | Bacteria | 1699 |
| 494 | Ga0207652_10636996 | 3300025921 | Bacteria | 954 |
| 495 | Ga0207646_10045245 | 3300025922 | Bacteria | 3951 |
| 496 | Ga0207646_10096344 | 3300025922 | Bacteria | 2651 |
| 497 | Ga0207681_10251427 | 3300025923 | Bacteria | 1380 |
| 498 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 499 | Ga0207694_10065611 | 3300025924 | Bacteria | 2830 |
| 500 | Ga0207694_10109370 | 3300025924 | Bacteria | 2198 |
| 501 | Ga0207694_10285474 | 3300025924 | Bacteria | 1356 |
| 502 | Ga0207650_10172373 | 3300025925 | Bacteria | 1720 |
| 503 | Ga0207650_10554061 | 3300025925 | Bacteria | 964 |
| 504 | Ga0207659_10076784 | 3300025926 | Bacteria | 2457 |
| 505 | Ga0207687_10024493 | 3300025927 | Bacteria | 4033 |
| 506 | Ga0207687_10367887 | 3300025927 | Bacteria | 1175 |
| 507 | Ga0207700_10006007 | 3300025928 | Bacteria | 7306 |
| 508 | Ga0207700_10014341 | 3300025928 | Bacteria | 5191 |
| 509 | Ga0207700_10023644 | 3300025928 | Bacteria | 4243 |
| 510 | Ga0207700_10086417 | 3300025928 | Bacteria | 2464 |
| 511 | Ga0207700_10149910 | 3300025928 | Bacteria | 1926 |
| 512 | Ga0207664_10007756 | 3300025929 | Bacteria | 7449 |
| 513 | Ga0207664_10410335 | 3300025929 | Bacteria | 1206 |
| 514 | Ga0207644_10027591 | 3300025931 | Bacteria | 3924 |
| 515 | Ga0207644_10168650 | 3300025931 | Bacteria | 1707 |
| 516 | Ga0207644_10266123 | 3300025931 | Bacteria | 1372 |
| 517 | Ga0207690_10096337 | 3300025932 | Bacteria | 2104 |
| 518 | Ga0207706_10011626 | 3300025933 | Bacteria | 8021 |
| 519 | Ga0207706_10067622 | 3300025933 | Bacteria | 3144 |
| 520 | Ga0207706_10070010 | 3300025933 | Bacteria | 3085 |
| 521 | Ga0207706_10088708 | 3300025933 | Bacteria | 2719 |
| 522 | Ga0207706_10224350 | 3300025933 | Bacteria | 1645 |
| 523 | Ga0207686_10270147 | 3300025934 | Bacteria | 1251 |
| 524 | Ga0207686_10355326 | 3300025934 | Bacteria | 1104 |
| 525 | Ga0207709_10039609 | 3300025935 | Bacteria | 2816 |
| 526 | Ga0207670_10164380 | 3300025936 | Bacteria | 1659 |
| 527 | Ga0207670_10448070 | 3300025936 | Bacteria | 1040 |
| 528 | Ga0207669_10133425 | 3300025937 | Bacteria | 1711 |
| 529 | Ga0207669_10305649 | 3300025937 | Bacteria | 1211 |
| 530 | Ga0207669_10359627 | 3300025937 | Bacteria | 1127 |
| 531 | Ga0207704_10037422 | 3300025938 | Bacteria | 2803 |
| 532 | Ga0207704_10205573 | 3300025938 | Bacteria | 1445 |
| 533 | Ga0207665_10000537 | 3300025939 | Bacteria | 25552 |
| 534 | Ga0207665_10036306 | 3300025939 | Bacteria | 3277 |
| 535 | Ga0207665_10188231 | 3300025939 | Bacteria | 1498 |
| 536 | Ga0207665_10357327 | 3300025939 | Bacteria | 1104 |
| 537 | Ga0207691_10033893 | 3300025940 | Bacteria | 4753 |
| 538 | Ga0207691_10042590 | 3300025940 | Bacteria | 4185 |
| 539 | Ga0207711_10101038 | 3300025941 | Bacteria | 2552 |
| 540 | Ga0207711_10152478 | 3300025941 | Bacteria | 2086 |
| 541 | Ga0207711_10423881 | 3300025941 | Bacteria | 1238 |
| 542 | Ga0207661_10001004 | 3300025944 | Bacteria | 18641 |
| 543 | Ga0207661_10004383 | 3300025944 | Bacteria | 9894 |
| 544 | Ga0207661_10077568 | 3300025944 | Bacteria | 2732 |
| 545 | Ga0207661_10683265 | 3300025944 | Bacteria | 944 |
| 546 | Ga0207679_10173346 | 3300025945 | Bacteria | 1778 |
| 547 | Ga0207679_10194164 | 3300025945 | Bacteria | 1690 |
| 548 | Ga0207679_10332676 | 3300025945 | Bacteria | 1319 |
| 549 | Ga0207679_10415609 | 3300025945 | Bacteria | 1186 |
| 550 | Ga0207667_10006495 | 3300025949 | Bacteria | 14146 |
| 551 | Ga0207667_10063578 | 3300025949 | Bacteria | 3856 |
| 552 | Ga0207667_10149610 | 3300025949 | Bacteria | 2403 |
| 553 | Ga0207667_10181605 | 3300025949 | Bacteria | 2160 |
| 554 | Ga0207667_10233551 | 3300025949 | Bacteria | 1883 |
| 555 | Ga0207667_10248165 | 3300025949 | Bacteria | 1821 |
| 556 | Ga0207667_10666564 | 3300025949 | Bacteria | 1045 |
| 557 | Ga0207651_10004830 | 3300025960 | Bacteria | 6862 |
| 558 | Ga0207651_10055829 | 3300025960 | Bacteria | 2715 |
| 559 | Ga0207651_10233566 | 3300025960 | Bacteria | 1495 |
| 560 | Ga0207651_10237735 | 3300025960 | Bacteria | 1483 |
| 561 | Ga0207712_10005172 | 3300025961 | Bacteria | 8256 |
| 562 | Ga0207712_10340000 | 3300025961 | Bacteria | 1244 |
| 563 | Ga0207668_10003910 | 3300025972 | Bacteria | 8783 |
| 564 | Ga0207668_10196775 | 3300025972 | Bacteria | 1602 |
| 565 | Ga0207668_10248423 | 3300025972 | Bacteria | 1443 |
| 566 | Ga0207668_11021487 | 3300025972 | Bacteria | 739 |
| 567 | Ga0207640_10042961 | 3300025981 | Bacteria | 2885 |
| 568 | Ga0207640_10057584 | 3300025981 | Bacteria | 2557 |
| 569 | Ga0207640_10082223 | 3300025981 | Bacteria | 2205 |
| 570 | Ga0207640_10102749 | 3300025981 | Bacteria | 2008 |
| 571 | Ga0207640_10430388 | 3300025981 | Bacteria | 1082 |
| 572 | Ga0207658_10287537 | 3300025986 | Bacteria | 1412 |
| 573 | Ga0207658_10528605 | 3300025986 | Bacteria | 1053 |
| 574 | Ga0207658_10567938 | 3300025986 | Bacteria | 1016 |
| 575 | Ga0207677_10088394 | 3300026023 | Bacteria | 2246 |
| 576 | Ga0207703_10178292 | 3300026035 | Bacteria | 1874 |
| 577 | Ga0207703_10468773 | 3300026035 | Bacteria | 1179 |
| 578 | Ga0207703_11134423 | 3300026035 | Bacteria | 751 |
| 579 | Ga0207703_11440325 | 3300026035 | Bacteria | 663 |
| 580 | Ga0207639_10033198 | 3300026041 | Bacteria | 3805 |
| 581 | Ga0207639_10040580 | 3300026041 | Bacteria | 3475 |
| 582 | Ga0207639_10058323 | 3300026041 | Bacteria | 2969 |
| 583 | Ga0207639_10079198 | 3300026041 | Bacteria | 2596 |
| 584 | Ga0207639_10090237 | 3300026041 | Bacteria | 2451 |
| 585 | Ga0207639_10221978 | 3300026041 | Bacteria | 1633 |
| 586 | Ga0207639_10708056 | 3300026041 | Bacteria | 935 |
| 587 | Ga0207678_10005498 | 3300026067 | Bacteria | 11324 |
| 588 | Ga0207678_10023667 | 3300026067 | Bacteria | 5371 |
| 589 | Ga0207678_10036614 | 3300026067 | Bacteria | 4272 |
| 590 | Ga0207678_10145973 | 3300026067 | Bacteria | 2019 |
| 591 | Ga0207678_10181723 | 3300026067 | Bacteria | 1796 |
| 592 | Ga0207678_10197830 | 3300026067 | Bacteria | 1718 |
| 593 | Ga0207678_10350958 | 3300026067 | Bacteria | 1272 |
| 594 | Ga0207678_10435236 | 3300026067 | Bacteria | 1139 |
| 595 | Ga0207708_10019168 | 3300026075 | Bacteria | 5153 |
| 596 | Ga0207708_10037515 | 3300026075 | Bacteria | 3692 |
| 597 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 598 | Ga0207702_10030183 | 3300026078 | Bacteria | 4517 |
| 599 | Ga0207702_10047629 | 3300026078 | Bacteria | 3613 |
| 600 | Ga0207702_10321160 | 3300026078 | Bacteria | 1474 |
| 601 | Ga0207702_10480930 | 3300026078 | Bacteria | 1208 |
| 602 | Ga0207641_10141807 | 3300026088 | Bacteria | 2169 |
| 603 | Ga0207641_10156631 | 3300026088 | Bacteria | 2067 |
| 604 | Ga0207641_10285073 | 3300026088 | Bacteria | 1555 |
| 605 | Ga0207641_10573146 | 3300026088 | Bacteria | 1103 |
| 606 | Ga0207648_10022493 | 3300026089 | Bacteria | 5658 |
| 607 | Ga0207648_10861681 | 3300026089 | Bacteria | 845 |
| 608 | Ga0207676_10050927 | 3300026095 | Bacteria | 3231 |
| 609 | Ga0207676_10141664 | 3300026095 | Bacteria | 2059 |
| 610 | Ga0207676_10205575 | 3300026095 | Bacteria | 1743 |
| 611 | Ga0207674_10005330 | 3300026116 | Bacteria | 15297 |
| 612 | Ga0207674_10020302 | 3300026116 | Bacteria | 7181 |
| 613 | Ga0207674_10136917 | 3300026116 | Bacteria | 2410 |
| 614 | Ga0207674_10183794 | 3300026116 | Bacteria | 2041 |
| 615 | Ga0207674_10248958 | 3300026116 | Bacteria | 1724 |
| 616 | Ga0207675_100043556 | 3300026118 | Bacteria | 4191 |
| 617 | Ga0207675_100046342 | 3300026118 | Bacteria | 4061 |
| 618 | Ga0207675_100551853 | 3300026118 | Bacteria | 1151 |
| 619 | Ga0207683_10012010 | 3300026121 | Bacteria | 7394 |
| 620 | Ga0207683_10080862 | 3300026121 | Bacteria | 2883 |
| 621 | Ga0207683_10432669 | 3300026121 | Bacteria | 1212 |
| 622 | Ga0207683_10794793 | 3300026121 | Bacteria | 878 |
| 623 | Ga0207683_10804410 | 3300026121 | Bacteria | 872 |
| 624 | Ga0207698_10051462 | 3300026142 | Bacteria | 3149 |
| 625 | Ga0207698_10131962 | 3300026142 | Bacteria | 2136 |
| 626 | Ga0207698_10190493 | 3300026142 | Bacteria | 1826 |
| 627 | Ga0207698_10234552 | 3300026142 | Bacteria | 1668 |
| 628 | Ga0207698_10246998 | 3300026142 | Bacteria | 1630 |
| 629 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 630 | Ga0209389_1000412 | 3300027296 | Bacteria | 25422 |
| 631 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 632 | Ga0209589_1004063 | 3300027357 | Bacteria | 25422 |
| 633 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 634 | Ga0209489_100090 | 3300027361 | Bacteria | 123931 |
| 635 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 636 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 637 | Ga0209588_1016793 | 3300027671 | Bacteria | 2264 |
| 638 | Ga0209588_1087162 | 3300027671 | Bacteria | 1007 |
| 639 | Ga0268266_10044745 | 3300028379 | Bacteria | 3784 |
| 640 | Ga0268266_10243604 | 3300028379 | Bacteria | 1660 |
| 641 | Ga0268266_10922860 | 3300028379 | Bacteria | 844 |
| 642 | Ga0268265_10300809 | 3300028380 | Bacteria | 1444 |
| 643 | Ga0268265_10620530 | 3300028380 | Bacteria | 1036 |
| 644 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 645 | Ga0268264_10399150 | 3300028381 | Bacteria | 1321 |
| 646 | Ga0268264_10586894 | 3300028381 | Bacteria | 1097 |
| 647 | Ga0265337_1017079 | 3300028556 | Bacteria | 2334 |
| 648 | Ga0265319_1043817 | 3300028563 | Bacteria | 1501 |
| 649 | Ga0265334_10001927 | 3300028573 | Bacteria | 9850 |
| 650 | Ga0265334_10032099 | 3300028573 | Bacteria | 2096 |
| 651 | Ga0265318_10021721 | 3300028577 | Bacteria | 2574 |
| 652 | Ga0265323_10011044 | 3300028653 | Bacteria | 3651 |
| 653 | Ga0265336_10000588 | 3300028666 | Bacteria | 20447 |
| 654 | Ga0307517_10003796 | 3300028786 | Bacteria | 23466 |
| 655 | Ga0307517_10160945 | 3300028786 | Bacteria | 1507 |
| 656 | Ga0307515_10058433 | 3300028794 | Bacteria | 5554 |
| 657 | Ga0307515_10359430 | 3300028794 | Bacteria | 1098 |
| 658 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 659 | Ga0265338_10489097 | 3300028800 | Bacteria | 867 |
| 660 | Ga0265324_10043083 | 3300029957 | Bacteria | 1558 |
| 661 | Ga0307511_10078196 | 3300030521 | Bacteria | 2348 |
| 662 | Ga0265330_10016271 | 3300031235 | Bacteria | 3434 |
| 663 | Ga0265330_10019276 | 3300031235 | Bacteria | 3128 |
| 664 | Ga0265332_10074016 | 3300031238 | Bacteria | 1449 |
| 665 | Ga0265325_10013731 | 3300031241 | Bacteria | 4599 |
| 666 | Ga0265340_10168757 | 3300031247 | Bacteria | 992 |
| 667 | Ga0265340_10174506 | 3300031247 | Bacteria | 973 |
| 668 | Ga0265331_10164351 | 3300031250 | Bacteria | 1005 |
| 669 | Ga0265316_10103151 | 3300031344 | Bacteria | 2166 |
| 670 | Ga0307513_10111708 | 3300031456 | Bacteria | 2725 |
| 671 | Ga0307509_10301085 | 3300031507 | Bacteria | 1351 |
| 672 | Ga0307509_10478164 | 3300031507 | Bacteria | 934 |
| 673 | Ga0307508_10000249 | 3300031616 | Bacteria | 65482 |
| 674 | Ga0307508_10332846 | 3300031616 | Bacteria | 1110 |
| 675 | Ga0265314_10226234 | 3300031711 | Bacteria | 1088 |
| 676 | Ga0265314_10231834 | 3300031711 | Bacteria | 1070 |
| 677 | Ga0265342_10119243 | 3300031712 | Bacteria | 1487 |
| 678 | Ga0307516_10012936 | 3300031730 | Bacteria | 8947 |
| 679 | Ga0307516_10029804 | 3300031730 | Bacteria | 5513 |
| 680 | Ga0307516_10355342 | 3300031730 | Bacteria | 1130 |
| 681 | Ga0307405_10128305 | 3300031731 | Bacteria | 1748 |
| 682 | Ga0307405_10311119 | 3300031731 | Bacteria | 1199 |
| 683 | Ga0307410_10221470 | 3300031852 | Bacteria | 1456 |
| 684 | Ga0307406_10130066 | 3300031901 | Bacteria | 1766 |
| 685 | Ga0307406_10509555 | 3300031901 | Bacteria | 977 |
| 686 | Ga0307412_10054888 | 3300031911 | Bacteria | 2647 |
| 687 | Ga0307412_10264109 | 3300031911 | Bacteria | 1344 |
| 688 | Ga0307409_100157459 | 3300031995 | Bacteria | 1981 |
| 689 | Ga0307416_100271975 | 3300032002 | Bacteria | 1664 |
| 690 | Ga0307411_10475131 | 3300032005 | Bacteria | 1051 |
| 691 | Ga0307415_100028829 | 3300032126 | Bacteria | 3539 |
| 692 | Ga0307507_10012335 | 3300033179 | Bacteria | 10574 |
| 693 | Ga0307510_10027857 | 3300033180 | Bacteria | 6463 |
| 694 | Ga0307510_10052013 | 3300033180 | Bacteria | 4325 |
| 695 | Ga0307510_10068711 | 3300033180 | Bacteria | 3553 |
| 696 | Ga0307510_10114422 | 3300033180 | Bacteria | 2427 |
| 697 | Ga0307510_10190178 | 3300033180 | Bacteria | 1602 |
| 698 | Ga0307510_10366185 | 3300033180 | Bacteria | 889 |
| 699 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 700 | Ga0373938_0063810 | 3300034957 | Bacteria | 867 |
| 701 | Ga0373926_0004928 | 3300035083 | Bacteria | 4384 |
| 702 | Ga0373926_0044855 | 3300035083 | Unclassified | 1584 |
| 703 | Ga0373934_0018056 | 3300035086 | Bacteria | 2698 |
| 704 | Ga0373940_0025756 | 3300035088 | Bacteria | 1534 |
| 705 | Ga0373944_0004479 | 3300035089 | Bacteria | 3641 |
| 706 | Ga0373944_0043741 | 3300035089 | Bacteria | 1393 |
| 707 | Ga0373923_0002188 | 3300035111 | Bacteria | 5937 |
| 708 | Ga0373923_0016399 | 3300035111 | Bacteria | 2814 |
| 709 | Ga0373923_0053464 | 3300035111 | Unclassified | 1698 |
| 710 | Ga0373923_0109645 | 3300035111 | Bacteria | 1225 |
| 711 | Ga0373923_0116521 | 3300035111 | Bacteria | 1190 |
| 712 | Ga0373936_0003062 | 3300035113 | Bacteria | 6253 |
| 713 | Ga0373936_0007741 | 3300035113 | Bacteria | 4034 |
| 714 | Ga0373936_0106712 | 3300035113 | Bacteria | 1186 |
| 715 | Ga0373936_0209758 | 3300035113 | Bacteria | 862 |
| 716 | Ga0373945_0002360 | 3300035116 | Bacteria | 5926 |
| 717 | Ga0373945_0011384 | 3300035116 | Unclassified | 2942 |
| 718 | Ga0373945_0012335 | 3300035116 | Bacteria | 2837 |
| 719 | Ga0373953_0002005 | 3300035117 | Bacteria | 6052 |
| 720 | Ga0373953_0047486 | 3300035117 | Bacteria | 1727 |
| 721 | Ga0373953_0218059 | 3300035117 | Bacteria | 826 |
| 722 | Ga0373954_0008972 | 3300035118 | Bacteria | 4401 |
| 723 | Ga0373954_0012542 | 3300035118 | Bacteria | 3769 |
| 724 | Ga0373954_0074276 | 3300035118 | Bacteria | 1618 |
| 725 | Ga0373956_0004542 | 3300035119 | Bacteria | 5541 |
| 726 | Ga0373956_0085934 | 3300035119 | Bacteria | 1447 |
| 727 | Ga0373956_0155357 | 3300035119 | Unclassified | 1077 |
| 728 | Ga0373957_0040002 | 3300035120 | Bacteria | 1761 |
| 729 | Ga0373957_0129454 | 3300035120 | Bacteria | 1027 |
| 730 | Ga0373943_0001590 | 3300035170 | Bacteria | 10286 |
| 731 | Ga0373943_0009393 | 3300035170 | Bacteria | 4382 |
| 732 | Ga0373943_0041003 | 3300035170 | Bacteria | 2237 |
| 733 | Ga0373943_0048765 | 3300035170 | Bacteria | 2076 |
| 734 | Ga0373943_0118799 | 3300035170 | Bacteria | 1403 |
| 735 | Ga0373943_0237420 | 3300035170 | Bacteria | 1020 |
| 736 | Ga0373943_0241115 | 3300035170 | Bacteria | 1013 |
| 737 | Ga0373943_0290316 | 3300035170 | Bacteria | 927 |
| 738 | Ga0373943_0341833 | 3300035170 | Bacteria | 856 |
| 739 | Ga0373946_0001138 | 3300035171 | Bacteria | 9201 |
| 740 | Ga0373946_0004971 | 3300035171 | Bacteria | 4788 |
| 741 | Ga0373946_0008733 | 3300035171 | Bacteria | 3719 |
| 742 | Ga0373946_0034447 | 3300035171 | Bacteria | 2045 |
| 743 | Ga0373955_0031966 | 3300035172 | Bacteria | 2759 |
| 744 | Ga0373955_0046774 | 3300035172 | Bacteria | 2340 |
| 745 | Ga0373955_0124010 | 3300035172 | Bacteria | 1503 |
| 746 | Ga0373955_0181915 | 3300035172 | Unclassified | 1248 |
| 747 | Ga0373955_0247332 | 3300035172 | Bacteria | 1069 |
| 748 | Ga0373955_0427032 | 3300035172 | Bacteria | 806 |
| 749 | Ga0373955_0431260 | 3300035172 | Bacteria | 802 |
| 750 | Ga0373942_0015643 | 3300035207 | Bacteria | 1852 |
| 751 | Ga0373924_0036572 | 3300035410 | Bacteria | 1996 |
| 752 | Ga0373931_0004151 | 3300035691 | Bacteria | 6579 |
| 753 | Ga0373931_0138379 | 3300035691 | Bacteria | 1408 |
| 754 | Ga0373931_0222258 | 3300035691 | Bacteria | 1137 |
| 755 | Ga0373931_0252612 | 3300035691 | Bacteria | 1073 |
| 756 | Ga0373931_0405657 | 3300035691 | Bacteria | 864 |
| 757 | Ga0373931_0442534 | 3300035691 | Bacteria | 830 |
| 758 | Ga0373935_0004402 | 3300035692 | Bacteria | 8271 |
| 759 | Ga0373935_0009514 | 3300035692 | Bacteria | 5814 |
| 760 | Ga0373935_0035237 | 3300035692 | Bacteria | 3123 |
| 761 | Ga0373935_0040476 | 3300035692 | Bacteria | 2925 |
| 762 | Ga0373935_0044615 | 3300035692 | Bacteria | 2794 |
| 763 | Ga0373935_0353389 | 3300035692 | Bacteria | 1048 |
| 764 | Ga0373935_0376461 | 3300035692 | Bacteria | 1016 |
| 765 | Ga0373927_0001631 | 3300035695 | Bacteria | 16813 |
| 766 | Ga0373927_0001997 | 3300035695 | Bacteria | 15042 |
| 767 | Ga0373927_0002674 | 3300035695 | Bacteria | 12990 |
| 768 | Ga0373927_0003550 | 3300035695 | Bacteria | 11146 |
| 769 | Ga0373927_0007120 | 3300035695 | Bacteria | 7590 |
| 770 | Ga0373927_0040133 | 3300035695 | Bacteria | 3037 |
| 771 | Ga0373927_0114326 | 3300035695 | Bacteria | 1759 |
| 772 | Ga0373927_0410309 | 3300035695 | Bacteria | 894 |
| 773 | Ga0373933_0000062 | 3300035724 | Bacteria | 64991 |
| 774 | Ga0373933_0011368 | 3300035724 | Bacteria | 4903 |
| 775 | Ga0373933_0038438 | 3300035724 | Bacteria | 2811 |
| 776 | Ga0373933_0061784 | 3300035724 | Bacteria | 2261 |
| 777 | Ga0373933_0079720 | 3300035724 | Bacteria | 2006 |
| 778 | Ga0373933_0103235 | 3300035724 | Bacteria | 1771 |
| 779 | Ga0373933_0343963 | 3300035724 | Bacteria | 968 |
| 780 | Ga0373947_0000775 | 3300035725 | Bacteria | 19173 |
| 781 | Ga0373947_0002775 | 3300035725 | Bacteria | 10472 |
| 782 | Ga0373947_0009604 | 3300035725 | Bacteria | 5552 |
| 783 | Ga0373947_0178130 | 3300035725 | Bacteria | 1383 |
| 784 | Ga0373947_0233394 | 3300035725 | Bacteria | 1212 |
| 785 | Ga0373937_0006410 | 3300036401 | Bacteria | 10154 |
| 786 | Ga0373937_0016961 | 3300036401 | Bacteria | 6476 |
| 787 | Ga0373937_0043209 | 3300036401 | Bacteria | 4112 |
| 788 | Ga0373937_0083596 | 3300036401 | Bacteria | 2953 |
| 789 | Ga0373937_0114593 | 3300036401 | Bacteria | 2509 |
| 790 | Ga0373937_0121290 | 3300036401 | Bacteria | 2436 |
| 791 | Ga0372808_021550 | 3300036459 | Bacteria | 927 |
| 792 | Ga0373925_0009647 | 3300037068 | Bacteria | 7032 |
| 793 | Ga0373925_0010569 | 3300037068 | Bacteria | 6693 |
| 794 | Ga0373925_0030941 | 3300037068 | Bacteria | 3931 |
| 795 | Ga0373925_0033659 | 3300037068 | Bacteria | 3775 |
| 796 | Ga0373925_0037820 | 3300037068 | Bacteria | 3565 |
| 797 | Ga0373925_0039820 | 3300037068 | Bacteria | 3478 |
| 798 | Ga0373925_0117602 | 3300037068 | Bacteria | 2060 |
| 799 | Ga0373925_0169004 | 3300037068 | Unclassified | 1725 |
| 800 | Ga0373925_0240049 | 3300037068 | Bacteria | 1451 |
| 801 | Ga0373925_1027809 | 3300037068 | Bacteria | 678 |
| 802 | Ga0395899_0057698 | 3300037312 | Bacteria | 2865 |
| 803 | Ga0395899_0334368 | 3300037312 | Bacteria | 1017 |
| 804 | Ga0395899_0406425 | 3300037312 | Bacteria | 900 |
| 805 | Ga0395899_0542273 | 3300037312 | Bacteria | 749 |
| 806 | Ga0395900_0001786 | 3300037418 | Bacteria | 24649 |
| 807 | Ga0395900_0183547 | 3300037418 | Bacteria | 2124 |
| 808 | Ga0395900_0256586 | 3300037418 | Bacteria | 1747 |
