F496103

General Info

Members Datasets Scaffolds Average Seq Length
1938 767 1692 371

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8006964411|8006965006
Length 436
Sequence SMLTASFRVRLEVILKSGNFLNRKLARRYQLWLVRDRFDKAIRRAEPGVSQRYRPRVGIVSGDPTLERIARGNGLALCAAGSWTARFAPVLERMVADAEKLSGTRPNILIDVSQVSKLDTFGAWLIERLRRSLTQGGIEAQIAGLSANYSSLVDEVRRVKAEPIIETDRVTITGILDQIGRAVASIGGTLIGLIDMLGAVLAAAAHVLIRPRNFRLTSTIHHLEQVCWRAVPIVVLITFLIGCIISQQGIFHFRKFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRTMGFDPIEVLILPRMLALVLALPILAFLGAMAALYGGGLVAWLYGGVEPEAFLLRLRDAISIDHFIVGLIKAPVMAAVIGIVACVEGLAVQGSAESLGQHTTSSVVKGIFFVIVMDGVFAIFFASIGM

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
27 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
28 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
29 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
30 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
31 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
32 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
33 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
34 2643221651 Afipia sp. Root123D2 Isolate Unclassified
35 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
36 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
37 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
38 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
39 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
40 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
41 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
42 2791355199
43 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
46 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
47 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
48 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
49 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
50 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
51 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
52 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
53 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
54 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
55 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
56 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
57 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
58 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
59 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
60 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
61 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
62 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
63 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
64 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
65 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
66 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
67 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
68 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
69 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
70 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
71 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
72 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
73 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
74 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
75 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
76 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
77 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
78 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
79 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
80 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
81 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
82 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
83 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
84 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
85 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
86 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
87 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
88 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
89 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
90 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
91 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
92 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
93 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
94 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
95 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
96 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
97 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
98 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
99 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
100 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
101 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
102 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
103 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
104 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
105 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
106 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
107 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
108 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
109 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
110 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
111 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
112 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
113 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
114 2904699407
115 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
116 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
117 2906610324
118 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
119 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
120 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
121 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
122 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
123 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
124 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
125 2909042592 Labrys sp. LIt4 Isolate Nodule
126 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
127 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
128 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
129 2922368715
130 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
131 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
132 2922425934
133 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
134 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
135 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
136 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
137 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
138 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
139 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
140 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
141 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
142 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
143 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
144 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
145 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
146 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
147 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
148 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
149 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
150 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
151 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
152 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
153 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
154 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
155 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
156 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
157 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
158 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
159 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
160 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
161 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
162 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
163 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
164 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
165 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
166 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
167 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
168 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
169 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
170 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
171 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
172 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
173 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
174 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
175 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
176 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
177 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
178 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
179 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
180 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
181 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
182 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
183 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
184 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
185 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
186 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
187 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
188 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
189 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
190 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
191 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
192 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
193 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
194 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
195 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
196 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
197 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
198 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
199 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
200 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
201 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
202 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
203 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
204 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
205 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
206 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
207 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
208 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
209 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
210 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
211 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
212 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
213 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
214 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
215 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
216 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
217 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
218 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
219 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
220 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
221 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
222 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
223 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
224 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
225 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
226 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
227 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
228 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
229 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
230 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
231 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
232 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
233 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
234 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
235 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
236 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
237 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
238 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
239 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
240 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
241 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
242 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
243 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
244 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
245 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
246 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
247 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
248 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
249 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
250 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
251 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
252 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
253 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
254 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
255 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
256 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
257 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
258 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
259 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
260 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
261 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
262 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
263 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
264 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
265 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
266 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
267 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
268 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
269 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
270 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
271 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
272 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
273 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
274 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
275 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
276 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
277 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
278 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
279 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
280 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
281 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
282 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
283 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
284 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
285 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
286 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
287 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
288 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
289 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
290 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
291 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
292 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
293 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
294 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
295 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
296 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
297 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
298 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
299 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
300 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
301 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
302 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
303 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
304 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
305 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
306 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
307 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
308 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
309 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
310 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
311 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
312 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
313 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
314 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
315 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
316 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
317 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
318 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
319 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
320 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
321 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
322 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
323 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
324 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
325 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
326 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
327 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
328 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
329 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
330 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
331 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
332 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
333 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
334 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
335 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
336 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
337 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
338 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
339 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
340 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
341 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
342 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
343 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
344 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
345 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
346 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
347 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
348 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
349 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
350 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
351 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
352 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
353 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
354 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
355 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
356 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
357 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
358 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
359 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
360 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
361 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
362 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
363 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
364 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
365 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
366 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
367 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
368 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
369 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
372 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
374 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
376 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
377 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
378 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
443 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
444 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
445 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
446 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
447 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
448 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
449 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
451 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
452 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
453 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
457 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
458 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
459 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
460 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
461 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
462 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
463 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
464 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
465 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
466 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
467 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
468 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
469 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
470 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
471 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
472 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
473 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
474 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
475 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
476 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
477 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
478 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
479 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
480 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
481 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
482 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
483 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
484 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
485 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
486 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
487 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
488 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
489 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
490 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
491 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
492 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
493 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
494 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
495 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
496 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
497 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
498 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
499 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
500 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
501 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
502 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
503 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
504 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
505 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
506 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
507 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
508 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
509 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
510 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
511 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
512 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
513 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
514 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
515 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
516 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
517 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
518 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
519 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
520 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
521 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
522 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
523 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
524 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
525 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
526 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
527 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
528 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
529 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
530 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
531 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
532 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
533 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
534 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
535 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
536 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
537 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
538 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
539 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
540 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
541 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
542 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
543 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
544 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
545 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
546 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
547 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
548 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
549 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
550 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
551 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
552 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
553 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
554 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
555 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
556 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
557 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
558 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
559 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
560 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
561 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
562 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
563 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
564 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
565 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
566 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
567 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
568 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
569 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
570 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
571 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
572 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
573 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
574 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
575 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
576 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
577 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
578 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
579 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
580 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
581 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
582 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
583 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
584 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
585 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
586 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
587 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
588 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
589 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
590 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
591 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
592 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
593 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
594 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
595 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
596 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
597 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
598 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
599 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
600 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
601 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
602 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