| 809 | Ga0395900_0305073 | 3300037418 | Bacteria | 1577 |
| 810 | Ga0395898_0042817 | 3300037466 | Bacteria | 4465 |
| 811 | Ga0395898_0167294 | 3300037466 | Bacteria | 2102 |
| 812 | Ga0395898_0246436 | 3300037466 | Bacteria | 1704 |
| 813 | Ga0395898_0817361 | 3300037466 | Bacteria | 872 |
| 814 | Ga0395905_0025721 | 3300037471 | Bacteria | 5550 |
| 815 | Ga0395905_0057784 | 3300037471 | Bacteria | 3628 |
| 816 | Ga0395905_0386848 | 3300037471 | Bacteria | 1293 |
| 817 | Ga0395905_0436080 | 3300037471 | Bacteria | 1207 |
| 818 | Ga0395905_1174172 | 3300037471 | Bacteria | 671 |
| 819 | Ga0436364_0209550 | 3300037853 | Bacteria | 7718 |
| 820 | Ga0395901_0012729 | 3300038443 | Bacteria | 8534 |
| 821 | Ga0395901_0046838 | 3300038443 | Bacteria | 4492 |
| 822 | Ga0395901_0102502 | 3300038443 | Bacteria | 3004 |
| 823 | Ga0395901_0118999 | 3300038443 | Bacteria | 2775 |
| 824 | Ga0395901_0165792 | 3300038443 | Bacteria | 2320 |
| 825 | Ga0395901_0393971 | 3300038443 | Bacteria | 1423 |
| 826 | Ga0395901_0875526 | 3300038443 | Bacteria | 882 |
| 827 | Ga0395901_1112557 | 3300038443 | Bacteria | 760 |
| 828 | Ga0436365_0034335 | 3300039437 | Bacteria | 4704 |
| 829 | Ga0436365_0100384 | 3300039437 | Bacteria | 14382 |
| 830 | Ga0436365_0592065 | 3300039437 | Bacteria | 6307 |
| 831 | Ga0436365_1461628 | 3300039437 | Bacteria | 1201 |
| 832 | Ga0436365_1578029 | 3300039437 | Bacteria | 694 |
| 833 | Ga0436365_1635710 | 3300039437 | Bacteria | 9235 |
| 834 | Ga0436360_0841399 | 3300039438 | Bacteria | 1229 |
| 835 | Ga0436360_1128260 | 3300039438 | Bacteria | 1136 |
| 836 | Ga0436361_0460374 | 3300039447 | Bacteria | 849 |
| 837 | Ga0436361_0547832 | 3300039447 | Bacteria | 2104 |
| 838 | Ga0436361_1066754 | 3300039447 | Bacteria | 2073 |
| 839 | Ga0436363_0096959 | 3300039450 | Bacteria | 669 |
| 840 | Ga0436363_0235830 | 3300039450 | Bacteria | 9228 |
| 841 | Ga0436363_0497150 | 3300039450 | Bacteria | 3880 |
| 842 | Ga0436363_0757377 | 3300039450 | Bacteria | 918 |
| 843 | Ga0436362_0358185 | 3300039453 | Bacteria | 1386 |
| 844 | Ga0436362_1228923 | 3300039453 | Bacteria | 899 |
| 845 | Ga0451800_0836785 | 3300041459 | Bacteria | 943 |
| 846 | Ga0451807_1316634 | 3300041486 | Bacteria | 921 |
| 847 | Ga0451839_1366619 | 3300041496 | Bacteria | 714 |
| 848 | Ga0451843_0418884 | 3300041509 | Bacteria | 1104 |
| 849 | Ga0451855_0811600 | 3300041511 | Bacteria | 676 |
| 850 | Ga0439441_071950 | 3300042001 | Bacteria | 743 |
| 851 | Ga0466969_0014467 | 3300044656 | Bacteria | 4149 |
| 852 | Ga0466972_0000200 | 3300044658 | Bacteria | 43953 |
| 853 | Ga0466972_0020843 | 3300044658 | Bacteria | 3272 |
| 854 | Ga0466965_0074017 | 3300044683 | Bacteria | 1716 |
| 855 | Ga0466966_0021082 | 3300044684 | Bacteria | 4280 |
| 856 | Ga0466961_0000102 | 3300044693 | Bacteria | 55644 |
| 857 | Ga0466961_0105547 | 3300044693 | Bacteria | 1774 |
| 858 | Ga0466963_0020583 | 3300044694 | Bacteria | 4149 |
| 859 | Ga0466963_0039622 | 3300044694 | Bacteria | 3086 |
| 860 | Ga0466964_0059951 | 3300044706 | Bacteria | 1582 |
| 861 | Ga0466968_0059593 | 3300044735 | Bacteria | 1644 |
| 862 | Ga0466968_0242783 | 3300044735 | Bacteria | 853 |
| 863 | Ga0466957_0019778 | 3300044842 | Bacteria | 3963 |
| 864 | Ga0466957_0113952 | 3300044842 | Bacteria | 1717 |
| 865 | Ga0466960_0028887 | 3300044901 | Bacteria | 2540 |
| 866 | Ga0466960_0111836 | 3300044901 | Bacteria | 1420 |
| 867 | Ga0466959_0039738 | 3300045049 | Bacteria | 3477 |
| 868 | Ga0466959_0081703 | 3300045049 | Bacteria | 2329 |
| 869 | Ga0466959_0189018 | 3300045049 | Bacteria | 1438 |
| 870 | Ga0466959_0218567 | 3300045049 | Bacteria | 1322 |
| 871 | Ga0466959_0230734 | 3300045049 | Bacteria | 1281 |
| 872 | Ga0466967_0067953 | 3300045976 | Bacteria | 3180 |
| 873 | Ga0466967_0170216 | 3300045976 | Bacteria | 2049 |
| 874 | Ga0466967_0494890 | 3300045976 | Bacteria | 1199 |
| 875 | Ga0495617_028545 | 3300046452 | Bacteria | 1875 |
| 876 | Ga0495617_143779 | 3300046452 | Bacteria | 761 |
| 877 | Ga0495592_0042882 | 3300046454 | Bacteria | 3387 |
| 878 | Ga0495592_0055751 | 3300046454 | Bacteria | 2922 |
| 879 | Ga0495592_0089446 | 3300046454 | Bacteria | 2211 |
| 880 | Ga0495592_0101010 | 3300046454 | Bacteria | 2056 |
| 881 | Ga0495592_0153346 | 3300046454 | Bacteria | 1591 |
| 882 | Ga0495592_0162625 | 3300046454 | Bacteria | 1534 |
| 883 | Ga0495592_0380530 | 3300046454 | Bacteria | 898 |
| 884 | Ga0495592_0504643 | 3300046454 | Bacteria | 750 |
| 885 | Ga0495603_0001689 | 3300046455 | Bacteria | 12972 |
| 886 | Ga0495603_0013972 | 3300046455 | Bacteria | 4856 |
| 887 | Ga0495603_0019223 | 3300046455 | Bacteria | 4136 |
| 888 | Ga0495603_0085847 | 3300046455 | Bacteria | 1842 |
| 889 | Ga0495603_0090905 | 3300046455 | Bacteria | 1785 |
| 890 | Ga0495603_0119401 | 3300046455 | Bacteria | 1537 |
| 891 | Ga0495603_0439088 | 3300046455 | Unclassified | 747 |
| 892 | Ga0495629_0002784 | 3300046459 | Bacteria | 13349 |
| 893 | Ga0495629_0005268 | 3300046459 | Bacteria | 9666 |
| 894 | Ga0495629_0027516 | 3300046459 | Bacteria | 4037 |
| 895 | Ga0495629_0057552 | 3300046459 | Bacteria | 2718 |
| 896 | Ga0495629_0083029 | 3300046459 | Bacteria | 2236 |
| 897 | Ga0495629_0227978 | 3300046459 | Bacteria | 1284 |
| 898 | Ga0495629_0480286 | 3300046459 | Bacteria | 839 |
| 899 | Ga0495638_0078309 | 3300046460 | Bacteria | 2011 |
| 900 | Ga0495638_0324809 | 3300046460 | Bacteria | 821 |
| 901 | Ga0495638_0359303 | 3300046460 | Bacteria | 766 |
| 902 | Ga0495641_0015327 | 3300046461 | Bacteria | 4098 |
| 903 | Ga0495651_0013038 | 3300046462 | Bacteria | 6421 |
| 904 | Ga0495651_0020762 | 3300046462 | Bacteria | 5099 |
| 905 | Ga0495651_0033911 | 3300046462 | Bacteria | 3980 |
| 906 | Ga0495651_0087384 | 3300046462 | Bacteria | 2344 |
| 907 | Ga0495651_0149193 | 3300046462 | Bacteria | 1687 |
| 908 | Ga0495651_0225667 | 3300046462 | Bacteria | 1293 |
| 909 | Ga0495651_0309713 | 3300046462 | Bacteria | 1056 |
| 910 | Ga0495653_0031788 | 3300046463 | Bacteria | 4194 |
| 911 | Ga0495653_0119850 | 3300046463 | Unclassified | 1877 |
| 912 | Ga0495653_0155914 | 3300046463 | Bacteria | 1590 |
| 913 | Ga0495653_0288135 | 3300046463 | Bacteria | 1075 |
| 914 | Ga0495580_0005616 | 3300046472 | Bacteria | 10331 |
| 915 | Ga0495580_0008118 | 3300046472 | Bacteria | 8372 |
| 916 | Ga0495580_0026858 | 3300046472 | Bacteria | 4193 |
| 917 | Ga0495580_0082961 | 3300046472 | Bacteria | 2234 |
| 918 | Ga0495580_0163421 | 3300046472 | Unclassified | 1540 |
| 919 | Ga0495580_0576188 | 3300046472 | Bacteria | 745 |
| 920 | Ga0495582_0000228 | 3300046473 | Bacteria | 31086 |
| 921 | Ga0495582_0008256 | 3300046473 | Bacteria | 5747 |
| 922 | Ga0495582_0042985 | 3300046473 | Bacteria | 2488 |
| 923 | Ga0495582_0076883 | 3300046473 | Bacteria | 1851 |
| 924 | Ga0495582_0172377 | 3300046473 | Bacteria | 1232 |
| 925 | Ga0495605_0106592 | 3300046474 | Bacteria | 1282 |
| 926 | Ga0495639_0000261 | 3300046475 | Bacteria | 26039 |
| 927 | Ga0495639_0001957 | 3300046475 | Bacteria | 9135 |
| 928 | Ga0495639_0016411 | 3300046475 | Bacteria | 3215 |
| 929 | Ga0495639_0045026 | 3300046475 | Bacteria | 1996 |
| 930 | Ga0495639_0053948 | 3300046475 | Bacteria | 1832 |
| 931 | Ga0495639_0069279 | 3300046475 | Bacteria | 1627 |
| 932 | Ga0495639_0311576 | 3300046475 | Bacteria | 786 |
| 933 | Ga0495662_0001403 | 3300046476 | Bacteria | 11950 |
| 934 | Ga0495662_0009843 | 3300046476 | Bacteria | 4696 |
| 935 | Ga0495662_0029901 | 3300046476 | Bacteria | 2629 |
| 936 | Ga0495662_0033540 | 3300046476 | Bacteria | 2480 |
| 937 | Ga0495662_0225180 | 3300046476 | Bacteria | 925 |
| 938 | Ga0495662_0241520 | 3300046476 | Bacteria | 890 |
| 939 | Ga0495664_0009409 | 3300046477 | Bacteria | 5467 |
| 940 | Ga0495664_0009558 | 3300046477 | Bacteria | 5426 |
| 941 | Ga0495664_0019496 | 3300046477 | Bacteria | 3900 |
| 942 | Ga0495664_0035329 | 3300046477 | Bacteria | 2942 |
| 943 | Ga0495664_0056486 | 3300046477 | Bacteria | 2335 |
| 944 | Ga0495664_0068578 | 3300046477 | Bacteria | 2116 |
| 945 | Ga0495664_0114438 | 3300046477 | Bacteria | 1630 |
| 946 | Ga0495584_0049348 | 3300046491 | Bacteria | 2121 |
| 947 | Ga0495584_0199609 | 3300046491 | Bacteria | 1017 |
| 948 | Ga0495584_0270842 | 3300046491 | Bacteria | 863 |
| 949 | Ga0495585_0059383 | 3300046492 | Unclassified | 2107 |
| 950 | Ga0495585_0117789 | 3300046492 | Bacteria | 1407 |
| 951 | Ga0495585_0138573 | 3300046492 | Bacteria | 1275 |
| 952 | Ga0495594_0010814 | 3300046499 | Bacteria | 4741 |
| 953 | Ga0495594_0083875 | 3300046499 | Unclassified | 1781 |
| 954 | Ga0495594_0110971 | 3300046499 | Bacteria | 1547 |
| 955 | Ga0495594_0167097 | 3300046499 | Bacteria | 1251 |
| 956 | Ga0495594_0449903 | 3300046499 | Bacteria | 732 |
| 957 | Ga0495607_0027106 | 3300046501 | Bacteria | 3548 |
| 958 | Ga0495607_0043332 | 3300046501 | Unclassified | 2662 |
| 959 | Ga0495583_0176304 | 3300046506 | Bacteria | 876 |
| 960 | Ga0495606_0006063 | 3300046507 | Bacteria | 11295 |
| 961 | Ga0495606_0045509 | 3300046507 | Bacteria | 2907 |
| 962 | Ga0495606_0060727 | 3300046507 | Bacteria | 2420 |
| 963 | Ga0495606_0334353 | 3300046507 | Bacteria | 809 |
| 964 | Ga0495608_0005477 | 3300046511 | Bacteria | 9073 |
| 965 | Ga0495608_0051105 | 3300046511 | Bacteria | 2740 |
| 966 | Ga0495608_0190261 | 3300046511 | Bacteria | 1296 |
| 967 | Ga0495608_0300929 | 3300046511 | Bacteria | 993 |
| 968 | Ga0495610_0041466 | 3300046512 | Bacteria | 2310 |
| 969 | Ga0495610_0103565 | 3300046512 | Bacteria | 1271 |
| 970 | Ga0495610_0254338 | 3300046512 | Bacteria | 694 |
| 971 | Ga0495616_0106933 | 3300046513 | Bacteria | 1304 |
| 972 | Ga0495616_0107976 | 3300046513 | Bacteria | 1296 |
| 973 | Ga0495618_0009115 | 3300046514 | Bacteria | 5988 |
| 974 | Ga0495618_0010034 | 3300046514 | Bacteria | 5728 |
| 975 | Ga0495618_0024844 | 3300046514 | Bacteria | 3714 |
| 976 | Ga0495618_0048145 | 3300046514 | Bacteria | 2691 |
| 977 | Ga0495618_0103105 | 3300046514 | Bacteria | 1826 |
| 978 | Ga0495618_0225580 | 3300046514 | Bacteria | 1181 |
| 979 | Ga0495618_0345238 | 3300046514 | Bacteria | 918 |
| 980 | Ga0495620_0092455 | 3300046515 | Bacteria | 1212 |
| 981 | Ga0495628_0011105 | 3300046516 | Bacteria | 7623 |
| 982 | Ga0495628_0018283 | 3300046516 | Bacteria | 5811 |
| 983 | Ga0495628_0033468 | 3300046516 | Bacteria | 4142 |
| 984 | Ga0495628_0149640 | 3300046516 | Bacteria | 1779 |
| 985 | Ga0495628_0240734 | 3300046516 | Bacteria | 1353 |
| 986 | Ga0495630_0001773 | 3300046517 | Bacteria | 15102 |
| 987 | Ga0495630_0007498 | 3300046517 | Bacteria | 7797 |
| 988 | Ga0495630_0095136 | 3300046517 | Bacteria | 2252 |
| 989 | Ga0495630_0100824 | 3300046517 | Unclassified | 2184 |
| 990 | Ga0495630_0152889 | 3300046517 | Unclassified | 1756 |
| 991 | Ga0495630_0154542 | 3300046517 | Bacteria | 1746 |
| 992 | Ga0495630_0235245 | 3300046517 | Bacteria | 1400 |
| 993 | Ga0495630_1153539 | 3300046517 | Bacteria | 587 |
| 994 | Ga0495631_0018806 | 3300046518 | Bacteria | 3248 |
| 995 | Ga0495631_0070805 | 3300046518 | Bacteria | 1507 |
| 996 | Ga0495631_0154661 | 3300046518 | Bacteria | 984 |
| 997 | Ga0495632_0078062 | 3300046519 | Bacteria | 1582 |
| 998 | Ga0495632_0241791 | 3300046519 | Bacteria | 812 |
| 999 | Ga0495643_0010662 | 3300046522 | Bacteria | 5646 |
| 1000 | Ga0495643_0081066 | 3300046522 | Bacteria | 1688 |
| 1001 | Ga0495643_0189941 | 3300046522 | Bacteria | 992 |
| 1002 | Ga0495644_0057469 | 3300046523 | Bacteria | 1462 |
| 1003 | Ga0495644_0250408 | 3300046523 | Bacteria | 688 |
| 1004 | Ga0495648_0003345 | 3300046524 | Bacteria | 14142 |
| 1005 | Ga0495648_0004592 | 3300046524 | Bacteria | 11760 |
| 1006 | Ga0495648_0083048 | 3300046524 | Bacteria | 1816 |
| 1007 | Ga0495666_0006712 | 3300046526 | Bacteria | 5789 |
| 1008 | Ga0495666_0059767 | 3300046526 | Bacteria | 1823 |
| 1009 | Ga0495666_0085656 | 3300046526 | Bacteria | 1488 |
| 1010 | Ga0495666_0179338 | 3300046526 | Bacteria | 978 |
| 1011 | Ga0495652_0019969 | 3300046529 | Bacteria | 5958 |
| 1012 | Ga0495652_0023429 | 3300046529 | Bacteria | 5471 |
| 1013 | Ga0495652_0038900 | 3300046529 | Bacteria | 4116 |
| 1014 | Ga0495652_0041390 | 3300046529 | Bacteria | 3977 |
| 1015 | Ga0495652_0044333 | 3300046529 | Bacteria | 3831 |
| 1016 | Ga0495652_0072785 | 3300046529 | Bacteria | 2863 |
| 1017 | Ga0495652_0174916 | 3300046529 | Bacteria | 1653 |
| 1018 | Ga0495665_0005489 | 3300046531 | Bacteria | 6828 |
| 1019 | Ga0495665_0034460 | 3300046531 | Bacteria | 2707 |
| 1020 | Ga0495665_0065474 | 3300046531 | Bacteria | 1918 |
| 1021 | Ga0495665_0148508 | 3300046531 | Unclassified | 1224 |
| 1022 | Ga0495640_0007929 | 3300046533 | Bacteria | 8351 |
| 1023 | Ga0495640_0009559 | 3300046533 | Bacteria | 7542 |
| 1024 | Ga0495640_0041460 | 3300046533 | Bacteria | 3217 |
| 1025 | Ga0495640_0059963 | 3300046533 | Unclassified | 2589 |
| 1026 | Ga0495640_0066561 | 3300046533 | Unclassified | 2430 |
| 1027 | Ga0495640_0088014 | 3300046533 | Bacteria | 2053 |
| 1028 | Ga0495640_0092347 | 3300046533 | Bacteria | 1996 |
| 1029 | Ga0495640_0276026 | 3300046533 | Bacteria | 1047 |
| 1030 | Ga0495586_0082113 | 3300046535 | Unclassified | 1772 |
| 1031 | Ga0495586_0103235 | 3300046535 | Unclassified | 1583 |
| 1032 | Ga0495587_0049432 | 3300046536 | Unclassified | 2489 |
| 1033 | Ga0495587_0089452 | 3300046536 | Bacteria | 1779 |
| 1034 | Ga0495587_0174791 | 3300046536 | Bacteria | 1219 |
| 1035 | Ga0495609_0092364 | 3300046538 | Bacteria | 1316 |
| 1036 | Ga0495621_0009179 | 3300046539 | Bacteria | 2994 |
| 1037 | Ga0495645_0046050 | 3300046543 | Bacteria | 3180 |
| 1038 | Ga0495645_0071072 | 3300046543 | Bacteria | 2510 |
| 1039 | Ga0495645_0090596 | 3300046543 | Bacteria | 2185 |
| 1040 | Ga0495645_0099826 | 3300046543 | Bacteria | 2065 |
| 1041 | Ga0495645_0155917 | 3300046543 | Bacteria | 1582 |
| 1042 | Ga0495645_0437886 | 3300046543 | Bacteria | 826 |
| 1043 | Ga0495622_0004883 | 3300046557 | Bacteria | 6208 |
| 1044 | Ga0495622_0006509 | 3300046557 | Bacteria | 5418 |
| 1045 | Ga0495622_0043915 | 3300046557 | Bacteria | 2077 |
| 1046 | Ga0495633_0004411 | 3300046558 | Bacteria | 8958 |
| 1047 | Ga0495633_0037789 | 3300046558 | Bacteria | 2309 |
| 1048 | Ga0495633_0058116 | 3300046558 | Bacteria | 1816 |
| 1049 | Ga0495667_0005052 | 3300046559 | Bacteria | 8922 |
| 1050 | Ga0495667_0005284 | 3300046559 | Bacteria | 8729 |
| 1051 | Ga0495667_0019161 | 3300046559 | Bacteria | 4618 |
| 1052 | Ga0495667_0093728 | 3300046559 | Bacteria | 1944 |
| 1053 | Ga0495667_0108078 | 3300046559 | Bacteria | 1797 |
| 1054 | Ga0495667_0125357 | 3300046559 | Bacteria | 1657 |
| 1055 | Ga0495667_0185227 | 3300046559 | Bacteria | 1335 |
| 1056 | Ga0495667_0215758 | 3300046559 | Bacteria | 1225 |
| 1057 | Ga0495667_0551771 | 3300046559 | Bacteria | 720 |
| 1058 | Ga0495667_0562913 | 3300046559 | Bacteria | 712 |
| 1059 | Ga0495667_0607637 | 3300046559 | Unclassified | 681 |
| 1060 | Ga0495656_0018299 | 3300046615 | Bacteria | 2687 |
| 1061 | Ga0495656_0020894 | 3300046615 | Bacteria | 2543 |
| 1062 | Ga0495656_0099459 | 3300046615 | Bacteria | 1343 |
| 1063 | Ga0495656_0153532 | 3300046615 | Bacteria | 1114 |
| 1064 | Ga0495656_0227122 | 3300046615 | Bacteria | 935 |
| 1065 | Ga0495656_0229854 | 3300046615 | Bacteria | 930 |
| 1066 | Ga0495668_0021645 | 3300046616 | Bacteria | 3684 |
| 1067 | Ga0495668_0021688 | 3300046616 | Bacteria | 3680 |
| 1068 | Ga0495668_0071686 | 3300046616 | Bacteria | 1904 |
| 1069 | Ga0495668_0179518 | 3300046616 | Bacteria | 1160 |
| 1070 | Ga0495634_0003006 | 3300046642 | Bacteria | 13727 |
| 1071 | Ga0495634_0020439 | 3300046642 | Bacteria | 4695 |
| 1072 | Ga0495634_0022022 | 3300046642 | Bacteria | 4494 |
| 1073 | Ga0495634_0115063 | 3300046642 | Bacteria | 1726 |
| 1074 | Ga0495634_0196192 | 3300046642 | Unclassified | 1256 |
| 1075 | Ga0495634_0627858 | 3300046642 | Bacteria | 622 |
| 1076 | Ga0495611_0030844 | 3300046648 | Bacteria | 2358 |
| 1077 | Ga0495611_0174882 | 3300046648 | Bacteria | 1003 |
| 1078 | Ga0495625_0114346 | 3300046660 | Bacteria | 1842 |
| 1079 | Ga0495625_0207415 | 3300046660 | Bacteria | 1290 |
| 1080 | Ga0495635_0000584 | 3300046663 | Bacteria | 23456 |
| 1081 | Ga0495635_0002773 | 3300046663 | Bacteria | 12015 |
| 1082 | Ga0495635_0045260 | 3300046663 | Unclassified | 3036 |
| 1083 | Ga0495635_0062187 | 3300046663 | Bacteria | 2563 |
| 1084 | Ga0495635_0109045 | 3300046663 | Bacteria | 1891 |
| 1085 | Ga0495635_0142774 | 3300046663 | Bacteria | 1630 |
| 1086 | Ga0495635_0225883 | 3300046663 | Unclassified | 1265 |
| 1087 | Ga0495661_0116248 | 3300046665 | Bacteria | 1484 |
| 1088 | Ga0495661_0136167 | 3300046665 | Bacteria | 1340 |
| 1089 | Ga0495588_0007973 | 3300046674 | Bacteria | 4841 |
| 1090 | Ga0495588_0055835 | 3300046674 | Unclassified | 2038 |
| 1091 | Ga0495588_0070439 | 3300046674 | Bacteria | 1817 |
| 1092 | Ga0495588_0137426 | 3300046674 | Bacteria | 1290 |
| 1093 | Ga0495588_0138678 | 3300046674 | Bacteria | 1284 |
| 1094 | Ga0495588_0521193 | 3300046674 | Bacteria | 623 |
| 1095 | Ga0495657_0004948 | 3300046675 | Bacteria | 10591 |
| 1096 | Ga0495657_0050289 | 3300046675 | Bacteria | 2802 |
| 1097 | Ga0495657_0123948 | 3300046675 | Bacteria | 1625 |
| 1098 | Ga0495657_0202310 | 3300046675 | Bacteria | 1210 |
| 1099 | Ga0495657_0283668 | 3300046675 | Bacteria | 990 |
| 1100 | Ga0495599_0015121 | 3300046678 | Bacteria | 4784 |
| 1101 | Ga0495599_0039462 | 3300046678 | Bacteria | 2966 |
| 1102 | Ga0495599_0050298 | 3300046678 | Bacteria | 2611 |
| 1103 | Ga0495599_0062978 | 3300046678 | Bacteria | 2317 |
| 1104 | Ga0495599_0149633 | 3300046678 | Bacteria | 1446 |
| 1105 | Ga0495599_0288212 | 3300046678 | Unclassified | 993 |
| 1106 | Ga0495623_0001850 | 3300046679 | Bacteria | 14179 |
| 1107 | Ga0495623_0009506 | 3300046679 | Bacteria | 6313 |
| 1108 | Ga0495623_0073594 | 3300046679 | Bacteria | 2124 |
| 1109 | Ga0495646_0031462 | 3300046680 | Bacteria | 3306 |
| 1110 | Ga0495646_0065534 | 3300046680 | Bacteria | 2151 |
| 1111 | Ga0495646_0084155 | 3300046680 | Bacteria | 1847 |
| 1112 | Ga0495646_0142062 | 3300046680 | Bacteria | 1341 |
| 1113 | Ga0495646_0154331 | 3300046680 | Bacteria | 1275 |
| 1114 | Ga0495647_0001733 | 3300046681 | Bacteria | 6766 |
| 1115 | Ga0495647_0024455 | 3300046681 | Bacteria | 2198 |
| 1116 | Ga0495647_0068186 | 3300046681 | Bacteria | 1419 |
| 1117 | Ga0495647_0070504 | 3300046681 | Unclassified | 1398 |
| 1118 | Ga0495647_0121817 | 3300046681 | Bacteria | 1097 |
| 1119 | Ga0495647_0479372 | 3300046681 | Unclassified | 578 |
| 1120 | Ga0495658_0000941 | 3300046683 | Bacteria | 15502 |
| 1121 | Ga0495658_0007724 | 3300046683 | Bacteria | 5329 |
| 1122 | Ga0495658_0011094 | 3300046683 | Bacteria | 4522 |
| 1123 | Ga0495658_0018412 | 3300046683 | Bacteria | 3632 |
| 1124 | Ga0495658_0066994 | 3300046683 | Bacteria | 2075 |
| 1125 | Ga0495658_0121326 | 3300046683 | Bacteria | 1581 |
| 1126 | Ga0495658_0138067 | 3300046683 | Bacteria | 1489 |
| 1127 | Ga0495669_0006028 | 3300046684 | Bacteria | 5056 |
| 1128 | Ga0495613_0019620 | 3300046689 | Bacteria | 5040 |
| 1129 | Ga0495613_0023147 | 3300046689 | Bacteria | 4629 |
| 1130 | Ga0495613_0023549 | 3300046689 | Bacteria | 4588 |
| 1131 | Ga0495613_0039198 | 3300046689 | Bacteria | 3513 |
| 1132 | Ga0495613_0060021 | 3300046689 | Bacteria | 2786 |
| 1133 | Ga0495613_0129228 | 3300046689 | Bacteria | 1810 |
| 1134 | Ga0495613_0153403 | 3300046689 | Bacteria | 1642 |
| 1135 | Ga0495613_0208761 | 3300046689 | Unclassified | 1374 |
| 1136 | Ga0495613_0217660 | 3300046689 | Unclassified | 1341 |
| 1137 | Ga0495613_0309650 | 3300046689 | Unclassified | 1092 |
| 1138 | Ga0495624_0001434 | 3300046690 | Bacteria | 18540 |
| 1139 | Ga0495624_0004285 | 3300046690 | Bacteria | 10478 |
| 1140 | Ga0495624_0009777 | 3300046690 | Bacteria | 6636 |
| 1141 | Ga0495624_0025490 | 3300046690 | Bacteria | 3881 |
| 1142 | Ga0495624_0191613 | 3300046690 | Unclassified | 1243 |
| 1143 | Ga0495624_0293753 | 3300046690 | Bacteria | 980 |
| 1144 | Ga0495670_0006183 | 3300046691 | Bacteria | 5882 |
| 1145 | Ga0495670_0011261 | 3300046691 | Bacteria | 4396 |
| 1146 | Ga0495670_0053226 | 3300046691 | Bacteria | 2027 |
| 1147 | Ga0495671_0103138 | 3300046692 | Bacteria | 1393 |
| 1148 | Ga0495671_0282527 | 3300046692 | Bacteria | 799 |
| 1149 | Ga0495671_0300985 | 3300046692 | Unclassified | 771 |
| 1150 | Ga0495649_0205836 | 3300046694 | Bacteria | 1021 |
| 1151 | Ga0495589_0238258 | 3300046794 | Bacteria | 852 |
| 1152 | Ga0495600_0000403 | 3300046809 | Bacteria | 22314 |
| 1153 | Ga0495600_0035078 | 3300046809 | Bacteria | 3257 |
| 1154 | Ga0495600_0083126 | 3300046809 | Bacteria | 2090 |
| 1155 | Ga0495600_0117057 | 3300046809 | Bacteria | 1734 |
| 1156 | Ga0495600_0121385 | 3300046809 | Bacteria | 1699 |
| 1157 | Ga0495600_0230472 | 3300046809 | Unclassified | 1182 |
| 1158 | Ga0495660_0095184 | 3300046810 | Bacteria | 1541 |
| 1159 | Ga0495660_0198100 | 3300046810 | Bacteria | 961 |
| 1160 | Ga0495581_0001142 | 3300047315 | Bacteria | 14513 |
| 1161 | Ga0495581_0023132 | 3300047315 | Bacteria | 3601 |
| 1162 | Ga0495581_0030889 | 3300047315 | Bacteria | 3103 |
| 1163 | Ga0495581_0038552 | 3300047315 | Bacteria | 2765 |
| 1164 | Ga0495581_0073761 | 3300047315 | Bacteria | 1975 |
| 1165 | Ga0495581_0120561 | 3300047315 | Bacteria | 1526 |
| 1166 | Ga0495581_0257740 | 3300047315 | Bacteria | 1020 |
| 1167 | Ga0495604_0008342 | 3300047317 | Bacteria | 8194 |
| 1168 | Ga0495604_0035753 | 3300047317 | Bacteria | 3921 |
| 1169 | Ga0495604_0046930 | 3300047317 | Bacteria | 3366 |
| 1170 | Ga0495604_0121167 | 3300047317 | Bacteria | 1893 |
| 1171 | Ga0495604_0151753 | 3300047317 | Bacteria | 1645 |
| 1172 | Ga0495604_0162247 | 3300047317 | Bacteria | 1578 |
| 1173 | Ga0495604_0320768 | 3300047317 | Bacteria | 1035 |
| 1174 | Ga0495636_0054992 | 3300047318 | Bacteria | 1673 |
| 1175 | Ga0495674_0001977 | 3300047319 | Bacteria | 20157 |
| 1176 | Ga0495674_0005615 | 3300047319 | Bacteria | 12027 |
| 1177 | Ga0495674_0051155 | 3300047319 | Bacteria | 3642 |
| 1178 | Ga0495674_0068279 | 3300047319 | Bacteria | 3077 |
| 1179 | Ga0495674_0076517 | 3300047319 | Bacteria | 2878 |
| 1180 | Ga0495674_0085887 | 3300047319 | Bacteria | 2695 |
| 1181 | Ga0495674_0122252 | 3300047319 | Bacteria | 2198 |
| 1182 | Ga0495674_0591465 | 3300047319 | Bacteria | 880 |
| 1183 | Ga0495672_0199407 | 3300047320 | Bacteria | 1002 |
| 1184 | Ga0495672_0365503 | 3300047320 | Bacteria | 667 |
| 1185 | Ga0495676_0062775 | 3300047321 | Unclassified | 2899 |
| 1186 | Ga0495676_0065085 | 3300047321 | Bacteria | 2831 |
| 1187 | Ga0495676_0067422 | 3300047321 | Bacteria | 2768 |
| 1188 | Ga0495676_0087817 | 3300047321 | Bacteria | 2335 |
| 1189 | Ga0495676_0427750 | 3300047321 | Bacteria | 876 |
| 1190 | Ga0495680_0051093 | 3300047322 | Bacteria | 3229 |
| 1191 | Ga0495680_0066841 | 3300047322 | Bacteria | 2750 |
| 1192 | Ga0495680_0088283 | 3300047322 | Bacteria | 2330 |
| 1193 | Ga0495680_0096285 | 3300047322 | Unclassified | 2211 |
| 1194 | Ga0495680_0194557 | 3300047322 | Bacteria | 1458 |
| 1195 | Ga0495680_0312293 | 3300047322 | Bacteria | 1101 |
| 1196 | Ga0495683_0099138 | 3300047323 | Bacteria | 1403 |
| 1197 | Ga0495675_0009532 | 3300047444 | Bacteria | 6049 |
| 1198 | Ga0495675_0159215 | 3300047444 | Bacteria | 1391 |
| 1199 | Ga0495675_0190637 | 3300047444 | Bacteria | 1251 |
| 1200 | Ga0495679_021704 | 3300047446 | Unclassified | 2211 |
| 1201 | Ga0495673_0021531 | 3300047469 | Bacteria | 3181 |
| 1202 | Ga0495673_0055161 | 3300047469 | Bacteria | 1725 |
| 1203 | Ga0495673_0120623 | 3300047469 | Bacteria | 1039 |
| 1204 | Ga0495673_0157876 | 3300047469 | Bacteria | 872 |
| 1205 | Ga0495681_0188150 | 3300047470 | Bacteria | 844 |
| 1206 | Ga0495684_0008846 | 3300047471 | Bacteria | 7781 |
| 1207 | Ga0495684_0012789 | 3300047471 | Bacteria | 6476 |
| 1208 | Ga0495684_0028651 | 3300047471 | Bacteria | 4275 |
| 1209 | Ga0495684_0030022 | 3300047471 | Bacteria | 4174 |
| 1210 | Ga0495684_0088669 | 3300047471 | Bacteria | 2344 |
| 1211 | Ga0495684_0089734 | 3300047471 | Bacteria | 2329 |
| 1212 | Ga0495684_0123166 | 3300047471 | Unclassified | 1951 |
| 1213 | Ga0495684_0146768 | 3300047471 | Bacteria | 1766 |
| 1214 | Ga0495684_0200470 | 3300047471 | Bacteria | 1471 |
| 1215 | Ga0495686_0021356 | 3300047472 | Bacteria | 4301 |
| 1216 | Ga0495686_0044707 | 3300047472 | Bacteria | 2803 |
| 1217 | Ga0495686_0124139 | 3300047472 | Bacteria | 1536 |
| 1218 | Ga0495593_0002128 | 3300047673 | Bacteria | 11830 |
| 1219 | Ga0495593_0023793 | 3300047673 | Bacteria | 3400 |
| 1220 | Ga0495593_0038236 | 3300047673 | Bacteria | 2592 |
| 1221 | Ga0495593_0100701 | 3300047673 | Bacteria | 1481 |
| 1222 | Ga0495593_0136478 | 3300047673 | Bacteria | 1244 |
| 1223 | Ga0495593_0362844 | 3300047673 | Unclassified | 724 |
| 1224 | Ga0495602_0010811 | 3300048088 | Bacteria | 9458 |
| 1225 | Ga0495602_0023787 | 3300048088 | Bacteria | 5960 |
| 1226 | Ga0495602_0040943 | 3300048088 | Bacteria | 4237 |
| 1227 | Ga0495602_0043422 | 3300048088 | Bacteria | 4087 |
| 1228 | Ga0495602_0105087 | 3300048088 | Bacteria | 2309 |
| 1229 | Ga0495602_0244467 | 3300048088 | Bacteria | 1341 |
| 1230 | Ga0495614_0047880 | 3300048089 | Unclassified | 1833 |
| 1231 | Ga0495614_0214726 | 3300048089 | Bacteria | 873 |
| 1232 | Ga0495615_0054260 | 3300048090 | Bacteria | 1040 |
| 1233 | Ga0495626_0140392 | 3300048091 | Bacteria | 1025 |
| 1234 | Ga0496100_0002855 | 3300048903 | Bacteria | 8848 |
| 1235 | Ga0496100_0042265 | 3300048903 | Bacteria | 2911 |
| 1236 | Ga0496100_0047384 | 3300048903 | Bacteria | 2769 |
| 1237 | Ga0496100_0140543 | 3300048903 | Bacteria | 1711 |
| 1238 | Ga0496100_0379039 | 3300048903 | Bacteria | 1074 |
| 1239 | Ga0496101_0015791 | 3300048904 | Bacteria | 5095 |
| 1240 | Ga0496101_0016053 | 3300048904 | Bacteria | 5055 |
| 1241 | Ga0496101_0095187 | 3300048904 | Bacteria | 2221 |
| 1242 | Ga0496101_0096186 | 3300048904 | Bacteria | 2210 |
| 1243 | Ga0496101_0098440 | 3300048904 | Bacteria | 2185 |
| 1244 | Ga0496101_0098933 | 3300048904 | Bacteria | 2180 |
| 1245 | Ga0496101_0183225 | 3300048904 | Bacteria | 1613 |
| 1246 | Ga0496102_0005213 | 3300048905 | Bacteria | 11035 |
| 1247 | Ga0496102_0007639 | 3300048905 | Bacteria | 9235 |
| 1248 | Ga0496102_0012393 | 3300048905 | Bacteria | 7377 |
| 1249 | Ga0496102_0069908 | 3300048905 | Bacteria | 3223 |
| 1250 | Ga0496102_0241013 | 3300048905 | Bacteria | 1705 |
| 1251 | Ga0496102_0252004 | 3300048905 | Bacteria | 1665 |
| 1252 | Ga0496102_0528521 | 3300048905 | Bacteria | 1102 |
| 1253 | Ga0496102_0989492 | 3300048905 | Bacteria | 762 |
| 1254 | Ga0496103_0085102 | 3300048906 | Bacteria | 1992 |
| 1255 | Ga0496103_0240510 | 3300048906 | Bacteria | 1165 |
| 1256 | Ga0496104_0000430 | 3300048907 | Bacteria | 36402 |
| 1257 | Ga0496104_0007365 | 3300048907 | Bacteria | 9722 |
| 1258 | Ga0496104_0053657 | 3300048907 | Bacteria | 3809 |
| 1259 | Ga0496104_0093136 | 3300048907 | Bacteria | 2881 |
| 1260 | Ga0496104_0353377 | 3300048907 | Bacteria | 1382 |
| 1261 | Ga0496104_0624992 | 3300048907 | Bacteria | 987 |
| 1262 | Ga0496105_0006356 | 3300048908 | Bacteria | 9075 |
| 1263 | Ga0496105_0008068 | 3300048908 | Bacteria | 8184 |
| 1264 | Ga0496105_0127066 | 3300048908 | Bacteria | 2102 |
| 1265 | Ga0496105_0210849 | 3300048908 | Bacteria | 1583 |
| 1266 | Ga0496105_0324191 | 3300048908 | Bacteria | 1234 |
| 1267 | Ga0496105_0512623 | 3300048908 | Bacteria | 940 |
| 1268 | Ga0496106_0004759 | 3300048909 | Bacteria | 10033 |
| 1269 | Ga0496106_0005044 | 3300048909 | Bacteria | 9768 |
| 1270 | Ga0496106_0010296 | 3300048909 | Bacteria | 6914 |
| 1271 | Ga0496106_0039463 | 3300048909 | Bacteria | 3536 |
| 1272 | Ga0496106_0040831 | 3300048909 | Bacteria | 3476 |
| 1273 | Ga0496106_0071165 | 3300048909 | Bacteria | 2658 |
| 1274 | Ga0496106_0082059 | 3300048909 | Bacteria | 2477 |
| 1275 | Ga0496106_0203985 | 3300048909 | Bacteria | 1574 |
| 1276 | Ga0496106_0599825 | 3300048909 | Bacteria | 882 |
| 1277 | Ga0496106_0623192 | 3300048909 | Bacteria | 863 |
| 1278 | Ga0496106_0895237 | 3300048909 | Bacteria | 701 |
| 1279 | Ga0496107_0003265 | 3300048910 | Bacteria | 10806 |
| 1280 | Ga0496107_0007983 | 3300048910 | Bacteria | 7305 |
| 1281 | Ga0496107_0185280 | 3300048910 | Bacteria | 1546 |
| 1282 | Ga0496107_0195536 | 3300048910 | Bacteria | 1503 |
| 1283 | Ga0496107_0559991 | 3300048910 | Bacteria | 846 |
| 1284 | Ga0496107_0596536 | 3300048910 | Bacteria | 816 |
| 1285 | Ga0496108_0000415 | 3300048911 | Bacteria | 34866 |
| 1286 | Ga0496108_0016710 | 3300048911 | Bacteria | 5994 |
| 1287 | Ga0496108_0038583 | 3300048911 | Bacteria | 3980 |
| 1288 | Ga0496108_0425765 | 3300048911 | Bacteria | 1159 |
| 1289 | Ga0496108_0533502 | 3300048911 | Bacteria | 1024 |
| 1290 | Ga0496108_0644101 | 3300048911 | Bacteria | 921 |
| 1291 | Ga0496109_0000759 | 3300048912 | Bacteria | 26784 |
| 1292 | Ga0496109_0083699 | 3300048912 | Bacteria | 2942 |
| 1293 | Ga0496109_0130734 | 3300048912 | Bacteria | 2343 |
| 1294 | Ga0496109_0151320 | 3300048912 | Bacteria | 2172 |
| 1295 | Ga0496109_0169021 | 3300048912 | Bacteria | 2051 |
| 1296 | Ga0496109_0182669 | 3300048912 | Bacteria | 1970 |
| 1297 | Ga0496109_0350298 | 3300048912 | Bacteria | 1395 |
| 1298 | Ga0496109_0803604 | 3300048912 | Bacteria | 878 |
| 1299 | Ga0496109_0867497 | 3300048912 | Bacteria | 840 |
| 1300 | Ga0496110_0011522 | 3300048913 | Bacteria | 7242 |
| 1301 | Ga0496110_0116790 | 3300048913 | Bacteria | 2402 |
| 1302 | Ga0496110_0405130 | 3300048913 | Bacteria | 1243 |
| 1303 | Ga0496110_0595233 | 3300048913 | Bacteria | 1003 |
| 1304 | Ga0496110_0929396 | 3300048913 | Bacteria | 776 |
| 1305 | Ga0496111_0021000 | 3300048914 | Bacteria | 4553 |
| 1306 | Ga0496111_0040423 | 3300048914 | Bacteria | 3345 |
| 1307 | Ga0496111_0123868 | 3300048914 | Bacteria | 1910 |
| 1308 | Ga0496111_0146765 | 3300048914 | Bacteria | 1749 |
| 1309 | Ga0496111_0164435 | 3300048914 | Bacteria | 1648 |
| 1310 | Ga0496111_0669021 | 3300048914 | Bacteria | 757 |
| 1311 | Ga0496112_0000395 | 3300048915 | Bacteria | 28497 |
| 1312 | Ga0496112_0007176 | 3300048915 | Bacteria | 9869 |
| 1313 | Ga0496112_0007941 | 3300048915 | Bacteria | 9461 |
| 1314 | Ga0496112_0026148 | 3300048915 | Bacteria | 5612 |
| 1315 | Ga0496112_0034003 | 3300048915 | Bacteria | 4959 |
| 1316 | Ga0496112_0112166 | 3300048915 | Bacteria | 2696 |
| 1317 | Ga0496112_0114173 | 3300048915 | Bacteria | 2672 |
| 1318 | Ga0496112_0151150 | 3300048915 | Bacteria | 2289 |
| 1319 | Ga0496112_0159120 | 3300048915 | Bacteria | 2225 |
| 1320 | Ga0496112_0247957 | 3300048915 | Bacteria | 1732 |
| 1321 | Ga0496112_0275699 | 3300048915 | Bacteria | 1629 |
| 1322 | Ga0496112_0913407 | 3300048915 | Bacteria | 800 |
| 1323 | Ga0496112_0919147 | 3300048915 | Bacteria | 796 |
| 1324 | Ga0496113_0014638 | 3300048916 | Bacteria | 5360 |
| 1325 | Ga0496113_0071846 | 3300048916 | Bacteria | 2632 |
| 1326 | Ga0496113_0148522 | 3300048916 | Bacteria | 1848 |
| 1327 | Ga0496113_0153284 | 3300048916 | Bacteria | 1819 |
| 1328 | Ga0496113_0193833 | 3300048916 | Bacteria | 1613 |
| 1329 | Ga0496113_0310871 | 3300048916 | Bacteria | 1262 |
| 1330 | Ga0496113_0597296 | 3300048916 | Bacteria | 884 |
| 1331 | Ga0496114_0024690 | 3300048917 | Bacteria | 4907 |
| 1332 | Ga0496114_0035096 | 3300048917 | Bacteria | 4140 |
| 1333 | Ga0496114_0057160 | 3300048917 | Bacteria | 3256 |
| 1334 | Ga0496114_0166942 | 3300048917 | Bacteria | 1917 |
| 1335 | Ga0496114_0184466 | 3300048917 | Bacteria | 1823 |
| 1336 | Ga0496114_0518833 | 3300048917 | Bacteria | 1054 |
| 1337 | Ga0496115_0018252 | 3300048918 | Bacteria | 5382 |
| 1338 | Ga0496115_0045970 | 3300048918 | Bacteria | 3487 |
| 1339 | Ga0496115_0046676 | 3300048918 | Bacteria | 3463 |
| 1340 | Ga0496115_0088598 | 3300048918 | Bacteria | 2527 |
| 1341 | Ga0496115_0097124 | 3300048918 | Bacteria | 2413 |
| 1342 | Ga0496115_0115409 | 3300048918 | Bacteria | 2208 |
| 1343 | Ga0496115_0137874 | 3300048918 | Bacteria | 2012 |
| 1344 | Ga0496115_0141228 | 3300048918 | Bacteria | 1987 |
| 1345 | Ga0496115_0142334 | 3300048918 | Bacteria | 1979 |
| 1346 | Ga0496115_0160388 | 3300048918 | Bacteria | 1858 |
| 1347 | Ga0496115_0231681 | 3300048918 | Bacteria | 1523 |
| 1348 | Ga0496115_0349881 | 3300048918 | Bacteria | 1205 |
| 1349 | Ga0496115_0353479 | 3300048918 | Bacteria | 1198 |
| 1350 | Ga0496115_0439855 | 3300048918 | Bacteria | 1054 |
| 1351 | Ga0496116_0006156 | 3300048919 | Bacteria | 10970 |
| 1352 | Ga0496116_0233374 | 3300048919 | Bacteria | 931 |
| 1353 | Ga0496117_0068124 | 3300048920 | Bacteria | 2404 |
| 1354 | Ga0496117_0119765 | 3300048920 | Bacteria | 1620 |
| 1355 | Ga0496117_0211179 | 3300048920 | Bacteria | 1088 |
| 1356 | Ga0496117_0219237 | 3300048920 | Bacteria | 1060 |
| 1357 | Ga0496117_0403043 | 3300048920 | Bacteria | 689 |
| 1358 | Ga0496118_0002114 | 3300048921 | Bacteria | 27831 |
| 1359 | Ga0496118_0017746 | 3300048921 | Bacteria | 6460 |
| 1360 | Ga0496118_0059322 | 3300048921 | Bacteria | 2850 |
| 1361 | Ga0496118_0095751 | 3300048921 | Bacteria | 2025 |
| 1362 | Ga0496118_0136249 | 3300048921 | Bacteria | 1566 |
| 1363 | Ga0496118_0190857 | 3300048921 | Bacteria | 1225 |
| 1364 | Ga0496118_0372962 | 3300048921 | Bacteria | 752 |
| 1365 | Ga0496119_0014065 | 3300048922 | Bacteria | 6298 |
| 1366 | Ga0496119_0065340 | 3300048922 | Bacteria | 2155 |
| 1367 | Ga0496119_0158362 | 3300048922 | Bacteria | 1206 |
| 1368 | Ga0496120_0005770 | 3300048923 | Bacteria | 9725 |
| 1369 | Ga0496120_0012705 | 3300048923 | Bacteria | 5713 |
| 1370 | Ga0496120_0028452 | 3300048923 | Bacteria | 3425 |
| 1371 | Ga0496120_0032671 | 3300048923 | Bacteria | 3135 |
| 1372 | Ga0496121_0000757 | 3300048924 | Bacteria | 59348 |
| 1373 | Ga0496121_0004207 | 3300048924 | Bacteria | 19640 |
| 1374 | Ga0496121_0015422 | 3300048924 | Bacteria | 8009 |
| 1375 | Ga0496121_0031249 | 3300048924 | Bacteria | 4868 |
| 1376 | Ga0496121_0073180 | 3300048924 | Bacteria | 2748 |
| 1377 | Ga0496121_0082803 | 3300048924 | Bacteria | 2535 |
| 1378 | Ga0496121_0110003 | 3300048924 | Bacteria | 2103 |
| 1379 | Ga0496121_0120484 | 3300048924 | Bacteria | 1982 |
| 1380 | Ga0496121_0168711 | 3300048924 | Bacteria | 1592 |
| 1381 | Ga0496121_0198829 | 3300048924 | Bacteria | 1430 |
| 1382 | Ga0496121_0474169 | 3300048924 | Bacteria | 801 |
| 1383 | Ga0496122_0086710 | 3300048925 | Bacteria | 2153 |
| 1384 | Ga0496122_0166513 | 3300048925 | Bacteria | 1336 |
| 1385 | Ga0496122_0319840 | 3300048925 | Bacteria | 826 |
| 1386 | Ga0496123_0270040 | 3300048926 | Bacteria | 828 |
| 1387 | Ga0496124_0003589 | 3300048927 | Bacteria | 18856 |
| 1388 | Ga0496124_0039448 | 3300048927 | Bacteria | 4094 |
| 1389 | Ga0496124_0053586 | 3300048927 | Bacteria | 3418 |
| 1390 | Ga0496124_0135858 | 3300048927 | Bacteria | 1947 |
| 1391 | Ga0496124_0153877 | 3300048927 | Bacteria | 1801 |
| 1392 | Ga0496124_0233608 | 3300048927 | Bacteria | 1373 |
| 1393 | Ga0496124_0235195 | 3300048927 | Bacteria | 1366 |
| 1394 | Ga0496124_0402208 | 3300048927 | Bacteria | 950 |
| 1395 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 1396 | Ga0496125_0001136 | 3300048928 | Bacteria | 40509 |
| 1397 | Ga0496125_0003959 | 3300048928 | Bacteria | 17459 |
| 1398 | Ga0496125_0042098 | 3300048928 | Bacteria | 3896 |
| 1399 | Ga0496125_0052681 | 3300048928 | Bacteria | 3345 |
| 1400 | Ga0496125_0063656 | 3300048928 | Bacteria | 2939 |
| 1401 | Ga0496125_0145890 | 3300048928 | Bacteria | 1636 |
| 1402 | Ga0496126_0003396 | 3300048929 | Bacteria | 20150 |
| 1403 | Ga0496126_0013933 | 3300048929 | Bacteria | 8157 |
| 1404 | Ga0496126_0013959 | 3300048929 | Bacteria | 8145 |
| 1405 | Ga0496126_0025615 | 3300048929 | Bacteria | 5671 |
| 1406 | Ga0496126_0035100 | 3300048929 | Bacteria | 4703 |
| 1407 | Ga0496126_0037427 | 3300048929 | Bacteria | 4528 |
| 1408 | Ga0496126_0038017 | 3300048929 | Bacteria | 4481 |
| 1409 | Ga0496126_0043788 | 3300048929 | Bacteria | 4126 |
| 1410 | Ga0496126_0045586 | 3300048929 | Bacteria | 4028 |
| 1411 | Ga0496126_0050525 | 3300048929 | Bacteria | 3788 |
| 1412 | Ga0496126_0059106 | 3300048929 | Bacteria | 3454 |
| 1413 | Ga0496126_0069156 | 3300048929 | Bacteria | 3150 |
| 1414 | Ga0496126_0167945 | 3300048929 | Bacteria | 1871 |
| 1415 | Ga0496126_0290181 | 3300048929 | Bacteria | 1353 |
| 1416 | Ga0496126_0311322 | 3300048929 | Bacteria | 1296 |
| 1417 | Ga0496126_0390100 | 3300048929 | Bacteria | 1131 |
| 1418 | Ga0496126_0440703 | 3300048929 | Bacteria | 1050 |
| 1419 | Ga0496126_0460271 | 3300048929 | Bacteria | 1022 |
| 1420 | Ga0496126_0637004 | 3300048929 | Bacteria | 836 |
| 1421 | Ga0495682_0107319 | 3300049460 | Bacteria | 1001 |
| 1422 | Ga0501031_0002124 | 3300049568 | Bacteria | 12501 |
| 1423 | Ga0501031_0008325 | 3300049568 | Bacteria | 6746 |
| 1424 | Ga0501031_0139601 | 3300049568 | Bacteria | 1584 |
| 1425 | Ga0501031_0376312 | 3300049568 | Bacteria | 919 |
| 1426 | Ga0501032_0000038 | 3300049569 | Bacteria | 115810 |
| 1427 | Ga0501032_0028464 | 3300049569 | Bacteria | 3839 |
| 1428 | Ga0501032_0082953 | 3300049569 | Bacteria | 2132 |
| 1429 | Ga0501032_0119004 | 3300049569 | Bacteria | 1746 |
| 1430 | Ga0501032_0135729 | 3300049569 | Bacteria | 1621 |
| 1431 | Ga0501032_0157737 | 3300049569 | Bacteria | 1490 |
| 1432 | Ga0501033_0000089 | 3300049570 | Bacteria | 86782 |
| 1433 | Ga0501033_0002894 | 3300049570 | Bacteria | 14359 |
| 1434 | Ga0501033_0049416 | 3300049570 | Bacteria | 3121 |
| 1435 | Ga0501033_0102775 | 3300049570 | Bacteria | 2084 |
| 1436 | Ga0501034_0000228 | 3300049571 | Bacteria | 106111 |
| 1437 | Ga0501034_0087402 | 3300049571 | Bacteria | 3117 |