603 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
604 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
605 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
606 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
607 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
608 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
609 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
610 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
611 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
612 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
613 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
614 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
615 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
616 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
617 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
618 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
619 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
620 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
621 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
622 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
623 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
624 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
625 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
626 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
627 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
628 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
629 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
630 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
631 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
632 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
633 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
634 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
635 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
636 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
637 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
638 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
639 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
640 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
641 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
642 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
643 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
644 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
645 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
649 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
650 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
651 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
653 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
658 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
659 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
660 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
661 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
662 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
663 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
664 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
665 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
666 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
667 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
668 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
669 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
670 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
671 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
672 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
674 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
675 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
676 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
677 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
678 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
679 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
680 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
681 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
682 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
683 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
684 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
685 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
686 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
687 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
688 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
689 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
690 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
691 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
692 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
693 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
694 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
695 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
696 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
697 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
698 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
699 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
700 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
701 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
702 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
703 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
704 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
705 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
706 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
707 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
708 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
709 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
710 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
711 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
712 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
713 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
714 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
715 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
716 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
717 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
718 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
719 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
720 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
721 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
722 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
723 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
724 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
725 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
726 641522639 Methylobacterium sp. 4-46 Isolate Nodule
727 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
728 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
729 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
730 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
731 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
732 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
733 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
734 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
735 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
736 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
737 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
738 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
739 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
740 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
741 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
742 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
743 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
744 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
745 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
746 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
747 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
748 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
749 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
750 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
751 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
752 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
753 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
754 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
755 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
756 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
757 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
758 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
759 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
760 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
761 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
762 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
763 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
764 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
765 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
766 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
767 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.53
Metatranscriptomes 0
Isolates 12.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.76
Nodule 9.7
Rhizoplane 5.01
Rhizosphere 72.14
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544935 2209111006 Bacteria 6286
2 ARSoilYngRDRAFT_c00089 3300000042 Bacteria 15393
3 ARSoilOldRDRAFT_c000300 3300000044 Bacteria 6790
4 ARSoilOldRDRAFT_c000339 3300000044 Bacteria 6016
5 ARCol0oldRDRAFT_c00174 3300000045 Bacteria 5852
6 ARCol0yngRDRAFT_1000107 3300000652 Bacteria 15394
7 JGI24741J21665_1013626 3300001915 Bacteria 1376
8 JGI24746J21847_1000182 3300001977 Bacteria 8294
9 JGI24747J21853_1002123 3300001978 Bacteria 1576
10 JGI24739J22299_10002319 3300001989 Bacteria 7334
11 JGI24737J22298_10007743 3300001990 Bacteria 3622
12 JGI24737J22298_10010552 3300001990 Bacteria 3047
13 JGI24737J22298_10023654 3300001990 Bacteria 1948
14 JGI24750J21931_1000513 3300002070 Bacteria 6023
15 JGI24750J21931_1000665 3300002070 Bacteria 5085
16 JGI24745J21846_1000274 3300002073 Bacteria 4375
17 JGI24738J21930_10000052 3300002075 Bacteria 23911
18 JGI24749J21850_1002731 3300002076 Bacteria 2474
19 JGI24744J21845_10001379 3300002077 Bacteria 4810
20 JGI24035J26624_1000226 3300002126 Bacteria 5170
21 JGI24033J26618_1002616 3300002155 Bacteria 1852
22 JGI24742J22300_10001173 3300002244 Bacteria 4083
23 JGI25406J46586_10000014 3300003203 Bacteria 93855
24 JGI25160J50197_1006147 3300003354 Bacteria 4890
25 JGI25160J50197_1006602 3300003354 Bacteria 4674
26 JGI25404J52841_10009833 3300003659 Bacteria 2051
27 JGI25404J52841_10011033 3300003659 Bacteria 1945
28 Ga0055542_1003874 3300003762 Bacteria 3855
29 Ga0065165_1024748 3300005262 Bacteria 2011
30 Ga0065704_10090369 3300005289 Bacteria 2792
31 Ga0065712_10003538 3300005290 Bacteria 5261
32 Ga0065712_10015554 3300005290 Bacteria 1991
33 Ga0065712_10068990 3300005290 Bacteria 8358
34 Ga0065712_10083170 3300005290 Bacteria 2858
35 Ga0065712_10099300 3300005290 Bacteria 2085
36 Ga0065715_10089733 3300005293 Bacteria 8685
37 Ga0065715_10104580 3300005293 Bacteria 2951
38 Ga0065707_10092121 3300005295 Bacteria 3822
39 Ga0070676_10001246 3300005328 Bacteria 12817
40 Ga0070683_100003790 3300005329 Bacteria 12347
41 Ga0070683_100012630 3300005329 Bacteria 7342
42 Ga0070683_100036431 3300005329 Bacteria 4501
43 Ga0070683_100041700 3300005329 Bacteria 4224
44 Ga0070690_100004565 3300005330 Bacteria 7694
45 Ga0070690_100004629 3300005330 Bacteria 7656
46 Ga0070690_100134507 3300005330 Bacteria 1673
47 Ga0070670_100002085 3300005331 Bacteria 16387
48 Ga0070670_100037991 3300005331 Bacteria 4140
49 Ga0070670_100042623 3300005331 Bacteria 3902
50 Ga0070670_100100990 3300005331 Bacteria 2484
51 Ga0070670_100144944 3300005331 Bacteria 2054
52 Ga0070670_100263878 3300005331 Bacteria 1501
53 Ga0070677_10000009 3300005333 Bacteria 65648
54 Ga0068869_100002305 3300005334 Bacteria 11486
55 Ga0068869_100040444 3300005334 Bacteria 3334
56 Ga0070666_10007715 3300005335 Bacteria 6646
57 Ga0070666_10009200 3300005335 Bacteria 6158
58 Ga0070680_100004098 3300005336 Bacteria 10915
59 Ga0070680_100018156 3300005336 Bacteria 5556
60 Ga0070680_100063307 3300005336 Bacteria 3029
61 Ga0070680_100069347 3300005336 Bacteria 2895
62 Ga0070682_100000116 3300005337 Bacteria 69952
63 Ga0070682_100000979 3300005337 Bacteria 16545
64 Ga0070682_100034485 3300005337 Bacteria 3083
65 Ga0068868_100003854 3300005338 Bacteria 10469
66 Ga0068868_100052544 3300005338 Bacteria 3208
67 Ga0068868_100118518 3300005338 Bacteria 2158
68 Ga0068868_100121868 3300005338 Bacteria 2128
69 Ga0070660_100003331 3300005339 Bacteria 11041
70 Ga0070660_100019816 3300005339 Bacteria 4934
71 Ga0070660_100086700 3300005339 Bacteria 2463
72 Ga0070689_100003558 3300005340 Bacteria 10371
73 Ga0070689_100010855 3300005340 Bacteria 6511
74 Ga0070689_100111071 3300005340 Bacteria 2180
75 Ga0070689_100194892 3300005340 Bacteria 1651
76 Ga0070691_10003923 3300005341 Bacteria 6732
77 Ga0070691_10018597 3300005341 Bacteria 3203
78 Ga0070691_10019647 3300005341 Bacteria 3119
79 Ga0070687_100000789 3300005343 Bacteria 10526
80 Ga0070687_100023301 3300005343 Bacteria 2941
81 Ga0070661_100001106 3300005344 Bacteria 18965
82 Ga0070661_100040659 3300005344 Bacteria 3393
83 Ga0070692_10000072 3300005345 Bacteria 20566
84 Ga0070692_10014992 3300005345 Bacteria 3656
85 Ga0070668_100101369 3300005347 Bacteria 2282
86 Ga0070669_100006413 3300005353 Bacteria 8465
87 Ga0070669_100023793 3300005353 Bacteria 4390
88 Ga0070675_100002349 3300005354 Bacteria 14066
89 Ga0070675_100075291 3300005354 Bacteria 2806
90 Ga0070671_100000438 3300005355 Bacteria 28920
91 Ga0070671_100022090 3300005355 Bacteria 5198
92 Ga0070671_100050350 3300005355 Bacteria 3464
93 Ga0070671_100101976 3300005355 Bacteria 2408
94 Ga0070671_100103037 3300005355 Bacteria 2394
95 Ga0070674_100010977 3300005356 Bacteria 5495
96 Ga0070674_100082631 3300005356 Bacteria 2298
97 Ga0070674_100134883 3300005356 Bacteria 1845
98 Ga0070673_100013957 3300005364 Bacteria 5578
99 Ga0070673_100081869 3300005364 Bacteria 2619
100 Ga0070673_100108718 3300005364 Bacteria 2296
101 Ga0070673_100129260 3300005364 Bacteria 2117
102 Ga0070688_100002434 3300005365 Bacteria 9408
103 Ga0070688_100011673 3300005365 Bacteria 4891
104 Ga0070688_100024430 3300005365 Bacteria 3566
105 Ga0070688_100089378 3300005365 Bacteria 2010
106 Ga0070688_100144809 3300005365 Bacteria 1618
107 Ga0070659_100004384 3300005366 Bacteria 10078
108 Ga0070659_100008591 3300005366 Bacteria 7468
109 Ga0070659_100031077 3300005366 Bacteria 4135
110 Ga0070667_100022200 3300005367 Bacteria 5265
111 Ga0070667_100028213 3300005367 Bacteria 4672
112 Ga0070667_100132488 3300005367 Bacteria 2177
113 Ga0070667_100162549 3300005367 Bacteria 1967
114 Ga0070709_10002732 3300005434 Bacteria 9543
115 Ga0070709_10045389 3300005434 Bacteria 2727
116 Ga0070709_10081750 3300005434 Bacteria 2110
117 Ga0070709_10083770 3300005434 Bacteria 2086
118 Ga0070714_100019598 3300005435 Bacteria 5515
119 Ga0070714_100056531 3300005435 Bacteria 3356
120 Ga0070714_100184654 3300005435 Bacteria 1900
121 Ga0070713_100019289 3300005436 Bacteria 5202
122 Ga0070713_100035925 3300005436 Bacteria 3994
123 Ga0070713_100064129 3300005436 Bacteria 3082
124 Ga0070713_100169074 3300005436 Bacteria 1957
125 Ga0070710_10005268 3300005437 Bacteria 6133
126 Ga0070710_10011405 3300005437 Bacteria 4389
127 Ga0070701_10000749 3300005438 Bacteria 11526
128 Ga0070701_10029566 3300005438 Bacteria 2703
129 Ga0070711_100004717 3300005439 Bacteria 8070
130 Ga0070711_100006985 3300005439 Bacteria 6847
131 Ga0070711_100012265 3300005439 Bacteria 5348
132 Ga0070711_100014964 3300005439 Bacteria 4901
133 Ga0070711_100096662 3300005439 Bacteria 2140
134 Ga0070711_100115530 3300005439 Bacteria 1976
135 Ga0070711_100131993 3300005439 Bacteria 1861
136 Ga0070705_100001548 3300005440 Bacteria 12063
137 Ga0070705_100008627 3300005440 Bacteria 5047
138 Ga0070700_100002431 3300005441 Bacteria 9474
139 Ga0070700_100005261 3300005441 Bacteria 6844
140 Ga0070694_100008016 3300005444 Bacteria 6454
141 Ga0070694_100020661 3300005444 Bacteria 4199
142 Ga0070663_100002701 3300005455 Bacteria 10040
143 Ga0070663_100028958 3300005455 Bacteria 3777
144 Ga0070663_100071948 3300005455 Bacteria 2517
145 Ga0070678_100003996 3300005456 Bacteria 8295
146 Ga0070678_100021420 3300005456 Bacteria 4262
147 Ga0070678_100029939 3300005456 Bacteria 3735
148 Ga0070662_100013570 3300005457 Bacteria 5424
149 Ga0070662_100032477 3300005457 Bacteria 3669
150 Ga0070681_10008360 3300005458 Bacteria 10138
151 Ga0070681_10027797 3300005458 Bacteria 5687
152 Ga0070681_10046810 3300005458 Bacteria 4323
153 Ga0070681_10049000 3300005458 Bacteria 4220
154 Ga0068867_100003047 3300005459 Bacteria 11816
155 Ga0068867_100087539 3300005459 Bacteria 2359
156 Ga0068867_100133071 3300005459 Bacteria 1935
157 Ga0070685_10006097 3300005466 Bacteria 6143
158 Ga0070685_10022040 3300005466 Bacteria 3468
159 Ga0070685_10023246 3300005466 Bacteria 3392
160 Ga0070685_10052006 3300005466 Bacteria 2370
161 Ga0070685_10056001 3300005466 Bacteria 2291
162 Ga0070698_100230579 3300005471 Bacteria 1785
163 Ga0070698_100310135 3300005471 Bacteria 1509
164 Ga0070679_100012488 3300005530 Bacteria 8120
165 Ga0070679_100012608 3300005530 Bacteria 8083
166 Ga0070679_100045348 3300005530 Bacteria 4380
167 Ga0070679_100066163 3300005530 Bacteria 3602
168 Ga0070679_100091000 3300005530 Bacteria 3039
169 Ga0070679_100174934 3300005530 Bacteria 2119
170 Ga0070684_100043470 3300005535 Bacteria 3880
171 Ga0070684_100147360 3300005535 Bacteria 2131
172 Ga0070684_100265552 3300005535 Bacteria 1570
173 Ga0070697_100001151 3300005536 Bacteria 20042
174 Ga0068853_100000659 3300005539 Bacteria 23749
175 Ga0068853_100004427 3300005539 Bacteria 10875
176 Ga0068853_100005475 3300005539 Bacteria 9947
177 Ga0068853_100039671 3300005539 Bacteria 4017
178 Ga0068853_100142783 3300005539 Bacteria 2150
179 Ga0068853_100179625 3300005539 Bacteria 1919
180 Ga0070672_100003650 3300005543 Bacteria 9997
181 Ga0070672_100072586 3300005543 Bacteria 2740
182 Ga0070672_100097229 3300005543 Bacteria 2383
183 Ga0070672_100148955 3300005543 Bacteria 1935
184 Ga0070686_100001755 3300005544 Bacteria 12140
185 Ga0070686_100015274 3300005544 Bacteria 4442
186 Ga0070686_100042821 3300005544 Bacteria 2838
187 Ga0070686_100058573 3300005544 Bacteria 2479
188 Ga0070686_100068040 3300005544 Bacteria 2322
189 Ga0070695_100003819 3300005545 Bacteria 8784
190 Ga0070695_100013267 3300005545 Bacteria 4950
191 Ga0070695_100014726 3300005545 Bacteria 4717
192 Ga0070696_100021998 3300005546 Bacteria 4328
193 Ga0070696_100022292 3300005546 Bacteria 4301
194 Ga0070696_100043536 3300005546 Bacteria 3106
195 Ga0070696_100225897 3300005546 Bacteria 1407
196 Ga0070693_100000988 3300005547 Bacteria 12664
197 Ga0070693_100002396 3300005547 Bacteria 8622
198 Ga0070693_100054369 3300005547 Bacteria 2302
199 Ga0070693_100089785 3300005547 Bacteria 1850
200 Ga0070665_100006275 3300005548 Bacteria 12150
201 Ga0070665_100047526 3300005548 Bacteria 4307
202 Ga0070665_100058037 3300005548 Bacteria 3880
203 Ga0070665_100060124 3300005548 Bacteria 3809
204 Ga0070665_100187906 3300005548 Bacteria 2067
205 Ga0070704_100002150 3300005549 Bacteria 10978
206 Ga0070704_100006558 3300005549 Bacteria 6863
207 Ga0070704_100030161 3300005549 Bacteria 3631
208 Ga0070704_100132809 3300005549 Bacteria 1932
209 Ga0068855_100015636 3300005563 Bacteria 9131
210 Ga0068855_100039924 3300005563 Bacteria 5571
211 Ga0068855_100064883 3300005563 Bacteria 4258
212 Ga0068855_100082470 3300005563 Bacteria 3726
213 Ga0068855_100118529 3300005563 Bacteria 3031
214 Ga0068855_100268339 3300005563 Bacteria 1898
215 Ga0070664_100065325 3300005564 Bacteria 3104
216 Ga0070664_100080119 3300005564 Bacteria 2812
217 Ga0070664_100165374 3300005564 Bacteria 1960
218 Ga0068857_100000295 3300005577 Bacteria 34486
219 Ga0068857_100012531 3300005577 Bacteria 7383
220 Ga0068857_100051056 3300005577 Bacteria 3667
221 Ga0068854_100000260 3300005578 Bacteria 35995
222 Ga0068854_100054196 3300005578 Bacteria 2883
223 Ga0068854_100056325 3300005578 Bacteria 2833
224 Ga0068856_100008963 3300005614 Bacteria 9734
225 Ga0068856_100037475 3300005614 Bacteria 4758
226 Ga0068856_100067052 3300005614 Bacteria 3546
227 Ga0068856_100293657 3300005614 Bacteria 1642
228 Ga0070702_100000267 3300005615 Bacteria 17761
229 Ga0070702_100069352 3300005615 Bacteria 2077
230 Ga0068859_100016349 3300005617 Bacteria 7454
231 Ga0068859_100031702 3300005617 Bacteria 5308
232 Ga0068859_100161711 3300005617 Bacteria 2318
233 Ga0068864_100001366 3300005618 Bacteria 20286
234 Ga0068864_100262041 3300005618 Bacteria 1608
235 Ga0068866_10001935 3300005718 Bacteria 8641
236 Ga0068866_10025008 3300005718 Bacteria 2802
237 Ga0068861_100001047 3300005719 Bacteria 16998
238 Ga0068861_100080421 3300005719 Bacteria 2550
239 Ga0068851_10009190 3300005834 Bacteria 4590
240 Ga0068870_10000404 3300005840 Bacteria 16242
241 Ga0068870_10036806 3300005840 Bacteria 2519
242 Ga0068863_100007320 3300005841 Bacteria 10808
243 Ga0068863_100091617 3300005841 Bacteria 2883
244 Ga0068863_100192569 3300005841 Bacteria 1960
245 Ga0068863_100246853 3300005841 Bacteria 1724
246 Ga0068858_100004119 3300005842 Bacteria 14313
247 Ga0068858_100037563 3300005842 Bacteria 4492
248 Ga0068858_100049400 3300005842 Bacteria 3896
249 Ga0068858_100088219 3300005842 Bacteria 2886
250 Ga0068858_100121995 3300005842 Bacteria 2438
251 Ga0068858_100167218 3300005842 Bacteria 2073
252 Ga0068860_100000562 3300005843 Bacteria 44958
253 Ga0068860_100007370 3300005843 Bacteria 11000
254 Ga0068860_100062258 3300005843 Bacteria 3545
255 Ga0068860_100101582 3300005843 Bacteria 2744
256 Ga0068860_100309147 3300005843 Bacteria 1550
257 Ga0068862_100005293 3300005844 Bacteria 10814
258 Ga0081455_10000012 3300005937 Bacteria 201668
259 Ga0081455_10000419 3300005937 Bacteria 55807
260 Ga0081455_10004709 3300005937 Bacteria 15165
261 Ga0081455_10007131 3300005937 Bacteria 11831
262 Ga0081455_10007757 3300005937 Bacteria 11254
263 Ga0081455_10007799 3300005937 Bacteria 11212
264 Ga0081455_10042462 3300005937 Bacteria 3988
265 Ga0081455_10085171 3300005937 Bacteria 2578
266 Ga0081538_10012089 3300005981 Bacteria 6944
267 Ga0081538_10020591 3300005981 Bacteria 4846
268 Ga0081538_10036175 3300005981 Bacteria 3227
269 Ga0081540_1000003 3300005983 Bacteria 233942
270 Ga0081540_1000585 3300005983 Bacteria 35126
271 Ga0081540_1006269 3300005983 Bacteria 8704
272 Ga0081540_1014526 3300005983 Bacteria 5037
273 Ga0081540_1015307 3300005983 Bacteria 4861
274 Ga0081540_1017136 3300005983 Bacteria 4497
275 Ga0081540_1020861 3300005983 Bacteria 3925
276 Ga0081539_10000008 3300005985 Bacteria 525071
277 Ga0070717_10002456 3300006028 Bacteria 13077
278 Ga0075365_10002418 3300006038 Bacteria 9149
279 Ga0075365_10021887 3300006038 Bacteria 3996
280 Ga0075365_10090220 3300006038 Bacteria 2087
281 Ga0075365_10147405 3300006038 Bacteria 1636
282 Ga0075365_10222012 3300006038 Bacteria 1326
283 Ga0075368_10005197 3300006042 Bacteria 4464
284 Ga0075368_10006102 3300006042 Bacteria 4188
285 Ga0075368_10012790 3300006042 Bacteria 3074
286 Ga0075363_100004607 3300006048 Bacteria 6054
287 Ga0075363_100095898 3300006048 Bacteria 1637
288 Ga0075364_10005987 3300006051 Bacteria 7107
289 Ga0075364_10022670 3300006051 Bacteria 3969
290 Ga0075364_10051487 3300006051 Bacteria 2690
291 Ga0075364_10125572 3300006051 Bacteria 1720
292 Ga0075364_10166750 3300006051 Bacteria 1488
293 Ga0070715_10008835 3300006163 Bacteria 3526
294 Ga0070716_100004186 3300006173 Bacteria 6861
295 Ga0070716_100031647 3300006173 Bacteria 2879
296 Ga0070716_100103903 3300006173 Bacteria 1748
297 Ga0070712_100030142 3300006175 Bacteria 3643
298 Ga0070712_100096908 3300006175 Bacteria 2172
299 Ga0070712_100101329 3300006175 Bacteria 2130
300 Ga0070712_100195450 3300006175 Bacteria 1586
301 Ga0075367_10000969 3300006178 Bacteria 11723
302 Ga0075367_10038585 3300006178 Bacteria 2781
303 Ga0075367_10051435 3300006178 Bacteria 2435
304 Ga0075367_10068864 3300006178 Bacteria 2123
305 Ga0075367_10082613 3300006178 Bacteria 1945
306 Ga0075367_10097893 3300006178 Bacteria 1790
307 Ga0075367_10176390 3300006178 Bacteria 1332
308 Ga0075369_10009443 3300006186 Bacteria 3790
309 Ga0075369_10023578 3300006186 Bacteria 2545
310 Ga0075369_10035439 3300006186 Bacteria 2121
311 Ga0075369_10046899 3300006186 Bacteria 1862
312 Ga0075366_10041025 3300006195 Bacteria 2739
313 Ga0075366_10105801 3300006195 Bacteria 1691
314 Ga0097621_100000421 3300006237 Bacteria 29460
315 Ga0097621_100002992 3300006237 Bacteria 11612
316 Ga0097621_100063763 3300006237 Bacteria 3029
317 Ga0075370_10010442 3300006353 Bacteria 4856
318 Ga0075370_10041822 3300006353 Bacteria 2588
319 Ga0075370_10052846 3300006353 Bacteria 2306
320 Ga0075370_10058740 3300006353 Bacteria 2188
321 Ga0068871_100000879 3300006358 Bacteria 20044
322 Ga0068871_100025095 3300006358 Bacteria 4632
323 Ga0068871_100087672 3300006358 Bacteria 2588
324 Ga0068871_100124931 3300006358 Bacteria 2177
325 Ga0075428_100011825 3300006844 Bacteria 9715
326 Ga0075430_100005350 3300006846 Bacteria 10840
327 Ga0075431_100000774 3300006847 Bacteria 27749
328 Ga0075431_100004764 3300006847 Bacteria 13342
329 Ga0075431_100097870 3300006847 Bacteria 3029
330 Ga0075433_10036921 3300006852 Bacteria 4212
331 Ga0075433_10072998 3300006852 Bacteria 3018
332 Ga0075433_10086516 3300006852 Bacteria 2767
333 Ga0075434_100002590 3300006871 Bacteria 15967
334 Ga0075434_100005762 3300006871 Bacteria 11314
335 Ga0075434_100046214 3300006871 Bacteria 4321
336 Ga0075434_100100350 3300006871 Bacteria 2901
337 Ga0075429_100002604 3300006880 Bacteria 15220
338 Ga0075429_100019740 3300006880 Bacteria 5842
339 Ga0075429_100177792 3300006880 Bacteria 1865
340 Ga0068865_100003376 3300006881 Bacteria 9563
341 Ga0068865_100013454 3300006881 Bacteria 5170
342 Ga0068865_100111081 3300006881 Bacteria 2022
343 Ga0097620_100016349 3300006931 Bacteria 7454
344 Ga0097620_100031702 3300006931 Bacteria 5308
345 Ga0097620_100161714 3300006931 Bacteria 2318
346 Ga0099824_1006244 3300006942 Bacteria 16446
347 Ga0099824_1025327 3300006942 Bacteria 3271
348 Ga0099822_1004519 3300006943 Bacteria 18114
349 Ga0099823_1020076 3300006944 Bacteria 6335
350 Ga0075435_100031352 3300007076 Bacteria 4187
351 Ga0075435_100064028 3300007076 Bacteria 2987
352 Ga0075435_100237785 3300007076 Bacteria 1548
353 Ga0105251_10007401 3300009011 Bacteria 6769
354 Ga0105240_10003963 3300009093 Bacteria 22864
355 Ga0105240_10015053 3300009093 Bacteria 10529
356 Ga0105240_10082733 3300009093 Bacteria 3941
357 Ga0105240_10189027 3300009093 Bacteria 2423
358 Ga0105240_10522574 3300009093 Bacteria 1317
359 Ga0111539_10000373 3300009094 Bacteria 55466
360 Ga0111539_10003962 3300009094 Bacteria 19452
361 Ga0111539_10009860 3300009094 Bacteria 12053
362 Ga0111539_10152393 3300009094 Bacteria 2706
363 Ga0111539_10162494 3300009094 Bacteria 2612
364 Ga0105245_10013128 3300009098 Bacteria 7217
365 Ga0105245_10019119 3300009098 Bacteria 5997
366 Ga0105245_10024300 3300009098 Bacteria 5320
367 Ga0105245_10049447 3300009098 Bacteria 3765
368 Ga0105245_10069230 3300009098 Bacteria 3199
369 Ga0105245_10162754 3300009098 Bacteria 2118
370 Ga0105247_10009472 3300009101 Bacteria 5909
371 Ga0105247_10012428 3300009101 Bacteria 5113
372 Ga0105247_10012564 3300009101 Bacteria 5087
373 Ga0105247_10014958 3300009101 Bacteria 4652
374 Ga0105247_10042332 3300009101 Bacteria 2790
375 Ga0114129_10000170 3300009147 Bacteria 70817
376 Ga0114129_10023543 3300009147 Bacteria 8728
377 Ga0114129_10060452 3300009147 Bacteria 5298
378 Ga0114129_10167898 3300009147 Bacteria 2993
379 Ga0114129_10178319 3300009147 Bacteria 2893
380 Ga0105243_10018313 3300009148 Bacteria 5303
381 Ga0105243_10037937 3300009148 Bacteria 3749
382 Ga0105241_10002379 3300009174 Bacteria 14125
383 Ga0105241_10009140 3300009174 Bacteria 7293
384 Ga0105241_10080881 3300009174 Bacteria 2544
385 Ga0105242_10004099 3300009176 Bacteria 11330
386 Ga0105242_10045993 3300009176 Bacteria 3539
387 Ga0105242_10138945 3300009176 Bacteria 2106
388 Ga0105242_10184154 3300009176 Bacteria 1844
389 Ga0105248_10000821 3300009177 Bacteria 34849
390 Ga0105248_10021823 3300009177 Bacteria 7095
391 Ga0105248_10025465 3300009177 Bacteria 6579
392 Ga0105248_10160609 3300009177 Bacteria 2535
393 Ga0105248_10391109 3300009177 Bacteria 1565
394 Ga0105237_10001028 3300009545 Bacteria 37573
395 Ga0105237_10028415 3300009545 Bacteria 5697
396 Ga0105237_10129840 3300009545 Bacteria 2514
397 Ga0105237_10205311 3300009545 Bacteria 1971
398 Ga0105237_10209164 3300009545 Bacteria 1951
399 Ga0105237_10369684 3300009545 Bacteria 1439
400 Ga0105238_10059607 3300009551 Bacteria 3823
401 Ga0105238_10060156 3300009551 Bacteria 3804
402 Ga0105238_10121038 3300009551 Bacteria 2597
403 Ga0105238_10148860 3300009551 Bacteria 2317
404 Ga0105238_10369881 3300009551 Bacteria 1424
405 Ga0105249_10001420 3300009553 Bacteria 20968
406 Ga0105249_10008599 3300009553 Bacteria 8897
407 Ga0105249_10009911 3300009553 Bacteria 8351
408 Ga0105249_10035195 3300009553 Bacteria 4541
409 Ga0105249_10099953 3300009553 Bacteria 2727
410 Ga0105249_10178816 3300009553 Bacteria 2062
411 Ga0105239_10020537 3300010375 Bacteria 7286
412 Ga0105239_10040794 3300010375 Bacteria 5086
413 Ga0105239_10053277 3300010375 Bacteria 4438
414 Ga0105239_10062737 3300010375 Bacteria 4079
415 Ga0105239_10090619 3300010375 Bacteria 3373
416 Ga0105239_10130296 3300010375 Bacteria 2797