| 1438 | Ga0501034_0150448 | 3300049571 | Bacteria | 2304 |
| 1439 | Ga0501034_0220023 | 3300049571 | Bacteria | 1851 |
| 1440 | Ga0501034_0546874 | 3300049571 | Bacteria | 1067 |
| 1441 | Ga0501034_1376430 | 3300049571 | Bacteria | 581 |
| 1442 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 1443 | Ga0501036_0008070 | 3300049572 | Bacteria | 8623 |
| 1444 | Ga0501036_0039089 | 3300049572 | Bacteria | 4017 |
| 1445 | Ga0501036_0242568 | 3300049572 | Bacteria | 1511 |
| 1446 | Ga0501036_0337991 | 3300049572 | Bacteria | 1258 |
| 1447 | Ga0501037_0000291 | 3300049573 | Bacteria | 42514 |
| 1448 | Ga0501037_0004166 | 3300049573 | Bacteria | 10484 |
| 1449 | Ga0501037_0016257 | 3300049573 | Bacteria | 5476 |
| 1450 | Ga0501037_0082090 | 3300049573 | Bacteria | 2336 |
| 1451 | Ga0501037_0234471 | 3300049573 | Bacteria | 1288 |
| 1452 | Ga0501037_0281080 | 3300049573 | Bacteria | 1159 |
| 1453 | Ga0501038_0000079 | 3300049574 | Bacteria | 81639 |
| 1454 | Ga0501038_0004207 | 3300049574 | Bacteria | 13372 |
| 1455 | Ga0501038_0062627 | 3300049574 | Bacteria | 3178 |
| 1456 | Ga0501038_0155624 | 3300049574 | Bacteria | 1861 |
| 1457 | Ga0501039_0000616 | 3300049575 | Bacteria | 25733 |
| 1458 | Ga0501039_0098010 | 3300049575 | Bacteria | 2286 |
| 1459 | Ga0501039_0101672 | 3300049575 | Bacteria | 2243 |
| 1460 | Ga0501039_0135675 | 3300049575 | Bacteria | 1932 |
| 1461 | Ga0501039_0356401 | 3300049575 | Bacteria | 1149 |
| 1462 | Ga0501039_0374429 | 3300049575 | Bacteria | 1119 |
| 1463 | Ga0501040_0064753 | 3300049576 | Bacteria | 2517 |
| 1464 | Ga0501040_0561457 | 3300049576 | Bacteria | 824 |
| 1465 | Ga0501041_0012042 | 3300049577 | Bacteria | 5119 |
| 1466 | Ga0501042_0033727 | 3300049578 | Bacteria | 3630 |
| 1467 | Ga0501042_0041964 | 3300049578 | Bacteria | 3254 |
| 1468 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 1469 | Ga0501043_0001791 | 3300049579 | Bacteria | 18452 |
| 1470 | Ga0501043_0064821 | 3300049579 | Bacteria | 2869 |
| 1471 | Ga0501043_0186532 | 3300049579 | Bacteria | 1614 |
| 1472 | Ga0501046_0007870 | 3300049580 | Bacteria | 9345 |
| 1473 | Ga0501046_0047846 | 3300049580 | Bacteria | 3389 |
| 1474 | Ga0501046_0049136 | 3300049580 | Bacteria | 3338 |
| 1475 | Ga0501046_0049725 | 3300049580 | Bacteria | 3315 |
| 1476 | Ga0501047_0000041 | 3300049581 | Bacteria | 184355 |
| 1477 | Ga0501047_0005405 | 3300049581 | Bacteria | 12013 |
| 1478 | Ga0501047_0009705 | 3300049581 | Bacteria | 9101 |
| 1479 | Ga0501047_0276250 | 3300049581 | Bacteria | 1525 |
| 1480 | Ga0501047_1016290 | 3300049581 | Bacteria | 642 |
| 1481 | Ga0501048_0000954 | 3300049582 | Bacteria | 21351 |
| 1482 | Ga0501048_0282071 | 3300049582 | Bacteria | 1181 |
| 1483 | Ga0501067_0002094 | 3300049583 | Bacteria | 10998 |
| 1484 | Ga0501067_0136139 | 3300049583 | Bacteria | 1368 |
| 1485 | Ga0501067_0242274 | 3300049583 | Bacteria | 1003 |
| 1486 | Ga0501068_0000285 | 3300049584 | Bacteria | 25201 |
| 1487 | Ga0501069_0001245 | 3300049585 | Bacteria | 12471 |
| 1488 | Ga0501070_0000986 | 3300049586 | Bacteria | 25571 |
| 1489 | Ga0501070_0032489 | 3300049586 | Bacteria | 4368 |
| 1490 | Ga0501070_0046634 | 3300049586 | Bacteria | 3603 |
| 1491 | Ga0501070_0096975 | 3300049586 | Bacteria | 2439 |
| 1492 | Ga0501070_0099496 | 3300049586 | Bacteria | 2406 |
| 1493 | Ga0501070_0185663 | 3300049586 | Bacteria | 1710 |
| 1494 | Ga0501070_0273258 | 3300049586 | Bacteria | 1379 |
| 1495 | Ga0501070_0444298 | 3300049586 | Bacteria | 1046 |
| 1496 | Ga0501070_0540698 | 3300049586 | Bacteria | 933 |
| 1497 | Ga0501071_0045361 | 3300049587 | Bacteria | 3156 |
| 1498 | Ga0501071_0290752 | 3300049587 | Bacteria | 1238 |
| 1499 | Ga0501071_0391018 | 3300049587 | Bacteria | 1061 |
| 1500 | Ga0501072_0005779 | 3300049588 | Bacteria | 9419 |
| 1501 | Ga0501072_0180503 | 3300049588 | Bacteria | 1684 |
| 1502 | Ga0501073_0000056 | 3300049589 | Bacteria | 70854 |
| 1503 | Ga0501073_0016826 | 3300049589 | Bacteria | 5298 |
| 1504 | Ga0501073_0093902 | 3300049589 | Bacteria | 2084 |
| 1505 | Ga0501073_0110358 | 3300049589 | Bacteria | 1908 |
| 1506 | Ga0501073_0284012 | 3300049589 | Bacteria | 1142 |
| 1507 | Ga0501074_0012527 | 3300049590 | Bacteria | 6166 |
| 1508 | Ga0501074_0157621 | 3300049590 | Bacteria | 1621 |
| 1509 | Ga0501075_0049286 | 3300049591 | Bacteria | 3166 |
| 1510 | Ga0501076_0089107 | 3300049592 | Bacteria | 2480 |
| 1511 | Ga0501076_0123182 | 3300049592 | Bacteria | 2100 |
| 1512 | Ga0501076_0160716 | 3300049592 | Bacteria | 1830 |
| 1513 | Ga0501077_0111099 | 3300049593 | Bacteria | 1737 |
| 1514 | Ga0501079_0001576 | 3300049741 | Bacteria | 16193 |
| 1515 | Ga0501079_0072750 | 3300049741 | Bacteria | 2657 |
| 1516 | Ga0501079_0372469 | 3300049741 | Bacteria | 1119 |
| 1517 | Ga0501080_0000138 | 3300049742 | Bacteria | 50982 |
| 1518 | Ga0501080_0002680 | 3300049742 | Bacteria | 15586 |
| 1519 | Ga0501080_0098917 | 3300049742 | Bacteria | 2707 |
| 1520 | Ga0501080_0124121 | 3300049742 | Bacteria | 2391 |
| 1521 | Ga0501081_0171374 | 3300049743 | Bacteria | 1567 |
| 1522 | Ga0501081_0225316 | 3300049743 | Bacteria | 1364 |
| 1523 | Ga0501081_0316717 | 3300049743 | Bacteria | 1146 |
| 1524 | Ga0501083_0004205 | 3300049744 | Bacteria | 10137 |
| 1525 | Ga0501083_0653481 | 3300049744 | Bacteria | 684 |
| 1526 | Ga0501035_0000090 | 3300049822 | Bacteria | 112445 |
| 1527 | Ga0501035_0002286 | 3300049822 | Bacteria | 18944 |
| 1528 | Ga0501035_0020636 | 3300049822 | Bacteria | 6052 |
| 1529 | Ga0501035_0144468 | 3300049822 | Bacteria | 2067 |
| 1530 | Ga0501035_0155850 | 3300049822 | Bacteria | 1979 |
| 1531 | Ga0501035_0300437 | 3300049822 | Bacteria | 1353 |
| 1532 | Ga0501044_0000054 | 3300049823 | Bacteria | 141399 |
| 1533 | Ga0501044_0007477 | 3300049823 | Bacteria | 12015 |
| 1534 | Ga0501044_0009233 | 3300049823 | Bacteria | 10769 |
| 1535 | Ga0501044_0012007 | 3300049823 | Bacteria | 9384 |
| 1536 | Ga0501044_0040797 | 3300049823 | Bacteria | 4836 |
| 1537 | Ga0501044_0047391 | 3300049823 | Bacteria | 4445 |
| 1538 | Ga0501044_0763856 | 3300049823 | Bacteria | 848 |
| 1539 | Ga0501044_1012238 | 3300049823 | Bacteria | 702 |
| 1540 | Ga0501045_0009955 | 3300049824 | Bacteria | 6651 |
| 1541 | nmdc:mga03683_127332_c1 | 3300050489 | Bacteria | 1137 |
| 1542 | nmdc:mga00v17_296349_c1 | 3300050491 | Bacteria | 1050 |
| 1543 | nmdc:mga00v17_39451_c1 | 3300050491 | Bacteria | 2828 |
| 1544 | nmdc:mga00v17_558537_c1 | 3300050491 | Bacteria | 740 |
| 1545 | nmdc:mga0yw44_114759_c1 | 3300050492 | Bacteria | 1729 |
| 1546 | nmdc:mga0yw44_22683_c1 | 3300050492 | Bacteria | 3524 |
| 1547 | nmdc:mga0yw44_49085_c1 | 3300050492 | Bacteria | 2546 |
| 1548 | nmdc:mga0yw44_57354_c1 | 3300050492 | Bacteria | 2376 |
| 1549 | nmdc:mga0yw44_609607_c1 | 3300050492 | Bacteria | 742 |
| 1550 | nmdc:mga0k408_161280_c1 | 3300050493 | Bacteria | 1336 |
| 1551 | nmdc:mga0k408_23701_c1 | 3300050493 | Bacteria | 3465 |
| 1552 | nmdc:mga0k408_36679_c1 | 3300050493 | Bacteria | 2814 |
| 1553 | nmdc:mga06z11_155886_c1 | 3300050494 | Bacteria | 1302 |
| 1554 | nmdc:mga06z11_189978_c1 | 3300050494 | Bacteria | 1189 |
| 1555 | nmdc:mga06z11_318008_c1 | 3300050494 | Bacteria | 928 |
| 1556 | nmdc:mga06z11_536761_c1 | 3300050494 | Bacteria | 710 |
| 1557 | nmdc:mga04h51_42650_c1 | 3300050495 | Bacteria | 1489 |
| 1558 | nmdc:mga07m45_286075_c1 | 3300050496 | Bacteria | 959 |
| 1559 | nmdc:mga05p37_101287_c1 | 3300050507 | Bacteria | 3547 |
| 1560 | nmdc:mga09592_823386_c1 | 3300050508 | Bacteria | 784 |
| 1561 | nmdc:mga08y16_410602_c1 | 3300050511 | Bacteria | 1385 |
| 1562 | nmdc:mga0n895_643034_c1 | 3300050512 | Bacteria | 1060 |
| 1563 | nmdc:mga0n895_9544_c1 | 3300050512 | Bacteria | 8499 |
| 1564 | nmdc:mga0rr50_200319_c1 | 3300050513 | Bacteria | 1640 |
| 1565 | nmdc:mga0sz30_12372_c1 | 3300050516 | Bacteria | 3320 |
| 1566 | nmdc:mga0sz30_145119_c1 | 3300050516 | Bacteria | 1049 |
| 1567 | nmdc:mga0sz30_20885_c1 | 3300050516 | Bacteria | 2645 |
| 1568 | nmdc:mga0sz30_2684_c1 | 3300050516 | Bacteria | 6338 |
| 1569 | Ga0495601_0014255 | 3300053077 | Bacteria | 4789 |
| 1570 | Ga0495601_0014406 | 3300053077 | Bacteria | 4764 |
| 1571 | Ga0495601_0021028 | 3300053077 | Bacteria | 3991 |
| 1572 | Ga0495601_0028181 | 3300053077 | Bacteria | 3477 |
| 1573 | Ga0495601_0066479 | 3300053077 | Bacteria | 2295 |
| 1574 | Ga0495601_0087185 | 3300053077 | Bacteria | 2006 |
| 1575 | Ga0495601_0135398 | 3300053077 | Bacteria | 1606 |
| 1576 | Ga0495601_0230024 | 3300053077 | Bacteria | 1211 |
| 1577 | Ga0495612_0002731 | 3300053078 | Bacteria | 7305 |
| 1578 | Ga0495612_0014294 | 3300053078 | Bacteria | 3193 |
| 1579 | Ga0495612_0017545 | 3300053078 | Bacteria | 2865 |
| 1580 | Ga0495612_0145512 | 3300053078 | Bacteria | 1029 |
| 1581 | Ga0500635_0000944 | 3300053080 | Bacteria | 7020 |
| 1582 | Ga0500635_0053833 | 3300053080 | Bacteria | 1385 |
| 1583 | Ga0500635_0079162 | 3300053080 | Bacteria | 1178 |
| 1584 | Ga0495655_0005420 | 3300053083 | Bacteria | 2251 |
| 1585 | Ga0495655_0039823 | 3300053083 | Bacteria | 1193 |
| 1586 | Ga0495655_0065830 | 3300053083 | Bacteria | 1001 |
| 1587 | Ga0495655_0104343 | 3300053083 | Bacteria | 844 |
| 1588 | Ga0495595_0014428 | 3300053084 | Bacteria | 3352 |
| 1589 | Ga0495595_0033631 | 3300053084 | Bacteria | 2314 |
| 1590 | Ga0495595_0043440 | 3300053084 | Bacteria | 2061 |
| 1591 | Ga0495595_0050144 | 3300053084 | Bacteria | 1932 |
| 1592 | Ga0495595_0060800 | 3300053084 | Bacteria | 1768 |
| 1593 | Ga0495595_0123497 | 3300053084 | Bacteria | 1262 |
| 1594 | Ga0495595_0349589 | 3300053084 | Unclassified | 746 |
| 1595 | Ga0495619_0004650 | 3300053085 | Bacteria | 8745 |
| 1596 | Ga0495619_0016517 | 3300053085 | Bacteria | 4674 |
| 1597 | Ga0495619_0034063 | 3300053085 | Bacteria | 3310 |
| 1598 | Ga0495619_0035905 | 3300053085 | Bacteria | 3226 |
| 1599 | Ga0495619_0060466 | 3300053085 | Bacteria | 2518 |
| 1600 | Ga0495619_0127222 | 3300053085 | Bacteria | 1749 |
| 1601 | Ga0495619_0213764 | 3300053085 | Bacteria | 1335 |
| 1602 | Ga0495619_0285506 | 3300053085 | Bacteria | 1143 |
| 1603 | Ga0500643_000046 | 3300053087 | Bacteria | 150388 |
| 1604 | Ga0500646_0043306 | 3300053090 | Bacteria | 1274 |
| 1605 | Ga0500647_0083784 | 3300053091 | Bacteria | 1529 |
| 1606 | Ga0500647_0085903 | 3300053091 | Bacteria | 1508 |
| 1607 | Ga0500583_0354619 | 3300053092 | Bacteria | 710 |
| 1608 | Ga0500651_0305123 | 3300053093 | Bacteria | 912 |
| 1609 | Ga0500651_0488885 | 3300053093 | Bacteria | 680 |
| 1610 | Ga0500566_0000048 | 3300053094 | Bacteria | 58542 |
| 1611 | Ga0500566_0000301 | 3300053094 | Bacteria | 26447 |
| 1612 | Ga0500566_0011657 | 3300053094 | Bacteria | 5176 |
| 1613 | Ga0500566_0013839 | 3300053094 | Bacteria | 4747 |
| 1614 | Ga0500566_0237222 | 3300053094 | Bacteria | 896 |
| 1615 | Ga0500566_0347518 | 3300053094 | Bacteria | 681 |
| 1616 | Ga0500640_098561 | 3300053095 | Bacteria | 1211 |
| 1617 | Ga0500641_0034171 | 3300053096 | Bacteria | 2022 |
| 1618 | Ga0500641_0047575 | 3300053096 | Bacteria | 1754 |
| 1619 | Ga0500650_0005800 | 3300053098 | Bacteria | 4648 |
| 1620 | Ga0500650_0150337 | 3300053098 | Bacteria | 1077 |
| 1621 | Ga0500554_005519 | 3300053102 | Bacteria | 2766 |
| 1622 | Ga0500554_029673 | 3300053102 | Bacteria | 1600 |
| 1623 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1624 | Ga0500557_000020 | 3300053105 | Bacteria | 91933 |
| 1625 | Ga0500562_008283 | 3300053108 | Bacteria | 2625 |
| 1626 | Ga0500562_015687 | 3300053108 | Bacteria | 1944 |
| 1627 | Ga0500569_066803 | 3300053109 | Bacteria | 1123 |
| 1628 | Ga0500572_000045 | 3300053111 | Bacteria | 38005 |
| 1629 | Ga0500572_000352 | 3300053111 | Bacteria | 16420 |
| 1630 | Ga0500572_002884 | 3300053111 | Bacteria | 4037 |
| 1631 | Ga0500591_003235 | 3300053115 | Bacteria | 6896 |
| 1632 | Ga0500594_0007961 | 3300053118 | Bacteria | 2408 |
| 1633 | Ga0500595_000494 | 3300053119 | Bacteria | 24038 |
| 1634 | Ga0500595_007040 | 3300053119 | Bacteria | 4707 |
| 1635 | Ga0500595_010569 | 3300053119 | Bacteria | 3661 |
| 1636 | Ga0500595_024432 | 3300053119 | Bacteria | 2109 |
| 1637 | Ga0500595_031885 | 3300053119 | Bacteria | 1764 |
| 1638 | Ga0500595_064396 | 3300053119 | Bacteria | 1099 |
| 1639 | Ga0500607_007093 | 3300053121 | Bacteria | 6979 |
| 1640 | Ga0500608_023055 | 3300053122 | Bacteria | 2893 |
| 1641 | Ga0500608_039133 | 3300053122 | Bacteria | 2270 |
| 1642 | Ga0500608_069772 | 3300053122 | Bacteria | 1671 |
| 1643 | Ga0500608_221563 | 3300053122 | Bacteria | 763 |
| 1644 | Ga0500614_021046 | 3300053123 | Bacteria | 1510 |
| 1645 | Ga0500621_157692 | 3300053126 | Bacteria | 845 |
| 1646 | Ga0500642_0000034 | 3300053130 | Bacteria | 110440 |
| 1647 | Ga0500642_0015211 | 3300053130 | Bacteria | 2886 |
| 1648 | Ga0500652_001231 | 3300053131 | Bacteria | 8135 |
| 1649 | Ga0500652_149629 | 3300053131 | Bacteria | 969 |
| 1650 | Ga0500655_010901 | 3300053133 | Bacteria | 1644 |
| 1651 | Ga0500658_0139804 | 3300053134 | Bacteria | 1085 |
| 1652 | Ga0500658_0248892 | 3300053134 | Bacteria | 816 |
| 1653 | Ga0500559_0000099 | 3300053136 | Bacteria | 67311 |
| 1654 | Ga0500559_0002781 | 3300053136 | Bacteria | 8854 |
| 1655 | Ga0500559_0003698 | 3300053136 | Bacteria | 7458 |
| 1656 | Ga0500559_0095821 | 3300053136 | Bacteria | 1362 |
| 1657 | Ga0500559_0260022 | 3300053136 | Bacteria | 817 |
| 1658 | Ga0500568_0000842 | 3300053139 | Bacteria | 21569 |
| 1659 | Ga0500568_0037159 | 3300053139 | Bacteria | 1977 |
| 1660 | Ga0500577_0000025 | 3300053142 | Bacteria | 38251 |
| 1661 | Ga0500577_0118557 | 3300053142 | Bacteria | 1099 |
| 1662 | Ga0500585_150398 | 3300053144 | Bacteria | 813 |
| 1663 | Ga0500586_002721 | 3300053145 | Bacteria | 4051 |
| 1664 | Ga0500590_105171 | 3300053148 | Bacteria | 1348 |
| 1665 | Ga0500603_000041 | 3300053150 | Bacteria | 30524 |
| 1666 | Ga0500603_000138 | 3300053150 | Bacteria | 17480 |
| 1667 | Ga0500604_0007816 | 3300053151 | Bacteria | 2834 |
| 1668 | Ga0500616_0000061 | 3300053153 | Bacteria | 249158 |
| 1669 | Ga0500619_108561 | 3300053154 | Bacteria | 944 |
| 1670 | Ga0500619_163128 | 3300053154 | Bacteria | 756 |
| 1671 | Ga0500622_0004044 | 3300053156 | Bacteria | 9436 |
| 1672 | Ga0500622_0229354 | 3300053156 | Bacteria | 828 |
| 1673 | Ga0500627_0030358 | 3300053158 | Bacteria | 2262 |
| 1674 | Ga0500627_0191005 | 3300053158 | Bacteria | 920 |
| 1675 | Ga0500627_0291107 | 3300053158 | Bacteria | 715 |
| 1676 | Ga0500630_001433 | 3300053159 | Bacteria | 11319 |
| 1677 | Ga0500633_0083897 | 3300053160 | Bacteria | 1156 |
| 1678 | Ga0500633_0097215 | 3300053160 | Bacteria | 1081 |
| 1679 | Ga0500638_030569 | 3300053162 | Bacteria | 2593 |
| 1680 | Ga0500638_037572 | 3300053162 | Bacteria | 2350 |
| 1681 | Ga0500638_048930 | 3300053162 | Bacteria | 2046 |
| 1682 | Ga0500638_084347 | 3300053162 | Bacteria | 1505 |
| 1683 | Ga0500638_131854 | 3300053162 | Bacteria | 1132 |
| 1684 | Ga0500639_000228 | 3300053163 | Bacteria | 27840 |
| 1685 | Ga0500636_0000173 | 3300053177 | Bacteria | 34092 |
| 1686 | Ga0500636_0002921 | 3300053177 | Bacteria | 9570 |
| 1687 | Ga0500636_0021705 | 3300053177 | Bacteria | 3801 |
| 1688 | Ga0500636_0247951 | 3300053177 | Bacteria | 910 |
| 1689 | Ga0500637_0000162 | 3300053178 | Bacteria | 24729 |
| 1690 | Ga0500637_0000555 | 3300053178 | Bacteria | 14632 |
| 1691 | Ga0500637_0028427 | 3300053178 | Bacteria | 3093 |
| 1692 | Ga0500576_053151 | 3300053725 | Bacteria | 1791 |
| 1693 | Ga0500576_094469 | 3300053725 | Bacteria | 1234 |
| 1694 | Ga0500625_018970 | 3300053729 | Bacteria | 3225 |
| 1695 | Ga0500609_002640 | 3300053731 | Bacteria | 2551 |
| 1696 | Ga0500596_002664 | 3300053735 | Bacteria | 3501 |
| 1697 | Ga0500596_005590 | 3300053735 | Bacteria | 2195 |
| 1698 | Ga0500601_000334 | 3300053737 | Bacteria | 8622 |
| 1699 | Ga0500601_008059 | 3300053737 | Bacteria | 1169 |
| 1700 | Ga0501084_0001679 | 3300054114 | Bacteria | 17584 |
| 1701 | Ga0501084_0079171 | 3300054114 | Bacteria | 2755 |
| 1702 | Ga0500661_000236 | 3300055283 | Bacteria | 9863 |
| 1703 | Ga0501082_0006099 | 3300060353 | Bacteria | 10462 |
| 1704 | Ga0501082_0354716 | 3300060353 | Bacteria | 1279 |
| 1705 | Ga0501082_0461790 | 3300060353 | Bacteria | 1110 |
| 1706 | 2507507824 | 2507262055 | Bacteria | 8048963 |
| 1707 | 2508541935 | 2508501009 | Bacteria | 7784016 |
| 1708 | 2508692516 | 2508501042 | Bacteria | 8719808 |
| 1709 | 2509153339 | 2508501128 | Bacteria | 8613869 |
| 1710 | 2511397360 | 2511231028 | Bacteria | 8046582 |
| 1711 | 2513622895 | 2513237092 | Bacteria | 8341956 |
| 1712 | 2513639271 | 2513237094 | Bacteria | 8789602 |
| 1713 | 2513647364 | 2513237095 | Bacteria | 8976980 |
| 1714 | 2513653952 | 2513237096 | Bacteria | 8722461 |
| 1715 | 2513676224 | 2513237098 | Bacteria | 9902361 |
| 1716 | 2513695767 | 2513237101 | Bacteria | 7952346 |
| 1717 | 2513700875 | 2513237102 | Bacteria | 7703324 |
| 1718 | 2513856386 | 2513237137 | Bacteria | 9558895 |
| 1719 | 2513878214 | 2513237139 | Bacteria | 8737671 |
| 1720 | 2513891415 | 2513237141 | Bacteria | 8496279 |
| 1721 | 2513918292 | 2513237145 | Bacteria | 8979722 |
| 1722 | 2514009595 | 2513237161 | Bacteria | 8871253 |
| 1723 | 2515626732 | 2515154112 | Bacteria | 8294334 |
| 1724 | 2517103987 | 2517093001 | Bacteria | 9002274 |
| 1725 | 2517891478 | 2517572143 | Bacteria | 9484767 |
| 1726 | 2524436413 | 2524023205 | Bacteria | 8918781 |
| 1727 | 2524470318 | 2524023210 | Bacteria | 9029266 |
| 1728 | 2524538341 | 2524023228 | Bacteria | 10118060 |
| 1729 | 2528852615 | 2528768022 | Bacteria | 10457665 |
| 1730 | 2603861475 | 2602042107 | Bacteria | 6226103 |
| 1731 | 2617346632 | 2617270735 | Bacteria | 9163226 |
| 1732 | 2617372567 | 2617270741 | Bacteria | 8201522 |
| 1733 | 2671118756 | 2667528175 | Bacteria | 7532676 |
| 1734 | 2723847217 | 2721755755 | Bacteria | 8322773 |
| 1735 | 2728754857 | 2728368998 | Bacteria | 8720350 |
| 1736 | 2745080633 | 2744054633 | Bacteria | 8678936 |
| 1737 | 2793064509 | 2791355196 | Bacteria | 7323613 |
| 1738 | 2793066846 | 2791355197 | Bacteria | 8420563 |
| 1739 | 2793084175 | |||
| 1740 | 2805919219 | 2802429603 | Bacteria | 8777136 |
| 1741 | 2818236401 | 2816332527 | Bacteria | 8933356 |
| 1742 | 2824605400 | 2824600985 | Bacteria | 8488197 |
| 1743 | 2824613572 | 2824609381 | Bacteria | 8672835 |
| 1744 | 2824621435 | 2824617872 | Bacteria | 8814715 |
| 1745 | 2824630504 | 2824626560 | Bacteria | 8813858 |
| 1746 | 2824638795 | 2824635225 | Bacteria | 8785348 |
| 1747 | 2824648624 | 2824644064 | Bacteria | 8743947 |
| 1748 | 2824657620 | 2824653114 | Bacteria | 8493680 |
| 1749 | 2824668093 | 2824661429 | Bacteria | 9877870 |
| 1750 | 2824675939 | 2824671348 | Bacteria | 8369588 |
| 1751 | 2824683049 | 2824679649 | Bacteria | 8248951 |
| 1752 | 2824692134 | 2824687955 | Bacteria | 8360029 |