417 Ga0105246_10000011 3300011119 Bacteria 68021
418 Ga0105246_10003642 3300011119 Bacteria 9322
419 Ga0105246_10033401 3300011119 Bacteria 3420
420 Ga0105246_10035325 3300011119 Bacteria 3340
421 Ga0105246_10341826 3300011119 Bacteria 1223
422 Ga0157373_10003303 3300013100 Bacteria 12186
423 Ga0157373_10072583 3300013100 Bacteria 2429
424 Ga0157373_10086093 3300013100 Bacteria 2214
425 Ga0157371_10007729 3300013102 Bacteria 8646
426 Ga0157371_10050467 3300013102 Bacteria 2957
427 Ga0157370_10019379 3300013104 Bacteria 6826
428 Ga0157370_10053454 3300013104 Bacteria 3851
429 Ga0157370_10066296 3300013104 Bacteria 3414
430 Ga0157369_10034405 3300013105 Bacteria 5561
431 Ga0157369_10112993 3300013105 Bacteria 2885
432 Ga0157374_10005683 3300013296 Bacteria 10515
433 Ga0157374_10025470 3300013296 Bacteria 5312
434 Ga0157374_10045777 3300013296 Bacteria 4049
435 Ga0157374_10099820 3300013296 Bacteria 2781
436 Ga0157378_10002005 3300013297 Bacteria 18210
437 Ga0157378_10108505 3300013297 Bacteria 2542
438 Ga0163162_10005215 3300013306 Bacteria 12531
439 Ga0163162_10027897 3300013306 Bacteria 5585
440 Ga0163162_10039343 3300013306 Bacteria 4725
441 Ga0163162_10060561 3300013306 Bacteria 3821
442 Ga0163162_10112055 3300013306 Bacteria 2827
443 Ga0163162_10351051 3300013306 Bacteria 1608
444 Ga0163162_10385325 3300013306 Bacteria 1535
445 Ga0157372_10005179 3300013307 Bacteria 13867
446 Ga0157372_10034995 3300013307 Bacteria 5527
447 Ga0157372_10077343 3300013307 Bacteria 3758
448 Ga0157372_10251571 3300013307 Bacteria 2051
449 Ga0157375_10012425 3300013308 Bacteria 7555
450 Ga0157375_10016062 3300013308 Bacteria 6717
451 Ga0157375_10021671 3300013308 Bacteria 5898
452 Ga0157375_10042851 3300013308 Bacteria 4385
453 Ga0157375_10059563 3300013308 Bacteria 3784
454 Ga0157375_10060259 3300013308 Bacteria 3763
455 Ga0157375_10657650 3300013308 Bacteria 1204
456 Ga0163163_10004718 3300014325 Bacteria 11678
457 Ga0163163_10005008 3300014325 Bacteria 11416
458 Ga0163163_10032891 3300014325 Bacteria 5011
459 Ga0163163_10032906 3300014325 Bacteria 5010
460 Ga0163163_10058563 3300014325 Bacteria 3809
461 Ga0157380_10005074 3300014326 Bacteria 9196
462 Ga0157380_10047528 3300014326 Bacteria 3376
463 Ga0157377_10000398 3300014745 Bacteria 18793
464 Ga0157377_10035335 3300014745 Bacteria 2741
465 Ga0157379_10006255 3300014968 Bacteria 10251
466 Ga0157379_10008086 3300014968 Bacteria 9136
467 Ga0157379_10014948 3300014968 Bacteria 6807
468 Ga0157379_10022881 3300014968 Bacteria 5540
469 Ga0157379_10026095 3300014968 Bacteria 5199
470 Ga0157379_10032074 3300014968 Bacteria 4681
471 Ga0157379_10033391 3300014968 Bacteria 4589
472 Ga0157379_10039533 3300014968 Bacteria 4208
473 Ga0157376_10003372 3300014969 Bacteria 10997
474 Ga0157376_10011670 3300014969 Bacteria 6486
475 Ga0157376_10077049 3300014969 Bacteria 2851
476 Ga0163161_10002430 3300017792 Bacteria 13315
477 Ga0163161_10048001 3300017792 Bacteria 3083
478 Ga0163161_10129959 3300017792 Bacteria 1899
479 Ga0214544_1000467 3300021320 Bacteria 73360
480 Ga0214542_1000185 3300021321 Bacteria 96676
481 Ga0214545_1000102 3300021324 Bacteria 96676
482 Ga0214545_1023945 3300021324 Bacteria 3887
483 Ga0214543_1000211 3300021327 Bacteria 87600
484 Ga0213873_10005190 3300021358 Bacteria 2482
485 Ga0213872_10064105 3300021361 Bacteria 1660
486 Ga0213874_10027120 3300021377 Bacteria 1627
487 Ga0213876_10002883 3300021384 Bacteria 9985
488 Ga0213876_10003126 3300021384 Bacteria 9562
489 Ga0213875_10001986 3300021388 Bacteria 12652
490 Ga0228598_1002460 3300024227 Bacteria 4035
491 Ga0209677_100138 3300025253 Bacteria 67992
492 Ga0209148_1001411 3300025254 Bacteria 12316
493 Ga0209233_1001323 3300025261 Bacteria 9891
494 Ga0209233_1008287 3300025261 Bacteria 3228
495 Ga0207666_1000038 3300025271 Bacteria 26508
496 Ga0207666_1001350 3300025271 Bacteria 2889
497 Ga0207673_1000111 3300025290 Bacteria 7514
498 Ga0209564_1000792 3300025295 Bacteria 43539
499 Ga0209564_1005226 3300025295 Bacteria 7511
500 Ga0209564_1010806 3300025295 Bacteria 4159
501 Ga0209564_1020885 3300025295 Bacteria 2381
502 Ga0209758_1000075 3300025297 Bacteria 271585
503 Ga0209758_1000187 3300025297 Bacteria 138759
504 Ga0209758_1015233 3300025297 Bacteria 4003
505 Ga0207426_1000422 3300025302 Bacteria 69436
506 Ga0207426_1004240 3300025302 Bacteria 7117
507 Ga0209257_1002081 3300025304 Bacteria 21090
508 Ga0207697_10001943 3300025315 Bacteria 10987
509 Ga0207697_10010836 3300025315 Bacteria 3878
510 Ga0207713_1027411 3300025735 Bacteria 2588
511 Ga0207653_10003072 3300025885 Bacteria 5290
512 Ga0207682_10000071 3300025893 Bacteria 44843
513 Ga0207692_10004905 3300025898 Bacteria 5325
514 Ga0207692_10038205 3300025898 Bacteria 2354
515 Ga0207710_10006950 3300025900 Bacteria 4813
516 Ga0207710_10010732 3300025900 Bacteria 3857
517 Ga0207710_10030249 3300025900 Bacteria 2361
518 Ga0207710_10039149 3300025900 Bacteria 2097
519 Ga0207688_10001967 3300025901 Bacteria 11016
520 Ga0207680_10008702 3300025903 Bacteria 4997
521 Ga0207680_10060801 3300025903 Bacteria 2301
522 Ga0207647_10001241 3300025904 Bacteria 19628
523 Ga0207647_10021971 3300025904 Bacteria 4246
524 Ga0207647_10024633 3300025904 Bacteria 3966
525 Ga0207685_10003844 3300025905 Bacteria 3718
526 Ga0207699_10015399 3300025906 Bacteria 3970
527 Ga0207699_10020526 3300025906 Bacteria 3543
528 Ga0207699_10047620 3300025906 Bacteria 2514
529 Ga0207699_10133082 3300025906 Bacteria 1625
530 Ga0207645_10000779 3300025907 Bacteria 26604
531 Ga0207645_10091820 3300025907 Bacteria 1953
532 Ga0207643_10000434 3300025908 Bacteria 27428
533 Ga0207654_10000498 3300025911 Bacteria 22492
534 Ga0207654_10016873 3300025911 Bacteria 3810
535 Ga0207654_10115520 3300025911 Bacteria 1677
536 Ga0207707_10000454 3300025912 Bacteria 42654
537 Ga0207707_10008330 3300025912 Bacteria 8994
538 Ga0207707_10018940 3300025912 Bacteria 6002
539 Ga0207707_10035836 3300025912 Bacteria 4338
540 Ga0207707_10058775 3300025912 Bacteria 3346
541 Ga0207707_10226787 3300025912 Bacteria 1626
542 Ga0207695_10000029 3300025913 Bacteria 548364
543 Ga0207695_10008792 3300025913 Bacteria 12590
544 Ga0207695_10042402 3300025913 Bacteria 4861
545 Ga0207695_10122854 3300025913 Bacteria 2562
546 Ga0207695_10300689 3300025913 Bacteria 1496
547 Ga0207671_10012690 3300025914 Bacteria 6759
548 Ga0207671_10046290 3300025914 Bacteria 3218
549 Ga0207671_10154394 3300025914 Bacteria 1775
550 Ga0207693_10018787 3300025915 Bacteria 5500
551 Ga0207693_10019955 3300025915 Bacteria 5331
552 Ga0207693_10037739 3300025915 Bacteria 3807
553 Ga0207693_10056832 3300025915 Bacteria 3067
554 Ga0207693_10132937 3300025915 Bacteria 1956
555 Ga0207693_10297195 3300025915 Bacteria 1265
556 Ga0207663_10018979 3300025916 Bacteria 3864
557 Ga0207663_10033876 3300025916 Bacteria 3047
558 Ga0207663_10067713 3300025916 Bacteria 2291
559 Ga0207663_10084777 3300025916 Bacteria 2084
560 Ga0207663_10109089 3300025916 Bacteria 1875
561 Ga0207660_10000006 3300025917 Bacteria 106298
562 Ga0207660_10008770 3300025917 Bacteria 6535
563 Ga0207660_10202593 3300025917 Bacteria 1551
564 Ga0207662_10003236 3300025918 Bacteria 8341
565 Ga0207662_10009842 3300025918 Bacteria 5275
566 Ga0207657_10007747 3300025919 Bacteria 10967
567 Ga0207657_10012757 3300025919 Bacteria 8275
568 Ga0207657_10016589 3300025919 Bacteria 7096
569 Ga0207657_10027550 3300025919 Bacteria 5203
570 Ga0207657_10033828 3300025919 Bacteria 4603
571 Ga0207649_10000049 3300025920 Bacteria 109723
572 Ga0207649_10212697 3300025920 Bacteria 1373
573 Ga0207652_10024012 3300025921 Bacteria 5057
574 Ga0207652_10088380 3300025921 Bacteria 2719
575 Ga0207652_10177262 3300025921 Bacteria 1914
576 Ga0207652_10197783 3300025921 Bacteria 1809
577 Ga0207681_10000731 3300025923 Bacteria 21513
578 Ga0207694_10000275 3300025924 Bacteria 48774
579 Ga0207694_10071276 3300025924 Bacteria 2715
580 Ga0207650_10000908 3300025925 Bacteria 22316
581 Ga0207650_10018326 3300025925 Bacteria 4912
582 Ga0207650_10117079 3300025925 Bacteria 2070
583 Ga0207659_10000143 3300025926 Bacteria 42200
584 Ga0207659_10113532 3300025926 Bacteria 2064
585 Ga0207687_10000428 3300025927 Bacteria 28486
586 Ga0207687_10040298 3300025927 Bacteria 3201
587 Ga0207687_10058843 3300025927 Bacteria 2705
588 Ga0207687_10257746 3300025927 Bacteria 1389
589 Ga0207700_10006307 3300025928 Bacteria 7155
590 Ga0207700_10068851 3300025928 Bacteria 2714
591 Ga0207700_10201039 3300025928 Bacteria 1679
592 Ga0207700_10212747 3300025928 Bacteria 1635
593 Ga0207664_10073102 3300025929 Bacteria 2766
594 Ga0207664_10106137 3300025929 Bacteria 2329
595 Ga0207664_10234476 3300025929 Bacteria 1596
596 Ga0207664_10333725 3300025929 Bacteria 1340
597 Ga0207644_10002382 3300025931 Bacteria 12134
598 Ga0207644_10008425 3300025931 Bacteria 6745
599 Ga0207644_10046328 3300025931 Bacteria 3097
600 Ga0207690_10005325 3300025932 Bacteria 7584
601 Ga0207690_10006061 3300025932 Bacteria 7161
602 Ga0207690_10112686 3300025932 Bacteria 1962
603 Ga0207690_10150206 3300025932 Bacteria 1726
604 Ga0207706_10001338 3300025933 Bacteria 24639
605 Ga0207706_10014198 3300025933 Bacteria 7220
606 Ga0207706_10030620 3300025933 Bacteria 4798
607 Ga0207706_10082603 3300025933 Bacteria 2824
608 Ga0207706_10111964 3300025933 Bacteria 2401
609 Ga0207686_10000340 3300025934 Bacteria 33599
610 Ga0207686_10015136 3300025934 Bacteria 4308
611 Ga0207709_10003778 3300025935 Bacteria 8900
612 Ga0207709_10105445 3300025935 Bacteria 1873
613 Ga0207670_10000464 3300025936 Bacteria 22603
614 Ga0207670_10019883 3300025936 Bacteria 4112
615 Ga0207669_10000240 3300025937 Bacteria 24886
616 Ga0207669_10059649 3300025937 Bacteria 2335
617 Ga0207704_10000456 3300025938 Bacteria 18284
618 Ga0207665_10001537 3300025939 Bacteria 15519
619 Ga0207665_10041282 3300025939 Bacteria 3080
620 Ga0207665_10201864 3300025939 Bacteria 1449
621 Ga0207691_10006817 3300025940 Bacteria 11013
622 Ga0207691_10014637 3300025940 Bacteria 7479
623 Ga0207691_10019931 3300025940 Bacteria 6344
624 Ga0207691_10066544 3300025940 Bacteria 3260
625 Ga0207711_10001303 3300025941 Bacteria 23595
626 Ga0207711_10021861 3300025941 Bacteria 5344
627 Ga0207711_10035377 3300025941 Bacteria 4233
628 Ga0207711_10068294 3300025941 Bacteria 3078
629 Ga0207711_10087829 3300025941 Bacteria 2729
630 Ga0207711_10114544 3300025941 Bacteria 2401
631 Ga0207711_10283378 3300025941 Bacteria 1526
632 Ga0207689_10000440 3300025942 Bacteria 38932
633 Ga0207689_10126100 3300025942 Bacteria 2106
634 Ga0207661_10000885 3300025944 Bacteria 19697
635 Ga0207661_10000945 3300025944 Bacteria 19134
636 Ga0207661_10043653 3300025944 Bacteria 3539
637 Ga0207661_10124475 3300025944 Bacteria 2200
638 Ga0207661_10181476 3300025944 Bacteria 1839
639 Ga0207679_10000131 3300025945 Bacteria 61363
640 Ga0207679_10019284 3300025945 Bacteria 4579
641 Ga0207667_10021708 3300025949 Bacteria 7113
642 Ga0207667_10027726 3300025949 Bacteria 6161
643 Ga0207667_10064284 3300025949 Bacteria 3831
644 Ga0207667_10072770 3300025949 Bacteria 3572
645 Ga0207667_10105403 3300025949 Bacteria 2908
646 Ga0207667_10190655 3300025949 Bacteria 2103
647 Ga0207667_10222717 3300025949 Bacteria 1933
648 Ga0207667_10280892 3300025949 Bacteria 1701
649 Ga0207651_10017245 3300025960 Bacteria 4260
650 Ga0207651_10069164 3300025960 Bacteria 2492
651 Ga0207651_10100599 3300025960 Bacteria 2143
652 Ga0207712_10010140 3300025961 Bacteria 5975
653 Ga0207712_10027320 3300025961 Bacteria 3810
654 Ga0207668_10000065 3300025972 Bacteria 86273
655 Ga0207640_10000762 3300025981 Bacteria 18417
656 Ga0207640_10077037 3300025981 Bacteria 2266
657 Ga0207658_10001114 3300025986 Bacteria 21721
658 Ga0207658_10047302 3300025986 Bacteria 3148
659 Ga0207677_10001753 3300026023 Bacteria 11481
660 Ga0207703_10000217 3300026035 Bacteria 66826
661 Ga0207703_10014014 3300026035 Bacteria 6249
662 Ga0207703_10033248 3300026035 Bacteria 4087
663 Ga0207703_10094610 3300026035 Bacteria 2519
664 Ga0207639_10008016 3300026041 Bacteria 7217
665 Ga0207639_10097624 3300026041 Bacteria 2366
666 Ga0207639_10110182 3300026041 Bacteria 2242
667 Ga0207639_10209987 3300026041 Bacteria 1675
668 Ga0207678_10000944 3300026067 Bacteria 26538
669 Ga0207678_10005274 3300026067 Bacteria 11576
670 Ga0207678_10013610 3300026067 Bacteria 7147
671 Ga0207678_10018969 3300026067 Bacteria 6042
672 Ga0207678_10020774 3300026067 Bacteria 5756
673 Ga0207678_10025054 3300026067 Bacteria 5209
674 Ga0207678_10043863 3300026067 Bacteria 3869
675 Ga0207708_10005368 3300026075 Bacteria 9444
676 Ga0207708_10027519 3300026075 Bacteria 4304
677 Ga0207702_10000026 3300026078 Bacteria 186067
678 Ga0207702_10000854 3300026078 Bacteria 31830
679 Ga0207702_10003744 3300026078 Bacteria 13741
680 Ga0207702_10107934 3300026078 Bacteria 2469
681 Ga0207641_10001313 3300026088 Bacteria 24577
682 Ga0207641_10014435 3300026088 Bacteria 6472
683 Ga0207641_10034442 3300026088 Bacteria 4213
684 Ga0207641_10165979 3300026088 Bacteria 2011
685 Ga0207648_10011217 3300026089 Bacteria 8450
686 Ga0207648_10052763 3300026089 Bacteria 3555
687 Ga0207648_10105082 3300026089 Bacteria 2477
688 Ga0207676_10002017 3300026095 Bacteria 14776
689 Ga0207676_10007816 3300026095 Bacteria 7606
690 Ga0207674_10000331 3300026116 Bacteria 60301
691 Ga0207674_10002364 3300026116 Bacteria 23847
692 Ga0207674_10002526 3300026116 Bacteria 23063
693 Ga0207674_10159944 3300026116 Bacteria 2207
694 Ga0207674_10165571 3300026116 Bacteria 2165
695 Ga0207675_100012773 3300026118 Bacteria 7845
696 Ga0207675_100031017 3300026118 Bacteria 4978
697 Ga0207675_100100344 3300026118 Bacteria 2727
698 Ga0207683_10000001 3300026121 Bacteria 352047
699 Ga0207683_10009425 3300026121 Bacteria 8320
700 Ga0207683_10011706 3300026121 Bacteria 7489
701 Ga0207683_10152480 3300026121 Bacteria 2086
702 Ga0207698_10079451 3300026142 Bacteria 2638
703 Ga0209389_1000003 3300027296 Bacteria 268927
704 Ga0209389_1000126 3300027296 Bacteria 67848
705 Ga0209589_1000004 3300027357 Bacteria 578529
706 Ga0209589_1000209 3300027357 Bacteria 69389
707 Ga0209489_100004 3300027361 Bacteria 578529
708 Ga0209489_100022 3300027361 Bacteria 202016
709 Ga0209489_100144 3300027361 Bacteria 106729
710 Ga0209700_100004 3300027363 Bacteria 578529
711 Ga0209700_100023 3300027363 Bacteria 229662
712 Ga0209999_1007703 3300027543 Bacteria 1937
713 Ga0209982_1001558 3300027552 Bacteria 3149
714 Ga0210002_1004248 3300027617 Bacteria 2126
715 Ga0209971_1017847 3300027682 Bacteria 1683
716 Ga0209966_1002020 3300027695 Bacteria 3395
717 Ga0209813_10014707 3300027866 Bacteria 2111
718 Ga0209813_10016556 3300027866 Bacteria 2013
719 Ga0207428_10000172 3300027907 Bacteria 90200
720 Ga0207428_10000255 3300027907 Bacteria 72962
721 Ga0207428_10000289 3300027907 Bacteria 67465
722 Ga0268266_10009846 3300028379 Bacteria 8403
723 Ga0268266_10033448 3300028379 Bacteria 4370
724 Ga0268266_10050734 3300028379 Bacteria 3560
725 Ga0268266_10159492 3300028379 Bacteria 2040
726 Ga0268266_10235769 3300028379 Bacteria 1687
727 Ga0268265_10004222 3300028380 Bacteria 10036
728 Ga0268265_10018419 3300028380 Bacteria 4838
729 Ga0268264_10000096 3300028381 Bacteria 230188
730 Ga0268264_10067578 3300028381 Bacteria 3017
731 Ga0268264_10123826 3300028381 Bacteria 2282
732 Ga0268264_10324733 3300028381 Bacteria 1456
733 Ga0268264_10467745 3300028381 Bacteria 1224
734 Ga0265337_1007261 3300028556 Bacteria 4159
735 Ga0265319_1015026 3300028563 Bacteria 3017
736 Ga0265323_10000788 3300028653 Bacteria 16961
737 Ga0265336_10005161 3300028666 Bacteria 4854
738 Ga0307517_10000315 3300028786 Bacteria 84020
739 Ga0307515_10018508 3300028794 Bacteria 12594
740 Ga0265338_10001265 3300028800 Bacteria 41690
741 Ga0265338_10037858 3300028800 Bacteria 4580
742 Ga0265338_10171689 3300028800 Bacteria 1662
743 Ga0265324_10006833 3300029957 Bacteria 4703
744 Ga0265330_10037409 3300031235 Bacteria 2161
745 Ga0265330_10039666 3300031235 Bacteria 2092
746 Ga0265332_10002650 3300031238 Bacteria 8989
747 Ga0265325_10002126 3300031241 Bacteria 13522
748 Ga0265325_10003615 3300031241 Bacteria 10034
749 Ga0265325_10006932 3300031241 Bacteria 6838
750 Ga0265325_10012689 3300031241 Bacteria 4812
751 Ga0265325_10024274 3300031241 Bacteria 3300
752 Ga0265325_10058055 3300031241 Bacteria 1972
753 Ga0265325_10090525 3300031241 Bacteria 1509
754 Ga0265340_10000765 3300031247 Bacteria 18294
755 Ga0265340_10015947 3300031247 Bacteria 3896
756 Ga0265340_10018100 3300031247 Bacteria 3638
757 Ga0265340_10030594 3300031247 Bacteria 2697
758 Ga0265339_10000158 3300031249 Bacteria 56155
759 Ga0265339_10003907 3300031249 Bacteria 10317
760 Ga0265339_10011755 3300031249 Bacteria 5372
761 Ga0265339_10024234 3300031249 Bacteria 3500
762 Ga0265339_10034700 3300031249 Bacteria 2833
763 Ga0265339_10061601 3300031249 Bacteria 2019
764 Ga0265339_10075589 3300031249 Bacteria 1788
765 Ga0265331_10032161 3300031250 Bacteria 2602
766 Ga0265331_10034472 3300031250 Bacteria 2497
767 Ga0265331_10063434 3300031250 Bacteria 1741
768 Ga0265316_10011375 3300031344 Bacteria 8031
769 Ga0265316_10041390 3300031344 Bacteria 3688
770 Ga0265316_10096701 3300031344 Bacteria 2248
771 Ga0265316_10113638 3300031344 Bacteria 2049
772 Ga0265316_10167878 3300031344 Bacteria 1638
773 Ga0307513_10033286 3300031456 Bacteria 5794
774 Ga0307408_100007113 3300031548 Bacteria 7407
775 Ga0265313_10000027 3300031595 Bacteria 133281
776 Ga0265313_10000426 3300031595 Bacteria 45023
777 Ga0265313_10014337 3300031595 Bacteria 4688
778 Ga0265313_10019090 3300031595 Bacteria 3831
779 Ga0265313_10048917 3300031595 Bacteria 2037
780 Ga0307508_10048516 3300031616 Bacteria 3782
781 Ga0316575_10015584 3300031665 Bacteria 2867
782 Ga0316579_10003798 3300031691 Bacteria 5948
783 Ga0316579_10107757 3300031691 Bacteria 1336
784 Ga0265314_10004473 3300031711 Bacteria 12962
785 Ga0265314_10010907 3300031711 Bacteria 7551
786 Ga0265314_10027160 3300031711 Bacteria 4289
787 Ga0265342_10000093 3300031712 Bacteria 98424
788 Ga0265342_10000761 3300031712 Bacteria 32930
789 Ga0265342_10028573 3300031712 Bacteria 3472
790 Ga0265342_10068055 3300031712 Bacteria 2082
791 Ga0307409_100240406 3300031995 Bacteria 1648
792 Ga0307416_100436891 3300032002 Bacteria 1358
793 Ga0373948_0000360 3300034817 Bacteria 5607
794 Ga0373948_0005292 3300034817 Bacteria 2084
795 Ga0373950_0000868 3300034818 Bacteria 3801
796 Ga0373958_0000309 3300034819 Bacteria 5887
797 Ga0373938_0000238 3300034957 Bacteria 8590
798 Ga0373938_0001315 3300034957 Bacteria 3990
799 Ga0373926_0003404 3300035083 Bacteria 5126
800 Ga0373926_0009583 3300035083 Bacteria 3235
801 Ga0373928_0001415 3300035084 Bacteria 4681
802 Ga0373928_0016122 3300035084 Bacteria 1526
803 Ga0373929_0001680 3300035085 Bacteria 4177
804 Ga0373934_0018659 3300035086 Bacteria 2656
805 Ga0373940_0007476 3300035088 Bacteria 2467
806 Ga0373940_0012269 3300035088 Bacteria 2050
807 Ga0373949_0002060 3300035090 Bacteria 5325
808 Ga0373949_0002127 3300035090 Bacteria 5207
809 Ga0373951_0000607 3300035091 Bacteria 9857
810 Ga0373951_0004013 3300035091 Bacteria 3527
811 Ga0373952_0000334 3300035092 Bacteria 7960
812 Ga0373952_0000549 3300035092 Bacteria 6606
813 Ga0373952_0001719 3300035092 Bacteria 3985
814 Ga0373923_0005521 3300035111 Bacteria 4298
815 Ga0373923_0057269 3300035111 Bacteria 1648
816 Ga0373923_0057850 3300035111 Bacteria 1640
817 Ga0373923_0064335 3300035111 Bacteria 1564
818 Ga0373932_0001896 3300035112 Bacteria 5588
819 Ga0373936_0015253 3300035113 Bacteria 2943
820 Ga0373939_0001870 3300035114 Bacteria 5027
821 Ga0373939_0016894 3300035114 Bacteria 1930
822 Ga0373941_0000803 3300035115 Bacteria 6459
823 Ga0373941_0000977 3300035115 Bacteria 5917
824 Ga0373941_0032082 3300035115 Bacteria 1570
825 Ga0373945_0004003 3300035116 Bacteria 4660
826 Ga0373945_0012819 3300035116 Bacteria 2790
827 Ga0373945_0028606 3300035116 Bacteria 1953
828 Ga0373945_0031233 3300035116 Bacteria 1881
829 Ga0373953_0001305 3300035117 Bacteria 7138
830 Ga0373953_0011755 3300035117 Bacteria 3083
831 Ga0373953_0030857 3300035117 Bacteria 2081
832 Ga0373953_0064333 3300035117 Bacteria 1504
833 Ga0373954_0016151 3300035118 Bacteria 3340
834 Ga0373954_0018425 3300035118 Bacteria 3143
835 Ga0373954_0070277 3300035118 Bacteria 1663
836 Ga0373956_0004249 3300035119 Bacteria 5753
837 Ga0373956_0004598 3300035119 Bacteria 5515
838 Ga0373956_0032556 3300035119 Bacteria 2287
839 Ga0373956_0057893 3300035119 Bacteria 1752
840 Ga0373956_0067231 3300035119 Bacteria 1631
841 Ga0373957_0000689 3300035120 Bacteria 8721
842 Ga0373957_0014655 3300035120 Bacteria 2684
843 Ga0373957_0019954 3300035120 Bacteria 2364
844 Ga0373957_0039688 3300035120 Bacteria 1767
845 Ga0373960_0001746 3300035121 Bacteria 4866
846 Ga0373943_0000476 3300035170 Bacteria 17084
847 Ga0373943_0003076 3300035170 Bacteria 7576
848 Ga0373943_0008345 3300035170 Bacteria 4649
849 Ga0373943_0011759 3300035170 Bacteria 3939
850 Ga0373943_0050791 3300035170 Bacteria 2039
851 Ga0373946_0005522 3300035171 Bacteria 4560
852 Ga0373946_0019699 3300035171 Bacteria 2602
853 Ga0373946_0026198 3300035171 Bacteria 2298
854 Ga0373946_0028471 3300035171 Bacteria 2216
855 Ga0373955_0000213 3300035172 Bacteria 24300
856 Ga0373955_0017485 3300035172 Bacteria 3551
857 Ga0373955_0056656 3300035172 Bacteria 2150
858 Ga0373942_0002320 3300035207 Bacteria 4647
859 Ga0373942_0003894 3300035207 Bacteria 3491
860 Ga0373942_0011273 3300035207 Bacteria 2119
861 Ga0373961_0005873 3300035241 Bacteria 2949
862 Ga0373962_0000684 3300035242 Bacteria 7658
863 Ga0373962_0004790 3300035242 Bacteria 3266
864 Ga0316574_0007201 3300035398 Bacteria 6080
865 Ga0316574_0065256 3300035398 Bacteria 2292
866 Ga0373924_0000686 3300035410 Bacteria 10535
867 Ga0373924_0023112 3300035410 Bacteria 2435
868 Ga0373931_0000832 3300035691 Bacteria 12966
869 Ga0373931_0008912 3300035691 Bacteria 4780
870 Ga0373931_0016415 3300035691 Bacteria 3643
871 Ga0373935_0000131 3300035692 Bacteria 34019
872 Ga0373935_0005953 3300035692 Bacteria 7233
873 Ga0373935_0008740 3300035692 Bacteria 6069
874 Ga0373935_0015233 3300035692 Bacteria 4645
875 Ga0373935_0050879 3300035692 Bacteria 2630
876 Ga0373935_0073906 3300035692 Bacteria 2203
877 Ga0373935_0099940 3300035692 Bacteria 1911
878 Ga0373935_0195985 3300035692 Bacteria 1393
879 Ga0373927_0001598 3300035695 Bacteria 16984
880 Ga0373927_0013741 3300035695 Bacteria 5375
881 Ga0373927_0014431 3300035695 Bacteria 5228
882 Ga0373927_0025227 3300035695 Bacteria 3885
883 Ga0373927_0026721 3300035695 Bacteria 3772
884 Ga0373927_0032564 3300035695 Bacteria 3395
885 Ga0373933_0004580 3300035724 Bacteria 7571
886 Ga0373933_0014822 3300035724 Bacteria 4337
887 Ga0373933_0018214 3300035724 Bacteria 3947
888 Ga0373933_0050042 3300035724 Bacteria 2493
889 Ga0373947_0001677 3300035725 Bacteria 13553
890 Ga0373947_0002287 3300035725 Bacteria 11579
891 Ga0373947_0002523 3300035725 Bacteria 11003
892 Ga0373947_0013576 3300035725 Bacteria 4666
893 Ga0373947_0015845 3300035725 Bacteria 4330
894 Ga0373947_0028815 3300035725 Bacteria 3256
895 Ga0373947_0098428 3300035725 Bacteria 1835
896 Ga0373947_0105141 3300035725 Bacteria 1778
897 Ga0373947_0107546 3300035725 Bacteria 1759
898 Ga0373937_0000293 3300036401 Bacteria 47507
899 Ga0373937_0000907 3300036401 Bacteria 25212
900 Ga0373937_0001336 3300036401 Bacteria 20629
901 Ga0373937_0020586 3300036401 Bacteria 5914
902 Ga0373937_0024713 3300036401 Bacteria 5421
903 Ga0373937_0026411 3300036401 Bacteria 5247
904 Ga0373937_0041608 3300036401 Bacteria 4191
905 Ga0373937_0052057 3300036401 Bacteria 3753
906 Ga0373937_0067560 3300036401 Bacteria 3294
907 Ga0373937_0074856 3300036401 Bacteria 3125
908 Ga0316582_0134982 3300036647 Bacteria 1660
909 Ga0316584_0014165 3300036712 Bacteria 5667
910 Ga0316584_0016716 3300036712 Bacteria 5264
911 Ga0373925_0000087 3300037068 Bacteria 99043
912 Ga0373925_0007402 3300037068 Bacteria 8010
913 Ga0373925_0008544 3300037068 Bacteria 7462
914 Ga0373925_0009531 3300037068 Bacteria 7069
915 Ga0373925_0013371 3300037068 Bacteria 5939
916 Ga0373925_0014125 3300037068 Bacteria 5779
917 Ga0373925_0016683 3300037068 Bacteria 5318
918 Ga0373925_0053411 3300037068 Bacteria 3020
919 Ga0373925_0079028 3300037068 Bacteria 2498
920 Ga0373925_0087648 3300037068 Bacteria 2376
921 Ga0373925_0134921 3300037068 Bacteria 1928
922 Ga0395899_0013310 3300037312 Bacteria 6293
923 Ga0395900_0015919 3300037418 Bacteria 7662
924 Ga0395900_0024496 3300037418 Bacteria 6180
925 Ga0395900_0028027 3300037418 Bacteria 5767
926 Ga0395900_0044317 3300037418 Bacteria 4584
927 Ga0395900_0139623 3300037418 Bacteria 2482
928 Ga0395900_0280832 3300037418 Bacteria 1657
929 Ga0395898_0030804 3300037466 Bacteria 5366
930 Ga0395898_0046786 3300037466 Bacteria 4249
931 Ga0395898_0051497 3300037466 Bacteria 4026
932 Ga0395898_0136672 3300037466 Bacteria 2347
933 Ga0395898_0141147 3300037466 Bacteria 2306
934 Ga0395905_0210773 3300037471 Bacteria 1820
935 Ga0436364_1105330 3300037853 Bacteria 5632
936 Ga0436364_1228736 3300037853 Bacteria 4750
937 Ga0436364_1346974 3300037853 Bacteria 3423
938 Ga0395901_0017419 3300038443 Bacteria 7334
939 Ga0395901_0045424 3300038443 Bacteria 4558
940 Ga0400488_27481 3300038741 Bacteria 1563
941 Ga0400486_05920 3300038742 Bacteria 1718
942 Ga0436365_0156475 3300039437 Bacteria 37868
943 Ga0436365_0352932 3300039437 Bacteria 2187
944 Ga0436365_0356842 3300039437 Bacteria 18396
945 Ga0436365_0621937 3300039437 Bacteria 2046
946 Ga0436365_1392756 3300039437 Bacteria 4163
947 Ga0436361_0721014 3300039447 Bacteria 1338
948 Ga0436363_0077061 3300039450 Bacteria 9960
949 Ga0436363_0538450 3300039450 Bacteria 22269
950 Ga0436363_1324669 3300039450 Bacteria 1905
951 Ga0436363_1434115 3300039450 Bacteria 1632
952 Ga0436363_1520052 3300039450 Bacteria 6158
953 Ga0436362_0582461 3300039453 Bacteria 7924
954 Ga0436362_0668050 3300039453 Bacteria 5148
955 Ga0439453_0002956 3300041408 Bacteria 2400
956 Ga0439465_0007239 3300041413 Bacteria 3527
957 Ga0439448_0053025 3300042005 Bacteria 1330
958 Ga0439450_005169 3300042008 Bacteria 2279
959 Ga0439455_0005312 3300042012 Bacteria 2609
960 Ga0439463_004402 3300042016 Bacteria 3532
961 Ga0439435_0002684 3300042436 Bacteria 3577
962 Ga0439464_0003806 3300042439 Bacteria 3835
963 Ga0439440_0007885 3300042993 Bacteria 2174
964 Ga0466969_0031674 3300044656 Bacteria 2691
965 Ga0466965_0091243 3300044683 Bacteria 1550
966 Ga0466966_0000524 3300044684 Bacteria 24457
967 Ga0466966_0036712 3300044684 Bacteria 3163
968 Ga0466961_0000795 3300044693 Bacteria 19721
969 Ga0466963_0020679 3300044694 Bacteria 4141
970 Ga0466963_0083566 3300044694 Bacteria 2165
971 Ga0453684_0030479 3300044712 Bacteria 7619
972 Ga0466971_0081638 3300044719 Bacteria 1475
973 Ga0466971_0114284 3300044719 Bacteria 1247
974 Ga0451576_0064931 3300045051 Bacteria 3801
975 Ga0466967_0033042 3300045976 Bacteria 4376
976 Ga0466967_0198851 3300045976 Bacteria 1897
977 Ga0495592_0000001 3300046454 Bacteria 305819
978 Ga0495592_0001841 3300046454 Bacteria 14911
979 Ga0495592_0013967 3300046454 Bacteria 6099
980 Ga0495592_0033557 3300046454 Bacteria 3870
981 Ga0495592_0060163 3300046454 Bacteria 2794
982 Ga0495592_0122353 3300046454 Bacteria 1829
983 Ga0495603_0001190 3300046455 Bacteria 15171
984 Ga0495603_0009828 3300046455 Bacteria 5789
985 Ga0495603_0012015 3300046455 Bacteria 5242
986 Ga0495603_0035241 3300046455 Bacteria 3006
987 Ga0495603_0050838 3300046455 Bacteria 2464
988 Ga0495603_0081354 3300046455 Bacteria 1898
989 Ga0495603_0084110 3300046455 Bacteria 1863
990 Ga0495590_0054329 3300046457 Bacteria 1399
991 Ga0495629_0001140 3300046459 Bacteria 20980
992 Ga0495629_0001999 3300046459 Bacteria 15839
993 Ga0495629_0002775 3300046459 Bacteria 13386
994 Ga0495629_0004187 3300046459 Bacteria 10830
995 Ga0495629_0010498 3300046459 Bacteria 6737
996 Ga0495629_0012888 3300046459 Bacteria 6047
997 Ga0495629_0079117 3300046459 Bacteria 2295
998 Ga0495629_0176388 3300046459 Bacteria 1482
999 Ga0495638_0099888 3300046460 Bacteria 1736
1000 Ga0495641_0010906 3300046461 Bacteria 5222
1001 Ga0495641_0015118 3300046461 Bacteria 4142
1002 Ga0495651_0001352 3300046462 Bacteria 18966
1003 Ga0495651_0001675 3300046462 Bacteria 17143
1004 Ga0495651_0004254 3300046462 Bacteria 10975
1005 Ga0495651_0011156 3300046462 Bacteria 6909
1006 Ga0495651_0011201 3300046462 Bacteria 6892
1007 Ga0495651_0050646 3300046462 Bacteria 3203
1008 Ga0495651_0055722 3300046462 Bacteria 3037
1009 Ga0495651_0079504 3300046462 Bacteria 2478
1010 Ga0495651_0145529 3300046462 Bacteria 1714
1011 Ga0495653_0000015 3300046463 Bacteria 213697
1012 Ga0495653_0002480 3300046463 Bacteria 14680
1013 Ga0495653_0015503 3300046463 Bacteria 6211
1014 Ga0495653_0024482 3300046463 Bacteria 4864
1015 Ga0495653_0028470 3300046463 Bacteria 4467
1016 Ga0495653_0031990 3300046463 Bacteria 4180
1017 Ga0495653_0073254 3300046463 Bacteria 2556
1018 Ga0495653_0132237 3300046463 Bacteria 1765
1019 Ga0495653_0166647 3300046463 Bacteria 1524
1020 Ga0495580_0001797 3300046472 Bacteria 18844
1021 Ga0495580_0007274 3300046472 Bacteria 8902
1022 Ga0495580_0055036 3300046472 Bacteria 2804
1023 Ga0495580_0060482 3300046472 Bacteria 2661
1024 Ga0495582_0000379 3300046473 Bacteria 24152
1025 Ga0495582_0001266 3300046473 Bacteria 14206
1026 Ga0495582_0015534 3300046473 Bacteria 4182
1027 Ga0495582_0016954 3300046473 Bacteria 3988
1028 Ga0495582_0017780 3300046473 Bacteria 3886
1029 Ga0495582_0040384 3300046473 Bacteria 2570
1030 Ga0495582_0070927 3300046473 Bacteria 1928
1031 Ga0495582_0125974 3300046473 Bacteria 1445
1032 Ga0495639_0001456 3300046475 Bacteria 10575
1033 Ga0495639_0005394 3300046475 Bacteria 5505
1034 Ga0495639_0016315 3300046475 Bacteria 3223
1035 Ga0495639_0019184 3300046475 Bacteria 2983
1036 Ga0495662_0000546 3300046476 Bacteria 17257
1037 Ga0495662_0000957 3300046476 Bacteria 14125
1038 Ga0495662_0002259 3300046476 Bacteria 9706
1039 Ga0495662_0011084 3300046476 Bacteria 4404
1040 Ga0495662_0048054 3300046476 Bacteria 2060
1041 Ga0495664_0000001 3300046477 Bacteria 757730
1042 Ga0495664_0004745 3300046477 Bacteria 7431
1043 Ga0495664_0017355 3300046477 Bacteria 4113
1044 Ga0495664_0038399 3300046477 Bacteria 2827
1045 Ga0495664_0047781 3300046477 Bacteria 2540
1046 Ga0495664_0104693 3300046477 Bacteria 1705
1047 Ga0495664_0152003 3300046477 Bacteria 1404
1048 Ga0495664_0186930 3300046477 Bacteria 1256
1049 Ga0495584_0126509 3300046491 Bacteria 1296
1050 Ga0495584_0140992 3300046491 Bacteria 1224
1051 Ga0495585_0006641 3300046492 Bacteria 7150
1052 Ga0495594_0000628 3300046499 Bacteria 18193
1053 Ga0495594_0003379 3300046499 Bacteria 8250
1054 Ga0495594_0012022 3300046499 Bacteria 4506
1055 Ga0495594_0014248 3300046499 Bacteria 4162
1056 Ga0495594_0036536 3300046499 Bacteria 2679
1057 Ga0495607_0008588 3300046501 Bacteria 6974
1058 Ga0495607_0020117 3300046501 Bacteria 4225
1059 Ga0495608_0000066 3300046511 Bacteria 81664
1060 Ga0495608_0000442 3300046511 Bacteria 28963
1061 Ga0495608_0008363 3300046511 Bacteria 7254
1062 Ga0495608_0023088 3300046511 Bacteria 4264
1063 Ga0495608_0027103 3300046511 Bacteria 3901
1064 Ga0495608_0154623 3300046511 Bacteria 1460
1065 Ga0495610_0015826 3300046512 Bacteria 4366
1066 Ga0495616_0007418 3300046513 Bacteria 6563
1067 Ga0495616_0091344 3300046513 Bacteria 1441
1068 Ga0495618_0000021 3300046514 Bacteria 129750
1069 Ga0495618_0002560 3300046514 Bacteria 11655
1070 Ga0495618_0002632 3300046514 Bacteria 11483
1071 Ga0495618_0004146 3300046514 Bacteria 8948
1072 Ga0495618_0011384 3300046514 Bacteria 5393
1073 Ga0495618_0038302 3300046514 Bacteria 3012
1074 Ga0495628_0000005 3300046516 Bacteria 420969
1075 Ga0495628_0003222 3300046516 Bacteria 14635
1076 Ga0495628_0011329 3300046516 Bacteria 7547
1077 Ga0495628_0111604 3300046516 Bacteria 2102
1078 Ga0495628_0128179 3300046516 Bacteria 1943
1079 Ga0495630_0000254 3300046517 Bacteria 43049
1080 Ga0495630_0002564 3300046517 Bacteria 12597
1081 Ga0495630_0039762 3300046517 Bacteria 3516
1082 Ga0495630_0057574 3300046517 Bacteria 2913
1083 Ga0495630_0092975 3300046517 Bacteria 2279
1084 Ga0495630_0179692 3300046517 Bacteria 1613
1085 Ga0495630_0219843 3300046517 Bacteria 1450
1086 Ga0495630_0266997 3300046517 Bacteria 1307
1087 Ga0495631_0052300 3300046518 Bacteria 1784
1088 Ga0495644_0004713 3300046523 Bacteria 5360
1089 Ga0495648_0005337 3300046524 Bacteria 10711
1090 Ga0495666_0001574 3300046526 Bacteria 11221
1091 Ga0495666_0006471 3300046526 Bacteria 5896
1092 Ga0495666_0019193 3300046526 Bacteria 3396
1093 Ga0495652_0000001 3300046529 Bacteria 1045081
1094 Ga0495652_0003251 3300046529 Bacteria 16195
1095 Ga0495652_0014533 3300046529 Bacteria 7064
1096 Ga0495652_0016208 3300046529 Bacteria 6666
1097 Ga0495652_0050982 3300046529 Bacteria 3536
1098 Ga0495652_0076711 3300046529 Bacteria 2772
1099 Ga0495652_0089248 3300046529 Bacteria 2524
1100 Ga0495652_0102123 3300046529 Bacteria 2323
1101 Ga0495652_0152603 3300046529 Bacteria 1802
1102 Ga0495665_0000387 3300046531 Bacteria 22327
1103 Ga0495665_0004256 3300046531 Bacteria 7731
1104 Ga0495665_0009547 3300046531 Bacteria 5257
1105 Ga0495640_0000006 3300046533 Bacteria 285419
1106 Ga0495640_0006068 3300046533 Bacteria 9582
1107 Ga0495640_0014924 3300046533 Bacteria 5859
1108 Ga0495640_0019531 3300046533 Bacteria 4999
1109 Ga0495640_0045494 3300046533 Bacteria 3045
1110 Ga0495640_0060368 3300046533 Bacteria 2579
1111 Ga0495640_0072032 3300046533 Bacteria 2316
1112 Ga0495640_0140441 3300046533 Bacteria 1557
1113 Ga0495586_0016632 3300046535 Bacteria 3911
1114 Ga0495587_0000012 3300046536 Bacteria 197088
1115 Ga0495587_0001204 3300046536 Bacteria 17140
1116 Ga0495587_0003023 3300046536 Bacteria 11245
1117 Ga0495587_0012911 3300046536 Bacteria 5252
1118 Ga0495587_0033102 3300046536 Bacteria 3122
1119 Ga0495587_0044458 3300046536 Bacteria 2642
1120 Ga0495587_0147463 3300046536 Bacteria 1341
1121 Ga0495609_0042528 3300046538 Bacteria 2041
1122 Ga0495645_0000041 3300046543 Bacteria 92278
1123 Ga0495645_0001743 3300046543 Bacteria 14779
1124 Ga0495645_0003505 3300046543 Bacteria 10619
1125 Ga0495645_0020519 3300046543 Bacteria 4769
1126 Ga0495645_0069726 3300046543 Bacteria 2537
1127 Ga0495622_0024844 3300046557 Bacteria 2798
1128 Ga0495622_0028163 3300046557 Bacteria 2623
1129 Ga0495622_0029274 3300046557 Bacteria 2573
1130 Ga0495633_0016941 3300046558 Bacteria 3738
1131 Ga0495667_0000001 3300046559 Bacteria 834831
1132 Ga0495667_0000365 3300046559 Bacteria 28797
1133 Ga0495667_0001732 3300046559 Bacteria 14498
1134 Ga0495667_0006271 3300046559 Bacteria 8065
1135 Ga0495667_0010665 3300046559 Bacteria 6212
1136 Ga0495667_0011498 3300046559 Bacteria 5992
1137 Ga0495667_0041089 3300046559 Bacteria 3068
1138 Ga0495667_0048217 3300046559 Bacteria 2813
1139 Ga0495656_0000167 3300046615 Bacteria 23487
1140 Ga0495656_0122334 3300046615 Bacteria 1230
1141 Ga0495668_0087184 3300046616 Bacteria 1712
1142 Ga0495668_0164476 3300046616 Bacteria 1215
1143 Ga0495634_0000624 3300046642 Bacteria 34336
1144 Ga0495634_0002816 3300046642 Bacteria 14283
1145 Ga0495634_0003795 3300046642 Bacteria 12004
1146 Ga0495634_0005914 3300046642 Bacteria 9345
1147 Ga0495634_0008856 3300046642 Bacteria 7463
1148 Ga0495634_0018765 3300046642 Bacteria 4919
1149 Ga0495634_0039315 3300046642 Bacteria 3221
1150 Ga0495634_0137849 3300046642 Bacteria 1551
1151 Ga0495634_0162865 3300046642 Bacteria 1405
1152 Ga0495635_0000007 3300046663 Bacteria 278786
1153 Ga0495635_0000981 3300046663 Bacteria 18808
1154 Ga0495635_0001522 3300046663 Bacteria 15511
1155 Ga0495635_0002092 3300046663 Bacteria 13549
1156 Ga0495635_0012948 3300046663 Bacteria 5839
1157 Ga0495635_0016633 3300046663 Bacteria 5138
1158 Ga0495635_0019774 3300046663 Bacteria 4691
1159 Ga0495635_0028616 3300046663 Bacteria 3874
1160 Ga0495635_0033558 3300046663 Bacteria 3560
1161 Ga0495659_0000357 3300046664 Bacteria 17886
1162 Ga0495661_0027692 3300046665 Bacteria 3635
1163 Ga0495661_0052158 3300046665 Bacteria 2465
1164 Ga0495588_0015611 3300046674 Bacteria 3660
1165 Ga0495588_0077723 3300046674 Bacteria 1731
1166 Ga0495657_0000047 3300046675 Bacteria 104362
1167 Ga0495657_0007791 3300046675 Bacteria 8226
1168 Ga0495657_0013213 3300046675 Bacteria 6099
1169 Ga0495657_0032813 3300046675 Bacteria 3620
1170 Ga0495657_0063861 3300046675 Bacteria 2427
1171 Ga0495599_0000002 3300046678 Bacteria 348168
1172 Ga0495599_0005483 3300046678 Bacteria 7588
1173 Ga0495599_0018968 3300046678 Bacteria 4287
1174 Ga0495599_0073349 3300046678 Bacteria 2136
1175 Ga0495599_0188571 3300046678 Bacteria 1269
1176 Ga0495623_0000023 3300046679 Bacteria 96650
1177 Ga0495623_0000281 3300046679 Bacteria 33061
1178 Ga0495623_0025726 3300046679 Bacteria 3791
1179 Ga0495623_0072195 3300046679 Bacteria 2146
1180 Ga0495623_0128608 3300046679 Bacteria 1519
1181 Ga0495646_0000024 3300046680 Bacteria 107836
1182 Ga0495646_0000794 3300046680 Bacteria 17647
1183 Ga0495646_0006978 3300046680 Bacteria 7170
1184 Ga0495646_0008319 3300046680 Bacteria 6597
1185 Ga0495646_0010351 3300046680 Bacteria 5932
1186 Ga0495646_0018443 3300046680 Bacteria 4419
1187 Ga0495646_0078071 3300046680 Bacteria 1936
1188 Ga0495647_0000516 3300046681 Bacteria 11276
1189 Ga0495647_0000985 3300046681 Bacteria 8652
1190 Ga0495647_0010622 3300046681 Bacteria 3139
1191 Ga0495647_0010627 3300046681 Bacteria 3138
1192 Ga0495647_0012548 3300046681 Bacteria 2919
1193 Ga0495647_0042747 3300046681 Bacteria 1732
1194 Ga0495658_0000210 3300046683 Bacteria 33648
1195 Ga0495658_0001195 3300046683 Bacteria 13670
1196 Ga0495658_0023094 3300046683 Bacteria 3299
1197 Ga0495658_0060153 3300046683 Bacteria 2178
1198 Ga0495613_0013591 3300046689 Bacteria 6044
1199 Ga0495613_0015398 3300046689 Bacteria 5687
1200 Ga0495613_0018004 3300046689 Bacteria 5265
1201 Ga0495613_0064648 3300046689 Bacteria 2675
1202 Ga0495613_0073149 3300046689 Bacteria 2498
1203 Ga0495624_0003648 3300046690 Bacteria 11385
1204 Ga0495624_0004943 3300046690 Bacteria 9663
1205 Ga0495624_0030701 3300046690 Bacteria 3498
1206 Ga0495624_0032910 3300046690 Bacteria 3359
1207 Ga0495624_0137502 3300046690 Bacteria 1497
1208 Ga0495670_0002677 3300046691 Bacteria 8789
1209 Ga0495670_0004128 3300046691 Bacteria 7121
1210 Ga0495600_0000013 3300046809 Bacteria 119404
1211 Ga0495600_0000388 3300046809 Bacteria 22724
1212 Ga0495600_0002666 3300046809 Bacteria 10315
1213 Ga0495600_0011043 3300046809 Bacteria 5621
1214 Ga0495600_0044885 3300046809 Bacteria 2883
1215 Ga0495600_0047443 3300046809 Bacteria 2801
1216 Ga0495600_0098805 3300046809 Bacteria 1903
1217 Ga0495600_0099298 3300046809 Bacteria 1897
1218 Ga0495581_0001283 3300047315 Bacteria 13848
1219 Ga0495581_0001772 3300047315 Bacteria 12062
1220 Ga0495581_0003342 3300047315 Bacteria 9216
1221 Ga0495581_0029188 3300047315 Bacteria 3197
1222 Ga0495581_0167389 3300047315 Bacteria 1285
1223 Ga0495604_0000007 3300047317 Bacteria 412174
1224 Ga0495604_0000422 3300047317 Bacteria 38179
1225 Ga0495604_0002563 3300047317 Bacteria 14535
1226 Ga0495604_0004482 3300047317 Bacteria 11061
1227 Ga0495604_0014260 3300047317 Bacteria 6335
1228 Ga0495604_0026128 3300047317 Bacteria 4649
1229 Ga0495604_0029470 3300047317 Bacteria 4367
1230 Ga0495674_0000001 3300047319 Bacteria 778665
1231 Ga0495674_0001490 3300047319 Bacteria 22945
1232 Ga0495674_0004401 3300047319 Bacteria 13544
1233 Ga0495674_0008877 3300047319 Bacteria 9562
1234 Ga0495674_0009425 3300047319 Bacteria 9279
1235 Ga0495674_0015781 3300047319 Bacteria 7050
1236 Ga0495674_0022729 3300047319 Bacteria 5780
1237 Ga0495674_0045990 3300047319 Bacteria 3875
1238 Ga0495674_0049741 3300047319 Bacteria 3702
1239 Ga0495674_0060922 3300047319 Bacteria 3291
1240 Ga0495674_0069601 3300047319 Bacteria 3042
1241 Ga0495672_0019795 3300047320 Bacteria 4429
1242 Ga0495676_0006651 3300047321 Bacteria 10656
1243 Ga0495676_0025913 3300047321 Bacteria 5054
1244 Ga0495676_0045629 3300047321 Bacteria 3565
1245 Ga0495676_0081445 3300047321 Bacteria 2454
1246 Ga0495676_0221358 3300047321 Bacteria 1304
1247 Ga0495680_0001437 3300047322 Bacteria 25662
1248 Ga0495680_0002318 3300047322 Bacteria 19524
1249 Ga0495680_0006216 3300047322 Bacteria 11133
1250 Ga0495680_0006978 3300047322 Bacteria 10418
1251 Ga0495680_0010055 3300047322 Bacteria 8460
1252 Ga0495680_0012387 3300047322 Bacteria 7503
1253 Ga0495680_0031794 3300047322 Bacteria 4291
1254 Ga0495680_0045097 3300047322 Bacteria 3483
1255 Ga0495680_0059489 3300047322 Bacteria 2949
1256 Ga0495680_0192008 3300047322 Bacteria 1469
1257 Ga0495675_0000014 3300047444 Bacteria 137646
1258 Ga0495675_0003130 3300047444 Bacteria 9934
1259 Ga0495675_0015559 3300047444 Bacteria 4810
1260 Ga0495675_0016294 3300047444 Bacteria 4701
1261 Ga0495675_0110810 3300047444 Bacteria 1713
1262 Ga0495677_0044149 3300047445 Bacteria 1634
1263 Ga0495679_011554 3300047446 Bacteria 3401
1264 Ga0495684_0000027 3300047471 Bacteria 124367
1265 Ga0495684_0001385 3300047471 Bacteria 19460
1266 Ga0495684_0002100 3300047471 Bacteria 15987
1267 Ga0495684_0041636 3300047471 Bacteria 3520
1268 Ga0495684_0061574 3300047471 Bacteria 2855
1269 Ga0495684_0083196 3300047471 Bacteria 2427
1270 Ga0495684_0246151 3300047471 Bacteria 1302
1271 Ga0495686_0022878 3300047472 Bacteria 4130
1272 Ga0495686_0147645 3300047472 Bacteria 1383
1273 Ga0495593_0001105 3300047673 Bacteria 15740
1274 Ga0495593_0002819 3300047673 Bacteria 10465
1275 Ga0495593_0013949 3300047673 Bacteria 4577
1276 Ga0495593_0019288 3300047673 Bacteria 3823
1277 Ga0495593_0026134 3300047673 Bacteria 3226
1278 Ga0495593_0041838 3300047673 Bacteria 2462
1279 Ga0495593_0112767 3300047673 Bacteria 1387
1280 Ga0495602_0000004 3300048088 Bacteria 326932
1281 Ga0495602_0004101 3300048088 Bacteria 15167
1282 Ga0495602_0004126 3300048088 Bacteria 15131
1283 Ga0495602_0015358 3300048088 Bacteria 7733
1284 Ga0495602_0024539 3300048088 Bacteria 5850
1285 Ga0495602_0037412 3300048088 Bacteria 4505
1286 Ga0495614_0043135 3300048089 Bacteria 1934
1287 Ga0495614_0094754 3300048089 Bacteria 1301
1288 Ga0496100_0000759 3300048903 Bacteria 15303
1289 Ga0496100_0002801 3300048903 Bacteria 8925
1290 Ga0496100_0004107 3300048903 Bacteria 7679
1291 Ga0496100_0004431 3300048903 Bacteria 7442
1292 Ga0496101_0000351 3300048904 Bacteria 31046
1293 Ga0496101_0006685 3300048904 Bacteria 7435
1294 Ga0496101_0109431 3300048904 Bacteria 2078
1295 Ga0496101_0124871 3300048904 Bacteria 1949
1296 Ga0496102_0007915 3300048905 Bacteria 9084
1297 Ga0496102_0012361 3300048905 Bacteria 7388
1298 Ga0496102_0015414 3300048905 Bacteria 6657
1299 Ga0496102_0062698 3300048905 Bacteria 3404
1300 Ga0496102_0069583 3300048905 Bacteria 3230
1301 Ga0496102_0174949 3300048905 Bacteria 2021
1302 Ga0496103_0000998 3300048906 Bacteria 19896
1303 Ga0496103_0024424 3300048906 Bacteria 3649
1304 Ga0496104_0001036 3300048907 Bacteria 23773
1305 Ga0496104_0005252 3300048907 Bacteria 11322
1306 Ga0496104_0030422 3300048907 Bacteria 5017
1307 Ga0496104_0044027 3300048907 Bacteria 4194
1308 Ga0496104_0068258 3300048907 Bacteria 3378
1309 Ga0496104_0110000 3300048907 Bacteria 2641
1310 Ga0496104_0124548 3300048907 Bacteria 2474
1311 Ga0496105_0003481 3300048908 Bacteria 11650
1312 Ga0496105_0025477 3300048908 Bacteria 4814
1313 Ga0496105_0033535 3300048908 Bacteria 4217
1314 Ga0496106_0006851 3300048909 Bacteria 8435
1315 Ga0496106_0015179 3300048909 Bacteria 5700
1316 Ga0496106_0024213 3300048909 Bacteria 4512
1317 Ga0496106_0059357 3300048909 Bacteria 2898
1318 Ga0496106_0148896 3300048909 Bacteria 1845
1319 Ga0496106_0187769 3300048909 Bacteria 1642
1320 Ga0496107_0001455 3300048910 Bacteria 14645
1321 Ga0496107_0006115 3300048910 Bacteria 8270
1322 Ga0496107_0010499 3300048910 Bacteria 6436
1323 Ga0496107_0022779 3300048910 Bacteria 4428
1324 Ga0496107_0029566 3300048910 Bacteria 3899
1325 Ga0496108_0000643 3300048911 Bacteria 27192
1326 Ga0496108_0007552 3300048911 Bacteria 8810
1327 Ga0496108_0018138 3300048911 Bacteria 5758
1328 Ga0496108_0025776 3300048911 Bacteria 4848
1329 Ga0496108_0031626 3300048911 Bacteria 4392
1330 Ga0496108_0048205 3300048911 Bacteria 3561
1331 Ga0496108_0148532 3300048911 Bacteria 2022
1332 Ga0496109_0000359 3300048912 Bacteria 42297
1333 Ga0496109_0000976 3300048912 Bacteria 23658
1334 Ga0496109_0002174 3300048912 Bacteria 16294
1335 Ga0496109_0004488 3300048912 Bacteria 11664
1336 Ga0496109_0005374 3300048912 Bacteria 10705
1337 Ga0496109_0026508 3300048912 Bacteria 5169
1338 Ga0496109_0026931 3300048912 Bacteria 5128
1339 Ga0496109_0031587 3300048912 Bacteria 4754
1340 Ga0496109_0166736 3300048912 Bacteria 2065
1341 Ga0496110_0020531 3300048913 Bacteria 5578
1342 Ga0496110_0071193 3300048913 Bacteria 3083
1343 Ga0496110_0104271 3300048913 Bacteria 2544
1344 Ga0496110_0300022 3300048913 Bacteria 1463
1345 Ga0496111_0019946 3300048914 Bacteria 4663
1346 Ga0496111_0025729 3300048914 Bacteria 4152
1347 Ga0496111_0040961 3300048914 Bacteria 3323
1348 Ga0496111_0221339 3300048914 Bacteria 1406
1349 Ga0496112_0000008 3300048915 Bacteria 310323
1350 Ga0496112_0006455 3300048915 Bacteria 10294
1351 Ga0496112_0013996 3300048915 Bacteria 7424
1352 Ga0496112_0015924 3300048915 Bacteria 7027
1353 Ga0496112_0031659 3300048915 Bacteria 5132
1354 Ga0496112_0064226 3300048915 Bacteria 3622
1355 Ga0496112_0065980 3300048915 Bacteria 3572
1356 Ga0496112_0116480 3300048915 Bacteria 2643
1357 Ga0496112_0166345 3300048915 Bacteria 2171
1358 Ga0496112_0258513 3300048915 Bacteria 1691
1359 Ga0496112_0327625 3300048915 Bacteria 1475
1360 Ga0496113_0000533 3300048916 Bacteria 18753
1361 Ga0496113_0002168 3300048916 Bacteria 11333
1362 Ga0496113_0003135 3300048916 Bacteria 9839
1363 Ga0496113_0015918 3300048916 Bacteria 5183
1364 Ga0496113_0038507 3300048916 Bacteria 3516
1365 Ga0496113_0054420 3300048916 Bacteria 2996
1366 Ga0496114_0035566 3300048917 Bacteria 4113
1367 Ga0496114_0038438 3300048917 Bacteria 3960
1368 Ga0496114_0058816 3300048917 Bacteria 3210
1369 Ga0496114_0127032 3300048917 Bacteria 2199
1370 Ga0496114_0146287 3300048917 Bacteria 2048
1371 Ga0496114_0194068 3300048917 Bacteria 1777
1372 Ga0496114_0381658 3300048917 Bacteria 1247
1373 Ga0496115_0001160 3300048918 Bacteria 18961
1374 Ga0496115_0002750 3300048918 Bacteria 12640
1375 Ga0496115_0008610 3300048918 Bacteria 7554
1376 Ga0496115_0014364 3300048918 Bacteria 5994
1377 Ga0496115_0020665 3300048918 Bacteria 5079
1378 Ga0496115_0037010 3300048918 Bacteria 3866
1379 Ga0496115_0037987 3300048918 Bacteria 3819
1380 Ga0496115_0074660 3300048918 Bacteria 2753
1381 Ga0496115_0148844 3300048918 Bacteria 1932
1382 Ga0496115_0196383 3300048918 Bacteria 1667
1383 Ga0496116_0001381 3300048919 Bacteria 27411
1384 Ga0496117_0071314 3300048920 Bacteria 2329
1385 Ga0496117_0096234 3300048920 Bacteria 1889
1386 Ga0496118_0039843 3300048921 Bacteria 3743
1387 Ga0496118_0043118 3300048921 Bacteria 3551
1388 Ga0496118_0082381 3300048921 Bacteria 2254
1389 Ga0496119_0002237 3300048922 Bacteria 21538
1390 Ga0496119_0039685 3300048922 Bacteria 3023
1391 Ga0496121_0001934 3300048924 Bacteria 33033
1392 Ga0496121_0004951 3300048924 Bacteria 17472
1393 Ga0496121_0008559 3300048924 Bacteria 11991
1394 Ga0496121_0012773 3300048924 Bacteria 9097
1395 Ga0496121_0061811 3300048924 Bacteria 3071
1396 Ga0496121_0074916 3300048924 Bacteria 2705
1397 Ga0496121_0129371 3300048924 Bacteria 1893
1398 Ga0496121_0132298 3300048924 Bacteria 1864
1399 Ga0496122_0000624 3300048925 Bacteria 72348
1400 Ga0496122_0078647 3300048925 Bacteria 2309
1401 Ga0496123_0000569 3300048926 Bacteria 63009
1402 Ga0496124_0009281 3300048927 Bacteria 10143
1403 Ga0496125_0000063 3300048928 Bacteria 250260
1404 Ga0496125_0000829 3300048928 Bacteria 49885
1405 Ga0496125_0003409 3300048928 Bacteria 19321
1406 Ga0496125_0008104 3300048928 Bacteria 11066
1407 Ga0496125_0050358 3300048928 Bacteria 3449
1408 Ga0496125_0060665 3300048928 Bacteria 3038
1409 Ga0496126_0090086 3300048929 Bacteria 2699
1410 Ga0496126_0096775 3300048929 Bacteria 2587
1411 Ga0496126_0115143 3300048929 Bacteria 2338
1412 Ga0496126_0160985 3300048929 Bacteria 1918
1413 Ga0501031_0000296 3300049568 Bacteria 28394
1414 Ga0501032_0000244 3300049569 Bacteria 45114
1415 Ga0501032_0055262 3300049569 Bacteria 2670
1416 Ga0501033_0001015 3300049570 Bacteria 25486
1417 Ga0501033_0030771 3300049570 Bacteria 4033
1418 Ga0501033_0131470 3300049570 Bacteria 1813
1419 Ga0501034_0001010 3300049571 Bacteria 40327
1420 Ga0501034_0041774 3300049571 Bacteria 4640
1421 Ga0501034_0096808 3300049571 Bacteria 2947
1422 Ga0501034_0164405 3300049571 Bacteria 2188
1423 Ga0501034_0210784 3300049571 Bacteria 1898
1424 Ga0501034_0382279 3300049571 Bacteria 1333
1425 Ga0501034_0492565 3300049571 Bacteria 1140
1426 Ga0501036_0000405 3300049572 Bacteria 30399
1427 Ga0501036_0043680 3300049572 Bacteria 3796
1428 Ga0501036_0058962 3300049572 Bacteria 3252
1429 Ga0501036_0083358 3300049572 Bacteria 2702
1430 Ga0501037_0000139 3300049573 Bacteria 67890
1431 Ga0501037_0051819 3300049573 Bacteria 3001
1432 Ga0501037_0115164 3300049573 Bacteria 1935
1433 Ga0501038_0000404 3300049574 Bacteria 37454
1434 Ga0501038_0024056 3300049574 Bacteria 5437
1435 Ga0501038_0042165 3300049574 Bacteria 3975
1436 Ga0501038_0054679 3300049574 Bacteria 3432
1437 Ga0501038_0339167 3300049574 Bacteria 1172
1438 Ga0501039_0030683 3300049575 Bacteria 4145
1439 Ga0501039_0270729 3300049575 Bacteria 1335
1440 Ga0501040_0039520 3300049576 Bacteria 3208
1441 Ga0501041_0052106 3300049577 Bacteria 2495
1442 Ga0501041_0075333 3300049577 Bacteria 2075
1443 Ga0501042_0107777 3300049578 Bacteria 2005
1444 Ga0501043_0000021 3300049579 Bacteria 155025
1445 Ga0501043_0029175 3300049579 Bacteria 4332
1446 Ga0501043_0041962 3300049579 Bacteria 3594
1447 Ga0501043_0064795 3300049579 Bacteria 2869
1448 Ga0501043_0138582 3300049579 Bacteria 1905
1449 Ga0501046_0000905 3300049580 Bacteria 28947
1450 Ga0501046_0041933 3300049580 Bacteria 3649
1451 Ga0501046_0090980 3300049580 Bacteria 2347
1452 Ga0501046_0167050 3300049580 Bacteria 1653
1453 Ga0501047_0000041 3300049581 Bacteria 184355
1454 Ga0501047_0094992 3300049581 Bacteria 2860
1455 Ga0501047_0096235 3300049581 Bacteria 2839
1456 Ga0501047_0104574 3300049581 Bacteria 2711
1457 Ga0501047_0113080 3300049581 Bacteria 2597
1458 Ga0501047_0156960 3300049581 Bacteria 2149
1459 Ga0501048_0000077 3300049582 Bacteria 51021
1460 Ga0501048_0003551 3300049582 Bacteria 11855
1461 Ga0501048_0027330 3300049582 Bacteria 4148
1462 Ga0501067_0000360 3300049583 Bacteria 24898
1463 Ga0501067_0000771 3300049583 Bacteria 17207
1464 Ga0501067_0011133 3300049583 Bacteria 4975
1465 Ga0501067_0027958 3300049583 Bacteria 3126
1466 Ga0501067_0075829 3300049583 Bacteria 1863
1467 Ga0501069_0000444 3300049585 Bacteria 18810
1468 Ga0501070_0002561 3300049586 Bacteria 15914
1469 Ga0501070_0008055 3300049586 Bacteria 8919
1470 Ga0501070_0068849 3300049586 Bacteria 2930
1471 Ga0501070_0088098 3300049586 Bacteria 2569
1472 Ga0501072_0007776 3300049588 Bacteria 8142
1473 Ga0501072_0010225 3300049588 Bacteria 7148
1474 Ga0501072_0083803 3300049588 Bacteria 2527
1475 Ga0501073_0001489 3300049589 Bacteria 17352
1476 Ga0501073_0020718 3300049589 Bacteria 4742
1477 Ga0501073_0025360 3300049589 Bacteria 4252
1478 Ga0501073_0037651 3300049589 Bacteria 3432
1479 Ga0501074_0001762 3300049590 Bacteria 14778
1480 Ga0501074_0077587 3300049590 Bacteria 2384
1481 Ga0501074_0082198 3300049590 Bacteria 2310
1482 Ga0501074_0083318 3300049590 Bacteria 2292
1483 Ga0501076_0061488 3300049592 Bacteria 2989
1484 Ga0501076_0284849 3300049592 Bacteria 1354
1485 Ga0501077_0002633 3300049593 Bacteria 10750
1486 Ga0501077_0004224 3300049593 Bacteria 8679
1487 Ga0501077_0006796 3300049593 Bacteria 7039
1488 Ga0501077_0011452 3300049593 Bacteria 5540
1489 Ga0501079_0002042 3300049741 Bacteria 14462
1490 Ga0501079_0038773 3300049741 Bacteria 3674
1491 Ga0501079_0039035 3300049741 Bacteria 3662
1492 Ga0501079_0137642 3300049741 Bacteria 1902
1493 Ga0501079_0238025 3300049741 Bacteria 1422
1494 Ga0501080_0108320 3300049742 Bacteria 2575
1495 Ga0501080_0121593 3300049742 Bacteria 2419
1496 Ga0501080_0154419 3300049742 Bacteria 2120
1497 Ga0501080_0192634 3300049742 Bacteria 1873
1498 Ga0501080_0292089 3300049742 Bacteria 1480
1499 Ga0501081_0006165 3300049743 Bacteria 7764
1500 Ga0501081_0054467 3300049743 Bacteria 2764
1501 Ga0501083_0000708 3300049744 Bacteria 21721
1502 Ga0501083_0002409 3300049744 Bacteria 12787
1503 Ga0501083_0005494 3300049744 Bacteria 8979
1504 Ga0501083_0059136 3300049744 Bacteria 2564
1505 Ga0501083_0072999 3300049744 Bacteria 2280
1506 Ga0501035_0000090 3300049822 Bacteria 112445
1507 Ga0501035_0000267 3300049822 Bacteria 61712
1508 Ga0501035_0021609 3300049822 Bacteria 5918
1509 Ga0501035_0121893 3300049822 Bacteria 2278
1510 Ga0501035_0174629 3300049822 Bacteria 1854
1511 Ga0501035_0183049 3300049822 Bacteria 1804
1512 Ga0501035_0332735 3300049822 Bacteria 1274
1513 Ga0501044_0000054 3300049823 Bacteria 141399
1514 Ga0501044_0036131 3300049823 Bacteria 5169
1515 Ga0501044_0040089 3300049823 Bacteria 4883
1516 Ga0501044_0077406 3300049823 Bacteria 3373
1517 Ga0501044_0136394 3300049823 Bacteria 2445
1518 Ga0501044_0148209 3300049823 Bacteria 2330
1519 Ga0501044_0211473 3300049823 Bacteria 1894
1520 Ga0501044_0247679 3300049823 Bacteria 1724
1521 Ga0501045_0007035 3300049824 Bacteria 7799
1522 Ga0501045_0008407 3300049824 Bacteria 7195
1523 Ga0501045_0012653 3300049824 Bacteria 5941
1524 Ga0501045_0066126 3300049824 Bacteria 2655
1525 nmdc:mga03n38_10860_c1 3300050490 Bacteria 3369
1526 nmdc:mga03n38_151332_c1 3300050490 Bacteria 1168
1527 nmdc:mga03n38_18250_c1 3300050490 Bacteria 2766
1528 nmdc:mga03n38_2618_c1 3300050490 Bacteria 5611
1529 nmdc:mga03n38_5130_c1 3300050490 Bacteria 4425
1530 nmdc:mga00v17_161450_c1 3300050491 Bacteria 1443
1531 nmdc:mga00v17_194944_c1 3300050491 Bacteria 1309
1532 nmdc:mga00v17_204192_c1 3300050491 Bacteria 1278
1533 nmdc:mga00v17_91310_c1 3300050491 Bacteria 1913
1534 nmdc:mga00v17_9734_c1 3300050491 Bacteria 5216
1535 nmdc:mga0yw44_100983_c1 3300050492 Bacteria 1838
1536 nmdc:mga0yw44_121307_c1 3300050492 Bacteria 1318
1537 nmdc:mga0yw44_131569_c1 3300050492 Bacteria 1620
1538 nmdc:mga0yw44_151537_c1 3300050492 Bacteria 1513
1539 nmdc:mga0yw44_18270_c1 3300050492 Bacteria 3835
1540 nmdc:mga0yw44_31020_c1 3300050492 Bacteria 3104
1541 nmdc:mga0yw44_78344_c1 3300050492 Bacteria 2067
1542 nmdc:mga0k408_222223_c1 3300050493 Bacteria 1127
1543 nmdc:mga0k408_77720_c1 3300050493 Bacteria 1941
1544 nmdc:mga06z11_1223_c1 3300050494 Bacteria 9481
1545 nmdc:mga06z11_2319_c1 3300050494 Bacteria 7245
1546 nmdc:mga06z11_44560_c1 3300050494 Bacteria 2238
1547 nmdc:mga04h51_39942_c1 3300050495 Bacteria 1527
1548 nmdc:mga07m45_62632_c1 3300050496 Bacteria 2108
1549 nmdc:mga07m45_9394_c1 3300050496 Bacteria 5071
1550 nmdc:mga05p37_102_c1 3300050507 Bacteria 69207
1551 nmdc:mga05p37_103644_c1 3300050507 Bacteria 3501
1552 nmdc:mga05p37_124_c1 3300050507 Bacteria 69907
1553 nmdc:mga05p37_322101_c1 3300050507 Bacteria 1829
1554 nmdc:mga09592_14658_c1 3300050508 Bacteria 6396
1555 nmdc:mga09592_3352_c3 3300050508 Bacteria 7345
1556 nmdc:mga09592_752_c1 3300050508 Bacteria 24935
1557 nmdc:mga0qj67_119_c1 3300050509 Bacteria 51910
1558 nmdc:mga06r32_1767_c1 3300050510 Bacteria 19402
1559 nmdc:mga06r32_621_c1 3300050510 Bacteria 30912
1560 nmdc:mga06r32_847_c1 3300050510 Bacteria 27075
1561 nmdc:mga08y16_1991_c1 3300050511 Bacteria 20864
1562 nmdc:mga08y16_30913_c1 3300050511 Bacteria 5631
1563 nmdc:mga08y16_3532_c1 3300050511 Bacteria 16232
1564 nmdc:mga0n895_1270_c1 3300050512 Bacteria 18661
1565 nmdc:mga0n895_192896_c1 3300050512 Bacteria 2068
1566 nmdc:mga0n895_2196_c1 3300050512 Bacteria 15097
1567 nmdc:mga0n895_45416_c1 3300050512 Bacteria 4287
1568 nmdc:mga0n895_90744_c1 3300050512 Bacteria 3058
1569 nmdc:mga0n895_97669_c1 3300050512 Bacteria 2943
1570 nmdc:mga0rr50_115027_c1 3300050513 Bacteria 2134
1571 nmdc:mga0rr50_187439_c1 3300050513 Bacteria 1694
1572 nmdc:mga0rr50_22191_c1 3300050513 Bacteria 4352
1573 nmdc:mga0rr50_54179_c1 3300050513 Bacteria 2987
1574 nmdc:mga0rr50_55627_c1 3300050513 Bacteria 2953
1575 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
1576 nmdc:mga0a205_146535_c1 3300050515 Bacteria 2261
1577 nmdc:mga0a205_1990_c1 3300050515 Bacteria 17809
1578 nmdc:mga0a205_421_c1 3300050515 Bacteria 32493
1579 nmdc:mga0a205_58386_c1 3300050515 Bacteria 3727
1580 Ga0495601_0000006 3300053077 Bacteria 373770
1581 Ga0495601_0000549 3300053077 Bacteria 19855
1582 Ga0495601_0002952 3300053077 Bacteria 9664
1583 Ga0495601_0003050 3300053077 Bacteria 9548
1584 Ga0495601_0003088 3300053077 Bacteria 9504
1585 Ga0495601_0015181 3300053077 Bacteria 4654
1586 Ga0495601_0016054 3300053077 Bacteria 4531
1587 Ga0495601_0019185 3300053077 Bacteria 4169
1588 Ga0495601_0036801 3300053077 Bacteria 3058
1589 Ga0495601_0039165 3300053077 Bacteria 2967
1590 Ga0495601_0043124 3300053077 Bacteria 2833
1591 Ga0495601_0044633 3300053077 Bacteria 2786
1592 Ga0495601_0044749 3300053077 Bacteria 2782
1593 Ga0495601_0085039 3300053077 Bacteria 2032
1594 Ga0495612_0000004 3300053078 Bacteria 286946
1595 Ga0495612_0000786 3300053078 Bacteria 12913
1596 Ga0495612_0001076 3300053078 Bacteria 11181
1597 Ga0495612_0010919 3300053078 Bacteria 3669
1598 Ga0495612_0011648 3300053078 Bacteria 3544
1599 Ga0495612_0015944 3300053078 Bacteria 3011
1600 Ga0495612_0056308 3300053078 Bacteria 1622
1601 Ga0495612_0071921 3300053078 Bacteria 1443
1602 Ga0495595_0000006 3300053084 Bacteria 231295
1603 Ga0495595_0000223 3300053084 Bacteria 22663
1604 Ga0495595_0000603 3300053084 Bacteria 13668
1605 Ga0495595_0000984 3300053084 Bacteria 10988
1606 Ga0495595_0001629 3300053084 Bacteria 8778
1607 Ga0495595_0002822 3300053084 Bacteria 6832
1608 Ga0495595_0006421 3300053084 Bacteria 4795
1609 Ga0495595_0022366 3300053084 Bacteria 2775
1610 Ga0495595_0028170 3300053084 Bacteria 2508
1611 Ga0495595_0105066 3300053084 Bacteria 1365
1612 Ga0495619_0000011 3300053085 Bacteria 287128
1613 Ga0495619_0000229 3300053085 Bacteria 40785
1614 Ga0495619_0001087 3300053085 Bacteria 17853
1615 Ga0495619_0001121 3300053085 Bacteria 17592
1616 Ga0495619_0001556 3300053085 Bacteria 15090
1617 Ga0495619_0001653 3300053085 Bacteria 14709
1618 Ga0495619_0005901 3300053085 Bacteria 7760
1619 Ga0495619_0006095 3300053085 Bacteria 7634
1620 Ga0495619_0010207 3300053085 Bacteria 5915
1621 Ga0495619_0023993 3300053085 Bacteria 3911
1622 Ga0495619_0080845 3300053085 Bacteria 2187
1623 Ga0495619_0109671 3300053085 Bacteria 1885
1624 Ga0495619_0126123 3300053085 Bacteria 1757
1625 Ga0495619_0159242 3300053085 Bacteria 1559
1626 Ga0495619_0264599 3300053085 Bacteria 1192
1627 Ga0500578_0076118 3300053086 Bacteria 2137
1628 Ga0500643_002090 3300053087 Bacteria 10629
1629 Ga0500643_019553 3300053087 Bacteria 2227
1630 Ga0500644_0000716 3300053088 Bacteria 11750
1631 Ga0500644_0009687 3300053088 Bacteria 2585
1632 Ga0500646_0008367 3300053090 Bacteria 2645
1633 Ga0500651_0013266 3300053093 Bacteria 5015
1634 Ga0500651_0031175 3300053093 Bacteria 3358
1635 Ga0500651_0105146 3300053093 Bacteria 1728
1636 Ga0500566_0001394 3300053094 Bacteria 14132
1637 Ga0500566_0032406 3300053094 Bacteria 3048