| 1753 | 2824704498 | 2824696289 | Bacteria | 8335049 |
| 1754 | 2824710310 | 2824704595 | Bacteria | 9667483 |
| 1755 | 2824718500 | 2824714736 | Bacteria | 8717648 |
| 1756 | 2824726234 | 2824723954 | Bacteria | 8758240 |
| 1757 | 2824735796 | 2824732956 | Bacteria | 7810675 |
| 1758 | 2824747003 | 2824746037 | Bacteria | 7911610 |
| 1759 | 2824755620 | 2824753945 | Bacteria | 9787441 |
| 1760 | 2824766283 | 2824763712 | Bacteria | 9792355 |
| 1761 | 2824777383 | 2824773399 | Bacteria | 8360218 |
| 1762 | 2838128955 | 2838122688 | Bacteria | 8803140 |
| 1763 | 2841944889 | 2841941048 | Bacteria | 8688029 |
| 1764 | 2841953315 | 2841949485 | Bacteria | 8680857 |
| 1765 | 2841959839 | 2841957949 | Bacteria | 8652217 |
| 1766 | 2841972205 | 2841966195 | Bacteria | 8673214 |
| 1767 | 2841978040 | 2841974524 | Bacteria | 8931498 |
| 1768 | 2841986330 | 2841983080 | Bacteria | 8395090 |
| 1769 | 2842040489 | 2842038055 | Bacteria | 8002051 |
| 1770 | 2842046566 | 2842045827 | Bacteria | 8006841 |
| 1771 | 2844319873 | 2844315083 | Bacteria | 8138177 |
| 1772 | 2847937191 | 2847930680 | Bacteria | 9342022 |
| 1773 | 2847947576 | 2847939898 | Bacteria | 8606328 |
| 1774 | 2849078548 | 2849076700 | Bacteria | 7039503 |
| 1775 | 2857512909 | 2857509624 | Bacteria | 7472071 |
| 1776 | 2857528415 | 2857524615 | Bacteria | 6615449 |
| 1777 | 2874598933 | 2874590934 | Bacteria | 8299676 |
| 1778 | 2874611020 | 2874604998 | Bacteria | 7834745 |
| 1779 | 2874614742 | 2874612657 | Bacteria | 8252029 |
| 1780 | 2874622255 | 2874620515 | Bacteria | 8290088 |
| 1781 | 2874635178 | 2874628541 | Bacteria | 8630250 |
| 1782 | 2874650618 | 2874645413 | Bacteria | 8214782 |
| 1783 | 2876764172 | 2876761206 | Bacteria | 10111113 |
| 1784 | 2876778972 | 2876771140 | Bacteria | 8287509 |
| 1785 | 2876814488 | 2876808645 | Bacteria | 8824342 |
| 1786 | 2876824133 | 2876818435 | Bacteria | 8274608 |
| 1787 | 2879082765 | 2879074833 | Bacteria | 8279565 |
| 1788 | 2879089144 | 2879083081 | Bacteria | 8587928 |
| 1789 | 2879105617 | 2879099564 | Bacteria | 10442239 |
| 1790 | 2879114587 | 2879110137 | Bacteria | 8907982 |
| 1791 | 2879132073 | 2879127579 | Bacteria | 8294491 |
| 1792 | 2879148400 | 2879142872 | Bacteria | 8267021 |
| 1793 | 2881364791 | 2881364244 | Bacteria | 7710352 |
| 1794 | 2881671904 | 2881665667 | Bacteria | 8175609 |
| 1795 | 2885369808 | 2885366525 | Bacteria | 8326213 |
| 1796 | 2885377817 | 2885374607 | Bacteria | 8927485 |
| 1797 | 2885390305 | 2885383462 | Bacteria | 9473874 |
| 1798 | 2885412342 | 2885409591 | Bacteria | 9235467 |
| 1799 | 2888385299 | 2888378607 | Bacteria | 9652610 |
| 1800 | 2888392948 | 2888388044 | Bacteria | 7304136 |
| 1801 | 2888425449 | 2888419890 | Bacteria | 7857137 |
| 1802 | 2889038155 | 2889033259 | Bacteria | 9099371 |
| 1803 | 2893068822 | 2893066018 | Bacteria | 6158120 |
| 1804 | 2903730456 | 2903727486 | Bacteria | 8281579 |
| 1805 | 2903758740 | 2903748898 | Bacteria | 9972761 |
| 1806 | 2904667866 | 2904666416 | Bacteria | 8226587 |
| 1807 | 2904691330 | 2904690495 | Bacteria | 9412302 |
| 1808 | 2904704823 | |||
| 1809 | 2904712134 | 2904711408 | Bacteria | 9771557 |
| 1810 | 2906609745 | 2906602504 | Bacteria | 8295279 |
| 1811 | 2906616654 | |||
| 1812 | 2906632375 | 2906626472 | Bacteria | 8826946 |
| 1813 | 2906643710 | 2906635258 | Bacteria | 8601019 |
| 1814 | 2906646971 | 2906643746 | Bacteria | 8722424 |
| 1815 | 2906666981 | 2906660503 | Bacteria | 8595048 |
| 1816 | 2908741820 | 2908739725 | Bacteria | 8628932 |
| 1817 | 2908759026 | 2908756301 | Bacteria | 8864324 |
| 1818 | 2908781016 | 2908775508 | Bacteria | 8092255 |
| 1819 | 2922368548 | 2922361189 | Bacteria | 7436256 |
| 1820 | 2922372597 | |||
| 1821 | 2922387476 | 2922386360 | Bacteria | 7017218 |
| 1822 | 2922397224 | 2922393267 | Bacteria | 8285685 |
| 1823 | 2922431323 | |||
| 1824 | 2929620408 | 2929615660 | Bacteria | 9193770 |
| 1825 | 2929626301 | 2929624759 | Bacteria | 9339455 |
| 1826 | 2932784823 | 2932784394 | Bacteria | 9704911 |
| 1827 | 2932795299 | 2932794094 | Bacteria | 7915132 |
| 1828 | 2932805827 | 2932801729 | Bacteria | 7987968 |
| 1829 | 2932805831 | 2932801729 | Bacteria | 7987968 |
| 1830 | 2932809856 | 2932809354 | Bacteria | 9135765 |
| 1831 | 2932818400 | 2932818245 | Bacteria | 9955613 |
| 1832 | 2932828659 | 2932828146 | Bacteria | 9745859 |
| 1833 | 2933582326 | 2933577622 | Bacteria | 9116884 |
| 1834 | 2935609683 | 2935608549 | Bacteria | 8203142 |
| 1835 | 2935619919 | 2935616580 | Bacteria | 9032984 |
| 1836 | 2935633915 | 2935630451 | Bacteria | 8169952 |
| 1837 | 2935638902 | 2935638405 | Bacteria | 10015038 |
| 1838 | 2935652172 | 2935648319 | Bacteria | 8801166 |
| 1839 | 2935660754 | 2935656913 | Bacteria | 8965014 |
| 1840 | 2935666247 | 2935665750 | Bacteria | 9571747 |
| 1841 | 2935676707 | 2935675223 | Bacteria | 9928132 |
| 1842 | 2935685096 | 2935684952 | Bacteria | 9590419 |
| 1843 | 2935694785 | 2935694250 | Bacteria | 9291695 |
| 1844 | 2935703908 | 2935703347 | Bacteria | 10242284 |
| 1845 | 2935713649 | 2935713505 | Bacteria | 9608509 |
| 1846 | 2935724269 | 2935722832 | Bacteria | 9608746 |
| 1847 | 2935733373 | 2935732158 | Bacteria | 9706831 |
| 1848 | 2935742752 | 2935741537 | Bacteria | 9707219 |
| 1849 | 2935751061 | 2935750917 | Bacteria | 9590372 |
| 1850 | 2935760416 | 2935760218 | Bacteria | 9817913 |
| 1851 | 2935772082 | 2935769743 | Bacteria | 7878163 |
| 1852 | 2935784259 | 2935777560 | Bacteria | 8077691 |
| 1853 | 2935787531 | 2935785616 | Bacteria | 7962367 |
| 1854 | 2935796162 | 2935793552 | Bacteria | 8012592 |
| 1855 | 2935802044 | 2935801545 | Bacteria | 9301974 |
| 1856 | 2935810813 | 2935810662 | Bacteria | 9401221 |
| 1857 | 2935822845 | 2935819856 | Bacteria | 8261050 |
| 1858 | 2935828396 | 2935827899 | Bacteria | 10038562 |
| 1859 | 2935839811 | 2935837841 | Bacteria | 9454360 |
| 1860 | 2935848427 | 2935847175 | Bacteria | 8228321 |
| 1861 | 2935857766 | 2935855204 | Bacteria | 9035059 |
| 1862 | 2935868893 | 2935864058 | Bacteria | 9784707 |
| 1863 | 2935874308 | 2935873716 | Bacteria | 9632195 |
| 1864 | 2935883804 | 2935883170 | Bacteria | 7964738 |
| 1865 | 2935909768 | 2935908558 | Bacteria | 8568796 |
| 1866 | 2935917493 | 2935916978 | Bacteria | 9113783 |
| 1867 | 2935927249 | 2935926038 | Bacteria | 8601059 |
| 1868 | 2935936907 | 2935934488 | Bacteria | 8602579 |
| 1869 | 2935944790 | 2935942939 | Bacteria | 8599779 |
| 1870 | 2935953227 | 2935951376 | Bacteria | 8602333 |
| 1871 | 2935961270 | 2935959822 | Bacteria | 7869783 |
| 1872 | 2935970067 | 2935967501 | Bacteria | 8603075 |
| 1873 | 2935980375 | 2935975950 | Bacteria | 8347125 |
| 1874 | 2935986638 | 2935984226 | Bacteria | 8302647 |
| 1875 | 2935992766 | 2935992306 | Bacteria | 9802711 |
| 1876 | 2936002679 | 2936002035 | Bacteria | 9362176 |
| 1877 | 2936014810 | 2936011229 | Bacteria | 8801034 |
| 1878 | 2936022209 | 2936019824 | Bacteria | 8804134 |
| 1879 | 2936032897 | 2936028420 | Bacteria | 8965941 |
| 1880 | 2936037767 | 2936037263 | Bacteria | 9446081 |
| 1881 | 2936050551 | 2936046547 | Bacteria | 8903709 |
| 1882 | 2936059673 | 2936055302 | Bacteria | 8785755 |
| 1883 | 2940558136 | 2940556831 | Bacteria | 9590747 |
| 1884 | 2941510782 | 2941507105 | Bacteria | 8166816 |
| 1885 | 2941518166 | 2941515067 | Bacteria | 8166720 |
| 1886 | 2941526963 | 2941523033 | Bacteria | 8169134 |
| 1887 | 2941531060 | 2941531003 | Bacteria | 7653939 |
| 1888 | 2941540848 | 2941538514 | Bacteria | 9402094 |
| 1889 | 3005481117 | 3005474847 | Bacteria | 9259049 |
| 1890 | 3005484948 | 3005483717 | Bacteria | 7877331 |
| 1891 | 3005508574 | 3005506211 | Bacteria | 6943378 |
| 1892 | 3005587223 | 3005587118 | Bacteria | 7794411 |
| 1893 | 3005600144 | 3005594810 | Bacteria | 8716512 |
| 1894 | 3005715668 | 3005710791 | Bacteria | 7622528 |
| 1895 | 3005723002 | 3005718088 | Bacteria | 8283608 |
| 1896 | 8006927856 | 8006926726 | Bacteria | 6749210 |
| 1897 | 8006939592 | 8006933436 | Bacteria | 10410654 |
| 1898 | 8006968413 | 8006964411 | Bacteria | 8966052 |
| 1899 | 8006979343 | 8006973647 | Bacteria | 10679141 |
| 1900 | 8006989238 | 8006984368 | Bacteria | 9651211 |
| 1901 | 8006994849 | 8006994254 | Bacteria | 8309700 |
| 1902 | 8016520826 | 8016511872 | Bacteria | 9921665 |
| 1903 | 8016534026 | 8016530956 | Bacteria | 8155261 |
| 1904 | 8016547250 | 8016539877 | Bacteria | 8155419 |
| 1905 | 8016554881 | 8016548790 | Bacteria | 8155074 |
| 1906 | 8016563246 | 8016557553 | Bacteria | 8154380 |
| 1907 | 8016576544 | 8016575299 | Bacteria | 8154085 |
| 1908 | 8016594119 | 8016583857 | Bacteria | 10421953 |
| 1909 | 8016601002 | 8016595262 | Bacteria | 8149947 |
| 1910 | 8016609458 | 8016603502 | Bacteria | 8731218 |
| 1911 | 8016615449 | 8016613128 | Bacteria | 8794220 |
| 1912 | 8016625766 | 8016622563 | Bacteria | 7999408 |
| 1913 | 8016639342 | 8016630954 | Bacteria | 9217207 |
| 1914 | 8017064764 | 8017057580 | Bacteria | 10023680 |
| 1915 | 8019533793 | 8019530166 | Bacteria | 8155624 |
| 1916 | 8019545872 | 8019538911 | Bacteria | 7872763 |
| 1917 | 8019552853 | 8019547302 | Bacteria | 7996444 |
| 1918 | 8019565485 | 8019555841 | Bacteria | 9642137 |
| 1919 | 8019575580 | 8019565922 | Bacteria | 9639779 |
| 1920 | 8019584137 | 8019576017 | Bacteria | 10049540 |
| 1921 | 8019591894 | 8019586578 | Bacteria | 10212056 |
| 1922 | 8019599389 | 8019597564 | Bacteria | 10041141 |
| 1923 | 8019608968 | 8019608314 | Bacteria | 10042931 |
| 1924 | 8019619636 | 8019619141 | Bacteria | 9218857 |
| 1925 | 8019633477 | 8019629233 | Bacteria | 8687553 |
| 1926 | 8019646420 | 8019638758 | Bacteria | 9062356 |
| 1927 | 8019649181 | 8019648815 | Bacteria | 10014479 |
| 1928 | 8019661362 | 8019659431 | Bacteria | 8577854 |
| 1929 | 8019670903 | 8019668869 | Bacteria | 8791617 |
| 1930 | 8019685292 | 8019678201 | Bacteria | 8863603 |
| 1931 | 8019690915 | 8019687851 | Bacteria | 8712826 |
| 1932 | 8055745270 | 8055742211 | Bacteria | 9226248 |
| 1933 | 8056679421 | 8056673599 | Bacteria | 7871253 |
| 1934 | 8056684934 | 8056681323 | Bacteria | 8472857 |
| 1935 | 8056693439 | 8056689827 | Bacteria | 6712655 |
| 1936 | 8056968893 | 8056967851 | Bacteria | 9038162 |
| 1937 | Ga0099824_1031623 | |||
| 1938 | JGI24740J21852_10018161 | |||
| 1939 | JGI24737J22298_10003352 | |||
| 1940 | JGI24750J21931_1014741 | |||
| 1941 | JGI24744J21845_10016348 | |||
| 1942 | JGI25406J46586_10000035 | |||
| 1943 | JGI25406J46586_10019089 | |||
| 1944 | JGI25153J46596_10024636 | |||
| 1945 | JGI25153J46596_10035718 | |||
| 1946 | JGI25153J46596_10046174 | |||
| 1947 | JGI25153J46596_10059871 | |||
| 1948 | JGI25160J50197_1001173 | |||
| 1949 | JGI25160J50197_1001457 | |||
| 1950 | JGI25404J52841_10014189 | |||
| 1951 | JGI25404J52841_10033124 | |||
| 1952 | JGI25404J52841_10063626 | |||
| 1953 | Ga0055542_1014783 | |||
| 1954 | Ga0055529_1010903 | |||
| 1955 | Ga0055531_10006944 | |||
| 1956 | Ga0055543_1020979 | |||
| 1957 | Ga0065165_1000662 | |||
| 1958 | Ga0065165_1001742 | |||
| 1959 | Ga0065165_1011291 | |||
| 1960 | Ga0070658_10035694 | |||
| 1961 | Ga0070658_10053521 | |||
| 1962 | Ga0070658_10154030 | |||
| 1963 | Ga0070676_10314006 | |||
| 1964 | Ga0070683_100004896 | |||
| 1965 | Ga0070683_100020769 | |||
| 1966 | Ga0070683_100034308 | |||
| 1967 | Ga0070683_100340228 | |||
| 1968 | Ga0070690_100036445 | |||
| 1969 | Ga0070670_100028360 | |||
| 1970 | Ga0070670_100129579 | |||
| 1971 | Ga0070670_100172802 | |||
| 1972 | Ga0070670_100539679 | |||
| 1973 | Ga0070677_10031918 | |||
| 1974 | Ga0068869_100202046 | |||
| 1975 | Ga0070666_10152531 | |||
| 1976 | Ga0070666_10239875 | |||
| 1977 | Ga0070680_100005549 | |||
| 1978 | Ga0070680_100405937 | |||
| 1979 | Ga0070682_100011716 | |||
| 1980 | Ga0070682_100381378 | |||
| 1981 | Ga0068868_100077925 | |||
| 1982 | Ga0068868_101061450 | |||
| 1983 | Ga0070660_100056116 | |||
| 1984 | Ga0070660_100158454 | |||
| 1985 | Ga0070660_100199347 | |||
| 1986 | Ga0070660_100656319 | |||
| 1987 | Ga0070689_100188427 | |||
| 1988 | Ga0070689_100399205 | |||
| 1989 | Ga0070691_10033220 | |||
| 1990 | Ga0070661_100114171 | |||
| 1991 | Ga0070692_10283667 | |||
| 1992 | Ga0070668_100041398 | |||
| 1993 | Ga0070669_100400506 | |||
| 1994 | Ga0070675_100082772 | |||
| 1995 | Ga0070671_100000984 | |||
| 1996 | Ga0070671_100066152 | |||
| 1997 | Ga0070671_100412151 | |||
| 1998 | Ga0070671_100781728 | |||
| 1999 | Ga0070674_100032222 | |||
| 2000 | Ga0070674_100974457 | |||
| 2001 | Ga0070673_100002766 | |||
| 2002 | Ga0070673_100202279 | |||
| 2003 | Ga0070673_100446711 | |||
| 2004 | Ga0070673_100631814 | |||
| 2005 | Ga0070688_100014794 | |||
| 2006 | Ga0070688_100372599 | |||
| 2007 | Ga0070659_100575931 | |||
| 2008 | Ga0070659_100662072 | |||
| 2009 | Ga0070667_100331712 | |||
| 2010 | Ga0070667_100572491 | |||
| 2011 | Ga0070709_10000810 | |||
| 2012 | Ga0070709_10008385 | |||
| 2013 | Ga0070709_10021481 | |||
| 2014 | Ga0070709_10036535 | |||
| 2015 | Ga0070709_10238951 | |||
| 2016 | Ga0070714_100005006 | |||
| 2017 | Ga0070714_100532914 | |||
| 2018 | Ga0070714_101328904 | |||
| 2019 | Ga0070713_100027405 | |||
| 2020 | Ga0070713_100084119 | |||
| 2021 | Ga0070713_100135276 | |||
| 2022 | Ga0070713_100662319 | |||
| 2023 | Ga0070710_10002889 | |||
| 2024 | Ga0070710_10007545 | |||
| 2025 | Ga0070711_100002400 | |||
| 2026 | Ga0070711_100002918 | |||
| 2027 | Ga0070711_100002976 | |||
| 2028 | Ga0070711_100008785 | |||
| 2029 | Ga0070711_100028567 | |||
| 2030 | Ga0070711_100078853 | |||
| 2031 | Ga0070711_100143512 | |||
| 2032 | Ga0070711_100223921 | |||
| 2033 | Ga0070700_100967635 | |||
| 2034 | Ga0070708_100149973 | |||
| 2035 | Ga0070663_100031884 | |||
| 2036 | Ga0070663_100061548 | |||
| 2037 | Ga0070663_100111538 | |||
| 2038 | Ga0070663_100113407 | |||
| 2039 | Ga0070663_100233804 | |||
| 2040 | Ga0070663_100427520 | |||
| 2041 | Ga0070678_100063626 | |||
| 2042 | Ga0070678_100083407 | |||
| 2043 | Ga0070678_101206432 | |||
| 2044 | Ga0070662_100116453 | |||
| 2045 | Ga0070662_100581119 | |||
| 2046 | Ga0070681_10002285 | |||
| 2047 | Ga0070681_10006739 | |||
| 2048 | Ga0070681_10220323 | |||
| 2049 | Ga0070681_10253419 | |||
| 2050 | Ga0070681_10553110 | |||
| 2051 | Ga0068867_100139372 | |||
| 2052 | Ga0070706_100069425 | |||
| 2053 | Ga0070706_100122952 | |||
| 2054 | Ga0070707_100106166 | |||
| 2055 | Ga0070698_100174586 | |||
| 2056 | Ga0070698_100297164 | |||
| 2057 | Ga0070699_100070554 | |||
| 2058 | Ga0070679_100034939 | |||
| 2059 | Ga0070679_100056755 | |||
| 2060 | Ga0070679_100058880 | |||
| 2061 | Ga0070679_100121327 | |||
| 2062 | Ga0070684_100011247 | |||
| 2063 | Ga0070684_100011751 | |||
| 2064 | Ga0070697_100024320 | |||
| 2065 | Ga0070697_100089871 | |||
| 2066 | Ga0068853_100009591 | |||
| 2067 | Ga0068853_100034597 | |||
| 2068 | Ga0068853_100168464 | |||
| 2069 | Ga0068853_100245522 | |||
| 2070 | Ga0070672_100090823 | |||
| 2071 | Ga0070672_100160866 | |||
| 2072 | Ga0070686_100086954 | |||
| 2073 | Ga0070686_100180391 | |||
| 2074 | Ga0070695_100415911 | |||
| 2075 | Ga0070693_100128317 | |||
| 2076 | Ga0070693_100469629 | |||
| 2077 | Ga0070693_100481692 | |||
| 2078 | Ga0070665_100031003 | |||
| 2079 | Ga0070665_100046174 | |||
| 2080 | Ga0070665_100083014 | |||
| 2081 | Ga0070665_100102413 | |||
| 2082 | Ga0068855_100023046 | |||
| 2083 | Ga0068855_100027258 | |||
| 2084 | Ga0068855_100141266 | |||
| 2085 | Ga0068855_100149185 | |||
| 2086 | Ga0068855_100180688 | |||
| 2087 | Ga0068855_100251805 | |||
| 2088 | Ga0068855_100642954 | |||
| 2089 | Ga0068855_100852215 | |||
| 2090 | Ga0070664_100128043 | |||
| 2091 | Ga0070664_100183059 | |||
| 2092 | Ga0070664_100424242 | |||
| 2093 | Ga0068857_100012550 | |||
| 2094 | Ga0068857_100138352 | |||
| 2095 | Ga0068857_100587736 | |||
| 2096 | Ga0068854_100021565 | |||
| 2097 | Ga0068854_100058673 | |||
| 2098 | Ga0068854_100220964 | |||
| 2099 | Ga0068854_100280717 | |||
| 2100 | Ga0068856_100045010 | |||
| 2101 | Ga0068856_100142886 | |||
| 2102 | Ga0068856_100284390 | |||
| 2103 | Ga0068856_100479637 | |||
| 2104 | Ga0068852_100013998 | |||
| 2105 | Ga0068852_100064307 | |||
| 2106 | Ga0068852_100184620 | |||
| 2107 | Ga0068852_100413376 | |||
| 2108 | Ga0068859_100173073 | |||
| 2109 | Ga0068859_100518474 | |||
| 2110 | Ga0068859_100564724 | |||
| 2111 | Ga0068859_100716678 | |||
| 2112 | Ga0068864_100224304 | |||
| 2113 | Ga0068866_10204966 | |||
| 2114 | Ga0068861_100081648 | |||
| 2115 | Ga0068861_100196656 | |||
| 2116 | Ga0068861_100265523 | |||
| 2117 | Ga0068851_10003388 | |||
| 2118 | Ga0068851_10166813 | |||
| 2119 | Ga0068863_100162223 | |||
| 2120 | Ga0068863_100524463 | |||
| 2121 | Ga0068863_100557660 | |||
| 2122 | Ga0068863_100921560 | |||
| 2123 | Ga0068858_100235099 | |||
| 2124 | Ga0068858_100396194 | |||
| 2125 | Ga0068860_100001690 | |||
| 2126 | Ga0068860_100032363 | |||
| 2127 | Ga0068860_100042065 | |||
| 2128 | Ga0068860_100089618 | |||
| 2129 | Ga0068860_100672218 | |||
| 2130 | Ga0068862_100137405 | |||
| 2131 | Ga0068862_100423347 | |||
| 2132 | Ga0068862_100617592 | |||
| 2133 | Ga0068862_100641173 | |||
| 2134 | Ga0068862_100770022 | |||
| 2135 | Ga0081455_10011984 | |||
| 2136 | Ga0081455_10016817 | |||
| 2137 | Ga0081455_10019455 | |||
| 2138 | Ga0081455_10296479 | |||
| 2139 | Ga0081538_10090004 | |||
| 2140 | Ga0081540_1005688 | |||
| 2141 | Ga0081540_1012357 | |||
| 2142 | Ga0081540_1020550 | |||
| 2143 | Ga0081540_1026240 | |||
| 2144 | Ga0081540_1028822 | |||
| 2145 | Ga0081540_1034666 | |||
| 2146 | Ga0081540_1038398 | |||
| 2147 | Ga0081540_1041540 | |||
| 2148 | Ga0081540_1110935 | |||
| 2149 | Ga0081540_1149566 | |||
| 2150 | Ga0081539_10000113 | |||
| 2151 | Ga0081539_10011797 | |||
| 2152 | Ga0081539_10019140 | |||
| 2153 | Ga0070717_10004653 | |||
| 2154 | Ga0070717_10005909 | |||
| 2155 | Ga0070717_10008342 | |||
| 2156 | Ga0070717_10829892 | |||
| 2157 | Ga0075365_10009994 | |||
| 2158 | Ga0075365_10015440 | |||
| 2159 | Ga0075365_10034054 | |||
| 2160 | Ga0075365_10045206 | |||
| 2161 | Ga0075365_10082617 | |||
| 2162 | Ga0075365_10302740 | |||
| 2163 | Ga0075368_10064053 | |||
| 2164 | Ga0075363_100017002 | |||
| 2165 | Ga0075363_100150679 | |||
| 2166 | Ga0075363_100195753 | |||
| 2167 | Ga0075364_10048183 | |||
| 2168 | Ga0075364_10106118 | |||
| 2169 | Ga0075364_10114187 | |||
| 2170 | Ga0070715_10000568 | |||
| 2171 | Ga0070716_100027743 | |||
| 2172 | Ga0070716_100053060 | |||
| 2173 | Ga0070716_100141523 | |||
| 2174 | Ga0070716_100174613 | |||
| 2175 | Ga0070712_100026768 | |||
| 2176 | Ga0070712_100034498 | |||
| 2177 | Ga0070712_100071104 | |||
| 2178 | Ga0070712_100095274 | |||
| 2179 | Ga0070712_100114728 | |||
| 2180 | Ga0075362_10131061 | |||
| 2181 | Ga0075367_10018473 | |||
| 2182 | Ga0075367_10092940 | |||