1638 Ga0500566_0070936 3300053094 Bacteria 1955
1639 Ga0500641_0005584 3300053096 Bacteria 4454
1640 Ga0500641_0007479 3300053096 Bacteria 3897
1641 Ga0500641_0010283 3300053096 Bacteria 3377
1642 Ga0500650_0001791 3300053098 Bacteria 6706
1643 Ga0500650_0022327 3300053098 Bacteria 2799
1644 Ga0500556_0000015 3300053104 Bacteria 202598
1645 Ga0500556_0000036 3300053104 Bacteria 144864
1646 Ga0500569_019211 3300053109 Bacteria 1775
1647 Ga0500572_004035 3300053111 Bacteria 3338
1648 Ga0500592_006308 3300053116 Bacteria 1889
1649 Ga0500595_000083 3300053119 Bacteria 66474
1650 Ga0500595_003722 3300053119 Bacteria 7033
1651 Ga0500595_005423 3300053119 Bacteria 5567
1652 Ga0500607_064381 3300053121 Bacteria 1909
1653 Ga0500608_015771 3300053122 Bacteria 3402
1654 Ga0500642_0000044 3300053130 Bacteria 82877
1655 Ga0500642_0012395 3300053130 Bacteria 3090
1656 Ga0500652_000006 3300053131 Bacteria 167437
1657 Ga0500652_000639 3300053131 Bacteria 11973
1658 Ga0500652_016010 3300053131 Bacteria 2719
1659 Ga0500559_0000130 3300053136 Bacteria 58494
1660 Ga0500559_0000596 3300053136 Bacteria 24584
1661 Ga0500559_0017573 3300053136 Bacteria 3020
1662 Ga0500568_0006894 3300053139 Bacteria 5646
1663 Ga0500568_0027980 3300053139 Bacteria 2353
1664 Ga0500577_0000032 3300053142 Bacteria 33173
1665 Ga0500586_002283 3300053145 Bacteria 4278
1666 Ga0500603_038286 3300053150 Bacteria 1269
1667 Ga0500604_0000656 3300053151 Bacteria 9492
1668 Ga0500616_0000041 3300053153 Bacteria 359328
1669 Ga0500616_0000084 3300053153 Bacteria 195562
1670 Ga0500616_0008359 3300053153 Bacteria 6439
1671 Ga0500622_0063860 3300053156 Bacteria 1873
1672 Ga0500634_0079328 3300053161 Bacteria 1696
1673 Ga0500639_002824 3300053163 Bacteria 8739
1674 Ga0500636_0000047 3300053177 Bacteria 62796
1675 Ga0500636_0003542 3300053177 Bacteria 8790
1676 Ga0500636_0010447 3300053177 Bacteria 5417
1677 Ga0500645_001743 3300053730 Bacteria 10554
1678 Ga0500645_015410 3300053730 Bacteria 2421
1679 Ga0500645_018168 3300053730 Bacteria 2198
1680 Ga0500645_031589 3300053730 Bacteria 1590
1681 Ga0501084_0031729 3300054114 Bacteria 4418
1682 Ga0501084_0032546 3300054114 Bacteria 4362
1683 Ga0501084_0085733 3300054114 Bacteria 2644
1684 Ga0501084_0215866 3300054114 Bacteria 1618
1685 Ga0501084_0283099 3300054114 Bacteria 1400
1686 Ga0501082_0001613 3300060353 Bacteria 19861
1687 Ga0501082_0004836 3300060353 Bacteria 11746
1688 Ga0501082_0026365 3300060353 Bacteria 5007
1689 Ga0501082_0039669 3300060353 Bacteria 4062
1690 Ga0501082_0043153 3300060353 Bacteria 3888
1691 Ga0501082_0052291 3300060353 Bacteria 3521
1692 Ga0501082_0137353 3300060353 Bacteria 2121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0283099 Ga0501084_0283099_383_1363 307
2 3300006038 Ga0075365_10222012 Ga0075365_102220122 308
3 3300050492 nmdc:mga0yw44_121307_c1 nmdc:mga0yw44_121307_c1_310_1296 308
4 3300046459 Ga0495629_0176388 Ga0495629_0176388_307_1353 317
5 3300049823 Ga0501044_0136394 Ga0501044_0136394_673_1707 320
6 3300046683 Ga0495658_0023094 Ga0495658_0023094_1435_2409 323
7 3300005981 Ga0081538_10020591 Ga0081538_100205915 324
8 3300053131 Ga0500652_016010 Ga0500652_016010_51_1028 325
9 3300005548 Ga0070665_100006275 Ga0070665_1000062759 326
10 3300028379 Ga0268266_10009846 Ga0268266_100098466 326
11 3300047673 Ga0495593_0112767 Ga0495593_0112767_34_1014 326
12 3300050490 nmdc:mga03n38_151332_c1 nmdc:mga03n38_151332_c1_139_1119 326
13 3300031249 Ga0265339_10011755 Ga0265339_100117554 327
14 3300031241 Ga0265325_10006932 Ga0265325_100069325 328
15 3300049571 Ga0501034_0492565 Ga0501034_0492565_103_1098 329
16 3300005364 Ga0070673_100081869 Ga0070673_1000818693 330
17 3300005983 Ga0081540_1000585 Ga0081540_100058520 330
18 3300048924 Ga0496121_0004951 Ga0496121_0004951_16071_17186 330
19 3300035111 Ga0373923_0005521 Ga0373923_0005521_1301_2506 331
20 3300035117 Ga0373953_0001305 Ga0373953_0001305_2773_3978 331
21 3300035118 Ga0373954_0018425 Ga0373954_0018425_61_1194 331
22 3300035120 Ga0373957_0019954 Ga0373957_0019954_1178_2311 331
23 3300035170 Ga0373943_0011759 Ga0373943_0011759_2342_3547 331
24 3300035172 Ga0373955_0000213 Ga0373955_0000213_21473_22678 331
25 3300035410 Ga0373924_0000686 Ga0373924_0000686_8721_9926 331
26 3300035692 Ga0373935_0000131 Ga0373935_0000131_12309_13514 331
27 3300035695 Ga0373927_0025227 Ga0373927_0025227_1403_2608 331
28 3300035725 Ga0373947_0002523 Ga0373947_0002523_7158_8363 331
29 3300036401 Ga0373937_0000293 Ga0373937_0000293_33829_35034 331
30 3300037068 Ga0373925_0000087 Ga0373925_0000087_67129_68334 331
31 3300046454 Ga0495592_0000001 Ga0495592_0000001_278447_279652 331
32 3300046459 Ga0495629_0010498 Ga0495629_0010498_3932_5137 331
33 3300046462 Ga0495651_0001675 Ga0495651_0001675_5541_6746 331
34 3300046463 Ga0495653_0000015 Ga0495653_0000015_40736_41941 331
35 3300046476 Ga0495662_0000957 Ga0495662_0000957_2051_3256 331
36 3300046477 Ga0495664_0000001 Ga0495664_0000001_36708_37913 331
37 3300046511 Ga0495608_0000066 Ga0495608_0000066_13219_14424 331
38 3300046514 Ga0495618_0000021 Ga0495618_0000021_5618_6823 331
39 3300046516 Ga0495628_0000005 Ga0495628_0000005_288709_289914 331
40 3300046517 Ga0495630_0000254 Ga0495630_0000254_6430_7635 331
41 3300046529 Ga0495652_0000001 Ga0495652_0000001_789252_790457 331
42 3300046533 Ga0495640_0000006 Ga0495640_0000006_236888_238093 331
43 3300046536 Ga0495587_0000012 Ga0495587_0000012_130893_132098 331
44 3300046543 Ga0495645_0000041 Ga0495645_0000041_22356_23561 331
45 3300046559 Ga0495667_0000001 Ga0495667_0000001_629220_630425 331
46 3300046642 Ga0495634_0000624 Ga0495634_0000624_9358_10563 331
47 3300046663 Ga0495635_0000007 Ga0495635_0000007_61242_62447 331
48 3300046675 Ga0495657_0000047 Ga0495657_0000047_80591_81796 331
49 3300046678 Ga0495599_0000002 Ga0495599_0000002_128294_129499 331
50 3300046679 Ga0495623_0000023 Ga0495623_0000023_69167_70372 331
51 3300046680 Ga0495646_0000024 Ga0495646_0000024_70076_71281 331
52 3300046809 Ga0495600_0000013 Ga0495600_0000013_100104_101309 331
53 3300047317 Ga0495604_0000007 Ga0495604_0000007_156302_157507 331
54 3300047319 Ga0495674_0000001 Ga0495674_0000001_236645_237850 331
55 3300047322 Ga0495680_0001437 Ga0495680_0001437_18770_19975 331
56 3300047444 Ga0495675_0000014 Ga0495675_0000014_110841_112046 331
57 3300047471 Ga0495684_0000027 Ga0495684_0000027_55065_56270 331
58 3300047673 Ga0495593_0002819 Ga0495593_0002819_2640_3845 331
59 3300048088 Ga0495602_0000004 Ga0495602_0000004_130936_132141 331
60 3300053077 Ga0495601_0000006 Ga0495601_0000006_76695_77900 331
61 3300053078 Ga0495612_0000004 Ga0495612_0000004_236760_237965 331
62 3300053084 Ga0495595_0000006 Ga0495595_0000006_164206_165411 331
63 3300053085 Ga0495619_0000011 Ga0495619_0000011_194766_195971 331
64 3300031711 Ga0265314_10010907 Ga0265314_100109076 332
65 3300031595 Ga0265313_10000027 Ga0265313_1000002722 333
66 iso_pu_bacteria 2904690495 2904695215 333
67 3300026078 Ga0207702_10000854 Ga0207702_1000085411 334
68 3300028786 Ga0307517_10000315 Ga0307517_1000031564 335
69 3300028794 Ga0307515_10018508 Ga0307515_1001850810 335
70 3300049593 Ga0501077_0002633 Ga0501077_0002633_3978_5066 335
71 3300050493 nmdc:mga0k408_222223_c1 nmdc:mga0k408_222223_c1_90_1097 335
72 iso_pu_bacteria 2909042592 2909047939 336
73 3300046642 Ga0495634_0162865 Ga0495634_0162865_371_1387 337
74 3300050492 nmdc:mga0yw44_18270_c1 nmdc:mga0yw44_18270_c1_2023_3114 338
75 3300005937 Ga0081455_10007131 Ga0081455_100071316 339
76 3300006038 Ga0075365_10090220 Ga0075365_100902201 339
77 3300009147 Ga0114129_10000170 Ga0114129_1000017053 339
78 3300050490 nmdc:mga03n38_5130_c1 nmdc:mga03n38_5130_c1_954_2045 339
79 3300050494 nmdc:mga06z11_1223_c1 nmdc:mga06z11_1223_c1_4608_5699 339
80 3300050496 nmdc:mga07m45_9394_c1 nmdc:mga07m45_9394_c1_2872_3963 339
81 3300050507 nmdc:mga05p37_124_c1 nmdc:mga05p37_124_c1_17466_18584 339
82 3300050508 nmdc:mga09592_3352_c3 nmdc:mga09592_3352_c3_1350_2468 339
83 3300050510 nmdc:mga06r32_847_c1 nmdc:mga06r32_847_c1_20970_22088 339
84 3300031616 Ga0307508_10048516 Ga0307508_100485162 340
85 3300009094 Ga0111539_10003962 Ga0111539_1000396221 341
86 3300032002 Ga0307416_100436891 Ga0307416_1004368911 342
87 3300005841 Ga0068863_100246853 Ga0068863_1002468532 343
88 3300009101 Ga0105247_10042332 Ga0105247_100423322 343
89 3300026088 Ga0207641_10165979 Ga0207641_101659792 343
90 3300035695 Ga0373927_0026721 Ga0373927_0026721_41_1174 343
91 3300037068 Ga0373925_0013371 Ga0373925_0013371_4579_5763 343
92 3300005937 Ga0081455_10042462 Ga0081455_100424623 344
93 3300006871 Ga0075434_100100350 Ga0075434_1001003503 344
94 3300046681 Ga0495647_0042747 Ga0495647_0042747_562_1716 344
95 3300050512 nmdc:mga0n895_97669_c1 nmdc:mga0n895_97669_c1_668_1804 344
96 3300025915 Ga0207693_10018787 Ga0207693_100187875 345
97 3300035171 Ga0373946_0026198 Ga0373946_0026198_189_1388 345
98 3300046455 Ga0495603_0050838 Ga0495603_0050838_80_1222 345
99 3300046476 Ga0495662_0048054 Ga0495662_0048054_424_1623 345
100 3300046616 Ga0495668_0087184 Ga0495668_0087184_109_1320 345
101 3300046642 Ga0495634_0018765 Ga0495634_0018765_2248_3384 345
102 3300049572 Ga0501036_0058962 Ga0501036_0058962_62_1189 345
103 3300049573 Ga0501037_0115164 Ga0501037_0115164_270_1397 345
104 3300049575 Ga0501039_0270729 Ga0501039_0270729_177_1304 345
105 3300049589 Ga0501073_0020718 Ga0501073_0020718_3312_4439 345
106 3300049742 Ga0501080_0192634 Ga0501080_0192634_192_1319 345
107 3300049822 Ga0501035_0332735 Ga0501035_0332735_61_1188 345
108 3300053085 Ga0495619_0126123 Ga0495619_0126123_171_1370 345
109 3300013104 Ga0157370_10066296 Ga0157370_100662963 346
110 3300013307 Ga0157372_10077343 Ga0157372_100773433 346
111 3300048929 Ga0496126_0115143 Ga0496126_0115143_612_1754 346
112 3300049568 Ga0501031_0000296 Ga0501031_0000296_10163_11278 346
113 3300049569 Ga0501032_0000244 Ga0501032_0000244_34382_35497 346
114 3300049570 Ga0501033_0001015 Ga0501033_0001015_13298_14413 346
115 3300049571 Ga0501034_0001010 Ga0501034_0001010_13166_14281 346
116 3300049572 Ga0501036_0000405 Ga0501036_0000405_18083_19198 346
117 3300049573 Ga0501037_0000139 Ga0501037_0000139_32784_33899 346
118 3300049574 Ga0501038_0000404 Ga0501038_0000404_34099_35214 346
119 3300049579 Ga0501043_0000021 Ga0501043_0000021_126310_127425 346
120 3300049580 Ga0501046_0000905 Ga0501046_0000905_26271_27386 346
121 3300049581 Ga0501047_0000041 Ga0501047_0000041_26047_27162 346
122 3300049582 Ga0501048_0000077 Ga0501048_0000077_17101_18216 346
123 3300049583 Ga0501067_0000360 Ga0501067_0000360_23703_24818 346
124 3300049585 Ga0501069_0000444 Ga0501069_0000444_6831_7946 346
125 3300049586 Ga0501070_0002561 Ga0501070_0002561_13717_14832 346
126 3300049586 Ga0501070_0068849 Ga0501070_0068849_1183_2298 346
127 3300049589 Ga0501073_0001489 Ga0501073_0001489_13997_15112 346
128 3300049590 Ga0501074_0001762 Ga0501074_0001762_809_1924 346
129 3300049741 Ga0501079_0002042 Ga0501079_0002042_12346_13461 346
130 3300049744 Ga0501083_0000708 Ga0501083_0000708_10881_11996 346
131 3300049822 Ga0501035_0000090 Ga0501035_0000090_78579_79694 346
132 3300049823 Ga0501044_0000054 Ga0501044_0000054_114238_115353 346
133 3300049824 Ga0501045_0007035 Ga0501045_0007035_761_1876 346
134 3300060353 Ga0501082_0026365 Ga0501082_0026365_3400_4515 346
135 3300005434 Ga0070709_10045389 Ga0070709_100453892 347
136 3300005439 Ga0070711_100006985 Ga0070711_1000069854 347
137 3300005614 Ga0068856_100037475 Ga0068856_1000374754 347
138 3300005843 Ga0068860_100000562 Ga0068860_1000005628 347
139 3300013105 Ga0157369_10034405 Ga0157369_100344054 347
140 3300025913 Ga0207695_10042402 Ga0207695_100424023 347
141 3300025915 Ga0207693_10132937 Ga0207693_101329372 347
142 3300025944 Ga0207661_10181476 Ga0207661_101814761 347
143 3300026142 Ga0207698_10079451 Ga0207698_100794511 347
144 3300028381 Ga0268264_10000096 Ga0268264_1000009675 347
145 3300037418 Ga0395900_0028027 Ga0395900_0028027_1449_2582 347
146 3300037466 Ga0395898_0141147 Ga0395898_0141147_778_1911 347
147 3300049744 Ga0501083_0002409 Ga0501083_0002409_3487_4578 347
148 3300037418 Ga0395900_0024496 Ga0395900_0024496_2680_3813 348
149 3300037466 Ga0395898_0136672 Ga0395898_0136672_993_2126 348
150 3300044683 Ga0466965_0091243 Ga0466965_0091243_54_1187 348
151 3300048929 Ga0496126_0090086 Ga0496126_0090086_547_1680 348
152 3300053094 Ga0500566_0070936 Ga0500566_0070936_406_1539 348
153 3300053111 Ga0500572_004035 Ga0500572_004035_504_1637 348
154 3300053136 Ga0500559_0017573 Ga0500559_0017573_1688_2821 348
155 3300053177 Ga0500636_0000047 Ga0500636_0000047_45662_46795 348
156 3300005336 Ga0070680_100063307 Ga0070680_1000633073 349
157 3300005535 Ga0070684_100043470 Ga0070684_1000434701 349
158 3300005563 Ga0068855_100118529 Ga0068855_1001185293 349
159 3300005842 Ga0068858_100121995 Ga0068858_1001219952 349
160 3300006847 Ga0075431_100000774 Ga0075431_10000077413 349
161 3300006880 Ga0075429_100019740 Ga0075429_1000197408 349
162 3300013105 Ga0157369_10112993 Ga0157369_101129931 349
163 3300014968 Ga0157379_10033391 Ga0157379_100333913 349
164 3300025949 Ga0207667_10105403 Ga0207667_101054031 349
165 3300026116 Ga0207674_10165571 Ga0207674_101655712 349
166 3300035116 Ga0373945_0028606 Ga0373945_0028606_59_1192 349
167 3300035170 Ga0373943_0050791 Ga0373943_0050791_342_1475 349
168 3300046690 Ga0495624_0032910 Ga0495624_0032910_1336_2469 349
169 3300048908 Ga0496105_0033535 Ga0496105_0033535_129_1379 349
170 3300048909 Ga0496106_0059357 Ga0496106_0059357_1630_2880 349
171 3300048912 Ga0496109_0026508 Ga0496109_0026508_1950_3200 349
172 3300048915 Ga0496112_0015924 Ga0496112_0015924_1738_2988 349
173 3300048915 Ga0496112_0166345 Ga0496112_0166345_841_1974 349
174 3300048918 Ga0496115_0037010 Ga0496115_0037010_1279_2529 349
175 3300009093 Ga0105240_10522574 Ga0105240_105225741 350
176 3300049742 Ga0501080_0121593 Ga0501080_0121593_735_1874 350
177 3300005262 Ga0065165_1024748 Ga0065165_10247482 351
178 3300005435 Ga0070714_100056531 Ga0070714_1000565312 351
179 3300006038 Ga0075365_10147405 Ga0075365_101474052 351
180 3300049581 Ga0501047_0113080 Ga0501047_0113080_255_1385 351
181 3300049583 Ga0501067_0075829 Ga0501067_0075829_753_1841 351
182 3300050490 nmdc:mga03n38_18250_c1 nmdc:mga03n38_18250_c1_1549_2712 351
183 3300050492 nmdc:mga0yw44_131569_c1 nmdc:mga0yw44_131569_c1_417_1580 351
184 3300005329 Ga0070683_100012630 Ga0070683_1000126303 352
185 3300005535 Ga0070684_100147360 Ga0070684_1001473602 352
186 3300005563 Ga0068855_100268339 Ga0068855_1002683393 352
187 3300006048 Ga0075363_100004607 Ga0075363_1000046076 352
188 3300006051 Ga0075364_10166750 Ga0075364_101667502 352
189 3300006178 Ga0075367_10000969 Ga0075367_100009696 352
190 3300006353 Ga0075370_10052846 Ga0075370_100528463 352
191 3300006942 Ga0099824_1006244 Ga0099824_10062444 352
192 3300006943 Ga0099822_1004519 Ga0099822_10045193 352
193 3300021320 Ga0214544_1000467 Ga0214544_100046741 352
194 3300021321 Ga0214542_1000185 Ga0214542_100018541 352
195 3300021324 Ga0214545_1000102 Ga0214545_100010241 352
196 3300021324 Ga0214545_1023945 Ga0214545_10239452 352
197 3300021327 Ga0214543_1000211 Ga0214543_100021139 352
198 3300025921 Ga0207652_10197783 Ga0207652_101977832 352
199 3300025929 Ga0207664_10234476 Ga0207664_102344761 352
200 3300025944 Ga0207661_10000945 Ga0207661_100009459 352
201 3300025949 Ga0207667_10222717 Ga0207667_102227172 352
202 3300027357 Ga0209589_1000004 Ga0209589_100000427 352
203 3300027361 Ga0209489_100004 Ga0209489_10000427 352
204 3300027363 Ga0209700_100004 Ga0209700_10000427 352
205 3300031238 Ga0265332_10002650 Ga0265332_100026509 352
206 3300031247 Ga0265340_10000765 Ga0265340_1000076518 352
207 3300031249 Ga0265339_10075589 Ga0265339_100755892 352
208 3300031250 Ga0265331_10034472 Ga0265331_100344723 352
209 3300031344 Ga0265316_10113638 Ga0265316_101136383 352
210 3300031712 Ga0265342_10000093 Ga0265342_1000009338 352
211 3300035695 Ga0373927_0014431 Ga0373927_0014431_3599_4732 352
212 3300035725 Ga0373947_0015845 Ga0373947_0015845_2807_3940 352
213 3300037418 Ga0395900_0139623 Ga0395900_0139623_1175_2395 352
214 3300049575 Ga0501039_0030683 Ga0501039_0030683_2102_3268 352
215 3300049577 Ga0501041_0075333 Ga0501041_0075333_544_1710 352
216 3300049580 Ga0501046_0090980 Ga0501046_0090980_335_1465 352
217 3300049581 Ga0501047_0156960 Ga0501047_0156960_341_1489 352
218 3300049586 Ga0501070_0008055 Ga0501070_0008055_1556_2746 352
219 3300049588 Ga0501072_0010225 Ga0501072_0010225_5531_6697 352
220 3300049593 Ga0501077_0006796 Ga0501077_0006796_5088_6218 352
221 3300049743 Ga0501081_0054467 Ga0501081_0054467_1233_2399 352
222 3300049822 Ga0501035_0000267 Ga0501035_0000267_48173_49363 352
223 3300049824 Ga0501045_0008407 Ga0501045_0008407_3643_4773 352
224 3300050492 nmdc:mga0yw44_31020_c1 nmdc:mga0yw44_31020_c1_1673_2803 352
225 3300053142 Ga0500577_0000032 Ga0500577_0000032_19520_20680 352
226 3300054114 Ga0501084_0032546 Ga0501084_0032546_3022_4188 352
227 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001473 353
228 3300005435 Ga0070714_100184654 Ga0070714_1001846542 353
229 3300005937 Ga0081455_10085171 Ga0081455_100851713 353
230 3300005983 Ga0081540_1006269 Ga0081540_10062694 353
231 3300005985 Ga0081539_10000008 Ga0081539_10000008215 353
232 3300006038 Ga0075365_10021887 Ga0075365_100218873 353
233 3300006173 Ga0070716_100103903 Ga0070716_1001039032 353
234 3300006871 Ga0075434_100046214 Ga0075434_1000462143 353
235 3300007076 Ga0075435_100064028 Ga0075435_1000640283 353
236 3300025295 Ga0209564_1000792 Ga0209564_10007928 353
237 3300025295 Ga0209564_1005226 Ga0209564_10052261 353
238 3300025302 Ga0207426_1004240 Ga0207426_10042404 353
239 3300025912 Ga0207707_10008330 Ga0207707_100083304 353
240 3300025912 Ga0207707_10058775 Ga0207707_100587752 353
241 3300025929 Ga0207664_10106137 Ga0207664_101061372 353
242 3300031712 Ga0265342_10028573 Ga0265342_100285732 353
243 3300035170 Ga0373943_0000476 Ga0373943_0000476_7424_8557 353
244 3300035692 Ga0373935_0005953 Ga0373935_0005953_1777_2910 353
245 3300035695 Ga0373927_0001598 Ga0373927_0001598_8136_9269 353
246 3300035725 Ga0373947_0001677 Ga0373947_0001677_7147_8280 353
247 3300036401 Ga0373937_0052057 Ga0373937_0052057_1718_2851 353
248 3300037068 Ga0373925_0007402 Ga0373925_0007402_3307_4440 353
249 3300037418 Ga0395900_0280832 Ga0395900_0280832_391_1524 353
250 3300037466 Ga0395898_0051497 Ga0395898_0051497_2324_3457 353
251 3300039437 Ga0436365_0621937 Ga0436365_0621937_234_1367 353
252 3300039437 Ga0436365_1392756 Ga0436365_1392756_949_2112 353
253 3300044684 Ga0466966_0036712 Ga0466966_0036712_667_1800 353
254 3300046455 Ga0495603_0001190 Ga0495603_0001190_5383_6516 353
255 3300046459 Ga0495629_0002775 Ga0495629_0002775_7908_9041 353
256 3300046461 Ga0495641_0010906 Ga0495641_0010906_1554_2687 353
257 3300046472 Ga0495580_0001797 Ga0495580_0001797_5383_6516 353
258 3300046473 Ga0495582_0001266 Ga0495582_0001266_11480_12613 353
259 3300046475 Ga0495639_0019184 Ga0495639_0019184_589_1722 353
260 3300046476 Ga0495662_0000546 Ga0495662_0000546_7810_8943 353
261 3300046516 Ga0495628_0011329 Ga0495628_0011329_1277_2410 353
262 3300046529 Ga0495652_0076711 Ga0495652_0076711_329_1462 353
263 3300046531 Ga0495665_0000387 Ga0495665_0000387_14187_15320 353
264 3300046543 Ga0495645_0020519 Ga0495645_0020519_2959_4074 353
265 3300046557 Ga0495622_0029274 Ga0495622_0029274_1429_2562 353
266 3300046642 Ga0495634_0002816 Ga0495634_0002816_7885_9018 353
267 3300046663 Ga0495635_0001522 Ga0495635_0001522_8539_9672 353
268 3300046674 Ga0495588_0077723 Ga0495588_0077723_35_1168 353
269 3300046680 Ga0495646_0018443 Ga0495646_0018443_3112_4245 353
270 3300046681 Ga0495647_0000516 Ga0495647_0000516_6275_7408 353
271 3300046689 Ga0495613_0013591 Ga0495613_0013591_3325_4458 353
272 3300046690 Ga0495624_0003648 Ga0495624_0003648_2161_3294 353
273 3300047315 Ga0495581_0001283 Ga0495581_0001283_11581_12714 353
274 3300047319 Ga0495674_0069601 Ga0495674_0069601_750_1883 353
275 3300047471 Ga0495684_0061574 Ga0495684_0061574_1073_2206 353
276 3300047472 Ga0495686_0147645 Ga0495686_0147645_26_1192 353
277 3300047673 Ga0495593_0001105 Ga0495593_0001105_1368_2501 353
278 3300048915 Ga0496112_0000008 Ga0496112_0000008_307256_308404 353
279 3300048918 Ga0496115_0196383 Ga0496115_0196383_13_1224 353
280 3300048920 Ga0496117_0071314 Ga0496117_0071314_846_1979 353
281 3300048921 Ga0496118_0039843 Ga0496118_0039843_1800_2933 353
282 3300048922 Ga0496119_0039685 Ga0496119_0039685_1295_2428 353
283 3300048924 Ga0496121_0001934 Ga0496121_0001934_20614_21747 353
284 3300048924 Ga0496121_0129371 Ga0496121_0129371_469_1602 353
285 3300048929 Ga0496126_0160985 Ga0496126_0160985_774_1904 353
286 3300049571 Ga0501034_0382279 Ga0501034_0382279_140_1279 353
287 3300049579 Ga0501043_0029175 Ga0501043_0029175_148_1281 353
288 3300049822 Ga0501035_0021609 Ga0501035_0021609_2291_3472 353
289 3300049823 Ga0501044_0148209 Ga0501044_0148209_608_1789 353
290 3300050512 nmdc:mga0n895_45416_c1 nmdc:mga0n895_45416_c1_2194_3327 353
291 3300050513 nmdc:mga0rr50_54179_c1 nmdc:mga0rr50_54179_c1_1313_2446 353
292 3300053077 Ga0495601_0019185 Ga0495601_0019185_754_1869 353
293 3300053093 Ga0500651_0013266 Ga0500651_0013266_2332_3465 353
294 3300053098 Ga0500650_0001791 Ga0500650_0001791_3083_4198 353
295 3300053116 Ga0500592_006308 Ga0500592_006308_250_1383 353
296 3300053119 Ga0500595_005423 Ga0500595_005423_2443_3576 353
297 3300053130 Ga0500642_0012395 Ga0500642_0012395_220_1353 353
298 3300053139 Ga0500568_0006894 Ga0500568_0006894_3566_4681 353
299 3300053150 Ga0500603_038286 Ga0500603_038286_78_1211 353
300 3300053151 Ga0500604_0000656 Ga0500604_0000656_33_1148 353
301 3300053730 Ga0500645_015410 Ga0500645_015410_928_2067 353
302 3300003354 JGI25160J50197_1006602 JGI25160J50197_10066024 354
303 3300003659 JGI25404J52841_10009833 JGI25404J52841_100098332 354
304 3300003659 JGI25404J52841_10011033 JGI25404J52841_100110332 354
305 3300003762 Ga0055542_1003874 Ga0055542_10038743 354
306 3300005331 Ga0070670_100144944 Ga0070670_1001449442 354
307 3300005334 Ga0068869_100040444 Ga0068869_1000404442 354
308 3300005439 Ga0070711_100012265 Ga0070711_1000122655 354
309 3300005455 Ga0070663_100071948 Ga0070663_1000719483 354
310 3300005471 Ga0070698_100230579 Ga0070698_1002305791 354
311 3300005548 Ga0070665_100058037 Ga0070665_1000580374 354
312 3300005563 Ga0068855_100064883 Ga0068855_1000648833 354
313 3300005578 Ga0068854_100056325 Ga0068854_1000563252 354
314 3300005937 Ga0081455_10004709 Ga0081455_1000470917 354
315 3300005983 Ga0081540_1014526 Ga0081540_10145262 354
316 3300005983 Ga0081540_1020861 Ga0081540_10208613 354
317 3300006038 Ga0075365_10002418 Ga0075365_100024184 354
318 3300006048 Ga0075363_100095898 Ga0075363_1000958981 354
319 3300006051 Ga0075364_10005987 Ga0075364_100059874 354
320 3300006178 Ga0075367_10068864 Ga0075367_100688642 354
321 3300006178 Ga0075367_10176390 Ga0075367_101763901 354
322 3300006195 Ga0075366_10041025 Ga0075366_100410253 354
323 3300006353 Ga0075370_10010442 Ga0075370_100104423 354
324 3300006353 Ga0075370_10041822 Ga0075370_100418222 354
325 3300009093 Ga0105240_10003963 Ga0105240_1000396317 354
326 3300009098 Ga0105245_10162754 Ga0105245_101627542 354
327 3300009174 Ga0105241_10080881 Ga0105241_100808811 354
328 3300009176 Ga0105242_10184154 Ga0105242_101841542 354
329 3300009545 Ga0105237_10001028 Ga0105237_100010288 354
330 3300025254 Ga0209148_1001411 Ga0209148_10014113 354
331 3300025295 Ga0209564_1010806 Ga0209564_10108062 354
332 3300025297 Ga0209758_1000075 Ga0209758_1000075255 354
333 3300025297 Ga0209758_1000187 Ga0209758_10001874 354
334 3300025302 Ga0207426_1000422 Ga0207426_100042262 354
335 3300025304 Ga0209257_1002081 Ga0209257_10020814 354
336 3300025735 Ga0207713_1027411 Ga0207713_10274113 354
337 3300025911 Ga0207654_10016873 Ga0207654_100168733 354
338 3300025913 Ga0207695_10000029 Ga0207695_10000029301 354
339 3300025913 Ga0207695_10122854 Ga0207695_101228542 354
340 3300025914 Ga0207671_10012690 Ga0207671_100126907 354
341 3300025914 Ga0207671_10046290 Ga0207671_100462903 354
342 3300025916 Ga0207663_10067713 Ga0207663_100677132 354
343 3300025941 Ga0207711_10021861 Ga0207711_100218614 354
344 3300025949 Ga0207667_10064284 Ga0207667_100642843 354
345 3300025981 Ga0207640_10077037 Ga0207640_100770372 354
346 3300026116 Ga0207674_10159944 Ga0207674_101599441 354
347 3300026121 Ga0207683_10152480 Ga0207683_101524801 354
348 3300035116 Ga0373945_0012819 Ga0373945_0012819_293_1435 354
349 3300035692 Ga0373935_0099940 Ga0373935_0099940_480_1622 354
350 3300035695 Ga0373927_0032564 Ga0373927_0032564_458_1600 354
351 3300037068 Ga0373925_0087648 Ga0373925_0087648_325_1467 354
352 3300044656 Ga0466969_0031674 Ga0466969_0031674_565_1698 354
353 3300044684 Ga0466966_0000524 Ga0466966_0000524_8190_9323 354
354 3300044693 Ga0466961_0000795 Ga0466961_0000795_7850_8983 354
355 3300044694 Ga0466963_0083566 Ga0466963_0083566_909_2057 354
356 3300044719 Ga0466971_0114284 Ga0466971_0114284_33_1166 354
357 3300046455 Ga0495603_0084110 Ga0495603_0084110_321_1535 354
358 3300046518 Ga0495631_0052300 Ga0495631_0052300_388_1521 354
359 3300046679 Ga0495623_0128608 Ga0495623_0128608_305_1438 354
360 3300048905 Ga0496102_0174949 Ga0496102_0174949_53_1195 354
361 3300048909 Ga0496106_0148896 Ga0496106_0148896_590_1732 354
362 3300048909 Ga0496106_0187769 Ga0496106_0187769_354_1496 354
363 3300048912 Ga0496109_0166736 Ga0496109_0166736_236_1579 354
364 3300048915 Ga0496112_0258513 Ga0496112_0258513_407_1543 354
365 3300048924 Ga0496121_0074916 Ga0496121_0074916_1041_2351 354
366 3300048928 Ga0496125_0060665 Ga0496125_0060665_1441_2574 354
367 3300049569 Ga0501032_0055262 Ga0501032_0055262_119_1255 354
368 3300049570 Ga0501033_0030771 Ga0501033_0030771_1697_2884 354
369 3300049571 Ga0501034_0164405 Ga0501034_0164405_423_1559 354
370 3300049571 Ga0501034_0210784 Ga0501034_0210784_55_1191 354
371 3300049572 Ga0501036_0083358 Ga0501036_0083358_656_1792 354
372 3300049573 Ga0501037_0051819 Ga0501037_0051819_119_1255 354
373 3300049574 Ga0501038_0024056 Ga0501038_0024056_3586_4722 354
374 3300049574 Ga0501038_0042165 Ga0501038_0042165_1093_2229 354
375 3300049574 Ga0501038_0054679 Ga0501038_0054679_1327_2463 354
376 3300049576 Ga0501040_0039520 Ga0501040_0039520_1721_2857 354
377 3300049578 Ga0501042_0107777 Ga0501042_0107777_582_1718 354
378 3300049579 Ga0501043_0041962 Ga0501043_0041962_1385_2521 354
379 3300049579 Ga0501043_0064795 Ga0501043_0064795_1191_2327 354
380 3300049579 Ga0501043_0138582 Ga0501043_0138582_350_1486 354
381 3300049580 Ga0501046_0041933 Ga0501046_0041933_1544_2680 354
382 3300049582 Ga0501048_0027330 Ga0501048_0027330_2537_3673 354
383 3300049583 Ga0501067_0011133 Ga0501067_0011133_2710_3846 354
384 3300049586 Ga0501070_0088098 Ga0501070_0088098_985_2121 354
385 3300049588 Ga0501072_0083803 Ga0501072_0083803_220_1356 354
386 3300049589 Ga0501073_0037651 Ga0501073_0037651_119_1255 354
387 3300049590 Ga0501074_0083318 Ga0501074_0083318_1118_2254 354
388 3300049742 Ga0501080_0108320 Ga0501080_0108320_479_1615 354
389 3300049744 Ga0501083_0072999 Ga0501083_0072999_1097_2233 354
390 3300049822 Ga0501035_0121893 Ga0501035_0121893_684_1820 354
391 3300049822 Ga0501035_0183049 Ga0501035_0183049_248_1384 354
392 3300049823 Ga0501044_0077406 Ga0501044_0077406_1057_2193 354
393 3300049824 Ga0501045_0012653 Ga0501045_0012653_1740_2876 354
394 3300050490 nmdc:mga03n38_2618_c1 nmdc:mga03n38_2618_c1_1343_2485 354
395 3300050491 nmdc:mga00v17_161450_c1 nmdc:mga00v17_161450_c1_138_1280 354
396 3300050491 nmdc:mga00v17_194944_c1 nmdc:mga00v17_194944_c1_110_1252 354
397 3300050491 nmdc:mga00v17_9734_c1 nmdc:mga00v17_9734_c1_3494_4639 354
398 3300050494 nmdc:mga06z11_44560_c1 nmdc:mga06z11_44560_c1_865_2007 354
399 3300053085 Ga0495619_0159242 Ga0495619_0159242_119_1240 354
400 3300054114 Ga0501084_0085733 Ga0501084_0085733_1400_2536 354
401 3300005937 Ga0081455_10000419 Ga0081455_1000041936 355
402 3300031249 Ga0265339_10061601 Ga0265339_100616011 355
403 3300031250 Ga0265331_10032161 Ga0265331_100321612 355
404 3300031344 Ga0265316_10167878 Ga0265316_101678782 355
405 3300042436 Ga0439435_0002684 Ga0439435_0002684_2041_3207 355
406 3300049744 Ga0501083_0005494 Ga0501083_0005494_1538_2656 355
407 iso_pu_bacteria 3003665799 3003668041 355
408 3300031548 Ga0307408_100007113 Ga0307408_1000071135 356
409 3300049571 Ga0501034_0041774 Ga0501034_0041774_1618_2748 356
410 3300049581 Ga0501047_0096235 Ga0501047_0096235_604_1734 356
411 3300049590 Ga0501074_0082198 Ga0501074_0082198_778_1908 356
412 3300049822 Ga0501035_0174629 Ga0501035_0174629_147_1277 356
413 3300053098 Ga0500650_0022327 Ga0500650_0022327_736_1869 356
414 3300005842 Ga0068858_100167218 Ga0068858_1001672182 357
415 3300005981 Ga0081538_10012089 Ga0081538_100120892 357
416 3300006944 Ga0099823_1020076 Ga0099823_10200763 357
417 3300027296 Ga0209389_1000003 Ga0209389_100000335 357
418 3300027361 Ga0209489_100022 Ga0209489_10002211 357
419 3300027363 Ga0209700_100023 Ga0209700_10002334 357
420 3300049583 Ga0501067_0000771 Ga0501067_0000771_12925_14016 357
421 3300049590 Ga0501074_0077587 Ga0501074_0077587_570_1661 357
422 3300005539 Ga0068853_100004427 Ga0068853_1000044275 358
423 3300005577 Ga0068857_100012531 Ga0068857_1000125314 358
424 3300005578 Ga0068854_100054196 Ga0068854_1000541962 358
425 3300005614 Ga0068856_100067052 Ga0068856_1000670523 358
426 3300005834 Ga0068851_10009190 Ga0068851_100091901 358
427 3300009174 Ga0105241_10002379 Ga0105241_1000237910 358
428 3300010375 Ga0105239_10053277 Ga0105239_100532771 358
429 3300021361 Ga0213872_10064105 Ga0213872_100641052 358
430 3300025913 Ga0207695_10008792 Ga0207695_100087923 358
431 3300025924 Ga0207694_10000275 Ga0207694_1000027537 358
432 3300025949 Ga0207667_10021708 Ga0207667_100217082 358
433 3300026041 Ga0207639_10097624 Ga0207639_100976242 358
434 3300026067 Ga0207678_10020774 Ga0207678_100207743 358
435 3300026078 Ga0207702_10000026 Ga0207702_10000026171 358
436 3300026116 Ga0207674_10002526 Ga0207674_100025265 358
437 3300039447 Ga0436361_0721014 Ga0436361_0721014_176_1309 358
438 3300046460 Ga0495638_0099888 Ga0495638_0099888_566_1696 358
439 3300046501 Ga0495607_0020117 Ga0495607_0020117_1631_2761 358
440 3300046512 Ga0495610_0015826 Ga0495610_0015826_2393_3523 358
441 3300046513 Ga0495616_0007418 Ga0495616_0007418_980_2110 358
442 3300046616 Ga0495668_0164476 Ga0495668_0164476_45_1175 358
443 3300046665 Ga0495661_0052158 Ga0495661_0052158_435_1565 358
444 3300046691 Ga0495670_0004128 Ga0495670_0004128_467_1597 358
445 3300047472 Ga0495686_0022878 Ga0495686_0022878_1087_2217 358
446 3300048924 Ga0496121_0008559 Ga0496121_0008559_5768_6898 358
447 3300048925 Ga0496122_0078647 Ga0496122_0078647_94_1224 358
448 3300048928 Ga0496125_0003409 Ga0496125_0003409_8365_9495 358
449 3300050492 nmdc:mga0yw44_151537_c1 nmdc:mga0yw44_151537_c1_278_1408 358
450 3300053086 Ga0500578_0076118 Ga0500578_0076118_659_1789 358
451 3300053087 Ga0500643_002090 Ga0500643_002090_5191_6321 358
452 3300053087 Ga0500643_019553 Ga0500643_019553_1068_2198 358
453 3300053088 Ga0500644_0009687 Ga0500644_0009687_355_1485 358
454 3300053090 Ga0500646_0008367 Ga0500646_0008367_1212_2342 358
455 3300053094 Ga0500566_0001394 Ga0500566_0001394_8413_9543 358
456 3300053094 Ga0500566_0032406 Ga0500566_0032406_1256_2386 358
457 3300053104 Ga0500556_0000015 Ga0500556_0000015_77525_78655 358
458 3300053109 Ga0500569_019211 Ga0500569_019211_424_1554 358
459 3300053119 Ga0500595_000083 Ga0500595_000083_58173_59303 358
460 3300053119 Ga0500595_003722 Ga0500595_003722_2453_3658 358
461 3300053122 Ga0500608_015771 Ga0500608_015771_2173_3303 358
462 3300053130 Ga0500642_0000044 Ga0500642_0000044_76947_78077 358
463 3300053131 Ga0500652_000006 Ga0500652_000006_115006_116211 358
464 3300053131 Ga0500652_000639 Ga0500652_000639_5951_7081 358
465 3300053136 Ga0500559_0000130 Ga0500559_0000130_14335_15465 358
466 3300053153 Ga0500616_0000041 Ga0500616_0000041_152893_154023 358
467 3300053156 Ga0500622_0063860 Ga0500622_0063860_526_1656 358
468 3300053161 Ga0500634_0079328 Ga0500634_0079328_131_1261 358
469 3300053177 Ga0500636_0003542 Ga0500636_0003542_7621_8754 358
470 3300053177 Ga0500636_0010447 Ga0500636_0010447_1870_3075 358
471 3300053730 Ga0500645_031589 Ga0500645_031589_145_1275 358
472 3300006942 Ga0099824_1025327 Ga0099824_10253273 359
473 3300025261 Ga0209233_1008287 Ga0209233_10082873 359
474 3300025297 Ga0209758_1015233 Ga0209758_10152332 359
475 3300027296 Ga0209389_1000126 Ga0209389_100012612 359
476 3300027357 Ga0209589_1000209 Ga0209589_100020913 359
477 3300027361 Ga0209489_100144 Ga0209489_10014444 359
478 3300046524 Ga0495648_0005337 Ga0495648_0005337_1152_2285 359
479 3300049577 Ga0501041_0052106 Ga0501041_0052106_25_1131 359
480 3300049593 Ga0501077_0004224 Ga0501077_0004224_7297_8403 359
481 3300049741 Ga0501079_0038773 Ga0501079_0038773_687_1793 359
482 3300049743 Ga0501081_0006165 Ga0501081_0006165_1899_3005 359
483 3300003354 JGI25160J50197_1006147 JGI25160J50197_10061473 360
484 3300005336 Ga0070680_100069347 Ga0070680_1000693472 360
485 3300005339 Ga0070660_100086700 Ga0070660_1000867002 360
486 3300005458 Ga0070681_10046810 Ga0070681_100468102 360
487 3300005530 Ga0070679_100066163 Ga0070679_1000661631 360
488 3300005563 Ga0068855_100039924 Ga0068855_1000399245 360
489 3300025919 Ga0207657_10012757 Ga0207657_100127574 360
490 3300025949 Ga0207667_10027726 Ga0207667_100277264 360
491 3300031595 Ga0265313_10019090 Ga0265313_100190904 360
492 3300031712 Ga0265342_10000761 Ga0265342_1000076130 360
493 3300039437 Ga0436365_0356842 Ga0436365_0356842_13124_14209 360
494 3300039450 Ga0436363_0538450 Ga0436363_0538450_7280_8365 360
495 3300046491 Ga0495584_0140992 Ga0495584_0140992_113_1201 360
496 3300005546 Ga0070696_100225897 Ga0070696_1002258971 361
497 3300009553 Ga0105249_10035195 Ga0105249_100351951 361
498 3300035725 Ga0373947_0098428 Ga0373947_0098428_255_1343 361
499 3300037853 Ga0436364_1228736 Ga0436364_1228736_1205_2293 361
500 3300041408 Ga0439453_0002956 Ga0439453_0002956_1236_2372 361
501 3300048907 Ga0496104_0030422 Ga0496104_0030422_792_1880 361
502 3300048908 Ga0496105_0025477 Ga0496105_0025477_3308_4396 361
503 3300048911 Ga0496108_0018138 Ga0496108_0018138_2196_3284 361
504 3300048912 Ga0496109_0002174 Ga0496109_0002174_6780_7868 361
505 3300048914 Ga0496111_0025729 Ga0496111_0025729_2375_3463 361
506 3300048916 Ga0496113_0015918 Ga0496113_0015918_3239_4327 361
507 3300048917 Ga0496114_0127032 Ga0496114_0127032_215_1303 361
508 3300050490 nmdc:mga03n38_10860_c1 nmdc:mga03n38_10860_c1_138_1283 361
509 3300050494 nmdc:mga06z11_2319_c1 nmdc:mga06z11_2319_c1_1765_2910 361
510 3300006042 Ga0075368_10006102 Ga0075368_100061024 362
511 3300006173 Ga0070716_100031647 Ga0070716_1000316472 362
512 3300006178 Ga0075367_10082613 Ga0075367_100826132 362
513 3300006186 Ga0075369_10035439 Ga0075369_100354392 362
514 3300006237 Ga0097621_100063763 Ga0097621_1000637632 362
515 3300009098 Ga0105245_10019119 Ga0105245_100191195 362
516 3300013296 Ga0157374_10025470 Ga0157374_100254706 362
517 3300013306 Ga0163162_10027897 Ga0163162_100278975 362
518 3300013308 Ga0157375_10042851 Ga0157375_100428513 362
519 3300014325 Ga0163163_10032906 Ga0163163_100329065 362
520 3300014968 Ga0157379_10022881 Ga0157379_100228815 362
521 3300014969 Ga0157376_10011670 Ga0157376_100116704 362
522 3300025927 Ga0207687_10058843 Ga0207687_100588432 362
523 3300025939 Ga0207665_10201864 Ga0207665_102018642 362
524 3300031344 Ga0265316_10096701 Ga0265316_100967012 362
525 3300044694 Ga0466963_0020679 Ga0466963_0020679_1262_2392 362
526 3300045976 Ga0466967_0033042 Ga0466967_0033042_1181_2311 362
527 3300046536 Ga0495587_0012911 Ga0495587_0012911_4150_5241 362
528 3300048905 Ga0496102_0007915 Ga0496102_0007915_2984_4075 362
529 3300048909 Ga0496106_0015179 Ga0496106_0015179_2974_4065 362
530 3300048912 Ga0496109_0026931 Ga0496109_0026931_2157_3248 362
531 3300048914 Ga0496111_0019946 Ga0496111_0019946_2627_3718 362
532 3300048917 Ga0496114_0381658 Ga0496114_0381658_90_1181 362
533 3300050492 nmdc:mga0yw44_78344_c1 nmdc:mga0yw44_78344_c1_837_1988 362
534 3300053085 Ga0495619_0264599 Ga0495619_0264599_83_1174 362
535 3300009551 Ga0105238_10059607 Ga0105238_100596072 363
536 3300025929 Ga0207664_10073102 Ga0207664_100731023 363
537 iso_pu_bacteria 2523231067 2523469747 363
538 iso_pu_bacteria 2922386360 2922386804 363
539 3300005434 Ga0070709_10083770 Ga0070709_100837702 364
540 3300009551 Ga0105238_10060156 Ga0105238_100601564 364
541 3300039450 Ga0436363_1324669 Ga0436363_1324669_647_1786 364
542 3300039453 Ga0436362_0668050 Ga0436362_0668050_716_1849 364
543 3300048927 Ga0496124_0009281 Ga0496124_0009281_6974_8107 364
544 3300048928 Ga0496125_0050358 Ga0496125_0050358_659_1792 364
545 3300049741 Ga0501079_0238025 Ga0501079_0238025_128_1264 364
546 3300049823 Ga0501044_0247679 Ga0501044_0247679_302_1438 364
547 3300053077 Ga0495601_0085039 Ga0495601_0085039_433_1566 364
548 3300021384 Ga0213876_10003126 Ga0213876_100031264 365
549 3300025929 Ga0207664_10333725 Ga0207664_103337251 365
550 3300031235 Ga0265330_10037409 Ga0265330_100374093 365
551 3300031241 Ga0265325_10003615 Ga0265325_100036155 365
552 3300031247 Ga0265340_10015947 Ga0265340_100159474 365
553 3300031247 Ga0265340_10030594 Ga0265340_100305942 365
554 3300031249 Ga0265339_10024234 Ga0265339_100242342 365
555 3300031712 Ga0265342_10068055 Ga0265342_100680552 365
556 3300037471 Ga0395905_0210773 Ga0395905_0210773_79_1212 365
557 3300053096 Ga0500641_0007479 Ga0500641_0007479_1777_2949 365
558 3300037853 Ga0436364_1105330 Ga0436364_1105330_643_1746 366
559 3300037853 Ga0436364_1346974 Ga0436364_1346974_1806_2909 366
560 3300039437 Ga0436365_0156475 Ga0436365_0156475_1398_2501 366
561 3300039450 Ga0436363_1520052 Ga0436363_1520052_1617_2720 366
562 3300039453 Ga0436362_0582461 Ga0436362_0582461_1437_2540 366
563 3300045976 Ga0466967_0198851 Ga0466967_0198851_703_1836 366
564 3300047322 Ga0495680_0192008 Ga0495680_0192008_146_1279 366
565 3300048928 Ga0496125_0000063 Ga0496125_0000063_165802_166935 366
566 3300050513 nmdc:mga0rr50_187439_c1 nmdc:mga0rr50_187439_c1_49_1167 366
567 3300031241 Ga0265325_10090525 Ga0265325_100905252 367
568 3300031247 Ga0265340_10018100 Ga0265340_100181002 367
569 3300031995 Ga0307409_100240406 Ga0307409_1002404062 367
570 3300039450 Ga0436363_1434115 Ga0436363_1434115_311_1432 367
571 3300046477 Ga0495664_0186930 Ga0495664_0186930_60_1196 367
572 iso_pu_bacteria 2513237087 2513589065 367
573 3300005337 Ga0070682_100000979 Ga0070682_1000009796 368
574 3300005341 Ga0070691_10019647 Ga0070691_100196472 368
575 3300005366 Ga0070659_100008591 Ga0070659_1000085916 368
576 3300005458 Ga0070681_10008360 Ga0070681_100083605 368
577 3300005530 Ga0070679_100012608 Ga0070679_1000126085 368
578 3300005539 Ga0068853_100000659 Ga0068853_1000006599 368
579 3300005547 Ga0070693_100000988 Ga0070693_1000009885 368
580 3300009545 Ga0105237_10209164 Ga0105237_102091643 368
581 3300013100 Ga0157373_10003303 Ga0157373_100033032 368
582 3300013104 Ga0157370_10019379 Ga0157370_100193792 368
583 3300013307 Ga0157372_10005179 Ga0157372_100051796 368
584 3300025912 Ga0207707_10018940 Ga0207707_100189406 368
585 3300025921 Ga0207652_10024012 Ga0207652_100240125 368
586 3300025921 Ga0207652_10088380 Ga0207652_100883803 368
587 3300025932 Ga0207690_10005325 Ga0207690_100053255 368
588 3300025949 Ga0207667_10072770 Ga0207667_100727704 368
589 3300031344 Ga0265316_10011375 Ga0265316_100113755 368
590 3300031711 Ga0265314_10027160 Ga0265314_100271602 368
591 3300049588 Ga0501072_0007776 Ga0501072_0007776_1536_2672 368
592 3300054114 Ga0501084_0215866 Ga0501084_0215866_471_1607 368
593 3300060353 Ga0501082_0043153 Ga0501082_0043153_1172_2308 368
594 3300013104 Ga0157370_10053454 Ga0157370_100534542 369
595 3300048922 Ga0496119_0002237 Ga0496119_0002237_16881_18005 369
596 3300048925 Ga0496122_0000624 Ga0496122_0000624_4996_6120 369
597 3300048926 Ga0496123_0000569 Ga0496123_0000569_18017_19141 369
598 3300049574 Ga0501038_0339167 Ga0501038_0339167_22_1134 369
599 3300049580 Ga0501046_0167050 Ga0501046_0167050_202_1314 369
600 3300053104 Ga0500556_0000036 Ga0500556_0000036_18032_19156 369
601 3300053730 Ga0500645_018168 Ga0500645_018168_444_1568 369
602 3300060353 Ga0501082_0001613 Ga0501082_0001613_2281_3420 369
603 iso_pu_bacteria 2828305725 2828309493 369
604 iso_pu_bacteria 643348564 643602601 369
605 3300048921 Ga0496118_0043118 Ga0496118_0043118_2127_3242 370
606 3300048924 Ga0496121_0061811 Ga0496121_0061811_1656_2771 370
607 3300048924 Ga0496121_0132298 Ga0496121_0132298_166_1281 370
608 3300053085 Ga0495619_0109671 Ga0495619_0109671_573_1703 370
609 3300053093 Ga0500651_0105146 Ga0500651_0105146_562_1698 370
610 3300006186 Ga0075369_10009443 Ga0075369_100094433 371
611 3300009011 Ga0105251_10007401 Ga0105251_100074016 371
612 3300009545 Ga0105237_10205311 Ga0105237_102053111 371
613 3300010375 Ga0105239_10062737 Ga0105239_100627374 371
614 3300011119 Ga0105246_10003642 Ga0105246_100036425 371
615 3300013306 Ga0163162_10351051 Ga0163162_103510512 371
616 3300013308 Ga0157375_10012425 Ga0157375_100124252 371
617 3300014968 Ga0157379_10008086 Ga0157379_100080866 371
618 3300025944 Ga0207661_10043653 Ga0207661_100436533 371
619 3300034957 Ga0373938_0001315 Ga0373938_0001315_1457_2590 371
620 3300035084 Ga0373928_0016122 Ga0373928_0016122_286_1419 371
621 3300035088 Ga0373940_0012269 Ga0373940_0012269_707_1840 371
622 3300035091 Ga0373951_0004013 Ga0373951_0004013_316_1449 371
623 3300035092 Ga0373952_0001719 Ga0373952_0001719_2654_3787 371
624 3300035115 Ga0373941_0032082 Ga0373941_0032082_71_1204 371
625 3300035207 Ga0373942_0011273 Ga0373942_0011273_695_1828 371
626 3300035398 Ga0316574_0007201 Ga0316574_0007201_2485_3603 371
627 3300035691 Ga0373931_0016415 Ga0373931_0016415_695_1828 371
628 3300035725 Ga0373947_0105141 Ga0373947_0105141_389_1522 371
629 3300036712 Ga0316584_0016716 Ga0316584_0016716_1597_2715 371
630 3300037068 Ga0373925_0014125 Ga0373925_0014125_4323_5456 371
631 3300046455 Ga0495603_0035241 Ga0495603_0035241_1689_2822 371
632 3300046459 Ga0495629_0001999 Ga0495629_0001999_5461_6594 371
633 3300046473 Ga0495582_0015534 Ga0495582_0015534_1240_2373 371
634 3300046491 Ga0495584_0126509 Ga0495584_0126509_54_1214 371
635 3300046499 Ga0495594_0003379 Ga0495594_0003379_897_2030 371
636 3300046681 Ga0495647_0010627 Ga0495647_0010627_167_1300 371
637 3300046683 Ga0495658_0001195 Ga0495658_0001195_10492_11625 371
638 3300046689 Ga0495613_0015398 Ga0495613_0015398_1322_2455 371
639 3300046809 Ga0495600_0044885 Ga0495600_0044885_108_1241 371
640 3300047315 Ga0495581_0167389 Ga0495581_0167389_84_1217 371
641 3300047322 Ga0495680_0006216 Ga0495680_0006216_6806_7939 371
642 3300047471 Ga0495684_0246151 Ga0495684_0246151_145_1278 371
643 3300047673 Ga0495593_0019288 Ga0495593_0019288_2604_3737 371
644 3300048905 Ga0496102_0012361 Ga0496102_0012361_5973_7106 371
645 3300048906 Ga0496103_0024424 Ga0496103_0024424_668_1801 371
646 3300048907 Ga0496104_0005252 Ga0496104_0005252_5919_7052 371
647 3300048908 Ga0496105_0003481 Ga0496105_0003481_4650_5783 371
648 3300048909 Ga0496106_0024213 Ga0496106_0024213_359_1492 371
649 3300048910 Ga0496107_0010499 Ga0496107_0010499_2427_3560 371
650 3300048911 Ga0496108_0048205 Ga0496108_0048205_1473_2606 371
651 3300048912 Ga0496109_0004488 Ga0496109_0004488_3412_4545 371
652 3300048913 Ga0496110_0104271 Ga0496110_0104271_1150_2283 371
653 3300048915 Ga0496112_0006455 Ga0496112_0006455_3319_4452 371
654 3300048915 Ga0496112_0065980 Ga0496112_0065980_1858_2979 371
655 3300048916 Ga0496113_0002168 Ga0496113_0002168_5755_6888 371
656 3300048918 Ga0496115_0008610 Ga0496115_0008610_449_1582 371
657 3300050512 nmdc:mga0n895_192896_c1 nmdc:mga0n895_192896_c1_849_1982 371
658 3300050513 nmdc:mga0rr50_55627_c1 nmdc:mga0rr50_55627_c1_1739_2872 371
659 3300053085 Ga0495619_0000229 Ga0495619_0000229_31134_32267 371
660 iso_pu_bacteria 2602042107 2603860783 371
661 iso_pu_bacteria 2738543031 2739348934 371
662 iso_pu_bacteria 2824696289 2824704342 371
663 iso_pu_bacteria 2857524615 2857524773 371
664 iso_pu_bacteria 2893066018 2893069293 371
665 iso_pu_bacteria 2919073203 2919078657 371
666 3300005981 Ga0081538_10036175 Ga0081538_100361753 372
667 3300025925 Ga0207650_10018326 Ga0207650_100183264 372
668 3300035118 Ga0373954_0016151 Ga0373954_0016151_1998_3119 372
669 3300035119 Ga0373956_0004598 Ga0373956_0004598_516_1637 372
670 3300035172 Ga0373955_0056656 Ga0373955_0056656_457_1578 372
671 3300035724 Ga0373933_0014822 Ga0373933_0014822_2820_3941 372
672 3300036401 Ga0373937_0024713 Ga0373937_0024713_1172_2293 372
673 3300036401 Ga0373937_0026411 Ga0373937_0026411_1791_2909 372
674 3300036401 Ga0373937_0067560 Ga0373937_0067560_79_1200 372
675 3300046462 Ga0495651_0055722 Ga0495651_0055722_1903_3024 372
676 3300046462 Ga0495651_0145529 Ga0495651_0145529_43_1161 372
677 3300046463 Ga0495653_0132237 Ga0495653_0132237_175_1296 372
678 3300046511 Ga0495608_0154623 Ga0495608_0154623_310_1428 372
679 3300046516 Ga0495628_0128179 Ga0495628_0128179_463_1581 372
680 3300046533 Ga0495640_0060368 Ga0495640_0060368_1412_2530 372
681 3300046536 Ga0495587_0044458 Ga0495587_0044458_424_1545 372
682 3300046559 Ga0495667_0048217 Ga0495667_0048217_928_2046 372
683 3300046663 Ga0495635_0019774 Ga0495635_0019774_1920_3038 372
684 3300046809 Ga0495600_0099298 Ga0495600_0099298_93_1214 372
685 3300047319 Ga0495674_0049741 Ga0495674_0049741_381_1499 372
686 3300047444 Ga0495675_0110810 Ga0495675_0110810_487_1608 372
687 3300048088 Ga0495602_0037412 Ga0495602_0037412_1192_2313 372
688 3300048917 Ga0496114_0146287 Ga0496114_0146287_767_1885 372
689 3300049582 Ga0501048_0003551 Ga0501048_0003551_1501_2673 372
690 3300049592 Ga0501076_0284849 Ga0501076_0284849_83_1204 372
691 3300049741 Ga0501079_0137642 Ga0501079_0137642_412_1536 372
692 3300050507 nmdc:mga05p37_322101_c1 nmdc:mga05p37_322101_c1_232_1353 372
693 3300053077 Ga0495601_0000549 Ga0495601_0000549_11817_12935 372
694 3300053077 Ga0495601_0015181 Ga0495601_0015181_809_1930 372
695 3300053078 Ga0495612_0011648 Ga0495612_0011648_83_1204 372
696 3300053078 Ga0495612_0015944 Ga0495612_0015944_1745_2863 372
697 3300053084 Ga0495595_0002822 Ga0495595_0002822_3342_4463 372
698 3300053085 Ga0495619_0001121 Ga0495619_0001121_3116_4234 372
699 3300053139 Ga0500568_0027980 Ga0500568_0027980_974_2107 372
700 iso_pu_bacteria 2507262055 2507510234 372
701 iso_pu_bacteria 2508501009 2508544245 372
702 iso_pu_bacteria 2508501042 2508697817 372
703 iso_pu_bacteria 2508501128 2509151155 372
704 iso_pu_bacteria 2511231028 2511400764 372
705 iso_pu_bacteria 2513237092 2513628134 372
706 iso_pu_bacteria 2513237094 2513640383 372
707 iso_pu_bacteria 2513237095 2513648765 372
708 iso_pu_bacteria 2513237096 2513659010 372
709 iso_pu_bacteria 2513237098 2513673213 372
710 iso_pu_bacteria 2513237101 2513695393 372
711 iso_pu_bacteria 2513237102 2513700384 372
712 iso_pu_bacteria 2513237104 2513716047 372
713 iso_pu_bacteria 2513237137 2513860373 372
714 iso_pu_bacteria 2513237139 2513878566 372
715 iso_pu_bacteria 2513237141 2513891846 372
716 iso_pu_bacteria 2513237145 2513921273 372
717 iso_pu_bacteria 2513237161 2514013436 372
718 iso_pu_bacteria 2515154112 2515630756 372
719 iso_pu_bacteria 2517093001 2517105303 372
720 iso_pu_bacteria 2517572143 2517894154 372
721 iso_pu_bacteria 2524023205 2524439275 372
722 iso_pu_bacteria 2524023210 2524466108 372
723 iso_pu_bacteria 2528768022 2528856930 372
724 iso_pu_bacteria 2617270735 2617349813 372
725 iso_pu_bacteria 2617270741 2617379170 372
726 iso_pu_bacteria 2643221651 2644287663 372
727 iso_pu_bacteria 2667528175 2671123468 372
728 iso_pu_bacteria 2721755755 2723843776 372
729 iso_pu_bacteria 2744054633 2745076676 372
730 iso_pu_bacteria 2791355196 2793065035 372
731 iso_pu_bacteria 2791355197 2793073136 372
732 iso_pu_bacteria 2802429603 2805917304 372
733 iso_pu_bacteria 2816332527 2818241818 372
734 iso_pu_bacteria 2824600985 2824609129 372
735 iso_pu_bacteria 2824609381 2824617747 372
736 iso_pu_bacteria 2824617872 2824621130 372
737 iso_pu_bacteria 2824626560 2824629757 372
738 iso_pu_bacteria 2824635225 2824643828 372
739 iso_pu_bacteria 2824644064 2824652615 372
740 iso_pu_bacteria 2824653114 2824661099 372
741 iso_pu_bacteria 2824661429 2824671198 372
742 iso_pu_bacteria 2824671348 2824679427 372
743 iso_pu_bacteria 2824679649 2824687228 372
744 iso_pu_bacteria 2824687955 2824695446 372
745 iso_pu_bacteria 2824704595 2824714035 372
746 iso_pu_bacteria 2824714736 2824723257 372
747 iso_pu_bacteria 2824723954 2824732559 372
748 iso_pu_bacteria 2824732956 2824740552 372
749 iso_pu_bacteria 2824746037 2824751781 372
750 iso_pu_bacteria 2824753945 2824760512 372
751 iso_pu_bacteria 2824763712 2824771311 372
752 iso_pu_bacteria 2824773399 2824778350 372
753 iso_pu_bacteria 2838122688 2838125583 372
754 iso_pu_bacteria 2841941048 2841941753 372
755 iso_pu_bacteria 2841949485 2841951184 372
756 iso_pu_bacteria 2841957949 2841959252 372
757 iso_pu_bacteria 2841966195 2841968825 372
758 iso_pu_bacteria 2841974524 2841975979 372
759 iso_pu_bacteria 2841983080 2841989166 372
760 iso_pu_bacteria 2842038055 2842045286 372
761 iso_pu_bacteria 2842045827 2842049052 372
762 iso_pu_bacteria 2844315083 2844317505 372
763 iso_pu_bacteria 2847930680 2847934299 372
764 iso_pu_bacteria 2847939898 2847944882 372
765 iso_pu_bacteria 2849076700 2849080914 372
766 iso_pu_bacteria 2857509624 2857509732 372
767 iso_pu_bacteria 2874590934 2874591998 372
768 iso_pu_bacteria 2874604998 2874612236 372
769 iso_pu_bacteria 2874612657 2874617775 372
770 iso_pu_bacteria 2874620515 2874623939 372
771 iso_pu_bacteria 2874628541 2874632750 372
772 iso_pu_bacteria 2874645413 2874646594 372
773 iso_pu_bacteria 2876761206 2876767862 372
774 iso_pu_bacteria 2876771140 2876772212 372
775 iso_pu_bacteria 2876808645 2876811362 372
776 iso_pu_bacteria 2876818435 2876819590 372
777 iso_pu_bacteria 2879074833 2879076099 372
778 iso_pu_bacteria 2879083081 2879086731 372
779 iso_pu_bacteria 2879099564 2879109956 372
780 iso_pu_bacteria 2879110137 2879114764 372
781 iso_pu_bacteria 2879127579 2879128846 372
782 iso_pu_bacteria 2879142872 2879144132 372
783 iso_pu_bacteria 2881364244 2881369242 372
784 iso_pu_bacteria 2881665667 2881669847 372
785 iso_pu_bacteria 2885366525 2885367567 372
786 iso_pu_bacteria 2885374607 2885379600 372
787 iso_pu_bacteria 2885409591 2885412792 372
788 iso_pu_bacteria 2888378607 2888382210 372
789 iso_pu_bacteria 2888388044 2888388466 372
790 iso_pu_bacteria 2888419890 2888422818 372
791 iso_pu_bacteria 2889033259 2889042020 372
792 iso_pu_bacteria 2903727486 2903733106 372
793 iso_pu_bacteria 2903748898 2903757558 372
794 iso_pu_bacteria 2904666416 2904673638 372
795 iso_pu_bacteria 2904690495 2904697413 372
796 iso_pu_bacteria 2904711408 2904718704 372
797 iso_pu_bacteria 2906602504 2906603958 372
798 iso_pu_bacteria 2906610324 2906610972 372
799 iso_pu_bacteria 2906626472 2906633372 372
800 iso_pu_bacteria 2906635258 2906639566 372
801 iso_pu_bacteria 2906643746 2906649293 372
802 iso_pu_bacteria 2906660503 2906661768 372
803 iso_pu_bacteria 2908739725 2908744482 372
804 iso_pu_bacteria 2908756301 2908762379 372
805 iso_pu_bacteria 2908775508 2908778489 372
806 iso_pu_bacteria 2922361189 2922366110 372
807 iso_pu_bacteria 2922368715 2922375812 372
808 iso_pu_bacteria 2922393267 2922399118 372
809 iso_pu_bacteria 2922425934 2922428349 372
810 iso_pu_bacteria 2929615660 2929616507 372
811 iso_pu_bacteria 2929624759 2929625251 372
812 iso_pu_bacteria 2932784394 2932786822 372
813 iso_pu_bacteria 2932794094 2932798941 372
814 iso_pu_bacteria 2932801729 2932804998 372
815 iso_pu_bacteria 2932809354 2932811024 372
816 iso_pu_bacteria 2932818245 2932825983 372
817 iso_pu_bacteria 2932828146 2932832588 372
818 iso_pu_bacteria 2933577622 2933578210 372
819 iso_pu_bacteria 2935608549 2935610849 372
820 iso_pu_bacteria 2935616580 2935619290 372
821 iso_pu_bacteria 2935630451 2935637839 372
822 iso_pu_bacteria 2935638405 2935645323 372
823 iso_pu_bacteria 2935648319 2935655481 372
824 iso_pu_bacteria 2935656913 2935664348 372
825 iso_pu_bacteria 2935665750 2935671421 372
826 iso_pu_bacteria 2935675223 2935683781 372
827 iso_pu_bacteria 2935684952 2935691914 372
828 iso_pu_bacteria 2935694250 2935695133 372
829 iso_pu_bacteria 2935703347 2935708060 372
830 iso_pu_bacteria 2935713505 2935719982 372
831 iso_pu_bacteria 2935722832 2935729251 372
832 iso_pu_bacteria 2935732158 2935738889 372
833 iso_pu_bacteria 2935741537 2935747926 372
834 iso_pu_bacteria 2935750917 2935756510 372
835 iso_pu_bacteria 2935760218 2935761511 372
836 iso_pu_bacteria 2935769743 2935776808 372
837 iso_pu_bacteria 2935777560 2935783397 372
838 iso_pu_bacteria 2935785616 2935792685 372
839 iso_pu_bacteria 2935793552 2935800712 372
840 iso_pu_bacteria 2935801545 2935805009 372
841 iso_pu_bacteria 2935810662 2935812172 372
842 iso_pu_bacteria 2935819856 2935820333 372
843 iso_pu_bacteria 2935827899 2935834834 372
844 iso_pu_bacteria 2935837841 2935838955 372
845 iso_pu_bacteria 2935847175 2935849657 372
846 iso_pu_bacteria 2935855204 2935857655 372
847 iso_pu_bacteria 2935864058 2935865209 372
848 iso_pu_bacteria 2935873716 2935881555 372
849 iso_pu_bacteria 2935883170 2935889331 372
850 iso_pu_bacteria 2935908558 2935911549 372
851 iso_pu_bacteria 2935916978 2935919203 372
852 iso_pu_bacteria 2935926038 2935928578 372
853 iso_pu_bacteria 2935934488 2935938223 372
854 iso_pu_bacteria 2935942939 2935945885 372
855 iso_pu_bacteria 2935951376 2935954508 372
856 iso_pu_bacteria 2935959822 2935966115 372
857 iso_pu_bacteria 2935967501 2935970395 372
858 iso_pu_bacteria 2935975950 2935979882 372
859 iso_pu_bacteria 2935984226 2935987643 372
860 iso_pu_bacteria 2935992306 2935997419 372
861 iso_pu_bacteria 2936002035 2936005202 372
862 iso_pu_bacteria 2936011229 2936018418 372
863 iso_pu_bacteria 2936019824 2936026949 372
864 iso_pu_bacteria 2936028420 2936035831 372
865 iso_pu_bacteria 2936037263 2936038766 372
866 iso_pu_bacteria 2936046547 2936053910 372
867 iso_pu_bacteria 2936055302 2936061962 372
868 iso_pu_bacteria 2940556831 2940562424 372
869 iso_pu_bacteria 2941507105 2941514512 372
870 iso_pu_bacteria 2941515067 2941522408 372
871 iso_pu_bacteria 2941523033 2941530279 372
872 iso_pu_bacteria 2941531003 2941537815 372
873 iso_pu_bacteria 2941538514 2941539645 372
874 iso_pu_bacteria 3005474847 3005478333 372
875 iso_pu_bacteria 3005483717 3005486523 372
876 iso_pu_bacteria 3005506211 3005512327 372
877 iso_pu_bacteria 3005587118 3005593517 372
878 iso_pu_bacteria 3005594810 3005597237 372
879 iso_pu_bacteria 3005710791 3005713273 372
880 iso_pu_bacteria 3005718088 3005720621 372
881 iso_pu_bacteria 8006926726 8006931512 372
882 iso_pu_bacteria 8006933436 8006942887 372
883 iso_pu_bacteria 8006973647 8006982607 372
884 iso_pu_bacteria 8006984368 8006988654 372
885 iso_pu_bacteria 8016511872 8016515412 372
886 iso_pu_bacteria 8016522445 8016523119 372
887 iso_pu_bacteria 8016530956 8016536591 372
888 iso_pu_bacteria 8016548790 8016552377 372
889 iso_pu_bacteria 8016557553 8016560759 372
890 iso_pu_bacteria 8016566248 8016566263 372
891 iso_pu_bacteria 8016575299 8016579022 372
892 iso_pu_bacteria 8016583857 8016590581 372
893 iso_pu_bacteria 8016595262 8016598639 372
894 iso_pu_bacteria 8016603502 8016612462 372
895 iso_pu_bacteria 8016613128 8016621347 372
896 iso_pu_bacteria 8016630954 8016632812 372
897 iso_pu_bacteria 8017057580 8017061066 372
898 iso_pu_bacteria 8019530166 8019536300 372
899 iso_pu_bacteria 8019538911 8019543161 372
900 iso_pu_bacteria 8019547302 8019555764 372
901 iso_pu_bacteria 8019555841 8019558669 372
902 iso_pu_bacteria 8019565922 8019566632 372
903 iso_pu_bacteria 8019576017 8019580539 372
904 iso_pu_bacteria 8019586578 8019588259 372
905 iso_pu_bacteria 8019597564 8019603080 372
906 iso_pu_bacteria 8019608314 8019615457 372
907 iso_pu_bacteria 8019629233 8019636214 372
908 iso_pu_bacteria 8019648815 8019656254 372
909 iso_pu_bacteria 8019659431 8019663983 372
910 iso_pu_bacteria 8019668869 8019673612 372
911 iso_pu_bacteria 8019678201 8019682521 372
912 iso_pu_bacteria 8019687851 8019688178 372
913 iso_pu_bacteria 8055742211 8055748153 372
914 iso_pu_bacteria 8056673599 8056679855 372
915 iso_pu_bacteria 8056681323 8056686505 372
916 iso_pu_bacteria 8056967851 8056968964 372
917 3300005471 Ga0070698_100310135 Ga0070698_1003101351 373
918 3300009094 Ga0111539_10152393 Ga0111539_101523933 373
919 3300036712 Ga0316584_0014165 Ga0316584_0014165_4022_5161 373
920 3300049589 Ga0501073_0025360 Ga0501073_0025360_2021_3148 373
921 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_272108_273235 373
922 iso_pu_bacteria 2643221547 2643755382 373
923 iso_pu_bacteria 8006994254 8006994369 373
924 3300005290 Ga0065712_10003538 Ga0065712_100035382 374
925 3300005365 Ga0070688_100089378 Ga0070688_1000893781 374
926 3300005367 Ga0070667_100132488 Ga0070667_1001324882 374
927 3300005549 Ga0070704_100030161 Ga0070704_1000301613 374
928 3300005937 Ga0081455_10007799 Ga0081455_100077994 374
929 3300006042 Ga0075368_10012790 Ga0075368_100127903 374
930 3300006051 Ga0075364_10051487 Ga0075364_100514873 374
931 3300006178 Ga0075367_10038585 Ga0075367_100385852 374
932 3300006353 Ga0075370_10058740 Ga0075370_100587403 374
933 3300009101 Ga0105247_10009472 Ga0105247_100094727 374
934 3300009177 Ga0105248_10025465 Ga0105248_100254659 374
935 3300009553 Ga0105249_10001420 Ga0105249_1000142015 374
936 3300011119 Ga0105246_10341826 Ga0105246_103418261 374
937 3300014325 Ga0163163_10004718 Ga0163163_1000471810 374
938 3300014968 Ga0157379_10026095 Ga0157379_100260956 374
939 3300025900 Ga0207710_10030249 Ga0207710_100302492 374
940 3300025941 Ga0207711_10035377 Ga0207711_100353772 374
941 3300026067 Ga0207678_10025054 Ga0207678_100250543 374
942 3300027866 Ga0209813_10016556 Ga0209813_100165562 374
943 3300031456 Ga0307513_10033286 Ga0307513_100332862 374
944 3300037068 Ga0373925_0079028 Ga0373925_0079028_81_1208 374
945 3300042005 Ga0439448_0053025 Ga0439448_0053025_173_1300 374
946 3300042012 Ga0439455_0005312 Ga0439455_0005312_938_2065 374
947 3300046472 Ga0495580_0055036 Ga0495580_0055036_291_1418 374
948 3300046473 Ga0495582_0017780 Ga0495582_0017780_1401_2528 374
949 3300046475 Ga0495639_0016315 Ga0495639_0016315_368_1495 374
950 3300046517 Ga0495630_0266997 Ga0495630_0266997_65_1192 374
951 3300046526 Ga0495666_0019193 Ga0495666_0019193_1934_3061 374
952 3300046533 Ga0495640_0014924 Ga0495640_0014924_1644_2771 374
953 3300046615 Ga0495656_0122334 Ga0495656_0122334_15_1142 374
954 3300048907 Ga0496104_0124548 Ga0496104_0124548_422_1549 374
955 3300048911 Ga0496108_0007552 Ga0496108_0007552_3191_4318 374
956 3300048915 Ga0496112_0013996 Ga0496112_0013996_4757_5884 374
957 3300048916 Ga0496113_0003135 Ga0496113_0003135_5097_6224 374
958 3300049570 Ga0501033_0131470 Ga0501033_0131470_651_1790 374
959 3300049572 Ga0501036_0043680 Ga0501036_0043680_1702_2841 374