| 2183 | Ga0075367_10167575 | |||
| 2184 | Ga0075367_10451517 | |||
| 2185 | Ga0075369_10023927 | |||
| 2186 | Ga0075369_10035186 | |||
| 2187 | Ga0075369_10036480 | |||
| 2188 | Ga0075369_10106822 | |||
| 2189 | Ga0075366_10041918 | |||
| 2190 | Ga0075366_10057269 | |||
| 2191 | Ga0097621_100169434 | |||
| 2192 | Ga0075370_10003171 | |||
| 2193 | Ga0075370_10035923 | |||
| 2194 | Ga0075370_10052327 | |||
| 2195 | Ga0075434_100014205 | |||
| 2196 | Ga0075429_100247855 | |||
| 2197 | Ga0075429_100942625 | |||
| 2198 | Ga0068865_100082807 | |||
| 2199 | Ga0097620_100173075 | |||
| 2200 | Ga0097620_100518519 | |||
| 2201 | Ga0097620_100564684 | |||
| 2202 | Ga0097620_100716699 | |||
| 2203 | Ga0099825_1021210 | |||
| 2204 | Ga0099822_1000695 | |||
| 2205 | Ga0075435_100238589 | |||
| 2206 | Ga0099794_10039678 | |||
| 2207 | Ga0099795_10016326 | |||
| 2208 | Ga0099795_10018025 | |||
| 2209 | Ga0099795_10021632 | |||
| 2210 | Ga0105250_10025743 | |||
| 2211 | Ga0105240_10004423 | |||
| 2212 | Ga0105240_10007970 | |||
| 2213 | Ga0105240_10011106 | |||
| 2214 | Ga0105240_10017597 | |||
| 2215 | Ga0105240_10086262 | |||
| 2216 | Ga0105240_10658424 | |||
| 2217 | Ga0111539_10080797 | |||
| 2218 | Ga0111539_10233692 | |||
| 2219 | Ga0105245_10045862 | |||
| 2220 | Ga0105245_10550848 | |||
| 2221 | Ga0105245_10921492 | |||
| 2222 | Ga0105247_10067243 | |||
| 2223 | Ga0105247_10304881 | |||
| 2224 | Ga0105247_10427647 | |||
| 2225 | Ga0105247_10458121 | |||
| 2226 | Ga0114129_10003967 | |||
| 2227 | Ga0114129_10818322 | |||
| 2228 | Ga0105243_10783854 | |||
| 2229 | Ga0105243_11115315 | |||
| 2230 | Ga0105241_10010224 | |||
| 2231 | Ga0105241_10297994 | |||
| 2232 | Ga0105241_10399683 | |||
| 2233 | Ga0105241_10621886 | |||
| 2234 | Ga0105242_10772351 | |||
| 2235 | Ga0105248_10232607 | |||
| 2236 | Ga0105248_10249434 | |||
| 2237 | Ga0105248_10305554 | |||
| 2238 | Ga0105248_10815198 | |||
| 2239 | Ga0105248_11032157 | |||
| 2240 | Ga0105248_11193219 | |||
| 2241 | Ga0105237_10019836 | |||
| 2242 | Ga0105237_10020040 | |||
| 2243 | Ga0105237_10030505 | |||
| 2244 | Ga0105237_10032217 | |||
| 2245 | Ga0105237_10063182 | |||
| 2246 | Ga0105237_10072469 | |||
| 2247 | Ga0105237_10110248 | |||
| 2248 | Ga0105237_10139187 | |||
| 2249 | Ga0105237_10330903 | |||
| 2250 | Ga0105237_10356780 | |||
| 2251 | Ga0105238_10007238 | |||
| 2252 | Ga0105238_10012675 | |||
| 2253 | Ga0105238_10029408 | |||
| 2254 | Ga0105238_10310418 | |||
| 2255 | Ga0105238_10564336 | |||
| 2256 | Ga0105249_10493114 | |||
| 2257 | Ga0099796_10019850 | |||
| 2258 | Ga0099796_10159015 | |||
| 2259 | Ga0105239_10032630 | |||
| 2260 | Ga0105239_10051708 | |||
| 2261 | Ga0105239_10081556 | |||
| 2262 | Ga0105239_10127663 | |||
| 2263 | Ga0105239_10151068 | |||
| 2264 | Ga0105239_10153794 | |||
| 2265 | Ga0105239_10177458 | |||
| 2266 | Ga0105239_10206757 | |||
| 2267 | Ga0105239_10220331 | |||
| 2268 | Ga0105239_10455235 | |||
| 2269 | Ga0105239_10586434 | |||
| 2270 | Ga0105239_10632834 | |||
| 2271 | Ga0105246_10031447 | |||
| 2272 | Ga0105246_10272038 | |||
| 2273 | Ga0105246_10331566 | |||
| 2274 | Ga0157373_10024137 | |||
| 2275 | Ga0157373_10130168 | |||
| 2276 | Ga0157371_10199131 | |||
| 2277 | Ga0157371_10476570 | |||
| 2278 | Ga0157370_10219898 | |||
| 2279 | Ga0157369_10007836 | |||
| 2280 | Ga0157369_10021752 | |||
| 2281 | Ga0157369_10043556 | |||
| 2282 | Ga0157369_10438713 | |||
| 2283 | Ga0157369_10585778 | |||
| 2284 | Ga0157374_10033052 | |||
| 2285 | Ga0157374_10044786 | |||
| 2286 | Ga0157374_11039496 | |||
| 2287 | Ga0157378_10013138 | |||
| 2288 | Ga0157378_10122248 | |||
| 2289 | Ga0157378_10193954 | |||
| 2290 | Ga0163162_10209857 | |||
| 2291 | Ga0163162_10279616 | |||
| 2292 | Ga0163162_11093082 | |||
| 2293 | Ga0163162_11168695 | |||
| 2294 | Ga0157375_10042178 | |||
| 2295 | Ga0157375_10154585 | |||
| 2296 | Ga0157375_10350351 | |||
| 2297 | Ga0157375_10386696 | |||
| 2298 | Ga0157375_10510605 | |||
| 2299 | Ga0157375_10803384 | |||
| 2300 | Ga0163163_10010549 | |||
| 2301 | Ga0163163_10035070 | |||
| 2302 | Ga0163163_10150382 | |||
| 2303 | Ga0163163_10172740 | |||
| 2304 | Ga0163163_10386980 | |||
| 2305 | Ga0157380_10256224 | |||
| 2306 | Ga0157377_10094238 | |||
| 2307 | Ga0157377_10682031 | |||
| 2308 | Ga0157379_10071291 | |||
| 2309 | Ga0157379_10179644 | |||
| 2310 | Ga0157379_10403377 | |||
| 2311 | Ga0157379_10474709 | |||
| 2312 | Ga0157379_10583775 | |||
| 2313 | Ga0157379_10588123 | |||
| 2314 | Ga0157376_10046230 | |||
| 2315 | Ga0157376_10080223 | |||
| 2316 | Ga0157376_10373120 | |||
| 2317 | Ga0157376_10459183 | |||
| 2318 | Ga0157376_11006471 | |||
| 2319 | Ga0157376_11134715 | |||
| 2320 | Ga0157376_11478807 | |||
| 2321 | Ga0182007_10049630 | |||
| 2322 | Ga0163161_10022935 | |||
| 2323 | Ga0197907_10618396 | |||
| 2324 | Ga0214544_1000004 | |||
| 2325 | Ga0214542_1000442 | |||
| 2326 | Ga0214545_1000001 | |||
| 2327 | Ga0214543_1000006 | |||
| 2328 | Ga0213872_10030742 | |||
| 2329 | Ga0213874_10038268 | |||
| 2330 | Ga0213874_10044331 | |||
| 2331 | Ga0213876_10000775 | |||
| 2332 | Ga0213876_10045498 | |||
| 2333 | Ga0213875_10149502 | |||
| 2334 | Ga0228598_1001742 | |||
| 2335 | Ga0209563_100564 | |||
| 2336 | Ga0209677_101733 | |||
| 2337 | Ga0209677_103966 | |||
| 2338 | Ga0209148_1000634 | |||
| 2339 | Ga0209233_1001540 | |||
| 2340 | Ga0209233_1001832 | |||
| 2341 | Ga0209455_1001165 | |||
| 2342 | Ga0209455_1004508 | |||
| 2343 | Ga0209455_1007057 | |||
| 2344 | Ga0209564_1001919 | |||
| 2345 | Ga0209564_1031500 | |||
| 2346 | Ga0209758_1000011 | |||
| 2347 | Ga0209758_1000359 | |||
| 2348 | Ga0209758_1000365 | |||
| 2349 | Ga0209758_1001302 | |||
| 2350 | Ga0209758_1001403 | |||
| 2351 | Ga0209758_1003658 | |||
| 2352 | Ga0209758_1006509 | |||
| 2353 | Ga0209758_1033786 | |||
| 2354 | Ga0209758_1055813 | |||
| 2355 | Ga0209256_1003144 | |||
| 2356 | Ga0209256_1028143 | |||
| 2357 | Ga0209256_1061993 | |||
| 2358 | Ga0207426_1000325 | |||
| 2359 | Ga0207426_1002810 | |||
| 2360 | Ga0207426_1028000 | |||
| 2361 | Ga0209257_1001035 | |||
| 2362 | Ga0209257_1019439 | |||
| 2363 | Ga0207656_10025714 | |||
| 2364 | Ga0207656_10028607 | |||
| 2365 | Ga0207656_10045878 | |||
| 2366 | Ga0207656_10130978 | |||
| 2367 | Ga0207682_10068394 | |||
| 2368 | Ga0207692_10000486 | |||
| 2369 | Ga0207692_10018110 | |||
| 2370 | Ga0207692_10235207 | |||
| 2371 | Ga0207642_10392680 | |||
| 2372 | Ga0207710_10065950 | |||
| 2373 | Ga0207710_10196601 | |||
| 2374 | Ga0207688_10024611 | |||
| 2375 | Ga0207688_10436385 | |||
| 2376 | Ga0207647_10000275 | |||
| 2377 | Ga0207647_10007934 | |||
| 2378 | Ga0207647_10058431 | |||
| 2379 | Ga0207699_10001305 | |||
| 2380 | Ga0207699_10007131 | |||
| 2381 | Ga0207699_10030759 | |||
| 2382 | Ga0207699_10076192 | |||
| 2383 | Ga0207643_10430928 | |||
| 2384 | Ga0207705_10053050 | |||
| 2385 | Ga0207705_10070090 | |||
| 2386 | Ga0207705_10116889 | |||
| 2387 | Ga0207684_10125074 | |||
| 2388 | Ga0207684_10167040 | |||
| 2389 | Ga0207654_10071633 | |||
| 2390 | Ga0207654_10087291 | |||
| 2391 | Ga0207707_10000404 | |||
| 2392 | Ga0207707_10007729 | |||
| 2393 | Ga0207707_10055228 | |||
| 2394 | Ga0207707_10069843 | |||
| 2395 | Ga0207707_10235212 | |||
| 2396 | Ga0207695_10000008 | |||
| 2397 | Ga0207695_10004288 | |||
| 2398 | Ga0207695_10048296 | |||
| 2399 | Ga0207695_10212280 | |||
| 2400 | Ga0207695_10470253 | |||
| 2401 | Ga0207695_10716483 | |||
| 2402 | Ga0207671_10014923 | |||
| 2403 | Ga0207671_10066737 | |||
| 2404 | Ga0207671_10087744 | |||
| 2405 | Ga0207671_10093294 | |||
| 2406 | Ga0207671_10103908 | |||
| 2407 | Ga0207671_10563056 | |||
| 2408 | Ga0207671_10779599 | |||
| 2409 | Ga0207693_10000910 | |||
| 2410 | Ga0207693_10002290 | |||
| 2411 | Ga0207693_10060338 | |||
| 2412 | Ga0207693_10061477 | |||
| 2413 | Ga0207693_10190136 | |||
| 2414 | Ga0207663_10001370 | |||
| 2415 | Ga0207663_10037072 | |||
| 2416 | Ga0207663_10062177 | |||
| 2417 | Ga0207663_10134024 | |||
| 2418 | Ga0207663_10168673 | |||
| 2419 | Ga0207663_10359220 | |||
| 2420 | Ga0207660_10002854 | |||
| 2421 | Ga0207660_10389753 | |||
| 2422 | Ga0207657_10004122 | |||
| 2423 | Ga0207657_10011792 | |||
| 2424 | Ga0207657_10055693 | |||
| 2425 | Ga0207657_10104255 | |||
| 2426 | Ga0207657_10286885 | |||
| 2427 | Ga0207649_10083882 | |||
| 2428 | Ga0207652_10002796 | |||
| 2429 | Ga0207652_10222844 | |||
| 2430 | Ga0207652_10636996 | |||
| 2431 | Ga0207646_10045245 | |||
| 2432 | Ga0207646_10096344 | |||
| 2433 | Ga0207681_10251427 | |||
| 2434 | Ga0207694_10000050 | |||
| 2435 | Ga0207694_10065611 | |||
| 2436 | Ga0207694_10109370 | |||
| 2437 | Ga0207694_10285474 | |||
| 2438 | Ga0207650_10172373 | |||
| 2439 | Ga0207650_10554061 | |||
| 2440 | Ga0207659_10076784 | |||
| 2441 | Ga0207687_10024493 | |||
| 2442 | Ga0207687_10367887 | |||
| 2443 | Ga0207700_10006007 | |||
| 2444 | Ga0207700_10014341 | |||
| 2445 | Ga0207700_10023644 | |||
| 2446 | Ga0207700_10086417 | |||
| 2447 | Ga0207700_10149910 | |||
| 2448 | Ga0207664_10007756 | |||
| 2449 | Ga0207664_10410335 | |||
| 2450 | Ga0207644_10027591 | |||
| 2451 | Ga0207644_10168650 | |||
| 2452 | Ga0207644_10266123 | |||
| 2453 | Ga0207690_10096337 | |||
| 2454 | Ga0207706_10011626 | |||
| 2455 | Ga0207706_10067622 | |||
| 2456 | Ga0207706_10070010 | |||
| 2457 | Ga0207706_10088708 | |||
| 2458 | Ga0207706_10224350 | |||
| 2459 | Ga0207686_10270147 | |||
| 2460 | Ga0207686_10355326 | |||
| 2461 | Ga0207709_10039609 | |||
| 2462 | Ga0207670_10164380 | |||
| 2463 | Ga0207670_10448070 | |||
| 2464 | Ga0207669_10133425 | |||
| 2465 | Ga0207669_10305649 | |||
| 2466 | Ga0207669_10359627 | |||
| 2467 | Ga0207704_10037422 | |||
| 2468 | Ga0207704_10205573 | |||
| 2469 | Ga0207665_10000537 | |||
| 2470 | Ga0207665_10036306 | |||
| 2471 | Ga0207665_10188231 | |||
| 2472 | Ga0207665_10357327 | |||
| 2473 | Ga0207691_10033893 | |||
| 2474 | Ga0207691_10042590 | |||
| 2475 | Ga0207711_10101038 | |||
| 2476 | Ga0207711_10152478 | |||
| 2477 | Ga0207711_10423881 | |||
| 2478 | Ga0207661_10001004 | |||
| 2479 | Ga0207661_10004383 | |||
| 2480 | Ga0207661_10077568 | |||
| 2481 | Ga0207661_10683265 | |||
| 2482 | Ga0207679_10173346 | |||
| 2483 | Ga0207679_10194164 | |||
| 2484 | Ga0207679_10332676 | |||
| 2485 | Ga0207679_10415609 | |||
| 2486 | Ga0207667_10006495 | |||
| 2487 | Ga0207667_10063578 | |||
| 2488 | Ga0207667_10149610 | |||
| 2489 | Ga0207667_10181605 | |||
| 2490 | Ga0207667_10233551 | |||
| 2491 | Ga0207667_10248165 | |||
| 2492 | Ga0207667_10666564 | |||
| 2493 | Ga0207651_10004830 | |||
| 2494 | Ga0207651_10055829 | |||
| 2495 | Ga0207651_10233566 | |||
| 2496 | Ga0207651_10237735 | |||
| 2497 | Ga0207712_10005172 | |||
| 2498 | Ga0207712_10340000 | |||
| 2499 | Ga0207668_10003910 | |||
| 2500 | Ga0207668_10196775 | |||
| 2501 | Ga0207668_10248423 | |||
| 2502 | Ga0207668_11021487 | |||
| 2503 | Ga0207640_10042961 | |||
| 2504 | Ga0207640_10057584 | |||
| 2505 | Ga0207640_10082223 | |||
| 2506 | Ga0207640_10102749 | |||
| 2507 | Ga0207640_10430388 | |||
| 2508 | Ga0207658_10287537 | |||
| 2509 | Ga0207658_10528605 | |||
| 2510 | Ga0207658_10567938 | |||
| 2511 | Ga0207677_10088394 | |||
| 2512 | Ga0207703_10178292 | |||
| 2513 | Ga0207703_10468773 | |||
| 2514 | Ga0207703_11134423 | |||
| 2515 | Ga0207703_11440325 | |||
| 2516 | Ga0207639_10033198 | |||
| 2517 | Ga0207639_10040580 | |||
| 2518 | Ga0207639_10058323 | |||
| 2519 | Ga0207639_10079198 | |||
| 2520 | Ga0207639_10090237 | |||
| 2521 | Ga0207639_10221978 | |||
| 2522 | Ga0207639_10708056 | |||
| 2523 | Ga0207678_10005498 | |||
| 2524 | Ga0207678_10023667 | |||
| 2525 | Ga0207678_10036614 | |||
| 2526 | Ga0207678_10145973 | |||
| 2527 | Ga0207678_10181723 | |||
| 2528 | Ga0207678_10197830 | |||
| 2529 | Ga0207678_10350958 | |||
| 2530 | Ga0207678_10435236 | |||
| 2531 | Ga0207708_10019168 | |||
| 2532 | Ga0207708_10037515 | |||
| 2533 | Ga0207702_10000002 | |||
| 2534 | Ga0207702_10030183 | |||
| 2535 | Ga0207702_10047629 | |||
| 2536 | Ga0207702_10321160 | |||
| 2537 | Ga0207702_10480930 | |||
| 2538 | Ga0207641_10141807 | |||
| 2539 | Ga0207641_10156631 | |||
| 2540 | Ga0207641_10285073 | |||
| 2541 | Ga0207641_10573146 | |||
| 2542 | Ga0207648_10022493 | |||
| 2543 | Ga0207648_10861681 | |||
| 2544 | Ga0207676_10050927 | |||
| 2545 | Ga0207676_10141664 | |||
| 2546 | Ga0207676_10205575 | |||
| 2547 | Ga0207674_10005330 | |||
| 2548 | Ga0207674_10020302 | |||
| 2549 | Ga0207674_10136917 | |||
| 2550 | Ga0207674_10183794 | |||
| 2551 | Ga0207674_10248958 | |||
| 2552 | Ga0207675_100043556 | |||
| 2553 | Ga0207675_100046342 | |||
| 2554 | Ga0207675_100551853 | |||
| 2555 | Ga0207683_10012010 | |||
| 2556 | Ga0207683_10080862 | |||
| 2557 | Ga0207683_10432669 | |||
| 2558 | Ga0207683_10794793 | |||
| 2559 | Ga0207683_10804410 | |||
| 2560 | Ga0207698_10051462 | |||
| 2561 | Ga0207698_10131962 | |||
| 2562 | Ga0207698_10190493 | |||
| 2563 | Ga0207698_10234552 | |||
| 2564 | Ga0207698_10246998 | |||
| 2565 | Ga0209389_1000001 | |||
| 2566 | Ga0209389_1000412 | |||
| 2567 | Ga0209589_1000014 | |||
| 2568 | Ga0209589_1004063 | |||
| 2569 | Ga0209489_100014 | |||
| 2570 | Ga0209489_100090 | |||
| 2571 | Ga0209700_100007 | |||
| 2572 | Ga0209700_100024 | |||
| 2573 | Ga0209588_1016793 | |||
| 2574 | Ga0209588_1087162 | |||
| 2575 | Ga0268266_10044745 | |||
| 2576 | Ga0268266_10243604 | |||
| 2577 | Ga0268266_10922860 | |||
| 2578 | Ga0268265_10300809 | |||
| 2579 | Ga0268265_10620530 | |||
| 2580 | Ga0268264_10000048 | |||
| 2581 | Ga0268264_10399150 | |||
| 2582 | Ga0268264_10586894 | |||
| 2583 | Ga0265337_1017079 | |||
| 2584 | Ga0265319_1043817 | |||
| 2585 | Ga0265334_10001927 | |||
| 2586 | Ga0265334_10032099 | |||
| 2587 | Ga0265318_10021721 | |||
| 2588 | Ga0265323_10011044 | |||
| 2589 | Ga0265336_10000588 | |||
| 2590 | Ga0307517_10003796 | |||
| 2591 | Ga0307517_10160945 | |||
| 2592 | Ga0307515_10058433 | |||
| 2593 | Ga0307515_10359430 | |||
| 2594 | Ga0265338_10000034 | |||
| 2595 | Ga0265338_10489097 | |||
| 2596 | Ga0265324_10043083 | |||
| 2597 | Ga0307511_10078196 | |||
| 2598 | Ga0265330_10016271 | |||
| 2599 | Ga0265330_10019276 | |||
| 2600 | Ga0265332_10074016 | |||
| 2601 | Ga0265325_10013731 | |||
| 2602 | Ga0265340_10168757 | |||
| 2603 | Ga0265340_10174506 | |||
| 2604 | Ga0265331_10164351 | |||
| 2605 | Ga0265316_10103151 | |||
| 2606 | Ga0307513_10111708 | |||
| 2607 | Ga0307509_10301085 | |||
| 2608 | Ga0307509_10478164 | |||
| 2609 | Ga0307508_10000249 | |||
| 2610 | Ga0307508_10332846 | |||
| 2611 | Ga0265314_10226234 | |||
| 2612 | Ga0265314_10231834 | |||
| 2613 | Ga0265342_10119243 | |||
| 2614 | Ga0307516_10012936 | |||
| 2615 | Ga0307516_10029804 | |||
| 2616 | Ga0307516_10355342 | |||
| 2617 | Ga0307405_10128305 | |||
| 2618 | Ga0307405_10311119 | |||
| 2619 | Ga0307410_10221470 | |||
| 2620 | Ga0307406_10130066 | |||
| 2621 | Ga0307406_10509555 | |||
| 2622 | Ga0307412_10054888 | |||
| 2623 | Ga0307412_10264109 | |||
| 2624 | Ga0307409_100157459 | |||
| 2625 | Ga0307416_100271975 | |||
| 2626 | Ga0307411_10475131 | |||
| 2627 | Ga0307415_100028829 | |||
| 2628 | Ga0307507_10012335 | |||
| 2629 | Ga0307510_10027857 | |||
| 2630 | Ga0307510_10052013 | |||
| 2631 | Ga0307510_10068711 | |||
| 2632 | Ga0307510_10114422 | |||
| 2633 | Ga0307510_10190178 | |||
| 2634 | Ga0307510_10366185 | |||
| 2635 | Ga0315911_1000002 | |||
| 2636 | Ga0373938_0063810 | |||
| 2637 | Ga0373926_0004928 | |||
| 2638 | Ga0373926_0044855 | |||
| 2639 | Ga0373934_0018056 | |||
| 2640 | Ga0373940_0025756 | |||
| 2641 | Ga0373944_0004479 | |||
| 2642 | Ga0373944_0043741 | |||
| 2643 | Ga0373923_0002188 | |||
| 2644 | Ga0373923_0016399 | |||
| 2645 | Ga0373923_0053464 | |||
| 2646 | Ga0373923_0109645 | |||
| 2647 | Ga0373923_0116521 | |||
| 2648 | Ga0373936_0003062 | |||
| 2649 | Ga0373936_0007741 | |||
| 2650 | Ga0373936_0106712 | |||
| 2651 | Ga0373936_0209758 | |||
| 2652 | Ga0373945_0002360 | |||
| 2653 | Ga0373945_0011384 | |||
| 2654 | Ga0373945_0012335 | |||
| 2655 | Ga0373953_0002005 | |||
| 2656 | Ga0373953_0047486 | |||
| 2657 | Ga0373953_0218059 | |||
| 2658 | Ga0373954_0008972 | |||
| 2659 | Ga0373954_0012542 | |||
| 2660 | Ga0373954_0074276 | |||
| 2661 | Ga0373956_0004542 | |||
| 2662 | Ga0373956_0085934 | |||
| 2663 | Ga0373956_0155357 | |||
| 2664 | Ga0373957_0040002 | |||
| 2665 | Ga0373957_0129454 | |||
| 2666 | Ga0373943_0001590 | |||
| 2667 | Ga0373943_0009393 | |||
| 2668 | Ga0373943_0041003 | |||
| 2669 | Ga0373943_0048765 | |||
| 2670 | Ga0373943_0118799 | |||
| 2671 | Ga0373943_0237420 | |||
| 2672 | Ga0373943_0241115 | |||
| 2673 | Ga0373943_0290316 | |||
| 2674 | Ga0373943_0341833 | |||
| 2675 | Ga0373946_0001138 | |||
| 2676 | Ga0373946_0004971 | |||
| 2677 | Ga0373946_0008733 | |||
| 2678 | Ga0373946_0034447 | |||
| 2679 | Ga0373955_0031966 | |||
| 2680 | Ga0373955_0046774 | |||
| 2681 | Ga0373955_0124010 | |||
| 2682 | Ga0373955_0181915 | |||
| 2683 | Ga0373955_0247332 | |||
| 2684 | Ga0373955_0427032 | |||
| 2685 | Ga0373955_0431260 | |||
| 2686 | Ga0373942_0015643 | |||
| 2687 | Ga0373924_0036572 | |||
| 2688 | Ga0373931_0004151 | |||
| 2689 | Ga0373931_0138379 | |||
| 2690 | Ga0373931_0222258 | |||
| 2691 | Ga0373931_0252612 | |||
| 2692 | Ga0373931_0405657 | |||
| 2693 | Ga0373931_0442534 | |||
| 2694 | Ga0373935_0004402 | |||
| 2695 | Ga0373935_0009514 | |||
| 2696 | Ga0373935_0035237 | |||
| 2697 | Ga0373935_0040476 | |||
| 2698 | Ga0373935_0044615 | |||
| 2699 | Ga0373935_0353389 | |||
| 2700 | Ga0373935_0376461 | |||
| 2701 | Ga0373927_0001631 | |||
| 2702 | Ga0373927_0001997 | |||
| 2703 | Ga0373927_0002674 | |||
| 2704 | Ga0373927_0003550 | |||
| 2705 | Ga0373927_0007120 | |||
| 2706 | Ga0373927_0040133 | |||
| 2707 | Ga0373927_0114326 | |||
| 2708 | Ga0373927_0410309 | |||
| 2709 | Ga0373933_0000062 | |||
| 2710 | Ga0373933_0011368 | |||
| 2711 | Ga0373933_0038438 | |||
| 2712 | Ga0373933_0061784 | |||
| 2713 | Ga0373933_0079720 | |||
| 2714 | Ga0373933_0103235 | |||
| 2715 | Ga0373933_0343963 | |||
| 2716 | Ga0373947_0000775 | |||
| 2717 | Ga0373947_0002775 | |||
| 2718 | Ga0373947_0009604 | |||
| 2719 | Ga0373947_0178130 | |||
| 2720 | Ga0373947_0233394 | |||
| 2721 | Ga0373937_0006410 | |||
| 2722 | Ga0373937_0016961 | |||
| 2723 | Ga0373937_0043209 | |||
| 2724 | Ga0373937_0083596 | |||
| 2725 | Ga0373937_0114593 | |||
| 2726 | Ga0373937_0121290 | |||
| 2727 | Ga0372808_021550 | |||
| 2728 | Ga0373925_0009647 | |||
| 2729 | Ga0373925_0010569 | |||
| 2730 | Ga0373925_0030941 | |||
| 2731 | Ga0373925_0033659 | |||
| 2732 | Ga0373925_0037820 | |||
| 2733 | Ga0373925_0039820 | |||
| 2734 | Ga0373925_0117602 | |||
| 2735 | Ga0373925_0169004 | |||
| 2736 | Ga0373925_0240049 | |||
| 2737 | Ga0373925_1027809 | |||
| 2738 | Ga0395899_0057698 | |||
| 2739 | Ga0395899_0334368 | |||
| 2740 | Ga0395899_0406425 | |||
| 2741 | Ga0395899_0542273 | |||
| 2742 | Ga0395900_0001786 | |||
| 2743 | Ga0395900_0183547 | |||
| 2744 | Ga0395900_0256586 | |||
| 2745 | Ga0395900_0305073 | |||
| 2746 | Ga0395898_0042817 | |||
| 2747 | Ga0395898_0167294 | |||
| 2748 | Ga0395898_0246436 | |||
| 2749 | Ga0395898_0817361 | |||
| 2750 | Ga0395905_0025721 | |||
| 2751 | Ga0395905_0057784 | |||
| 2752 | Ga0395905_0386848 | |||
| 2753 | Ga0395905_0436080 | |||
| 2754 | Ga0395905_1174172 | |||
| 2755 | Ga0436364_0209550 | |||
| 2756 | Ga0395901_0012729 | |||
| 2757 | Ga0395901_0046838 | |||
| 2758 | Ga0395901_0102502 | |||
| 2759 | Ga0395901_0118999 | |||
| 2760 | Ga0395901_0165792 | |||
| 2761 | Ga0395901_0393971 | |||
| 2762 | Ga0395901_0875526 | |||
| 2763 | Ga0395901_1112557 | |||
| 2764 | Ga0436365_0034335 | |||
| 2765 | Ga0436365_0100384 | |||
| 2766 | Ga0436365_0592065 | |||
| 2767 | Ga0436365_1461628 | |||
| 2768 | Ga0436365_1578029 | |||
| 2769 | Ga0436365_1635710 | |||
| 2770 | Ga0436360_0841399 | |||
| 2771 | Ga0436360_1128260 | |||
| 2772 | Ga0436361_0460374 | |||
| 2773 | Ga0436361_0547832 | |||
| 2774 | Ga0436361_1066754 | |||
| 2775 | Ga0436363_0096959 | |||
| 2776 | Ga0436363_0235830 | |||
| 2777 | Ga0436363_0497150 | |||
| 2778 | Ga0436363_0757377 | |||
| 2779 | Ga0436362_0358185 | |||
| 2780 | Ga0436362_1228923 | |||
| 2781 | Ga0451800_0836785 | |||
| 2782 | Ga0451807_1316634 | |||
| 2783 | Ga0451839_1366619 | |||
| 2784 | Ga0451843_0418884 | |||
| 2785 | Ga0451855_0811600 | |||
| 2786 | Ga0439441_071950 | |||
| 2787 | Ga0466969_0014467 | |||
| 2788 | Ga0466972_0000200 | |||
| 2789 | Ga0466972_0020843 | |||
| 2790 | Ga0466965_0074017 | |||
| 2791 | Ga0466966_0021082 | |||
| 2792 | Ga0466961_0000102 | |||
| 2793 | Ga0466961_0105547 | |||
| 2794 | Ga0466963_0020583 | |||
| 2795 | Ga0466963_0039622 | |||
| 2796 | Ga0466964_0059951 | |||
| 2797 | Ga0466968_0059593 | |||
| 2798 | Ga0466968_0242783 | |||
| 2799 | Ga0466957_0019778 | |||
| 2800 | Ga0466957_0113952 | |||
| 2801 | Ga0466960_0028887 | |||
| 2802 | Ga0466960_0111836 | |||
| 2803 | Ga0466959_0039738 | |||
| 2804 | Ga0466959_0081703 | |||
| 2805 | Ga0466959_0189018 | |||
| 2806 | Ga0466959_0218567 | |||
| 2807 | Ga0466959_0230734 | |||
| 2808 | Ga0466967_0067953 | |||
| 2809 | Ga0466967_0170216 | |||
| 2810 | Ga0466967_0494890 | |||
| 2811 | Ga0495617_028545 | |||
| 2812 | Ga0495617_143779 | |||
| 2813 | Ga0495592_0042882 | |||
| 2814 | Ga0495592_0055751 | |||
| 2815 | Ga0495592_0089446 | |||
| 2816 | Ga0495592_0101010 | |||
| 2817 | Ga0495592_0153346 | |||
| 2818 | Ga0495592_0162625 | |||
| 2819 | Ga0495592_0380530 | |||
| 2820 | Ga0495592_0504643 | |||
| 2821 | Ga0495603_0001689 | |||
| 2822 | Ga0495603_0013972 | |||
| 2823 | Ga0495603_0019223 | |||
| 2824 | Ga0495603_0085847 | |||
| 2825 | Ga0495603_0090905 | |||
| 2826 | Ga0495603_0119401 | |||
| 2827 | Ga0495603_0439088 | |||
| 2828 | Ga0495629_0002784 | |||
| 2829 | Ga0495629_0005268 | |||
| 2830 | Ga0495629_0027516 | |||
| 2831 | Ga0495629_0057552 | |||
| 2832 | Ga0495629_0083029 | |||
| 2833 | Ga0495629_0227978 | |||
| 2834 | Ga0495629_0480286 | |||
| 2835 | Ga0495638_0078309 | |||
| 2836 | Ga0495638_0324809 | |||
| 2837 | Ga0495638_0359303 | |||
| 2838 | Ga0495641_0015327 | |||
| 2839 | Ga0495651_0013038 | |||
| 2840 | Ga0495651_0020762 | |||
| 2841 | Ga0495651_0033911 | |||
| 2842 | Ga0495651_0087384 | |||
| 2843 | Ga0495651_0149193 | |||
| 2844 | Ga0495651_0225667 | |||
| 2845 | Ga0495651_0309713 | |||
| 2846 | Ga0495653_0031788 | |||
| 2847 | Ga0495653_0119850 | |||
| 2848 | Ga0495653_0155914 | |||
| 2849 | Ga0495653_0288135 | |||
| 2850 | Ga0495580_0005616 | |||
| 2851 | Ga0495580_0008118 | |||
| 2852 | Ga0495580_0026858 | |||
| 2853 | Ga0495580_0082961 | |||
| 2854 | Ga0495580_0163421 | |||
| 2855 | Ga0495580_0576188 | |||
| 2856 | Ga0495582_0000228 | |||
| 2857 | Ga0495582_0008256 | |||
| 2858 | Ga0495582_0042985 | |||
| 2859 | Ga0495582_0076883 | |||
| 2860 | Ga0495582_0172377 | |||
| 2861 | Ga0495605_0106592 | |||
| 2862 | Ga0495639_0000261 | |||
| 2863 | Ga0495639_0001957 | |||
| 2864 | Ga0495639_0016411 | |||
| 2865 | Ga0495639_0045026 | |||
| 2866 | Ga0495639_0053948 | |||
| 2867 | Ga0495639_0069279 | |||
| 2868 | Ga0495639_0311576 | |||
| 2869 | Ga0495662_0001403 | |||
| 2870 | Ga0495662_0009843 | |||
| 2871 | Ga0495662_0029901 | |||
| 2872 | Ga0495662_0033540 | |||
| 2873 | Ga0495662_0225180 | |||
| 2874 | Ga0495662_0241520 | |||
| 2875 | Ga0495664_0009409 | |||
| 2876 | Ga0495664_0009558 | |||
| 2877 | Ga0495664_0019496 | |||
| 2878 | Ga0495664_0035329 | |||
| 2879 | Ga0495664_0056486 | |||
| 2880 | Ga0495664_0068578 | |||
| 2881 | Ga0495664_0114438 | |||
| 2882 | Ga0495584_0049348 | |||
| 2883 | Ga0495584_0199609 | |||
| 2884 | Ga0495584_0270842 | |||
| 2885 | Ga0495585_0059383 | |||
| 2886 | Ga0495585_0117789 | |||
| 2887 | Ga0495585_0138573 | |||
| 2888 | Ga0495594_0010814 | |||
| 2889 | Ga0495594_0083875 | |||
| 2890 | Ga0495594_0110971 | |||
| 2891 | Ga0495594_0167097 | |||
| 2892 | Ga0495594_0449903 | |||
| 2893 | Ga0495607_0027106 | |||
| 2894 | Ga0495607_0043332 | |||
| 2895 | Ga0495583_0176304 | |||
| 2896 | Ga0495606_0006063 | |||
| 2897 | Ga0495606_0045509 | |||
| 2898 | Ga0495606_0060727 | |||
| 2899 | Ga0495606_0334353 | |||
| 2900 | Ga0495608_0005477 | |||
| 2901 | Ga0495608_0051105 | |||
| 2902 | Ga0495608_0190261 | |||
| 2903 | Ga0495608_0300929 | |||
| 2904 | Ga0495610_0041466 | |||
| 2905 | Ga0495610_0103565 | |||
| 2906 | Ga0495610_0254338 | |||
| 2907 | Ga0495616_0106933 | |||
| 2908 | Ga0495616_0107976 | |||
| 2909 | Ga0495618_0009115 | |||
| 2910 | Ga0495618_0010034 | |||
| 2911 | Ga0495618_0024844 | |||
| 2912 | Ga0495618_0048145 | |||
| 2913 | Ga0495618_0103105 | |||
| 2914 | Ga0495618_0225580 | |||
| 2915 | Ga0495618_0345238 | |||
| 2916 | Ga0495620_0092455 | |||
| 2917 | Ga0495628_0011105 | |||
| 2918 | Ga0495628_0018283 | |||
| 2919 | Ga0495628_0033468 | |||
| 2920 | Ga0495628_0149640 | |||
| 2921 | Ga0495628_0240734 | |||
| 2922 | Ga0495630_0001773 | |||
| 2923 | Ga0495630_0007498 | |||
| 2924 | Ga0495630_0095136 | |||
| 2925 | Ga0495630_0100824 | |||
| 2926 | Ga0495630_0152889 | |||
| 2927 | Ga0495630_0154542 | |||
| 2928 | Ga0495630_0235245 | |||
| 2929 | Ga0495630_1153539 | |||
| 2930 | Ga0495631_0018806 | |||
| 2931 | Ga0495631_0070805 | |||
| 2932 | Ga0495631_0154661 | |||
| 2933 | Ga0495632_0078062 | |||
| 2934 | Ga0495632_0241791 | |||
| 2935 | Ga0495643_0010662 | |||
| 2936 | Ga0495643_0081066 | |||
| 2937 | Ga0495643_0189941 | |||
| 2938 | Ga0495644_0057469 | |||
| 2939 | Ga0495644_0250408 | |||
| 2940 | Ga0495648_0003345 | |||
| 2941 | Ga0495648_0004592 | |||
| 2942 | Ga0495648_0083048 | |||
| 2943 | Ga0495666_0006712 | |||
| 2944 | Ga0495666_0059767 | |||
| 2945 | Ga0495666_0085656 | |||
| 2946 | Ga0495666_0179338 | |||
| 2947 | Ga0495652_0019969 | |||
| 2948 | Ga0495652_0023429 | |||
| 2949 | Ga0495652_0038900 | |||
| 2950 | Ga0495652_0041390 | |||
| 2951 | Ga0495652_0044333 | |||
| 2952 | Ga0495652_0072785 | |||
| 2953 | Ga0495652_0174916 | |||
| 2954 | Ga0495665_0005489 | |||
| 2955 | Ga0495665_0034460 | |||
| 2956 | Ga0495665_0065474 | |||
| 2957 | Ga0495665_0148508 | |||
| 2958 | Ga0495640_0007929 | |||
| 2959 | Ga0495640_0009559 | |||
| 2960 | Ga0495640_0041460 | |||
| 2961 | Ga0495640_0059963 | |||
| 2962 | Ga0495640_0066561 | |||
| 2963 | Ga0495640_0088014 | |||
| 2964 | Ga0495640_0092347 | |||
| 2965 | Ga0495640_0276026 | |||
| 2966 | Ga0495586_0082113 | |||
| 2967 | Ga0495586_0103235 | |||
| 2968 | Ga0495587_0049432 | |||
| 2969 | Ga0495587_0089452 | |||
| 2970 | Ga0495587_0174791 | |||
| 2971 | Ga0495609_0092364 | |||
| 2972 | Ga0495621_0009179 | |||
| 2973 | Ga0495645_0046050 | |||
| 2974 | Ga0495645_0071072 | |||
| 2975 | Ga0495645_0090596 | |||
| 2976 | Ga0495645_0099826 | |||
| 2977 | Ga0495645_0155917 | |||
| 2978 | Ga0495645_0437886 | |||
| 2979 | Ga0495622_0004883 | |||
| 2980 | Ga0495622_0006509 | |||
| 2981 | Ga0495622_0043915 | |||
| 2982 | Ga0495633_0004411 | |||
| 2983 | Ga0495633_0037789 | |||
| 2984 | Ga0495633_0058116 | |||
| 2985 | Ga0495667_0005052 | |||
| 2986 | Ga0495667_0005284 | |||
| 2987 | Ga0495667_0019161 | |||
| 2988 | Ga0495667_0093728 | |||
| 2989 | Ga0495667_0108078 | |||
| 2990 | Ga0495667_0125357 | |||
| 2991 | Ga0495667_0185227 | |||
| 2992 | Ga0495667_0215758 | |||
| 2993 | Ga0495667_0551771 | |||
| 2994 | Ga0495667_0562913 | |||
| 2995 | Ga0495667_0607637 | |||
| 2996 | Ga0495656_0018299 | |||
| 2997 | Ga0495656_0020894 | |||
| 2998 | Ga0495656_0099459 | |||
| 2999 | Ga0495656_0153532 | |||
| 3000 | Ga0495656_0227122 | |||
| 3001 | Ga0495656_0229854 | |||
| 3002 | Ga0495668_0021645 | |||
| 3003 | Ga0495668_0021688 | |||
| 3004 | Ga0495668_0071686 | |||
| 3005 | Ga0495668_0179518 | |||
| 3006 | Ga0495634_0003006 | |||
| 3007 | Ga0495634_0020439 | |||
| 3008 | Ga0495634_0022022 | |||
| 3009 | Ga0495634_0115063 | |||
| 3010 | Ga0495634_0196192 | |||
| 3011 | Ga0495634_0627858 | |||
| 3012 | Ga0495611_0030844 | |||
| 3013 | Ga0495611_0174882 | |||
| 3014 | Ga0495625_0114346 | |||
| 3015 | Ga0495625_0207415 | |||
| 3016 | Ga0495635_0000584 | |||
| 3017 | Ga0495635_0002773 | |||
| 3018 | Ga0495635_0045260 | |||
| 3019 | Ga0495635_0062187 | |||
| 3020 | Ga0495635_0109045 | |||
| 3021 | Ga0495635_0142774 | |||
| 3022 | Ga0495635_0225883 | |||
| 3023 | Ga0495661_0116248 | |||
| 3024 | Ga0495661_0136167 | |||
| 3025 | Ga0495588_0007973 | |||
| 3026 | Ga0495588_0055835 | |||
| 3027 | Ga0495588_0070439 | |||
| 3028 | Ga0495588_0137426 | |||
| 3029 | Ga0495588_0138678 | |||
| 3030 | Ga0495588_0521193 | |||
| 3031 | Ga0495657_0004948 | |||
| 3032 | Ga0495657_0050289 | |||
| 3033 | Ga0495657_0123948 | |||
| 3034 | Ga0495657_0202310 | |||
| 3035 | Ga0495657_0283668 | |||
| 3036 | Ga0495599_0015121 | |||
| 3037 | Ga0495599_0039462 | |||
| 3038 | Ga0495599_0050298 | |||
| 3039 | Ga0495599_0062978 | |||
| 3040 | Ga0495599_0149633 | |||
| 3041 | Ga0495599_0288212 | |||
| 3042 | Ga0495623_0001850 | |||
| 3043 | Ga0495623_0009506 | |||
| 3044 | Ga0495623_0073594 | |||
| 3045 | Ga0495646_0031462 | |||
| 3046 | Ga0495646_0065534 | |||
| 3047 | Ga0495646_0084155 | |||
| 3048 | Ga0495646_0142062 | |||
| 3049 | Ga0495646_0154331 | |||
| 3050 | Ga0495647_0001733 | |||
| 3051 | Ga0495647_0024455 | |||
| 3052 | Ga0495647_0068186 | |||
| 3053 | Ga0495647_0070504 | |||
| 3054 | Ga0495647_0121817 | |||
| 3055 | Ga0495647_0479372 | |||
| 3056 | Ga0495658_0000941 | |||
| 3057 | Ga0495658_0007724 | |||
| 3058 | Ga0495658_0011094 | |||
| 3059 | Ga0495658_0018412 | |||
| 3060 | Ga0495658_0066994 | |||
| 3061 | Ga0495658_0121326 | |||
| 3062 | Ga0495658_0138067 | |||
| 3063 | Ga0495669_0006028 | |||
| 3064 | Ga0495613_0019620 | |||
| 3065 | Ga0495613_0023147 | |||
| 3066 | Ga0495613_0023549 | |||
| 3067 | Ga0495613_0039198 | |||
| 3068 | Ga0495613_0060021 | |||
| 3069 | Ga0495613_0129228 | |||
| 3070 | Ga0495613_0153403 | |||
| 3071 | Ga0495613_0208761 | |||
| 3072 | Ga0495613_0217660 | |||
| 3073 | Ga0495613_0309650 | |||
| 3074 | Ga0495624_0001434 | |||
| 3075 | Ga0495624_0004285 | |||
| 3076 | Ga0495624_0009777 | |||
| 3077 | Ga0495624_0025490 | |||
| 3078 | Ga0495624_0191613 | |||
| 3079 | Ga0495624_0293753 | |||
| 3080 | Ga0495670_0006183 | |||
| 3081 | Ga0495670_0011261 | |||
| 3082 | Ga0495670_0053226 | |||
| 3083 | Ga0495671_0103138 | |||
| 3084 | Ga0495671_0282527 | |||
| 3085 | Ga0495671_0300985 | |||
| 3086 | Ga0495649_0205836 | |||
| 3087 | Ga0495589_0238258 | |||
| 3088 | Ga0495600_0000403 | |||
| 3089 | Ga0495600_0035078 | |||
| 3090 | Ga0495600_0083126 | |||
| 3091 | Ga0495600_0117057 | |||
| 3092 | Ga0495600_0121385 | |||
| 3093 | Ga0495600_0230472 | |||
| 3094 | Ga0495660_0095184 | |||
| 3095 | Ga0495660_0198100 | |||
| 3096 | Ga0495581_0001142 | |||
| 3097 | Ga0495581_0023132 | |||
| 3098 | Ga0495581_0030889 | |||
| 3099 | Ga0495581_0038552 | |||
| 3100 | Ga0495581_0073761 | |||
| 3101 | Ga0495581_0120561 | |||
| 3102 | Ga0495581_0257740 | |||
| 3103 | Ga0495604_0008342 | |||
| 3104 | Ga0495604_0035753 | |||
| 3105 | Ga0495604_0046930 | |||
| 3106 | Ga0495604_0121167 | |||
| 3107 | Ga0495604_0151753 | |||
| 3108 | Ga0495604_0162247 | |||
| 3109 | Ga0495604_0320768 | |||
| 3110 | Ga0495636_0054992 | |||
| 3111 | Ga0495674_0001977 | |||
| 3112 | Ga0495674_0005615 | |||
| 3113 | Ga0495674_0051155 | |||
| 3114 | Ga0495674_0068279 | |||
| 3115 | Ga0495674_0076517 | |||
| 3116 | Ga0495674_0085887 | |||
| 3117 | Ga0495674_0122252 | |||
| 3118 | Ga0495674_0591465 | |||
| 3119 | Ga0495672_0199407 | |||
| 3120 | Ga0495672_0365503 | |||
| 3121 | Ga0495676_0062775 | |||
| 3122 | Ga0495676_0065085 | |||
| 3123 | Ga0495676_0067422 | |||
| 3124 | Ga0495676_0087817 | |||
| 3125 | Ga0495676_0427750 | |||
| 3126 | Ga0495680_0051093 | |||
| 3127 | Ga0495680_0066841 | |||
| 3128 | Ga0495680_0088283 | |||
| 3129 | Ga0495680_0096285 | |||
| 3130 | Ga0495680_0194557 | |||
| 3131 | Ga0495680_0312293 | |||
| 3132 | Ga0495683_0099138 | |||
| 3133 | Ga0495675_0009532 | |||
| 3134 | Ga0495675_0159215 | |||
| 3135 | Ga0495675_0190637 | |||
| 3136 | Ga0495679_021704 | |||
| 3137 | Ga0495673_0021531 | |||
| 3138 | Ga0495673_0055161 | |||
| 3139 | Ga0495673_0120623 | |||
| 3140 | Ga0495673_0157876 | |||
| 3141 | Ga0495681_0188150 | |||
| 3142 | Ga0495684_0008846 | |||
| 3143 | Ga0495684_0012789 | |||
| 3144 | Ga0495684_0028651 | |||
| 3145 | Ga0495684_0030022 | |||
| 3146 | Ga0495684_0088669 | |||
| 3147 | Ga0495684_0089734 | |||
| 3148 | Ga0495684_0123166 | |||
| 3149 | Ga0495684_0146768 | |||
| 3150 | Ga0495684_0200470 | |||
| 3151 | Ga0495686_0021356 | |||
| 3152 | Ga0495686_0044707 | |||
| 3153 | Ga0495686_0124139 | |||
| 3154 | Ga0495593_0002128 | |||
| 3155 | Ga0495593_0023793 | |||
| 3156 | Ga0495593_0038236 | |||
| 3157 | Ga0495593_0100701 | |||
| 3158 | Ga0495593_0136478 | |||
| 3159 | Ga0495593_0362844 | |||
| 3160 | Ga0495602_0010811 | |||
| 3161 | Ga0495602_0023787 | |||
| 3162 | Ga0495602_0040943 | |||
| 3163 | Ga0495602_0043422 | |||
| 3164 | Ga0495602_0105087 | |||
| 3165 | Ga0495602_0244467 | |||
| 3166 | Ga0495614_0047880 | |||
| 3167 | Ga0495614_0214726 | |||
| 3168 | Ga0495615_0054260 | |||
| 3169 | Ga0495626_0140392 | |||
| 3170 | Ga0496100_0002855 | |||
| 3171 | Ga0496100_0042265 | |||
| 3172 | Ga0496100_0047384 | |||
| 3173 | Ga0496100_0140543 | |||
| 3174 | Ga0496100_0379039 | |||
| 3175 | Ga0496101_0015791 | |||
| 3176 | Ga0496101_0016053 | |||
| 3177 | Ga0496101_0095187 | |||
| 3178 | Ga0496101_0096186 | |||
| 3179 | Ga0496101_0098440 | |||
| 3180 | Ga0496101_0098933 | |||
| 3181 | Ga0496101_0183225 | |||
| 3182 | Ga0496102_0005213 | |||
| 3183 | Ga0496102_0007639 | |||
| 3184 | Ga0496102_0012393 | |||
| 3185 | Ga0496102_0069908 | |||
| 3186 | Ga0496102_0241013 | |||
| 3187 | Ga0496102_0252004 | |||
| 3188 | Ga0496102_0528521 | |||
| 3189 | Ga0496102_0989492 | |||
| 3190 | Ga0496103_0085102 | |||
| 3191 | Ga0496103_0240510 | |||
| 3192 | Ga0496104_0000430 | |||
| 3193 | Ga0496104_0007365 | |||
| 3194 | Ga0496104_0053657 | |||
| 3195 | Ga0496104_0093136 | |||
| 3196 | Ga0496104_0353377 | |||
| 3197 | Ga0496104_0624992 | |||
| 3198 | Ga0496105_0006356 | |||
| 3199 | Ga0496105_0008068 | |||
| 3200 | Ga0496105_0127066 | |||
| 3201 | Ga0496105_0210849 | |||
| 3202 | Ga0496105_0324191 | |||
| 3203 | Ga0496105_0512623 | |||
| 3204 | Ga0496106_0004759 | |||
| 3205 | Ga0496106_0005044 | |||
| 3206 | Ga0496106_0010296 | |||
| 3207 | Ga0496106_0039463 | |||
| 3208 | Ga0496106_0040831 | |||
| 3209 | Ga0496106_0071165 | |||
| 3210 | Ga0496106_0082059 | |||
| 3211 | Ga0496106_0203985 | |||
| 3212 | Ga0496106_0599825 | |||
| 3213 | Ga0496106_0623192 | |||
| 3214 | Ga0496106_0895237 | |||
| 3215 | Ga0496107_0003265 | |||
| 3216 | Ga0496107_0007983 | |||
| 3217 | Ga0496107_0185280 | |||
| 3218 | Ga0496107_0195536 | |||
| 3219 | Ga0496107_0559991 | |||
| 3220 | Ga0496107_0596536 | |||
| 3221 | Ga0496108_0000415 | |||
| 3222 | Ga0496108_0016710 | |||
| 3223 | Ga0496108_0038583 | |||
| 3224 | Ga0496108_0425765 | |||
| 3225 | Ga0496108_0533502 | |||
| 3226 | Ga0496108_0644101 | |||
| 3227 | Ga0496109_0000759 | |||
| 3228 | Ga0496109_0083699 | |||
| 3229 | Ga0496109_0130734 | |||
| 3230 | Ga0496109_0151320 | |||
| 3231 | Ga0496109_0169021 | |||
| 3232 | Ga0496109_0182669 | |||
| 3233 | Ga0496109_0350298 | |||
| 3234 | Ga0496109_0803604 | |||
| 3235 | Ga0496109_0867497 | |||
| 3236 | Ga0496110_0011522 | |||
| 3237 | Ga0496110_0116790 | |||
| 3238 | Ga0496110_0405130 | |||
| 3239 | Ga0496110_0595233 | |||
| 3240 | Ga0496110_0929396 | |||
| 3241 | Ga0496111_0021000 | |||
| 3242 | Ga0496111_0040423 | |||
| 3243 | Ga0496111_0123868 | |||
| 3244 | Ga0496111_0146765 | |||
| 3245 | Ga0496111_0164435 | |||
| 3246 | Ga0496111_0669021 | |||
| 3247 | Ga0496112_0000395 | |||
| 3248 | Ga0496112_0007176 | |||
| 3249 | Ga0496112_0007941 | |||
| 3250 | Ga0496112_0026148 | |||
| 3251 | Ga0496112_0034003 | |||
| 3252 | Ga0496112_0112166 | |||
| 3253 | Ga0496112_0114173 | |||
| 3254 | Ga0496112_0151150 | |||
| 3255 | Ga0496112_0159120 | |||
| 3256 | Ga0496112_0247957 | |||
| 3257 | Ga0496112_0275699 | |||
| 3258 | Ga0496112_0913407 | |||
| 3259 | Ga0496112_0919147 | |||
| 3260 | Ga0496113_0014638 | |||
| 3261 | Ga0496113_0071846 | |||
| 3262 | Ga0496113_0148522 | |||
| 3263 | Ga0496113_0153284 | |||
| 3264 | Ga0496113_0193833 | |||
| 3265 | Ga0496113_0310871 | |||
| 3266 | Ga0496113_0597296 | |||
| 3267 | Ga0496114_0024690 | |||
| 3268 | Ga0496114_0035096 | |||
| 3269 | Ga0496114_0057160 | |||
| 3270 | Ga0496114_0166942 | |||
| 3271 | Ga0496114_0184466 | |||
| 3272 | Ga0496114_0518833 | |||
| 3273 | Ga0496115_0018252 | |||
| 3274 | Ga0496115_0045970 | |||
| 3275 | Ga0496115_0046676 | |||
| 3276 | Ga0496115_0088598 | |||
| 3277 | Ga0496115_0097124 | |||
| 3278 | Ga0496115_0115409 | |||
| 3279 | Ga0496115_0137874 | |||
| 3280 | Ga0496115_0141228 | |||
| 3281 | Ga0496115_0142334 | |||
| 3282 | Ga0496115_0160388 | |||
| 3283 | Ga0496115_0231681 | |||
| 3284 | Ga0496115_0349881 | |||
| 3285 | Ga0496115_0353479 | |||
| 3286 | Ga0496115_0439855 | |||
| 3287 | Ga0496116_0006156 | |||
| 3288 | Ga0496116_0233374 | |||
| 3289 | Ga0496117_0068124 | |||
| 3290 | Ga0496117_0119765 | |||
| 3291 | Ga0496117_0211179 | |||
| 3292 | Ga0496117_0219237 | |||
| 3293 | Ga0496117_0403043 | |||
| 3294 | Ga0496118_0002114 | |||
| 3295 | Ga0496118_0017746 | |||
| 3296 | Ga0496118_0059322 | |||
| 3297 | Ga0496118_0095751 | |||
| 3298 | Ga0496118_0136249 | |||
| 3299 | Ga0496118_0190857 | |||
| 3300 | Ga0496118_0372962 | |||
| 3301 | Ga0496119_0014065 | |||
| 3302 | Ga0496119_0065340 | |||
| 3303 | Ga0496119_0158362 | |||
| 3304 | Ga0496120_0005770 | |||
| 3305 | Ga0496120_0012705 | |||
| 3306 | Ga0496120_0028452 | |||
| 3307 | Ga0496120_0032671 | |||
| 3308 | Ga0496121_0000757 | |||
| 3309 | Ga0496121_0004207 | |||