960 3300049581 Ga0501047_0104574 Ga0501047_0104574_1230_2369 374
961 3300049583 Ga0501067_0027958 Ga0501067_0027958_1202_2341 374
962 3300049823 Ga0501044_0036131 Ga0501044_0036131_484_1623 374
963 3300050495 nmdc:mga04h51_39942_c1 nmdc:mga04h51_39942_c1_312_1439 374
964 3300050496 nmdc:mga07m45_62632_c1 nmdc:mga07m45_62632_c1_964_2091 374
965 3300053093 Ga0500651_0031175 Ga0500651_0031175_1461_2594 374
966 3300054114 Ga0501084_0031729 Ga0501084_0031729_51_1178 374
967 3300060353 Ga0501082_0004836 Ga0501082_0004836_6353_7492 374
968 3300060353 Ga0501082_0137353 Ga0501082_0137353_337_1476 374
969 iso_pu_bacteria 2919450847 2919454615 374
970 iso_pu_bacteria 8001845381 8001849689 374
971 3300005329 Ga0070683_100036431 Ga0070683_1000364314 375
972 3300005364 Ga0070673_100129260 Ga0070673_1001292602 375
973 3300005439 Ga0070711_100096662 Ga0070711_1000966622 375
974 3300005530 Ga0070679_100091000 Ga0070679_1000910001 375
975 3300005983 Ga0081540_1000003 Ga0081540_100000333 375
976 3300006051 Ga0075364_10125572 Ga0075364_101255722 375
977 3300006175 Ga0070712_100101329 Ga0070712_1001013292 375
978 3300006186 Ga0075369_10046899 Ga0075369_100468992 375
979 3300009093 Ga0105240_10082733 Ga0105240_100827334 375
980 3300009177 Ga0105248_10391109 Ga0105248_103911092 375
981 3300009551 Ga0105238_10121038 Ga0105238_101210383 375
982 3300013100 Ga0157373_10072583 Ga0157373_100725831 375
983 3300013307 Ga0157372_10251571 Ga0157372_102515711 375
984 3300021358 Ga0213873_10005190 Ga0213873_100051901 375
985 3300021384 Ga0213876_10002883 Ga0213876_100028835 375
986 3300021388 Ga0213875_10001986 Ga0213875_100019864 375
987 3300024227 Ga0228598_1002460 Ga0228598_10024604 375
988 3300025295 Ga0209564_1020885 Ga0209564_10208853 375
989 3300025906 Ga0207699_10020526 Ga0207699_100205263 375
990 3300025906 Ga0207699_10133082 Ga0207699_101330821 375
991 3300025915 Ga0207693_10056832 Ga0207693_100568322 375
992 3300025932 Ga0207690_10112686 Ga0207690_101126861 375
993 3300025944 Ga0207661_10124475 Ga0207661_101244752 375
994 3300025949 Ga0207667_10280892 Ga0207667_102808921 375
995 3300031241 Ga0265325_10024274 Ga0265325_100242741 375
996 3300031241 Ga0265325_10058055 Ga0265325_100580552 375
997 3300031249 Ga0265339_10034700 Ga0265339_100347002 375
998 3300031250 Ga0265331_10063434 Ga0265331_100634342 375
999 3300031595 Ga0265313_10048917 Ga0265313_100489172 375
1000 3300031665 Ga0316575_10015584 Ga0316575_100155841 375
1001 3300031691 Ga0316579_10107757 Ga0316579_101077571 375
1002 3300035725 Ga0373947_0107546 Ga0373947_0107546_392_1522 375
1003 3300037312 Ga0395899_0013310 Ga0395899_0013310_3821_4951 375
1004 3300037418 Ga0395900_0015919 Ga0395900_0015919_1733_2863 375
1005 3300037418 Ga0395900_0044317 Ga0395900_0044317_158_1288 375
1006 3300037466 Ga0395898_0030804 Ga0395898_0030804_4079_5209 375
1007 3300037466 Ga0395898_0046786 Ga0395898_0046786_305_1435 375
1008 3300038443 Ga0395901_0017419 Ga0395901_0017419_4558_5688 375
1009 3300038443 Ga0395901_0045424 Ga0395901_0045424_2509_3639 375
1010 3300044719 Ga0466971_0081638 Ga0466971_0081638_129_1259 375
1011 3300046473 Ga0495582_0070927 Ga0495582_0070927_305_1438 375
1012 3300046689 Ga0495613_0073149 Ga0495613_0073149_252_1385 375
1013 3300047319 Ga0495674_0060922 Ga0495674_0060922_2082_3212 375
1014 3300048918 Ga0496115_0037987 Ga0496115_0037987_723_1853 375
1015 3300048919 Ga0496116_0001381 Ga0496116_0001381_17500_18630 375
1016 3300048920 Ga0496117_0096234 Ga0496117_0096234_675_1805 375
1017 3300048921 Ga0496118_0082381 Ga0496118_0082381_126_1256 375
1018 3300048928 Ga0496125_0008104 Ga0496125_0008104_4538_5668 375
1019 3300050491 nmdc:mga00v17_204192_c1 nmdc:mga00v17_204192_c1_37_1167 375
1020 3300050492 nmdc:mga0yw44_100983_c1 nmdc:mga0yw44_100983_c1_85_1215 375
1021 3300053077 Ga0495601_0036801 Ga0495601_0036801_296_1426 375
1022 3300053088 Ga0500644_0000716 Ga0500644_0000716_9864_10994 375
1023 3300053121 Ga0500607_064381 Ga0500607_064381_560_1690 375
1024 3300053145 Ga0500586_002283 Ga0500586_002283_1631_2761 375
1025 3300053730 Ga0500645_001743 Ga0500645_001743_8000_9130 375
1026 iso_pu_bacteria 2545555834 2545674327 375
1027 iso_pu_bacteria 2885383462 2885392207 375
1028 iso_pu_bacteria 2903768456 2903772781 375
1029 iso_pu_bacteria 641522639 641645069 375
1030 iso_pu_bacteria 8056689827 8056694724 375
1031 3300001990 JGI24737J22298_10010552 JGI24737J22298_100105521 376
1032 3300005331 Ga0070670_100037991 Ga0070670_1000379912 376
1033 3300005340 Ga0070689_100111071 Ga0070689_1001110711 376
1034 3300005355 Ga0070671_100103037 Ga0070671_1001030373 376
1035 3300005365 Ga0070688_100144809 Ga0070688_1001448092 376
1036 3300005434 Ga0070709_10081750 Ga0070709_100817501 376
1037 3300005435 Ga0070714_100019598 Ga0070714_1000195982 376
1038 3300005437 Ga0070710_10011405 Ga0070710_100114053 376
1039 3300005439 Ga0070711_100004717 Ga0070711_1000047174 376
1040 3300005530 Ga0070679_100012488 Ga0070679_1000124883 376
1041 3300005539 Ga0068853_100039671 Ga0068853_1000396711 376
1042 3300005543 Ga0070672_100097229 Ga0070672_1000972293 376
1043 3300005548 Ga0070665_100047526 Ga0070665_1000475263 376
1044 3300005548 Ga0070665_100187906 Ga0070665_1001879062 376
1045 3300005563 Ga0068855_100015636 Ga0068855_1000156365 376
1046 3300005577 Ga0068857_100051056 Ga0068857_1000510562 376
1047 3300005614 Ga0068856_100293657 Ga0068856_1002936572 376
1048 3300005719 Ga0068861_100080421 Ga0068861_1000804212 376
1049 3300005841 Ga0068863_100091617 Ga0068863_1000916174 376
1050 3300006042 Ga0075368_10005197 Ga0075368_100051973 376
1051 3300006051 Ga0075364_10022670 Ga0075364_100226702 376
1052 3300006175 Ga0070712_100096908 Ga0070712_1000969082 376
1053 3300006178 Ga0075367_10097893 Ga0075367_100978931 376
1054 3300006186 Ga0075369_10023578 Ga0075369_100235782 376
1055 3300006195 Ga0075366_10105801 Ga0075366_101058012 376
1056 3300009093 Ga0105240_10015053 Ga0105240_1001505311 376
1057 3300009147 Ga0114129_10178319 Ga0114129_101783192 376
1058 3300009545 Ga0105237_10369684 Ga0105237_103696841 376
1059 3300009551 Ga0105238_10369881 Ga0105238_103698811 376
1060 3300010375 Ga0105239_10020537 Ga0105239_100205372 376
1061 3300021377 Ga0213874_10027120 Ga0213874_100271202 376
1062 3300025253 Ga0209677_100138 Ga0209677_10013834 376
1063 3300025261 Ga0209233_1001323 Ga0209233_10013236 376
1064 3300025898 Ga0207692_10038205 Ga0207692_100382052 376
1065 3300025904 Ga0207647_10001241 Ga0207647_1000124116 376
1066 3300025906 Ga0207699_10047620 Ga0207699_100476202 376
1067 3300025915 Ga0207693_10019955 Ga0207693_100199553 376
1068 3300025916 Ga0207663_10033876 Ga0207663_100338763 376
1069 3300025917 Ga0207660_10202593 Ga0207660_102025932 376
1070 3300025920 Ga0207649_10212697 Ga0207649_102126971 376
1071 3300025924 Ga0207694_10071276 Ga0207694_100712762 376
1072 3300025925 Ga0207650_10117079 Ga0207650_101170792 376
1073 3300025931 Ga0207644_10046328 Ga0207644_100463282 376
1074 3300025933 Ga0207706_10082603 Ga0207706_100826032 376
1075 3300025940 Ga0207691_10066544 Ga0207691_100665442 376
1076 3300025949 Ga0207667_10190655 Ga0207667_101906551 376
1077 3300025960 Ga0207651_10069164 Ga0207651_100691642 376
1078 3300026035 Ga0207703_10033248 Ga0207703_100332483 376
1079 3300026041 Ga0207639_10110182 Ga0207639_101101821 376
1080 3300026078 Ga0207702_10107934 Ga0207702_101079341 376
1081 3300026116 Ga0207674_10002364 Ga0207674_1000236416 376
1082 3300026118 Ga0207675_100100344 Ga0207675_1001003442 376
1083 3300027866 Ga0209813_10014707 Ga0209813_100147072 376
1084 3300028379 Ga0268266_10050734 Ga0268266_100507342 376
1085 3300028563 Ga0265319_1015026 Ga0265319_10150263 376
1086 3300028653 Ga0265323_10000788 Ga0265323_100007882 376
1087 3300028666 Ga0265336_10005161 Ga0265336_100051614 376
1088 3300028800 Ga0265338_10001265 Ga0265338_1000126533 376
1089 3300028800 Ga0265338_10037858 Ga0265338_100378582 376
1090 3300029957 Ga0265324_10006833 Ga0265324_100068334 376
1091 3300031235 Ga0265330_10039666 Ga0265330_100396662 376
1092 3300031241 Ga0265325_10012689 Ga0265325_100126893 376
1093 3300031249 Ga0265339_10000158 Ga0265339_1000015826 376
1094 3300031249 Ga0265339_10003907 Ga0265339_100039074 376
1095 3300031595 Ga0265313_10000426 Ga0265313_1000042644 376
1096 3300031691 Ga0316579_10003798 Ga0316579_100037983 376
1097 3300031711 Ga0265314_10004473 Ga0265314_100044735 376
1098 3300035111 Ga0373923_0064335 Ga0373923_0064335_392_1528 376
1099 3300035117 Ga0373953_0011755 Ga0373953_0011755_990_2123 376
1100 3300035117 Ga0373953_0030857 Ga0373953_0030857_866_2002 376
1101 3300035117 Ga0373953_0064333 Ga0373953_0064333_330_1463 376
1102 3300035118 Ga0373954_0070277 Ga0373954_0070277_442_1578 376
1103 3300035119 Ga0373956_0004249 Ga0373956_0004249_1200_2333 376
1104 3300035120 Ga0373957_0014655 Ga0373957_0014655_857_1990 376
1105 3300035120 Ga0373957_0039688 Ga0373957_0039688_309_1445 376
1106 3300035398 Ga0316574_0065256 Ga0316574_0065256_1029_2183 376
1107 3300035410 Ga0373924_0023112 Ga0373924_0023112_999_2132 376
1108 3300035692 Ga0373935_0073906 Ga0373935_0073906_620_1753 376
1109 3300036401 Ga0373937_0001336 Ga0373937_0001336_7722_8855 376
1110 3300036647 Ga0316582_0134982 Ga0316582_0134982_46_1182 376
1111 3300037068 Ga0373925_0008544 Ga0373925_0008544_1080_2213 376
1112 3300038741 Ga0400488_27481 Ga0400488_27481_227_1366 376
1113 3300038742 Ga0400486_05920 Ga0400486_05920_250_1389 376
1114 3300039437 Ga0436365_0352932 Ga0436365_0352932_324_1457 376
1115 3300039450 Ga0436363_0077061 Ga0436363_0077061_2263_3423 376
1116 3300046454 Ga0495592_0033557 Ga0495592_0033557_2685_3821 376
1117 3300046459 Ga0495629_0012888 Ga0495629_0012888_1860_2993 376
1118 3300046462 Ga0495651_0001352 Ga0495651_0001352_13821_14954 376
1119 3300046462 Ga0495651_0079504 Ga0495651_0079504_154_1287 376
1120 3300046463 Ga0495653_0015503 Ga0495653_0015503_4280_5413 376
1121 3300046463 Ga0495653_0073254 Ga0495653_0073254_557_1693 376
1122 3300046477 Ga0495664_0152003 Ga0495664_0152003_67_1200 376
1123 3300046511 Ga0495608_0000442 Ga0495608_0000442_16672_17805 376
1124 3300046514 Ga0495618_0011384 Ga0495618_0011384_4077_5210 376
1125 3300046516 Ga0495628_0111604 Ga0495628_0111604_895_2031 376
1126 3300046517 Ga0495630_0219843 Ga0495630_0219843_255_1391 376
1127 3300046529 Ga0495652_0152603 Ga0495652_0152603_585_1718 376
1128 3300046533 Ga0495640_0019531 Ga0495640_0019531_1827_2960 376
1129 3300046536 Ga0495587_0001204 Ga0495587_0001204_913_2046 376
1130 3300046536 Ga0495587_0033102 Ga0495587_0033102_166_1299 376
1131 3300046559 Ga0495667_0001732 Ga0495667_0001732_3714_4847 376
1132 3300046559 Ga0495667_0011498 Ga0495667_0011498_3789_4922 376
1133 3300046559 Ga0495667_0041089 Ga0495667_0041089_753_1889 376
1134 3300046642 Ga0495634_0008856 Ga0495634_0008856_2157_3290 376
1135 3300046663 Ga0495635_0016633 Ga0495635_0016633_503_1636 376
1136 3300046675 Ga0495657_0063861 Ga0495657_0063861_130_1263 376
1137 3300046678 Ga0495599_0073349 Ga0495599_0073349_239_1372 376
1138 3300046679 Ga0495623_0072195 Ga0495623_0072195_781_1914 376
1139 3300046680 Ga0495646_0010351 Ga0495646_0010351_386_1519 376
1140 3300047317 Ga0495604_0000422 Ga0495604_0000422_24191_25324 376
1141 3300047319 Ga0495674_0004401 Ga0495674_0004401_922_2055 376
1142 3300047320 Ga0495672_0019795 Ga0495672_0019795_823_1956 376
1143 3300047321 Ga0495676_0045629 Ga0495676_0045629_1787_2920 376
1144 3300047322 Ga0495680_0002318 Ga0495680_0002318_5425_6558 376
1145 3300047444 Ga0495675_0016294 Ga0495675_0016294_1765_2898 376
1146 3300047471 Ga0495684_0002100 Ga0495684_0002100_11537_12670 376
1147 3300048088 Ga0495602_0015358 Ga0495602_0015358_2269_3402 376
1148 3300048088 Ga0495602_0024539 Ga0495602_0024539_3775_4911 376
1149 3300048915 Ga0496112_0031659 Ga0496112_0031659_1251_2384 376
1150 3300048915 Ga0496112_0064226 Ga0496112_0064226_1031_2164 376
1151 3300048918 Ga0496115_0148844 Ga0496115_0148844_462_1595 376
1152 3300048924 Ga0496121_0012773 Ga0496121_0012773_5212_6372 376
1153 3300048928 Ga0496125_0000829 Ga0496125_0000829_47829_48962 376
1154 3300048929 Ga0496126_0096775 Ga0496126_0096775_1387_2520 376
1155 3300049571 Ga0501034_0096808 Ga0501034_0096808_1162_2298 376
1156 3300049581 Ga0501047_0094992 Ga0501047_0094992_155_1303 376
1157 3300049592 Ga0501076_0061488 Ga0501076_0061488_1776_2912 376
1158 3300049741 Ga0501079_0039035 Ga0501079_0039035_924_2060 376
1159 3300049742 Ga0501080_0154419 Ga0501080_0154419_353_1501 376
1160 3300049823 Ga0501044_0040089 Ga0501044_0040089_2782_3930 376
1161 3300049823 Ga0501044_0211473 Ga0501044_0211473_281_1417 376
1162 3300049824 Ga0501045_0066126 Ga0501045_0066126_1124_2260 376
1163 3300050491 nmdc:mga00v17_91310_c1 nmdc:mga00v17_91310_c1_381_1517 376
1164 3300050493 nmdc:mga0k408_77720_c1 nmdc:mga0k408_77720_c1_509_1645 376
1165 3300053077 Ga0495601_0043124 Ga0495601_0043124_1421_2554 376
1166 3300053077 Ga0495601_0044633 Ga0495601_0044633_400_1533 376
1167 3300053084 Ga0495595_0000603 Ga0495595_0000603_4306_5439 376
1168 3300053084 Ga0495595_0022366 Ga0495595_0022366_1288_2421 376
1169 3300053084 Ga0495595_0105066 Ga0495595_0105066_184_1320 376
1170 3300053085 Ga0495619_0001556 Ga0495619_0001556_2625_3758 376
1171 3300053136 Ga0500559_0000596 Ga0500559_0000596_18172_19368 376
1172 3300053153 Ga0500616_0000084 Ga0500616_0000084_61997_63175 376
1173 3300053163 Ga0500639_002824 Ga0500639_002824_4324_5520 376
1174 3300060353 Ga0501082_0052291 Ga0501082_0052291_1843_2979 376
1175 iso_pu_bacteria 2524023228 2524536119 376
1176 iso_pu_bacteria 2728368998 2728748750 376
1177 iso_pu_bacteria 2791355199 2793079385 376
1178 iso_pu_bacteria 2891088606 2891089030 376
1179 iso_pu_bacteria 2904699407 2904705272 376
1180 iso_pu_bacteria 8006964411 8006965006 376
1181 2209111006 2214544935 2213593654 377
1182 3300000042 ARSoilYngRDRAFT_c00089 ARSoilYngRDRAFT_0008911 377
1183 3300000044 ARSoilOldRDRAFT_c000300 ARSoilOldRDRAFT_0003005 377
1184 3300000044 ARSoilOldRDRAFT_c000339 ARSoilOldRDRAFT_0003395 377
1185 3300000045 ARCol0oldRDRAFT_c00174 ARCol0oldRDRAFT_001744 377
1186 3300000652 ARCol0yngRDRAFT_1000107 ARCol0yngRDRAFT_100010711 377
1187 3300001915 JGI24741J21665_1013626 JGI24741J21665_10136262 377
1188 3300001977 JGI24746J21847_1000182 JGI24746J21847_10001826 377
1189 3300001978 JGI24747J21853_1002123 JGI24747J21853_10021232 377
1190 3300001989 JGI24739J22299_10002319 JGI24739J22299_100023194 377
1191 3300001990 JGI24737J22298_10007743 JGI24737J22298_100077433 377
1192 3300001990 JGI24737J22298_10023654 JGI24737J22298_100236542 377
1193 3300002070 JGI24750J21931_1000513 JGI24750J21931_10005133 377
1194 3300002070 JGI24750J21931_1000665 JGI24750J21931_10006656 377
1195 3300002073 JGI24745J21846_1000274 JGI24745J21846_10002741 377
1196 3300002075 JGI24738J21930_10000052 JGI24738J21930_1000005212 377
1197 3300002076 JGI24749J21850_1002731 JGI24749J21850_10027312 377
1198 3300002077 JGI24744J21845_10001379 JGI24744J21845_100013792 377
1199 3300002126 JGI24035J26624_1000226 JGI24035J26624_10002264 377
1200 3300002155 JGI24033J26618_1002616 JGI24033J26618_10026162 377
1201 3300002244 JGI24742J22300_10001173 JGI24742J22300_100011733 377
1202 3300005289 Ga0065704_10090369 Ga0065704_100903691 377
1203 3300005290 Ga0065712_10015554 Ga0065712_100155542 377
1204 3300005290 Ga0065712_10068990 Ga0065712_100689905 377
1205 3300005290 Ga0065712_10083170 Ga0065712_100831703 377
1206 3300005290 Ga0065712_10099300 Ga0065712_100993002 377
1207 3300005293 Ga0065715_10089733 Ga0065715_100897335 377
1208 3300005293 Ga0065715_10104580 Ga0065715_101045803 377
1209 3300005295 Ga0065707_10092121 Ga0065707_100921213 377
1210 3300005328 Ga0070676_10001246 Ga0070676_100012466 377
1211 3300005329 Ga0070683_100003790 Ga0070683_1000037906 377
1212 3300005329 Ga0070683_100041700 Ga0070683_1000417004 377
1213 3300005330 Ga0070690_100004565 Ga0070690_1000045652 377
1214 3300005330 Ga0070690_100004629 Ga0070690_1000046292 377
1215 3300005330 Ga0070690_100134507 Ga0070690_1001345072 377
1216 3300005331 Ga0070670_100002085 Ga0070670_10000208511 377
1217 3300005331 Ga0070670_100042623 Ga0070670_1000426232 377
1218 3300005331 Ga0070670_100100990 Ga0070670_1001009901 377
1219 3300005331 Ga0070670_100263878 Ga0070670_1002638781 377
1220 3300005333 Ga0070677_10000009 Ga0070677_1000000916 377
1221 3300005334 Ga0068869_100002305 Ga0068869_1000023056 377
1222 3300005335 Ga0070666_10007715 Ga0070666_100077155 377
1223 3300005335 Ga0070666_10009200 Ga0070666_100092004 377
1224 3300005336 Ga0070680_100004098 Ga0070680_1000040985 377
1225 3300005336 Ga0070680_100018156 Ga0070680_1000181564 377
1226 3300005337 Ga0070682_100000116 Ga0070682_1000001167 377
1227 3300005337 Ga0070682_100034485 Ga0070682_1000344853 377
1228 3300005338 Ga0068868_100003854 Ga0068868_1000038546 377
1229 3300005338 Ga0068868_100052544 Ga0068868_1000525443 377
1230 3300005338 Ga0068868_100118518 Ga0068868_1001185182 377
1231 3300005338 Ga0068868_100121868 Ga0068868_1001218682 377
1232 3300005339 Ga0070660_100003331 Ga0070660_1000033315 377
1233 3300005339 Ga0070660_100019816 Ga0070660_1000198164 377
1234 3300005340 Ga0070689_100003558 Ga0070689_1000035585 377
1235 3300005340 Ga0070689_100010855 Ga0070689_1000108555 377
1236 3300005340 Ga0070689_100194892 Ga0070689_1001948921 377
1237 3300005341 Ga0070691_10003923 Ga0070691_100039233 377
1238 3300005341 Ga0070691_10018597 Ga0070691_100185973 377
1239 3300005343 Ga0070687_100000789 Ga0070687_1000007895 377
1240 3300005343 Ga0070687_100023301 Ga0070687_1000233012 377
1241 3300005344 Ga0070661_100001106 Ga0070661_10000110612 377
1242 3300005344 Ga0070661_100040659 Ga0070661_1000406593 377
1243 3300005345 Ga0070692_10000072 Ga0070692_100000726 377
1244 3300005345 Ga0070692_10014992 Ga0070692_100149922 377
1245 3300005347 Ga0070668_100101369 Ga0070668_1001013692 377
1246 3300005353 Ga0070669_100006413 Ga0070669_1000064135 377
1247 3300005353 Ga0070669_100023793 Ga0070669_1000237933 377
1248 3300005354 Ga0070675_100002349 Ga0070675_10000234912 377
1249 3300005354 Ga0070675_100075291 Ga0070675_1000752912 377
1250 3300005355 Ga0070671_100000438 Ga0070671_10000043829 377
1251 3300005355 Ga0070671_100022090 Ga0070671_1000220904 377
1252 3300005355 Ga0070671_100050350 Ga0070671_1000503502 377
1253 3300005355 Ga0070671_100101976 Ga0070671_1001019762 377
1254 3300005356 Ga0070674_100010977 Ga0070674_1000109775 377
1255 3300005356 Ga0070674_100082631 Ga0070674_1000826312 377
1256 3300005356 Ga0070674_100134883 Ga0070674_1001348831 377
1257 3300005364 Ga0070673_100013957 Ga0070673_1000139572 377
1258 3300005364 Ga0070673_100108718 Ga0070673_1001087181 377
1259 3300005365 Ga0070688_100002434 Ga0070688_1000024343 377
1260 3300005365 Ga0070688_100011673 Ga0070688_1000116733 377
1261 3300005365 Ga0070688_100024430 Ga0070688_1000244301 377
1262 3300005366 Ga0070659_100004384 Ga0070659_1000043845 377
1263 3300005366 Ga0070659_100031077 Ga0070659_1000310772 377
1264 3300005367 Ga0070667_100022200 Ga0070667_1000222001 377
1265 3300005367 Ga0070667_100028213 Ga0070667_1000282133 377
1266 3300005367 Ga0070667_100162549 Ga0070667_1001625492 377
1267 3300005434 Ga0070709_10002732 Ga0070709_100027325 377
1268 3300005436 Ga0070713_100019289 Ga0070713_1000192894 377
1269 3300005436 Ga0070713_100035925 Ga0070713_1000359252 377
1270 3300005436 Ga0070713_100064129 Ga0070713_1000641294 377
1271 3300005436 Ga0070713_100169074 Ga0070713_1001690741 377
1272 3300005437 Ga0070710_10005268 Ga0070710_100052685 377
1273 3300005438 Ga0070701_10000749 Ga0070701_100007495 377
1274 3300005438 Ga0070701_10029566 Ga0070701_100295662 377
1275 3300005439 Ga0070711_100014964 Ga0070711_1000149645 377
1276 3300005439 Ga0070711_100115530 Ga0070711_1001155302 377
1277 3300005439 Ga0070711_100131993 Ga0070711_1001319932 377
1278 3300005440 Ga0070705_100001548 Ga0070705_1000015486 377
1279 3300005440 Ga0070705_100008627 Ga0070705_1000086274 377
1280 3300005441 Ga0070700_100002431 Ga0070700_1000024315 377
1281 3300005441 Ga0070700_100005261 Ga0070700_1000052615 377
1282 3300005444 Ga0070694_100008016 Ga0070694_1000080164 377
1283 3300005444 Ga0070694_100020661 Ga0070694_1000206614 377
1284 3300005455 Ga0070663_100002701 Ga0070663_1000027016 377
1285 3300005455 Ga0070663_100028958 Ga0070663_1000289583 377
1286 3300005456 Ga0070678_100003996 Ga0070678_1000039964 377
1287 3300005456 Ga0070678_100021420 Ga0070678_1000214202 377
1288 3300005456 Ga0070678_100029939 Ga0070678_1000299393 377
1289 3300005457 Ga0070662_100013570 Ga0070662_1000135703 377
1290 3300005457 Ga0070662_100032477 Ga0070662_1000324773 377
1291 3300005458 Ga0070681_10027797 Ga0070681_100277973 377
1292 3300005458 Ga0070681_10049000 Ga0070681_100490003 377
1293 3300005459 Ga0068867_100003047 Ga0068867_1000030475 377
1294 3300005459 Ga0068867_100087539 Ga0068867_1000875392 377
1295 3300005459 Ga0068867_100133071 Ga0068867_1001330711 377
1296 3300005466 Ga0070685_10006097 Ga0070685_100060972 377
1297 3300005466 Ga0070685_10022040 Ga0070685_100220404 377
1298 3300005466 Ga0070685_10023246 Ga0070685_100232463 377
1299 3300005466 Ga0070685_10052006 Ga0070685_100520062 377
1300 3300005466 Ga0070685_10056001 Ga0070685_100560012 377
1301 3300005530 Ga0070679_100045348 Ga0070679_1000453483 377
1302 3300005530 Ga0070679_100174934 Ga0070679_1001749342 377
1303 3300005535 Ga0070684_100265552 Ga0070684_1002655522 377
1304 3300005536 Ga0070697_100001151 Ga0070697_10000115121 377
1305 3300005539 Ga0068853_100005475 Ga0068853_1000054756 377
1306 3300005539 Ga0068853_100142783 Ga0068853_1001427832 377
1307 3300005539 Ga0068853_100179625 Ga0068853_1001796252 377
1308 3300005543 Ga0070672_100003650 Ga0070672_1000036503 377
1309 3300005543 Ga0070672_100072586 Ga0070672_1000725862 377
1310 3300005543 Ga0070672_100148955 Ga0070672_1001489552 377
1311 3300005544 Ga0070686_100001755 Ga0070686_1000017555 377
1312 3300005544 Ga0070686_100015274 Ga0070686_1000152743 377
1313 3300005544 Ga0070686_100042821 Ga0070686_1000428212 377
1314 3300005544 Ga0070686_100058573 Ga0070686_1000585731 377
1315 3300005544 Ga0070686_100068040 Ga0070686_1000680402 377
1316 3300005545 Ga0070695_100003819 Ga0070695_1000038192 377
1317 3300005545 Ga0070695_100013267 Ga0070695_1000132673 377
1318 3300005545 Ga0070695_100014726 Ga0070695_1000147264 377
1319 3300005546 Ga0070696_100021998 Ga0070696_1000219985 377
1320 3300005546 Ga0070696_100022292 Ga0070696_1000222923 377
1321 3300005546 Ga0070696_100043536 Ga0070696_1000435362 377
1322 3300005547 Ga0070693_100002396 Ga0070693_1000023966 377
1323 3300005547 Ga0070693_100054369 Ga0070693_1000543692 377
1324 3300005547 Ga0070693_100089785 Ga0070693_1000897852 377
1325 3300005548 Ga0070665_100060124 Ga0070665_1000601241 377
1326 3300005549 Ga0070704_100002150 Ga0070704_1000021505 377
1327 3300005549 Ga0070704_100006558 Ga0070704_1000065584 377
1328 3300005549 Ga0070704_100132809 Ga0070704_1001328092 377
1329 3300005563 Ga0068855_100082470 Ga0068855_1000824703 377
1330 3300005564 Ga0070664_100065325 Ga0070664_1000653253 377
1331 3300005564 Ga0070664_100080119 Ga0070664_1000801193 377
1332 3300005564 Ga0070664_100165374 Ga0070664_1001653742 377
1333 3300005577 Ga0068857_100000295 Ga0068857_10000029512 377
1334 3300005578 Ga0068854_100000260 Ga0068854_10000026033 377
1335 3300005614 Ga0068856_100008963 Ga0068856_1000089636 377
1336 3300005615 Ga0070702_100000267 Ga0070702_10000026714 377
1337 3300005615 Ga0070702_100069352 Ga0070702_1000693521 377
1338 3300005617 Ga0068859_100016349 Ga0068859_1000163495 377
1339 3300005617 Ga0068859_100031702 Ga0068859_1000317023 377
1340 3300005617 Ga0068859_100161711 Ga0068859_1001617112 377
1341 3300005618 Ga0068864_100001366 Ga0068864_1000013666 377
1342 3300005618 Ga0068864_100262041 Ga0068864_1002620411 377
1343 3300005718 Ga0068866_10001935 Ga0068866_100019352 377
1344 3300005718 Ga0068866_10025008 Ga0068866_100250083 377
1345 3300005719 Ga0068861_100001047 Ga0068861_1000010471 377
1346 3300005840 Ga0068870_10000404 Ga0068870_100004049 377
1347 3300005840 Ga0068870_10036806 Ga0068870_100368062 377
1348 3300005841 Ga0068863_100007320 Ga0068863_1000073204 377
1349 3300005841 Ga0068863_100192569 Ga0068863_1001925693 377
1350 3300005842 Ga0068858_100004119 Ga0068858_1000041197 377
1351 3300005842 Ga0068858_100037563 Ga0068858_1000375632 377
1352 3300005842 Ga0068858_100049400 Ga0068858_1000494001 377
1353 3300005842 Ga0068858_100088219 Ga0068858_1000882192 377
1354 3300005843 Ga0068860_100007370 Ga0068860_1000073705 377
1355 3300005843 Ga0068860_100062258 Ga0068860_1000622582 377
1356 3300005843 Ga0068860_100101582 Ga0068860_1001015822 377
1357 3300005843 Ga0068860_100309147 Ga0068860_1003091471 377
1358 3300005844 Ga0068862_100005293 Ga0068862_1000052935 377
1359 3300005937 Ga0081455_10000012 Ga0081455_10000012143 377
1360 3300005937 Ga0081455_10007757 Ga0081455_1000775711 377
1361 3300005983 Ga0081540_1015307 Ga0081540_10153074 377
1362 3300005983 Ga0081540_1017136 Ga0081540_10171362 377
1363 3300006028 Ga0070717_10002456 Ga0070717_100024566 377
1364 3300006163 Ga0070715_10008835 Ga0070715_100088352 377
1365 3300006173 Ga0070716_100004186 Ga0070716_1000041863 377
1366 3300006175 Ga0070712_100030142 Ga0070712_1000301424 377
1367 3300006175 Ga0070712_100195450 Ga0070712_1001954501 377
1368 3300006178 Ga0075367_10051435 Ga0075367_100514352 377
1369 3300006237 Ga0097621_100000421 Ga0097621_10000042118 377
1370 3300006237 Ga0097621_100002992 Ga0097621_1000029928 377
1371 3300006358 Ga0068871_100000879 Ga0068871_1000008794 377
1372 3300006358 Ga0068871_100025095 Ga0068871_1000250953 377
1373 3300006358 Ga0068871_100087672 Ga0068871_1000876722 377
1374 3300006358 Ga0068871_100124931 Ga0068871_1001249312 377
1375 3300006844 Ga0075428_100011825 Ga0075428_1000118254 377
1376 3300006846 Ga0075430_100005350 Ga0075430_1000053509 377
1377 3300006847 Ga0075431_100004764 Ga0075431_1000047643 377
1378 3300006847 Ga0075431_100097870 Ga0075431_1000978703 377
1379 3300006852 Ga0075433_10036921 Ga0075433_100369214 377
1380 3300006852 Ga0075433_10072998 Ga0075433_100729983 377
1381 3300006852 Ga0075433_10086516 Ga0075433_100865162 377
1382 3300006871 Ga0075434_100002590 Ga0075434_1000025908 377
1383 3300006871 Ga0075434_100005762 Ga0075434_1000057625 377
1384 3300006880 Ga0075429_100002604 Ga0075429_1000026045 377
1385 3300006880 Ga0075429_100177792 Ga0075429_1001777922 377
1386 3300006881 Ga0068865_100003376 Ga0068865_1000033764 377
1387 3300006881 Ga0068865_100013454 Ga0068865_1000134544 377
1388 3300006881 Ga0068865_100111081 Ga0068865_1001110812 377
1389 3300006931 Ga0097620_100016349 Ga0097620_1000163495 377
1390 3300006931 Ga0097620_100031702 Ga0097620_1000317023 377
1391 3300006931 Ga0097620_100161714 Ga0097620_1001617142 377
1392 3300007076 Ga0075435_100031352 Ga0075435_1000313525 377
1393 3300007076 Ga0075435_100237785 Ga0075435_1002377852 377
1394 3300009093 Ga0105240_10189027 Ga0105240_101890271 377
1395 3300009094 Ga0111539_10000373 Ga0111539_100003739 377
1396 3300009094 Ga0111539_10009860 Ga0111539_100098605 377
1397 3300009094 Ga0111539_10162494 Ga0111539_101624943 377
1398 3300009098 Ga0105245_10013128 Ga0105245_100131285 377
1399 3300009098 Ga0105245_10024300 Ga0105245_100243005 377
1400 3300009098 Ga0105245_10049447 Ga0105245_100494473 377
1401 3300009098 Ga0105245_10069230 Ga0105245_100692301 377
1402 3300009101 Ga0105247_10012428 Ga0105247_100124284 377
1403 3300009101 Ga0105247_10012564 Ga0105247_100125642 377
1404 3300009101 Ga0105247_10014958 Ga0105247_100149583 377
1405 3300009147 Ga0114129_10023543 Ga0114129_100235435 377
1406 3300009147 Ga0114129_10060452 Ga0114129_100604524 377
1407 3300009147 Ga0114129_10167898 Ga0114129_101678983 377
1408 3300009148 Ga0105243_10018313 Ga0105243_100183131 377
1409 3300009148 Ga0105243_10037937 Ga0105243_100379372 377
1410 3300009174 Ga0105241_10009140 Ga0105241_100091404 377
1411 3300009176 Ga0105242_10004099 Ga0105242_100040996 377
1412 3300009176 Ga0105242_10045993 Ga0105242_100459934 377
1413 3300009176 Ga0105242_10138945 Ga0105242_101389452 377
1414 3300009177 Ga0105248_10000821 Ga0105248_1000082117 377
1415 3300009177 Ga0105248_10021823 Ga0105248_100218232 377
1416 3300009177 Ga0105248_10160609 Ga0105248_101606091 377
1417 3300009545 Ga0105237_10028415 Ga0105237_100284156 377
1418 3300009545 Ga0105237_10129840 Ga0105237_101298402 377
1419 3300009551 Ga0105238_10148860 Ga0105238_101488602 377
1420 3300009553 Ga0105249_10008599 Ga0105249_100085996 377
1421 3300009553 Ga0105249_10009911 Ga0105249_100099115 377
1422 3300009553 Ga0105249_10099953 Ga0105249_100999533 377
1423 3300009553 Ga0105249_10178816 Ga0105249_101788162 377
1424 3300010375 Ga0105239_10040794 Ga0105239_100407947 377
1425 3300010375 Ga0105239_10090619 Ga0105239_100906194 377
1426 3300010375 Ga0105239_10130296 Ga0105239_101302962 377
1427 3300011119 Ga0105246_10000011 Ga0105246_100000115 377
1428 3300011119 Ga0105246_10033401 Ga0105246_100334013 377
1429 3300011119 Ga0105246_10035325 Ga0105246_100353251 377
1430 3300013100 Ga0157373_10086093 Ga0157373_100860932 377
1431 3300013102 Ga0157371_10007729 Ga0157371_100077296 377
1432 3300013102 Ga0157371_10050467 Ga0157371_100504672 377
1433 3300013296 Ga0157374_10005683 Ga0157374_100056836 377
1434 3300013296 Ga0157374_10045777 Ga0157374_100457774 377
1435 3300013296 Ga0157374_10099820 Ga0157374_100998203 377
1436 3300013297 Ga0157378_10002005 Ga0157378_100020056 377
1437 3300013297 Ga0157378_10108505 Ga0157378_101085052 377
1438 3300013306 Ga0163162_10005215 Ga0163162_100052156 377
1439 3300013306 Ga0163162_10039343 Ga0163162_100393433 377
1440 3300013306 Ga0163162_10060561 Ga0163162_100605611 377