| 3310 | Ga0496121_0015422 | |||
| 3311 | Ga0496121_0031249 | |||
| 3312 | Ga0496121_0073180 | |||
| 3313 | Ga0496121_0082803 | |||
| 3314 | Ga0496121_0110003 | |||
| 3315 | Ga0496121_0120484 | |||
| 3316 | Ga0496121_0168711 | |||
| 3317 | Ga0496121_0198829 | |||
| 3318 | Ga0496121_0474169 | |||
| 3319 | Ga0496122_0086710 | |||
| 3320 | Ga0496122_0166513 | |||
| 3321 | Ga0496122_0319840 | |||
| 3322 | Ga0496123_0270040 | |||
| 3323 | Ga0496124_0003589 | |||
| 3324 | Ga0496124_0039448 | |||
| 3325 | Ga0496124_0053586 | |||
| 3326 | Ga0496124_0135858 | |||
| 3327 | Ga0496124_0153877 | |||
| 3328 | Ga0496124_0233608 | |||
| 3329 | Ga0496124_0235195 | |||
| 3330 | Ga0496124_0402208 | |||
| 3331 | Ga0496125_0000040 | |||
| 3332 | Ga0496125_0001136 | |||
| 3333 | Ga0496125_0003959 | |||
| 3334 | Ga0496125_0042098 | |||
| 3335 | Ga0496125_0052681 | |||
| 3336 | Ga0496125_0063656 | |||
| 3337 | Ga0496125_0145890 | |||
| 3338 | Ga0496126_0003396 | |||
| 3339 | Ga0496126_0013933 | |||
| 3340 | Ga0496126_0013959 | |||
| 3341 | Ga0496126_0025615 | |||
| 3342 | Ga0496126_0035100 | |||
| 3343 | Ga0496126_0037427 | |||
| 3344 | Ga0496126_0038017 | |||
| 3345 | Ga0496126_0043788 | |||
| 3346 | Ga0496126_0045586 | |||
| 3347 | Ga0496126_0050525 | |||
| 3348 | Ga0496126_0059106 | |||
| 3349 | Ga0496126_0069156 | |||
| 3350 | Ga0496126_0167945 | |||
| 3351 | Ga0496126_0290181 | |||
| 3352 | Ga0496126_0311322 | |||
| 3353 | Ga0496126_0390100 | |||
| 3354 | Ga0496126_0440703 | |||
| 3355 | Ga0496126_0460271 | |||
| 3356 | Ga0496126_0637004 | |||
| 3357 | Ga0495682_0107319 | |||
| 3358 | Ga0501031_0002124 | |||
| 3359 | Ga0501031_0008325 | |||
| 3360 | Ga0501031_0139601 | |||
| 3361 | Ga0501031_0376312 | |||
| 3362 | Ga0501032_0000038 | |||
| 3363 | Ga0501032_0028464 | |||
| 3364 | Ga0501032_0082953 | |||
| 3365 | Ga0501032_0119004 | |||
| 3366 | Ga0501032_0135729 | |||
| 3367 | Ga0501032_0157737 | |||
| 3368 | Ga0501033_0000089 | |||
| 3369 | Ga0501033_0002894 | |||
| 3370 | Ga0501033_0049416 | |||
| 3371 | Ga0501033_0102775 | |||
| 3372 | Ga0501034_0000228 | |||
| 3373 | Ga0501034_0087402 | |||
| 3374 | Ga0501034_0150448 | |||
| 3375 | Ga0501034_0220023 | |||
| 3376 | Ga0501034_0546874 | |||
| 3377 | Ga0501034_1376430 | |||
| 3378 | Ga0501036_0000010 | |||
| 3379 | Ga0501036_0008070 | |||
| 3380 | Ga0501036_0039089 | |||
| 3381 | Ga0501036_0242568 | |||
| 3382 | Ga0501036_0337991 | |||
| 3383 | Ga0501037_0000291 | |||
| 3384 | Ga0501037_0004166 | |||
| 3385 | Ga0501037_0016257 | |||
| 3386 | Ga0501037_0082090 | |||
| 3387 | Ga0501037_0234471 | |||
| 3388 | Ga0501037_0281080 | |||
| 3389 | Ga0501038_0000079 | |||
| 3390 | Ga0501038_0004207 | |||
| 3391 | Ga0501038_0062627 | |||
| 3392 | Ga0501038_0155624 | |||
| 3393 | Ga0501039_0000616 | |||
| 3394 | Ga0501039_0098010 | |||
| 3395 | Ga0501039_0101672 | |||
| 3396 | Ga0501039_0135675 | |||
| 3397 | Ga0501039_0356401 | |||
| 3398 | Ga0501039_0374429 | |||
| 3399 | Ga0501040_0064753 | |||
| 3400 | Ga0501040_0561457 | |||
| 3401 | Ga0501041_0012042 | |||
| 3402 | Ga0501042_0033727 | |||
| 3403 | Ga0501042_0041964 | |||
| 3404 | Ga0501043_0000021 | |||
| 3405 | Ga0501043_0001791 | |||
| 3406 | Ga0501043_0064821 | |||
| 3407 | Ga0501043_0186532 | |||
| 3408 | Ga0501046_0007870 | |||
| 3409 | Ga0501046_0047846 | |||
| 3410 | Ga0501046_0049136 | |||
| 3411 | Ga0501046_0049725 | |||
| 3412 | Ga0501047_0000041 | |||
| 3413 | Ga0501047_0005405 | |||
| 3414 | Ga0501047_0009705 | |||
| 3415 | Ga0501047_0276250 | |||
| 3416 | Ga0501047_1016290 | |||
| 3417 | Ga0501048_0000954 | |||
| 3418 | Ga0501048_0282071 | |||
| 3419 | Ga0501067_0002094 | |||
| 3420 | Ga0501067_0136139 | |||
| 3421 | Ga0501067_0242274 | |||
| 3422 | Ga0501068_0000285 | |||
| 3423 | Ga0501069_0001245 | |||
| 3424 | Ga0501070_0000986 | |||
| 3425 | Ga0501070_0032489 | |||
| 3426 | Ga0501070_0046634 | |||
| 3427 | Ga0501070_0096975 | |||
| 3428 | Ga0501070_0099496 | |||
| 3429 | Ga0501070_0185663 | |||
| 3430 | Ga0501070_0273258 | |||
| 3431 | Ga0501070_0444298 | |||
| 3432 | Ga0501070_0540698 | |||
| 3433 | Ga0501071_0045361 | |||
| 3434 | Ga0501071_0290752 | |||
| 3435 | Ga0501071_0391018 | |||
| 3436 | Ga0501072_0005779 | |||
| 3437 | Ga0501072_0180503 | |||
| 3438 | Ga0501073_0000056 | |||
| 3439 | Ga0501073_0016826 | |||
| 3440 | Ga0501073_0093902 | |||
| 3441 | Ga0501073_0110358 | |||
| 3442 | Ga0501073_0284012 | |||
| 3443 | Ga0501074_0012527 | |||
| 3444 | Ga0501074_0157621 | |||
| 3445 | Ga0501075_0049286 | |||
| 3446 | Ga0501076_0089107 | |||
| 3447 | Ga0501076_0123182 | |||
| 3448 | Ga0501076_0160716 | |||
| 3449 | Ga0501077_0111099 | |||
| 3450 | Ga0501079_0001576 | |||
| 3451 | Ga0501079_0072750 | |||
| 3452 | Ga0501079_0372469 | |||
| 3453 | Ga0501080_0000138 | |||
| 3454 | Ga0501080_0002680 | |||
| 3455 | Ga0501080_0098917 | |||
| 3456 | Ga0501080_0124121 | |||
| 3457 | Ga0501081_0171374 | |||
| 3458 | Ga0501081_0225316 | |||
| 3459 | Ga0501081_0316717 | |||
| 3460 | Ga0501083_0004205 | |||
| 3461 | Ga0501083_0653481 | |||
| 3462 | Ga0501035_0000090 | |||
| 3463 | Ga0501035_0002286 | |||
| 3464 | Ga0501035_0020636 | |||
| 3465 | Ga0501035_0144468 | |||
| 3466 | Ga0501035_0155850 | |||
| 3467 | Ga0501035_0300437 | |||
| 3468 | Ga0501044_0000054 | |||
| 3469 | Ga0501044_0007477 | |||
| 3470 | Ga0501044_0009233 | |||
| 3471 | Ga0501044_0012007 | |||
| 3472 | Ga0501044_0040797 | |||
| 3473 | Ga0501044_0047391 | |||
| 3474 | Ga0501044_0763856 | |||
| 3475 | Ga0501044_1012238 | |||
| 3476 | Ga0501045_0009955 | |||
| 3477 | nmdc:mga03683_127332_c1 | |||
| 3478 | nmdc:mga00v17_296349_c1 | |||
| 3479 | nmdc:mga00v17_39451_c1 | |||
| 3480 | nmdc:mga00v17_558537_c1 | |||
| 3481 | nmdc:mga0yw44_114759_c1 | |||
| 3482 | nmdc:mga0yw44_22683_c1 | |||
| 3483 | nmdc:mga0yw44_49085_c1 | |||
| 3484 | nmdc:mga0yw44_57354_c1 | |||
| 3485 | nmdc:mga0yw44_609607_c1 | |||
| 3486 | nmdc:mga0k408_161280_c1 | |||
| 3487 | nmdc:mga0k408_23701_c1 | |||
| 3488 | nmdc:mga0k408_36679_c1 | |||
| 3489 | nmdc:mga06z11_155886_c1 | |||
| 3490 | nmdc:mga06z11_189978_c1 | |||
| 3491 | nmdc:mga06z11_318008_c1 | |||
| 3492 | nmdc:mga06z11_536761_c1 | |||
| 3493 | nmdc:mga04h51_42650_c1 | |||
| 3494 | nmdc:mga07m45_286075_c1 | |||
| 3495 | nmdc:mga05p37_101287_c1 | |||
| 3496 | nmdc:mga09592_823386_c1 | |||
| 3497 | nmdc:mga08y16_410602_c1 | |||
| 3498 | nmdc:mga0n895_643034_c1 | |||
| 3499 | nmdc:mga0n895_9544_c1 | |||
| 3500 | nmdc:mga0rr50_200319_c1 | |||
| 3501 | nmdc:mga0sz30_12372_c1 | |||
| 3502 | nmdc:mga0sz30_145119_c1 | |||
| 3503 | nmdc:mga0sz30_20885_c1 | |||
| 3504 | nmdc:mga0sz30_2684_c1 | |||
| 3505 | Ga0495601_0014255 | |||
| 3506 | Ga0495601_0014406 | |||
| 3507 | Ga0495601_0021028 | |||
| 3508 | Ga0495601_0028181 | |||
| 3509 | Ga0495601_0066479 | |||
| 3510 | Ga0495601_0087185 | |||
| 3511 | Ga0495601_0135398 | |||
| 3512 | Ga0495601_0230024 | |||
| 3513 | Ga0495612_0002731 | |||
| 3514 | Ga0495612_0014294 | |||
| 3515 | Ga0495612_0017545 | |||
| 3516 | Ga0495612_0145512 | |||
| 3517 | Ga0500635_0000944 | |||
| 3518 | Ga0500635_0053833 | |||
| 3519 | Ga0500635_0079162 | |||
| 3520 | Ga0495655_0005420 | |||
| 3521 | Ga0495655_0039823 | |||
| 3522 | Ga0495655_0065830 | |||
| 3523 | Ga0495655_0104343 | |||
| 3524 | Ga0495595_0014428 | |||
| 3525 | Ga0495595_0033631 | |||
| 3526 | Ga0495595_0043440 | |||
| 3527 | Ga0495595_0050144 | |||
| 3528 | Ga0495595_0060800 | |||
| 3529 | Ga0495595_0123497 | |||
| 3530 | Ga0495595_0349589 | |||
| 3531 | Ga0495619_0004650 | |||
| 3532 | Ga0495619_0016517 | |||
| 3533 | Ga0495619_0034063 | |||
| 3534 | Ga0495619_0035905 | |||
| 3535 | Ga0495619_0060466 | |||
| 3536 | Ga0495619_0127222 | |||
| 3537 | Ga0495619_0213764 | |||
| 3538 | Ga0495619_0285506 | |||
| 3539 | Ga0500643_000046 | |||
| 3540 | Ga0500646_0043306 | |||
| 3541 | Ga0500647_0083784 | |||
| 3542 | Ga0500647_0085903 | |||
| 3543 | Ga0500583_0354619 | |||
| 3544 | Ga0500651_0305123 | |||
| 3545 | Ga0500651_0488885 | |||
| 3546 | Ga0500566_0000048 | |||
| 3547 | Ga0500566_0000301 | |||
| 3548 | Ga0500566_0011657 | |||
| 3549 | Ga0500566_0013839 | |||
| 3550 | Ga0500566_0237222 | |||
| 3551 | Ga0500566_0347518 | |||
| 3552 | Ga0500640_098561 | |||
| 3553 | Ga0500641_0034171 | |||
| 3554 | Ga0500641_0047575 | |||
| 3555 | Ga0500650_0005800 | |||
| 3556 | Ga0500650_0150337 | |||
| 3557 | Ga0500554_005519 | |||
| 3558 | Ga0500554_029673 | |||
| 3559 | Ga0500556_0000002 | |||
| 3560 | Ga0500557_000020 | |||
| 3561 | Ga0500562_008283 | |||
| 3562 | Ga0500562_015687 | |||
| 3563 | Ga0500569_066803 | |||
| 3564 | Ga0500572_000045 | |||
| 3565 | Ga0500572_000352 | |||
| 3566 | Ga0500572_002884 | |||
| 3567 | Ga0500591_003235 | |||
| 3568 | Ga0500594_0007961 | |||
| 3569 | Ga0500595_000494 | |||
| 3570 | Ga0500595_007040 | |||
| 3571 | Ga0500595_010569 | |||
| 3572 | Ga0500595_024432 | |||
| 3573 | Ga0500595_031885 | |||
| 3574 | Ga0500595_064396 | |||
| 3575 | Ga0500607_007093 | |||
| 3576 | Ga0500608_023055 | |||
| 3577 | Ga0500608_039133 | |||
| 3578 | Ga0500608_069772 | |||
| 3579 | Ga0500608_221563 | |||
| 3580 | Ga0500614_021046 | |||
| 3581 | Ga0500621_157692 | |||
| 3582 | Ga0500642_0000034 | |||
| 3583 | Ga0500642_0015211 | |||
| 3584 | Ga0500652_001231 | |||
| 3585 | Ga0500652_149629 | |||
| 3586 | Ga0500655_010901 | |||
| 3587 | Ga0500658_0139804 | |||
| 3588 | Ga0500658_0248892 | |||
| 3589 | Ga0500559_0000099 | |||
| 3590 | Ga0500559_0002781 | |||
| 3591 | Ga0500559_0003698 | |||
| 3592 | Ga0500559_0095821 | |||
| 3593 | Ga0500559_0260022 | |||
| 3594 | Ga0500568_0000842 | |||
| 3595 | Ga0500568_0037159 | |||
| 3596 | Ga0500577_0000025 | |||
| 3597 | Ga0500577_0118557 | |||
| 3598 | Ga0500585_150398 | |||
| 3599 | Ga0500586_002721 | |||
| 3600 | Ga0500590_105171 | |||
| 3601 | Ga0500603_000041 | |||
| 3602 | Ga0500603_000138 | |||
| 3603 | Ga0500604_0007816 | |||
| 3604 | Ga0500616_0000061 | |||
| 3605 | Ga0500619_108561 | |||
| 3606 | Ga0500619_163128 | |||
| 3607 | Ga0500622_0004044 | |||
| 3608 | Ga0500622_0229354 | |||
| 3609 | Ga0500627_0030358 | |||
| 3610 | Ga0500627_0191005 | |||
| 3611 | Ga0500627_0291107 | |||
| 3612 | Ga0500630_001433 | |||
| 3613 | Ga0500633_0083897 | |||
| 3614 | Ga0500633_0097215 | |||
| 3615 | Ga0500638_030569 | |||
| 3616 | Ga0500638_037572 | |||
| 3617 | Ga0500638_048930 | |||
| 3618 | Ga0500638_084347 | |||
| 3619 | Ga0500638_131854 | |||
| 3620 | Ga0500639_000228 | |||
| 3621 | Ga0500636_0000173 | |||
| 3622 | Ga0500636_0002921 | |||
| 3623 | Ga0500636_0021705 | |||
| 3624 | Ga0500636_0247951 | |||
| 3625 | Ga0500637_0000162 | |||
| 3626 | Ga0500637_0000555 | |||
| 3627 | Ga0500637_0028427 | |||
| 3628 | Ga0500576_053151 | |||
| 3629 | Ga0500576_094469 | |||
| 3630 | Ga0500625_018970 | |||
| 3631 | Ga0500609_002640 | |||
| 3632 | Ga0500596_002664 | |||
| 3633 | Ga0500596_005590 | |||
| 3634 | Ga0500601_000334 | |||
| 3635 | Ga0500601_008059 | |||
| 3636 | Ga0501084_0001679 | |||
| 3637 | Ga0501084_0079171 | |||
| 3638 | Ga0500661_000236 | |||
| 3639 | Ga0501082_0006099 | |||
| 3640 | Ga0501082_0354716 | |||
| 3641 | Ga0501082_0461790 | |||
| 3642 | 2507507824 | |||
| 3643 | 2508541935 | |||
| 3644 | 2508692516 | |||
| 3645 | 2509153339 | |||
| 3646 | 2511397360 | |||
| 3647 | 2513622895 | |||
| 3648 | 2513639271 | |||
| 3649 | 2513647364 | |||
| 3650 | 2513653952 | |||
| 3651 | 2513676224 | |||
| 3652 | 2513695767 | |||
| 3653 | 2513700875 | |||
| 3654 | 2513856386 | |||
| 3655 | 2513878214 | |||
| 3656 | 2513891415 | |||
| 3657 | 2513918292 | |||
| 3658 | 2514009595 | |||
| 3659 | 2515626732 | |||
| 3660 | 2517103987 | |||
| 3661 | 2517891478 | |||
| 3662 | 2524436413 | |||
| 3663 | 2524470318 | |||
| 3664 | 2524538341 | |||
| 3665 | 2528852615 | |||
| 3666 | 2603861475 | |||
| 3667 | 2617346632 | |||
| 3668 | 2617372567 | |||
| 3669 | 2671118756 | |||
| 3670 | 2723847217 | |||
| 3671 | 2728754857 | |||
| 3672 | 2745080633 | |||
| 3673 | 2793064509 | |||
| 3674 | 2793066846 | |||
| 3675 | 2793084175 | |||
| 3676 | 2805919219 | |||
| 3677 | 2818236401 | |||
| 3678 | 2824605400 | |||
| 3679 | 2824613572 | |||
| 3680 | 2824621435 | |||
| 3681 | 2824630504 | |||
| 3682 | 2824638795 | |||
| 3683 | 2824648624 | |||
| 3684 | 2824657620 | |||
| 3685 | 2824668093 | |||
| 3686 | 2824675939 | |||
| 3687 | 2824683049 | |||
| 3688 | 2824692134 | |||
| 3689 | 2824704498 | |||
| 3690 | 2824710310 | |||
| 3691 | 2824718500 | |||
| 3692 | 2824726234 | |||
| 3693 | 2824735796 | |||
| 3694 | 2824747003 | |||
| 3695 | 2824755620 | |||
| 3696 | 2824766283 | |||
| 3697 | 2824777383 | |||
| 3698 | 2838128955 | |||
| 3699 | 2841944889 | |||
| 3700 | 2841953315 | |||
| 3701 | 2841959839 | |||
| 3702 | 2841972205 | |||
| 3703 | 2841978040 | |||
| 3704 | 2841986330 | |||
| 3705 | 2842040489 | |||
| 3706 | 2842046566 | |||
| 3707 | 2844319873 | |||
| 3708 | 2847937191 | |||
| 3709 | 2847947576 | |||
| 3710 | 2849078548 | |||
| 3711 | 2857512909 | |||
| 3712 | 2857528415 | |||
| 3713 | 2874598933 | |||
| 3714 | 2874611020 | |||
| 3715 | 2874614742 | |||
| 3716 | 2874622255 | |||
| 3717 | 2874635178 | |||
| 3718 | 2874650618 | |||
| 3719 | 2876764172 | |||
| 3720 | 2876778972 | |||
| 3721 | 2876814488 | |||
| 3722 | 2876824133 | |||
| 3723 | 2879082765 | |||
| 3724 | 2879089144 | |||
| 3725 | 2879105617 | |||
| 3726 | 2879114587 | |||
| 3727 | 2879132073 | |||
| 3728 | 2879148400 | |||
| 3729 | 2881364791 | |||
| 3730 | 2881671904 | |||
| 3731 | 2885369808 | |||
| 3732 | 2885377817 | |||
| 3733 | 2885390305 | |||
| 3734 | 2885412342 | |||
| 3735 | 2888385299 | |||
| 3736 | 2888392948 | |||
| 3737 | 2888425449 | |||
| 3738 | 2889038155 | |||
| 3739 | 2893068822 | |||
| 3740 | 2903730456 | |||
| 3741 | 2903758740 | |||
| 3742 | 2904667866 | |||
| 3743 | 2904691330 | |||
| 3744 | 2904704823 | |||
| 3745 | 2904712134 | |||
| 3746 | 2906609745 | |||
| 3747 | 2906616654 | |||
| 3748 | 2906632375 | |||
| 3749 | 2906643710 | |||
| 3750 | 2906646971 | |||
| 3751 | 2906666981 | |||
| 3752 | 2908741820 | |||
| 3753 | 2908759026 | |||
| 3754 | 2908781016 | |||
| 3755 | 2922368548 | |||
| 3756 | 2922372597 | |||
| 3757 | 2922387476 | |||
| 3758 | 2922397224 | |||
| 3759 | 2922431323 | |||
| 3760 | 2929620408 | |||
| 3761 | 2929626301 | |||
| 3762 | 2932784823 | |||
| 3763 | 2932795299 | |||
| 3764 | 2932805827 | |||
| 3765 | 2932805831 | |||
| 3766 | 2932809856 | |||
| 3767 | 2932818400 | |||
| 3768 | 2932828659 | |||
| 3769 | 2933582326 | |||
| 3770 | 2935609683 | |||
| 3771 | 2935619919 | |||
| 3772 | 2935633915 | |||
| 3773 | 2935638902 | |||
| 3774 | 2935652172 | |||
| 3775 | 2935660754 | |||
| 3776 | 2935666247 | |||
| 3777 | 2935676707 | |||
| 3778 | 2935685096 | |||
| 3779 | 2935694785 | |||
| 3780 | 2935703908 | |||
| 3781 | 2935713649 | |||
| 3782 | 2935724269 | |||
| 3783 | 2935733373 | |||
| 3784 | 2935742752 | |||
| 3785 | 2935751061 | |||
| 3786 | 2935760416 | |||
| 3787 | 2935772082 | |||
| 3788 | 2935784259 | |||
| 3789 | 2935787531 | |||
| 3790 | 2935796162 | |||
| 3791 | 2935802044 | |||
| 3792 | 2935810813 | |||
| 3793 | 2935822845 | |||
| 3794 | 2935828396 | |||
| 3795 | 2935839811 | |||
| 3796 | 2935848427 | |||
| 3797 | 2935857766 | |||
| 3798 | 2935868893 | |||
| 3799 | 2935874308 | |||
| 3800 | 2935883804 | |||
| 3801 | 2935909768 | |||
| 3802 | 2935917493 | |||
| 3803 | 2935927249 | |||
| 3804 | 2935936907 | |||
| 3805 | 2935944790 | |||
| 3806 | 2935953227 | |||
| 3807 | 2935961270 | |||
| 3808 | 2935970067 | |||
| 3809 | 2935980375 | |||
| 3810 | 2935986638 | |||
| 3811 | 2935992766 | |||
| 3812 | 2936002679 | |||
| 3813 | 2936014810 | |||
| 3814 | 2936022209 | |||
| 3815 | 2936032897 | |||
| 3816 | 2936037767 | |||
| 3817 | 2936050551 | |||
| 3818 | 2936059673 | |||
| 3819 | 2940558136 | |||
| 3820 | 2941510782 | |||
| 3821 | 2941518166 | |||
| 3822 | 2941526963 | |||
| 3823 | 2941531060 | |||
| 3824 | 2941540848 | |||
| 3825 | 3005481117 | |||
| 3826 | 3005484948 | |||
| 3827 | 3005508574 | |||
| 3828 | 3005587223 | |||
| 3829 | 3005600144 | |||
| 3830 | 3005715668 | |||
| 3831 | 3005723002 | |||
| 3832 | 8006927856 | |||
| 3833 | 8006939592 | |||
| 3834 | 8006968413 | |||
| 3835 | 8006979343 | |||
| 3836 | 8006989238 | |||
| 3837 | 8006994849 | |||
| 3838 | 8016520826 | |||
| 3839 | 8016534026 | |||
| 3840 | 8016547250 | |||
| 3841 | 8016554881 | |||
| 3842 | 8016563246 | |||
| 3843 | 8016576544 | |||
| 3844 | 8016594119 | |||
| 3845 | 8016601002 | |||
| 3846 | 8016609458 | |||
| 3847 | 8016615449 | |||
| 3848 | 8016625766 | |||
| 3849 | 8016639342 | |||
| 3850 | 8017064764 | |||
| 3851 | 8019533793 | |||
| 3852 | 8019545872 | |||
| 3853 | 8019552853 | |||
| 3854 | 8019565485 | |||
| 3855 | 8019575580 | |||
| 3856 | 8019584137 | |||
| 3857 | 8019591894 | |||
| 3858 | 8019599389 | |||
| 3859 | 8019608968 | |||
| 3860 | 8019619636 | |||
| 3861 | 8019633477 | |||
| 3862 | 8019646420 | |||
| 3863 | 8019649181 | |||
| 3864 | 8019661362 | |||
| 3865 | 8019670903 | |||
| 3866 | 8019685292 | |||
| 3867 | 8019690915 | |||
| 3868 | 8055745270 | |||
| 3869 | 8056679421 | |||
| 3870 | 8056684934 | |||
| 3871 | 8056693439 | |||
| 3872 | 8056968893 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xbz-assembly1.cif.gz_A-2 | multiple oligomeric forms of the pseudomonas aeruginosa rets sensor domain modulate accessibility to the ligand-binding site | 0.7039 | 67 | 159 |
| 3u07-assembly2.cif.gz_B | crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. | 0.7036 | 30 | 190 |
| 3u07-assembly3.cif.gz_C | crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. | 0.647 | 25 | 195 |
| 3vb9-assembly2.cif.gz_D | crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 | 0.6456 | 62 | 185 |
| 6ans-assembly2.cif.gz_B | crystal structure of a putative uncharacterized protein from burkholderia cenocepacia | 0.6228 | 36 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xbzA00 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6896 | 67 | 159 | 2.60.40.2380 |
| 3vb9A03 | Mainly Beta;Sandwich;Immunoglobulin-like;Domain of unknown function DUF1254 | 0.6332 | 59 | 187 | 2.60.40.1610 |
| af_A4I6N5_36_210_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.6174 | 67 | 156 | 2.60.120.10 |
| af_Q22824_286_380_3.40.525.10 | Alpha Beta;3-Layer(aba) Sandwich;Phosphatidylinositol Transfer Protein Sec14p;CRAL-TRIO lipid binding domain | 0.6074 | 68 | 156 | 3.40.525.10 |
| af_G5EFZ0_141_266_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6059 | 66 | 159 | 2.60.120.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317HX26-F1-model_v4 | deleted | 0.9322 | 60 | 180 |
|
| AF-H0SW22-F1-model_v4 | DUF1254 domain-containing protein | 0.9035 | 40 | 190 |
|
| AF-A0A317HX26-F1-model_v4 | deleted | 0.8965 | 60 | 180 |
|
| AF-A0A4Q3YGK8-F1-model_v4 | DUF1254 domain-containing protein | 0.8929 | 64 | 182 |
|
| AF-A0A4Q3YGK8-F1-model_v4 | DUF1254 domain-containing protein | 0.8723 | 64 | 182 |
|