1441 3300013306 Ga0163162_10112055 Ga0163162_101120552 377
1442 3300013306 Ga0163162_10385325 Ga0163162_103853252 377
1443 3300013307 Ga0157372_10034995 Ga0157372_100349953 377
1444 3300013308 Ga0157375_10016062 Ga0157375_100160623 377
1445 3300013308 Ga0157375_10021671 Ga0157375_100216713 377
1446 3300013308 Ga0157375_10059563 Ga0157375_100595631 377
1447 3300013308 Ga0157375_10060259 Ga0157375_100602594 377
1448 3300013308 Ga0157375_10657650 Ga0157375_106576501 377
1449 3300014325 Ga0163163_10005008 Ga0163163_100050085 377
1450 3300014325 Ga0163163_10032891 Ga0163163_100328914 377
1451 3300014325 Ga0163163_10058563 Ga0163163_100585632 377
1452 3300014326 Ga0157380_10005074 Ga0157380_100050745 377
1453 3300014326 Ga0157380_10047528 Ga0157380_100475282 377
1454 3300014745 Ga0157377_10000398 Ga0157377_1000039814 377
1455 3300014745 Ga0157377_10035335 Ga0157377_100353353 377
1456 3300014968 Ga0157379_10006255 Ga0157379_100062554 377
1457 3300014968 Ga0157379_10014948 Ga0157379_100149484 377
1458 3300014968 Ga0157379_10032074 Ga0157379_100320741 377
1459 3300014968 Ga0157379_10039533 Ga0157379_100395332 377
1460 3300014969 Ga0157376_10003372 Ga0157376_100033725 377
1461 3300014969 Ga0157376_10077049 Ga0157376_100770492 377
1462 3300017792 Ga0163161_10002430 Ga0163161_100024308 377
1463 3300017792 Ga0163161_10048001 Ga0163161_100480013 377
1464 3300017792 Ga0163161_10129959 Ga0163161_101299592 377
1465 3300025271 Ga0207666_1000038 Ga0207666_10000386 377
1466 3300025271 Ga0207666_1001350 Ga0207666_10013503 377
1467 3300025290 Ga0207673_1000111 Ga0207673_10001115 377
1468 3300025315 Ga0207697_10001943 Ga0207697_100019435 377
1469 3300025315 Ga0207697_10010836 Ga0207697_100108362 377
1470 3300025885 Ga0207653_10003072 Ga0207653_100030724 377
1471 3300025893 Ga0207682_10000071 Ga0207682_100000717 377
1472 3300025898 Ga0207692_10004905 Ga0207692_100049053 377
1473 3300025900 Ga0207710_10006950 Ga0207710_100069504 377
1474 3300025900 Ga0207710_10010732 Ga0207710_100107322 377
1475 3300025900 Ga0207710_10039149 Ga0207710_100391491 377
1476 3300025901 Ga0207688_10001967 Ga0207688_100019675 377
1477 3300025903 Ga0207680_10008702 Ga0207680_100087024 377
1478 3300025903 Ga0207680_10060801 Ga0207680_100608013 377
1479 3300025904 Ga0207647_10021971 Ga0207647_100219711 377
1480 3300025904 Ga0207647_10024633 Ga0207647_100246334 377
1481 3300025905 Ga0207685_10003844 Ga0207685_100038443 377
1482 3300025906 Ga0207699_10015399 Ga0207699_100153991 377
1483 3300025907 Ga0207645_10000779 Ga0207645_100007796 377
1484 3300025907 Ga0207645_10091820 Ga0207645_100918202 377
1485 3300025908 Ga0207643_10000434 Ga0207643_100004343 377
1486 3300025911 Ga0207654_10000498 Ga0207654_100004988 377
1487 3300025911 Ga0207654_10115520 Ga0207654_101155202 377
1488 3300025912 Ga0207707_10000454 Ga0207707_1000045432 377
1489 3300025912 Ga0207707_10035836 Ga0207707_100358363 377
1490 3300025912 Ga0207707_10226787 Ga0207707_102267872 377
1491 3300025913 Ga0207695_10300689 Ga0207695_103006891 377
1492 3300025914 Ga0207671_10154394 Ga0207671_101543942 377
1493 3300025915 Ga0207693_10037739 Ga0207693_100377393 377
1494 3300025915 Ga0207693_10297195 Ga0207693_102971951 377
1495 3300025916 Ga0207663_10018979 Ga0207663_100189792 377
1496 3300025916 Ga0207663_10084777 Ga0207663_100847772 377
1497 3300025916 Ga0207663_10109089 Ga0207663_101090892 377
1498 3300025917 Ga0207660_10000006 Ga0207660_100000067 377
1499 3300025917 Ga0207660_10008770 Ga0207660_100087704 377
1500 3300025918 Ga0207662_10003236 Ga0207662_100032365 377
1501 3300025918 Ga0207662_10009842 Ga0207662_100098423 377
1502 3300025919 Ga0207657_10007747 Ga0207657_100077475 377
1503 3300025919 Ga0207657_10016589 Ga0207657_100165895 377
1504 3300025919 Ga0207657_10027550 Ga0207657_100275503 377
1505 3300025919 Ga0207657_10033828 Ga0207657_100338284 377
1506 3300025920 Ga0207649_10000049 Ga0207649_1000004999 377
1507 3300025921 Ga0207652_10177262 Ga0207652_101772621 377
1508 3300025923 Ga0207681_10000731 Ga0207681_100007313 377
1509 3300025925 Ga0207650_10000908 Ga0207650_100009089 377
1510 3300025926 Ga0207659_10000143 Ga0207659_100001437 377
1511 3300025926 Ga0207659_10113532 Ga0207659_101135322 377
1512 3300025927 Ga0207687_10000428 Ga0207687_1000042817 377
1513 3300025927 Ga0207687_10040298 Ga0207687_100402981 377
1514 3300025927 Ga0207687_10257746 Ga0207687_102577461 377
1515 3300025928 Ga0207700_10006307 Ga0207700_100063075 377
1516 3300025928 Ga0207700_10068851 Ga0207700_100688513 377
1517 3300025928 Ga0207700_10201039 Ga0207700_102010391 377
1518 3300025928 Ga0207700_10212747 Ga0207700_102127472 377
1519 3300025931 Ga0207644_10002382 Ga0207644_100023829 377
1520 3300025931 Ga0207644_10008425 Ga0207644_100084255 377
1521 3300025932 Ga0207690_10006061 Ga0207690_100060614 377
1522 3300025932 Ga0207690_10150206 Ga0207690_101502061 377
1523 3300025933 Ga0207706_10001338 Ga0207706_100013385 377
1524 3300025933 Ga0207706_10014198 Ga0207706_100141986 377
1525 3300025933 Ga0207706_10030620 Ga0207706_100306204 377
1526 3300025933 Ga0207706_10111964 Ga0207706_101119642 377
1527 3300025934 Ga0207686_10000340 Ga0207686_1000034024 377
1528 3300025934 Ga0207686_10015136 Ga0207686_100151364 377
1529 3300025935 Ga0207709_10003778 Ga0207709_100037782 377
1530 3300025935 Ga0207709_10105445 Ga0207709_101054452 377
1531 3300025936 Ga0207670_10000464 Ga0207670_1000046415 377
1532 3300025936 Ga0207670_10019883 Ga0207670_100198833 377
1533 3300025937 Ga0207669_10000240 Ga0207669_100002409 377
1534 3300025937 Ga0207669_10059649 Ga0207669_100596492 377
1535 3300025938 Ga0207704_10000456 Ga0207704_100004569 377
1536 3300025939 Ga0207665_10001537 Ga0207665_100015379 377
1537 3300025939 Ga0207665_10041282 Ga0207665_100412822 377
1538 3300025940 Ga0207691_10006817 Ga0207691_100068176 377
1539 3300025940 Ga0207691_10014637 Ga0207691_100146372 377
1540 3300025940 Ga0207691_10019931 Ga0207691_100199315 377
1541 3300025941 Ga0207711_10001303 Ga0207711_100013033 377
1542 3300025941 Ga0207711_10068294 Ga0207711_100682944 377
1543 3300025941 Ga0207711_10087829 Ga0207711_100878293 377
1544 3300025941 Ga0207711_10114544 Ga0207711_101145442 377
1545 3300025941 Ga0207711_10283378 Ga0207711_102833782 377
1546 3300025942 Ga0207689_10000440 Ga0207689_100004406 377
1547 3300025942 Ga0207689_10126100 Ga0207689_101261002 377
1548 3300025944 Ga0207661_10000885 Ga0207661_100008856 377
1549 3300025945 Ga0207679_10000131 Ga0207679_1000013116 377
1550 3300025945 Ga0207679_10019284 Ga0207679_100192844 377
1551 3300025960 Ga0207651_10017245 Ga0207651_100172453 377
1552 3300025960 Ga0207651_10100599 Ga0207651_101005992 377
1553 3300025961 Ga0207712_10010140 Ga0207712_100101405 377
1554 3300025961 Ga0207712_10027320 Ga0207712_100273203 377
1555 3300025972 Ga0207668_10000065 Ga0207668_1000006522 377
1556 3300025981 Ga0207640_10000762 Ga0207640_1000076213 377
1557 3300025986 Ga0207658_10001114 Ga0207658_1000111414 377
1558 3300025986 Ga0207658_10047302 Ga0207658_100473022 377
1559 3300026023 Ga0207677_10001753 Ga0207677_100017536 377
1560 3300026035 Ga0207703_10000217 Ga0207703_1000021712 377
1561 3300026035 Ga0207703_10014014 Ga0207703_100140142 377
1562 3300026035 Ga0207703_10094610 Ga0207703_100946102 377
1563 3300026041 Ga0207639_10008016 Ga0207639_100080163 377
1564 3300026041 Ga0207639_10209987 Ga0207639_102099871 377
1565 3300026067 Ga0207678_10000944 Ga0207678_1000094422 377
1566 3300026067 Ga0207678_10005274 Ga0207678_100052746 377
1567 3300026067 Ga0207678_10013610 Ga0207678_100136101 377
1568 3300026067 Ga0207678_10018969 Ga0207678_100189695 377
1569 3300026067 Ga0207678_10043863 Ga0207678_100438634 377
1570 3300026075 Ga0207708_10005368 Ga0207708_100053685 377
1571 3300026075 Ga0207708_10027519 Ga0207708_100275193 377
1572 3300026078 Ga0207702_10003744 Ga0207702_100037444 377
1573 3300026088 Ga0207641_10001313 Ga0207641_1000131319 377
1574 3300026088 Ga0207641_10014435 Ga0207641_100144355 377
1575 3300026088 Ga0207641_10034442 Ga0207641_100344421 377
1576 3300026089 Ga0207648_10011217 Ga0207648_100112176 377
1577 3300026089 Ga0207648_10052763 Ga0207648_100527633 377
1578 3300026089 Ga0207648_10105082 Ga0207648_101050822 377
1579 3300026095 Ga0207676_10002017 Ga0207676_100020178 377
1580 3300026095 Ga0207676_10007816 Ga0207676_100078164 377
1581 3300026116 Ga0207674_10000331 Ga0207674_1000033149 377
1582 3300026118 Ga0207675_100012773 Ga0207675_1000127736 377
1583 3300026118 Ga0207675_100031017 Ga0207675_1000310172 377
1584 3300026121 Ga0207683_10000001 Ga0207683_10000001315 377
1585 3300026121 Ga0207683_10009425 Ga0207683_100094257 377
1586 3300026121 Ga0207683_10011706 Ga0207683_100117066 377
1587 3300027543 Ga0209999_1007703 Ga0209999_10077031 377
1588 3300027552 Ga0209982_1001558 Ga0209982_10015583 377
1589 3300027617 Ga0210002_1004248 Ga0210002_10042482 377
1590 3300027682 Ga0209971_1017847 Ga0209971_10178472 377
1591 3300027695 Ga0209966_1002020 Ga0209966_10020202 377
1592 3300027907 Ga0207428_10000172 Ga0207428_1000017228 377
1593 3300027907 Ga0207428_10000255 Ga0207428_1000025517 377
1594 3300027907 Ga0207428_10000289 Ga0207428_100002895 377
1595 3300028379 Ga0268266_10033448 Ga0268266_100334482 377
1596 3300028379 Ga0268266_10159492 Ga0268266_101594922 377
1597 3300028379 Ga0268266_10235769 Ga0268266_102357691 377
1598 3300028380 Ga0268265_10004222 Ga0268265_100042224 377
1599 3300028380 Ga0268265_10018419 Ga0268265_100184194 377
1600 3300028381 Ga0268264_10067578 Ga0268264_100675781 377
1601 3300028381 Ga0268264_10123826 Ga0268264_101238262 377
1602 3300028381 Ga0268264_10324733 Ga0268264_103247331 377
1603 3300028381 Ga0268264_10467745 Ga0268264_104677451 377
1604 3300028556 Ga0265337_1007261 Ga0265337_10072613 377
1605 3300028800 Ga0265338_10171689 Ga0265338_101716891 377
1606 3300031241 Ga0265325_10002126 Ga0265325_100021267 377
1607 3300031344 Ga0265316_10041390 Ga0265316_100413903 377
1608 3300031595 Ga0265313_10014337 Ga0265313_100143373 377
1609 3300034817 Ga0373948_0000360 Ga0373948_0000360_936_2069 377
1610 3300034817 Ga0373948_0005292 Ga0373948_0005292_320_1453 377
1611 3300034818 Ga0373950_0000868 Ga0373950_0000868_1009_2142 377
1612 3300034819 Ga0373958_0000309 Ga0373958_0000309_1667_2800 377
1613 3300034957 Ga0373938_0000238 Ga0373938_0000238_1452_2585 377
1614 3300035083 Ga0373926_0003404 Ga0373926_0003404_3879_5012 377
1615 3300035083 Ga0373926_0009583 Ga0373926_0009583_345_1478 377
1616 3300035084 Ga0373928_0001415 Ga0373928_0001415_3274_4407 377
1617 3300035085 Ga0373929_0001680 Ga0373929_0001680_1990_3123 377
1618 3300035086 Ga0373934_0018659 Ga0373934_0018659_115_1248 377
1619 3300035088 Ga0373940_0007476 Ga0373940_0007476_683_1816 377
1620 3300035090 Ga0373949_0002060 Ga0373949_0002060_2146_3279 377
1621 3300035090 Ga0373949_0002127 Ga0373949_0002127_3196_4329 377
1622 3300035091 Ga0373951_0000607 Ga0373951_0000607_2485_3618 377
1623 3300035092 Ga0373952_0000334 Ga0373952_0000334_1631_2764 377
1624 3300035092 Ga0373952_0000549 Ga0373952_0000549_4269_5402 377
1625 3300035111 Ga0373923_0057269 Ga0373923_0057269_302_1435 377
1626 3300035111 Ga0373923_0057850 Ga0373923_0057850_450_1583 377
1627 3300035112 Ga0373932_0001896 Ga0373932_0001896_2471_3604 377
1628 3300035113 Ga0373936_0015253 Ga0373936_0015253_1472_2605 377
1629 3300035114 Ga0373939_0001870 Ga0373939_0001870_1547_2680 377
1630 3300035114 Ga0373939_0016894 Ga0373939_0016894_238_1371 377
1631 3300035115 Ga0373941_0000803 Ga0373941_0000803_1789_2922 377
1632 3300035115 Ga0373941_0000977 Ga0373941_0000977_3006_4139 377
1633 3300035116 Ga0373945_0004003 Ga0373945_0004003_2577_3710 377
1634 3300035116 Ga0373945_0031233 Ga0373945_0031233_320_1453 377
1635 3300035119 Ga0373956_0032556 Ga0373956_0032556_419_1552 377
1636 3300035119 Ga0373956_0057893 Ga0373956_0057893_207_1340 377
1637 3300035119 Ga0373956_0067231 Ga0373956_0067231_357_1493 377
1638 3300035120 Ga0373957_0000689 Ga0373957_0000689_6425_7558 377
1639 3300035121 Ga0373960_0001746 Ga0373960_0001746_3496_4629 377
1640 3300035170 Ga0373943_0003076 Ga0373943_0003076_4242_5375 377
1641 3300035170 Ga0373943_0008345 Ga0373943_0008345_375_1508 377
1642 3300035171 Ga0373946_0005522 Ga0373946_0005522_440_1573 377
1643 3300035171 Ga0373946_0019699 Ga0373946_0019699_818_1954 377
1644 3300035171 Ga0373946_0028471 Ga0373946_0028471_870_2003 377
1645 3300035172 Ga0373955_0017485 Ga0373955_0017485_2292_3425 377
1646 3300035207 Ga0373942_0002320 Ga0373942_0002320_238_1371 377
1647 3300035207 Ga0373942_0003894 Ga0373942_0003894_2080_3213 377
1648 3300035241 Ga0373961_0005873 Ga0373961_0005873_443_1576 377
1649 3300035242 Ga0373962_0000684 Ga0373962_0000684_4733_5866 377
1650 3300035242 Ga0373962_0004790 Ga0373962_0004790_1596_2729 377
1651 3300035691 Ga0373931_0000832 Ga0373931_0000832_3407_4540 377
1652 3300035691 Ga0373931_0008912 Ga0373931_0008912_2508_3641 377
1653 3300035692 Ga0373935_0008740 Ga0373935_0008740_647_1780 377
1654 3300035692 Ga0373935_0015233 Ga0373935_0015233_1527_2660 377
1655 3300035692 Ga0373935_0050879 Ga0373935_0050879_65_1201 377
1656 3300035692 Ga0373935_0195985 Ga0373935_0195985_133_1266 377
1657 3300035695 Ga0373927_0013741 Ga0373927_0013741_326_1459 377
1658 3300035724 Ga0373933_0004580 Ga0373933_0004580_2865_4001 377
1659 3300035724 Ga0373933_0018214 Ga0373933_0018214_673_1806 377
1660 3300035724 Ga0373933_0050042 Ga0373933_0050042_596_1729 377
1661 3300035725 Ga0373947_0002287 Ga0373947_0002287_4253_5386 377
1662 3300035725 Ga0373947_0013576 Ga0373947_0013576_192_1325 377
1663 3300035725 Ga0373947_0028815 Ga0373947_0028815_1030_2166 377
1664 3300036401 Ga0373937_0000907 Ga0373937_0000907_5632_6765 377
1665 3300036401 Ga0373937_0020586 Ga0373937_0020586_1938_3188 377
1666 3300036401 Ga0373937_0041608 Ga0373937_0041608_1745_2878 377
1667 3300036401 Ga0373937_0074856 Ga0373937_0074856_428_1561 377
1668 3300037068 Ga0373925_0009531 Ga0373925_0009531_2228_3361 377
1669 3300037068 Ga0373925_0016683 Ga0373925_0016683_2362_3495 377
1670 3300037068 Ga0373925_0053411 Ga0373925_0053411_1429_2565 377
1671 3300037068 Ga0373925_0134921 Ga0373925_0134921_178_1311 377
1672 3300041413 Ga0439465_0007239 Ga0439465_0007239_335_1513 377
1673 3300042008 Ga0439450_005169 Ga0439450_005169_23_1156 377
1674 3300042016 Ga0439463_004402 Ga0439463_004402_779_1912 377
1675 3300042439 Ga0439464_0003806 Ga0439464_0003806_1088_2221 377
1676 3300042993 Ga0439440_0007885 Ga0439440_0007885_368_1501 377
1677 3300044712 Ga0453684_0030479 Ga0453684_0030479_518_1651 377
1678 3300045051 Ga0451576_0064931 Ga0451576_0064931_1884_3017 377
1679 3300046454 Ga0495592_0001841 Ga0495592_0001841_766_1899 377
1680 3300046454 Ga0495592_0013967 Ga0495592_0013967_250_1383 377
1681 3300046454 Ga0495592_0060163 Ga0495592_0060163_1001_2134 377
1682 3300046454 Ga0495592_0122353 Ga0495592_0122353_629_1762 377
1683 3300046455 Ga0495603_0009828 Ga0495603_0009828_4188_5321 377
1684 3300046455 Ga0495603_0012015 Ga0495603_0012015_124_1257 377
1685 3300046455 Ga0495603_0081354 Ga0495603_0081354_692_1828 377
1686 3300046457 Ga0495590_0054329 Ga0495590_0054329_130_1263 377
1687 3300046459 Ga0495629_0001140 Ga0495629_0001140_18275_19408 377
1688 3300046459 Ga0495629_0004187 Ga0495629_0004187_5692_6825 377
1689 3300046459 Ga0495629_0079117 Ga0495629_0079117_236_1372 377
1690 3300046461 Ga0495641_0015118 Ga0495641_0015118_1408_2541 377
1691 3300046462 Ga0495651_0004254 Ga0495651_0004254_8878_10011 377
1692 3300046462 Ga0495651_0011156 Ga0495651_0011156_657_1790 377
1693 3300046462 Ga0495651_0011201 Ga0495651_0011201_3613_4749 377
1694 3300046462 Ga0495651_0050646 Ga0495651_0050646_316_1449 377
1695 3300046463 Ga0495653_0002480 Ga0495653_0002480_8034_9167 377
1696 3300046463 Ga0495653_0024482 Ga0495653_0024482_1344_2477 377
1697 3300046463 Ga0495653_0028470 Ga0495653_0028470_451_1584 377
1698 3300046463 Ga0495653_0031990 Ga0495653_0031990_139_1275 377
1699 3300046463 Ga0495653_0166647 Ga0495653_0166647_260_1393 377
1700 3300046472 Ga0495580_0007274 Ga0495580_0007274_5411_6544 377
1701 3300046472 Ga0495580_0060482 Ga0495580_0060482_536_1672 377
1702 3300046473 Ga0495582_0000379 Ga0495582_0000379_17137_18270 377
1703 3300046473 Ga0495582_0016954 Ga0495582_0016954_2455_3588 377
1704 3300046473 Ga0495582_0040384 Ga0495582_0040384_1138_2271 377
1705 3300046473 Ga0495582_0125974 Ga0495582_0125974_213_1349 377
1706 3300046475 Ga0495639_0001456 Ga0495639_0001456_1459_2592 377
1707 3300046475 Ga0495639_0005394 Ga0495639_0005394_78_1211 377
1708 3300046476 Ga0495662_0002259 Ga0495662_0002259_3017_4150 377
1709 3300046476 Ga0495662_0011084 Ga0495662_0011084_610_1743 377
1710 3300046477 Ga0495664_0004745 Ga0495664_0004745_1930_3063 377
1711 3300046477 Ga0495664_0017355 Ga0495664_0017355_716_1849 377
1712 3300046477 Ga0495664_0038399 Ga0495664_0038399_512_1645 377
1713 3300046477 Ga0495664_0047781 Ga0495664_0047781_207_1343 377
1714 3300046477 Ga0495664_0104693 Ga0495664_0104693_248_1381 377
1715 3300046492 Ga0495585_0006641 Ga0495585_0006641_296_1429 377
1716 3300046499 Ga0495594_0000628 Ga0495594_0000628_3577_4710 377
1717 3300046499 Ga0495594_0012022 Ga0495594_0012022_1067_2203 377
1718 3300046499 Ga0495594_0014248 Ga0495594_0014248_1104_2237 377
1719 3300046499 Ga0495594_0036536 Ga0495594_0036536_447_1580 377
1720 3300046501 Ga0495607_0008588 Ga0495607_0008588_2551_3684 377
1721 3300046511 Ga0495608_0008363 Ga0495608_0008363_1981_3114 377
1722 3300046511 Ga0495608_0023088 Ga0495608_0023088_1421_2557 377
1723 3300046511 Ga0495608_0027103 Ga0495608_0027103_1435_2568 377
1724 3300046513 Ga0495616_0091344 Ga0495616_0091344_118_1251 377
1725 3300046514 Ga0495618_0002560 Ga0495618_0002560_4554_5687 377
1726 3300046514 Ga0495618_0002632 Ga0495618_0002632_4069_5202 377
1727 3300046514 Ga0495618_0004146 Ga0495618_0004146_1586_2719 377
1728 3300046514 Ga0495618_0038302 Ga0495618_0038302_1421_2557 377
1729 3300046516 Ga0495628_0003222 Ga0495628_0003222_12321_13454 377
1730 3300046517 Ga0495630_0002564 Ga0495630_0002564_6278_7411 377
1731 3300046517 Ga0495630_0039762 Ga0495630_0039762_242_1375 377
1732 3300046517 Ga0495630_0057574 Ga0495630_0057574_946_2082 377
1733 3300046517 Ga0495630_0092975 Ga0495630_0092975_413_1546 377
1734 3300046517 Ga0495630_0179692 Ga0495630_0179692_219_1355 377
1735 3300046523 Ga0495644_0004713 Ga0495644_0004713_1663_2796 377
1736 3300046526 Ga0495666_0001574 Ga0495666_0001574_8265_9398 377
1737 3300046526 Ga0495666_0006471 Ga0495666_0006471_2958_4091 377
1738 3300046529 Ga0495652_0003251 Ga0495652_0003251_1061_2194 377
1739 3300046529 Ga0495652_0014533 Ga0495652_0014533_1823_2956 377
1740 3300046529 Ga0495652_0016208 Ga0495652_0016208_2018_3151 377
1741 3300046529 Ga0495652_0050982 Ga0495652_0050982_852_1988 377
1742 3300046529 Ga0495652_0089248 Ga0495652_0089248_310_1446 377
1743 3300046529 Ga0495652_0102123 Ga0495652_0102123_530_1663 377
1744 3300046531 Ga0495665_0004256 Ga0495665_0004256_2110_3243 377
1745 3300046531 Ga0495665_0009547 Ga0495665_0009547_4069_5202 377
1746 3300046533 Ga0495640_0006068 Ga0495640_0006068_4007_5140 377
1747 3300046533 Ga0495640_0045494 Ga0495640_0045494_1687_2823 377
1748 3300046533 Ga0495640_0072032 Ga0495640_0072032_194_1330 377
1749 3300046533 Ga0495640_0140441 Ga0495640_0140441_243_1376 377
1750 3300046535 Ga0495586_0016632 Ga0495586_0016632_1436_2569 377
1751 3300046536 Ga0495587_0003023 Ga0495587_0003023_2877_4010 377
1752 3300046536 Ga0495587_0147463 Ga0495587_0147463_31_1164 377
1753 3300046538 Ga0495609_0042528 Ga0495609_0042528_281_1414 377
1754 3300046543 Ga0495645_0001743 Ga0495645_0001743_1178_2311 377
1755 3300046543 Ga0495645_0003505 Ga0495645_0003505_7935_9071 377
1756 3300046543 Ga0495645_0069726 Ga0495645_0069726_285_1418 377
1757 3300046557 Ga0495622_0024844 Ga0495622_0024844_1047_2180 377
1758 3300046557 Ga0495622_0028163 Ga0495622_0028163_72_1205 377
1759 3300046558 Ga0495633_0016941 Ga0495633_0016941_236_1369 377
1760 3300046559 Ga0495667_0000365 Ga0495667_0000365_16868_18001 377
1761 3300046559 Ga0495667_0006271 Ga0495667_0006271_4801_5934 377
1762 3300046559 Ga0495667_0010665 Ga0495667_0010665_1431_2564 377
1763 3300046615 Ga0495656_0000167 Ga0495656_0000167_14924_16057 377
1764 3300046642 Ga0495634_0003795 Ga0495634_0003795_7732_8865 377
1765 3300046642 Ga0495634_0005914 Ga0495634_0005914_4368_5501 377
1766 3300046642 Ga0495634_0039315 Ga0495634_0039315_64_1200 377
1767 3300046642 Ga0495634_0137849 Ga0495634_0137849_169_1302 377
1768 3300046663 Ga0495635_0000981 Ga0495635_0000981_16629_17762 377
1769 3300046663 Ga0495635_0002092 Ga0495635_0002092_4824_5960 377
1770 3300046663 Ga0495635_0012948 Ga0495635_0012948_4253_5386 377
1771 3300046663 Ga0495635_0028616 Ga0495635_0028616_1211_2344 377
1772 3300046663 Ga0495635_0033558 Ga0495635_0033558_1275_2408 377
1773 3300046664 Ga0495659_0000357 Ga0495659_0000357_13211_14344 377
1774 3300046665 Ga0495661_0027692 Ga0495661_0027692_765_1898 377
1775 3300046674 Ga0495588_0015611 Ga0495588_0015611_972_2105 377
1776 3300046675 Ga0495657_0007791 Ga0495657_0007791_5461_6597 377
1777 3300046675 Ga0495657_0013213 Ga0495657_0013213_4112_5245 377
1778 3300046675 Ga0495657_0032813 Ga0495657_0032813_2362_3495 377
1779 3300046678 Ga0495599_0005483 Ga0495599_0005483_952_2085 377
1780 3300046678 Ga0495599_0018968 Ga0495599_0018968_624_1760 377
1781 3300046678 Ga0495599_0188571 Ga0495599_0188571_11_1144 377
1782 3300046679 Ga0495623_0000281 Ga0495623_0000281_1325_2458 377
1783 3300046679 Ga0495623_0025726 Ga0495623_0025726_1792_2925 377
1784 3300046680 Ga0495646_0000794 Ga0495646_0000794_9238_10371 377
1785 3300046680 Ga0495646_0006978 Ga0495646_0006978_3614_4750 377
1786 3300046680 Ga0495646_0008319 Ga0495646_0008319_1160_2293 377
1787 3300046680 Ga0495646_0078071 Ga0495646_0078071_19_1152 377
1788 3300046681 Ga0495647_0000985 Ga0495647_0000985_1824_2957 377
1789 3300046681 Ga0495647_0010622 Ga0495647_0010622_1336_2472 377
1790 3300046681 Ga0495647_0012548 Ga0495647_0012548_28_1161 377
1791 3300046683 Ga0495658_0000210 Ga0495658_0000210_31061_32194 377
1792 3300046683 Ga0495658_0060153 Ga0495658_0060153_11_1147 377
1793 3300046689 Ga0495613_0018004 Ga0495613_0018004_3826_4959 377
1794 3300046689 Ga0495613_0064648 Ga0495613_0064648_579_1715 377
1795 3300046690 Ga0495624_0004943 Ga0495624_0004943_6861_7994 377
1796 3300046690 Ga0495624_0030701 Ga0495624_0030701_1443_2576 377
1797 3300046690 Ga0495624_0137502 Ga0495624_0137502_97_1233 377
1798 3300046691 Ga0495670_0002677 Ga0495670_0002677_6005_7138 377
1799 3300046809 Ga0495600_0000388 Ga0495600_0000388_7719_8852 377
1800 3300046809 Ga0495600_0002666 Ga0495600_0002666_7018_8151 377
1801 3300046809 Ga0495600_0011043 Ga0495600_0011043_1775_2911 377
1802 3300046809 Ga0495600_0047443 Ga0495600_0047443_245_1378 377
1803 3300046809 Ga0495600_0098805 Ga0495600_0098805_578_1828 377
1804 3300047315 Ga0495581_0001772 Ga0495581_0001772_215_1348 377
1805 3300047315 Ga0495581_0003342 Ga0495581_0003342_4328_5461 377
1806 3300047315 Ga0495581_0029188 Ga0495581_0029188_1722_2864 377
1807 3300047317 Ga0495604_0002563 Ga0495604_0002563_4436_5569 377
1808 3300047317 Ga0495604_0004482 Ga0495604_0004482_7290_8423 377
1809 3300047317 Ga0495604_0014260 Ga0495604_0014260_2235_3368 377
1810 3300047317 Ga0495604_0026128 Ga0495604_0026128_1268_2518 377
1811 3300047317 Ga0495604_0029470 Ga0495604_0029470_3136_4269 377
1812 3300047319 Ga0495674_0001490 Ga0495674_0001490_4493_5626 377
1813 3300047319 Ga0495674_0008877 Ga0495674_0008877_4166_5299 377
1814 3300047319 Ga0495674_0009425 Ga0495674_0009425_2528_3664 377
1815 3300047319 Ga0495674_0015781 Ga0495674_0015781_3792_4925 377
1816 3300047319 Ga0495674_0022729 Ga0495674_0022729_2271_3407 377
1817 3300047319 Ga0495674_0045990 Ga0495674_0045990_2663_3796 377
1818 3300047321 Ga0495676_0006651 Ga0495676_0006651_1798_2931 377
1819 3300047321 Ga0495676_0025913 Ga0495676_0025913_3702_4835 377
1820 3300047321 Ga0495676_0081445 Ga0495676_0081445_245_1381 377
1821 3300047321 Ga0495676_0221358 Ga0495676_0221358_82_1215 377
1822 3300047322 Ga0495680_0006978 Ga0495680_0006978_2347_3480 377
1823 3300047322 Ga0495680_0010055 Ga0495680_0010055_3391_4524 377
1824 3300047322 Ga0495680_0012387 Ga0495680_0012387_2196_3329 377
1825 3300047322 Ga0495680_0031794 Ga0495680_0031794_2981_4114 377
1826 3300047322 Ga0495680_0045097 Ga0495680_0045097_1482_2732 377
1827 3300047322 Ga0495680_0059489 Ga0495680_0059489_872_2008 377
1828 3300047444 Ga0495675_0003130 Ga0495675_0003130_1495_2628 377
1829 3300047444 Ga0495675_0015559 Ga0495675_0015559_2921_4054 377
1830 3300047445 Ga0495677_0044149 Ga0495677_0044149_356_1489 377
1831 3300047446 Ga0495679_011554 Ga0495679_011554_1926_3059 377
1832 3300047471 Ga0495684_0001385 Ga0495684_0001385_6309_7442 377
1833 3300047471 Ga0495684_0041636 Ga0495684_0041636_1635_2768 377
1834 3300047471 Ga0495684_0083196 Ga0495684_0083196_820_1953 377
1835 3300047673 Ga0495593_0013949 Ga0495593_0013949_2262_3395 377
1836 3300047673 Ga0495593_0026134 Ga0495593_0026134_1626_2759 377
1837 3300047673 Ga0495593_0041838 Ga0495593_0041838_873_2009 377
1838 3300048088 Ga0495602_0004101 Ga0495602_0004101_2546_3682 377
1839 3300048088 Ga0495602_0004126 Ga0495602_0004126_6050_7183 377
1840 3300048089 Ga0495614_0043135 Ga0495614_0043135_292_1425 377
1841 3300048089 Ga0495614_0094754 Ga0495614_0094754_23_1159 377
1842 3300048903 Ga0496100_0000759 Ga0496100_0000759_1415_2548 377
1843 3300048903 Ga0496100_0002801 Ga0496100_0002801_635_1768 377
1844 3300048903 Ga0496100_0004107 Ga0496100_0004107_5585_6718 377
1845 3300048903 Ga0496100_0004431 Ga0496100_0004431_5004_6143 377
1846 3300048904 Ga0496101_0000351 Ga0496101_0000351_6778_7911 377
1847 3300048904 Ga0496101_0006685 Ga0496101_0006685_3498_4631 377
1848 3300048904 Ga0496101_0109431 Ga0496101_0109431_278_1411 377
1849 3300048904 Ga0496101_0124871 Ga0496101_0124871_183_1322 377
1850 3300048905 Ga0496102_0015414 Ga0496102_0015414_1666_2799 377
1851 3300048905 Ga0496102_0062698 Ga0496102_0062698_2039_3178 377
1852 3300048905 Ga0496102_0069583 Ga0496102_0069583_1834_2967 377
1853 3300048906 Ga0496103_0000998 Ga0496103_0000998_5328_6461 377
1854 3300048907 Ga0496104_0001036 Ga0496104_0001036_9341_10477 377
1855 3300048907 Ga0496104_0044027 Ga0496104_0044027_2818_3951 377
1856 3300048907 Ga0496104_0068258 Ga0496104_0068258_496_1635 377
1857 3300048907 Ga0496104_0110000 Ga0496104_0110000_601_1734 377
1858 3300048909 Ga0496106_0006851 Ga0496106_0006851_2238_3377 377
1859 3300048910 Ga0496107_0001455 Ga0496107_0001455_12335_13468 377
1860 3300048910 Ga0496107_0006115 Ga0496107_0006115_3731_4864 377
1861 3300048910 Ga0496107_0022779 Ga0496107_0022779_748_1884 377
1862 3300048910 Ga0496107_0029566 Ga0496107_0029566_1964_3097 377
1863 3300048911 Ga0496108_0000643 Ga0496108_0000643_23069_24202 377
1864 3300048911 Ga0496108_0025776 Ga0496108_0025776_1222_2361 377
1865 3300048911 Ga0496108_0031626 Ga0496108_0031626_557_1690 377
1866 3300048911 Ga0496108_0148532 Ga0496108_0148532_105_1238 377
1867 3300048912 Ga0496109_0000359 Ga0496109_0000359_22999_24132 377
1868 3300048912 Ga0496109_0000976 Ga0496109_0000976_2330_3463 377
1869 3300048912 Ga0496109_0005374 Ga0496109_0005374_5784_6923 377
1870 3300048912 Ga0496109_0031587 Ga0496109_0031587_3087_4220 377
1871 3300048913 Ga0496110_0020531 Ga0496110_0020531_2677_3816 377
1872 3300048913 Ga0496110_0071193 Ga0496110_0071193_956_2089 377
1873 3300048913 Ga0496110_0300022 Ga0496110_0300022_251_1384 377
1874 3300048914 Ga0496111_0040961 Ga0496111_0040961_1057_2196 377
1875 3300048914 Ga0496111_0221339 Ga0496111_0221339_151_1284 377
1876 3300048915 Ga0496112_0116480 Ga0496112_0116480_1471_2604 377
1877 3300048915 Ga0496112_0327625 Ga0496112_0327625_120_1253 377
1878 3300048916 Ga0496113_0000533 Ga0496113_0000533_11346_12479 377
1879 3300048916 Ga0496113_0038507 Ga0496113_0038507_437_1576 377
1880 3300048916 Ga0496113_0054420 Ga0496113_0054420_1010_2143 377
1881 3300048917 Ga0496114_0035566 Ga0496114_0035566_1598_2731 377
1882 3300048917 Ga0496114_0038438 Ga0496114_0038438_375_1514 377
1883 3300048917 Ga0496114_0058816 Ga0496114_0058816_278_1411 377
1884 3300048917 Ga0496114_0194068 Ga0496114_0194068_599_1735 377
1885 3300048918 Ga0496115_0001160 Ga0496115_0001160_12701_13834 377
1886 3300048918 Ga0496115_0002750 Ga0496115_0002750_2397_3533 377
1887 3300048918 Ga0496115_0014364 Ga0496115_0014364_4381_5514 377
1888 3300048918 Ga0496115_0020665 Ga0496115_0020665_597_1736 377
1889 3300048918 Ga0496115_0074660 Ga0496115_0074660_1564_2697 377
1890 3300049593 Ga0501077_0011452 Ga0501077_0011452_283_1416 377
1891 3300049742 Ga0501080_0292089 Ga0501080_0292089_306_1442 377
1892 3300049744 Ga0501083_0059136 Ga0501083_0059136_941_2089 377
1893 3300050507 nmdc:mga05p37_102_c1 nmdc:mga05p37_102_c1_14072_15205 377
1894 3300050507 nmdc:mga05p37_103644_c1 nmdc:mga05p37_103644_c1_2075_3208 377
1895 3300050508 nmdc:mga09592_14658_c1 nmdc:mga09592_14658_c1_2819_3955 377
1896 3300050508 nmdc:mga09592_752_c1 nmdc:mga09592_752_c1_10638_11771 377
1897 3300050509 nmdc:mga0qj67_119_c1 nmdc:mga0qj67_119_c1_49028_50161 377
1898 3300050510 nmdc:mga06r32_1767_c1 nmdc:mga06r32_1767_c1_6033_7169 377
1899 3300050510 nmdc:mga06r32_621_c1 nmdc:mga06r32_621_c1_23395_24528 377
1900 3300050511 nmdc:mga08y16_1991_c1 nmdc:mga08y16_1991_c1_15643_16776 377
1901 3300050511 nmdc:mga08y16_30913_c1 nmdc:mga08y16_30913_c1_1701_2834 377
1902 3300050511 nmdc:mga08y16_3532_c1 nmdc:mga08y16_3532_c1_10322_11455 377
1903 3300050512 nmdc:mga0n895_1270_c1 nmdc:mga0n895_1270_c1_13440_14573 377
1904 3300050512 nmdc:mga0n895_2196_c1 nmdc:mga0n895_2196_c1_10889_12022 377
1905 3300050512 nmdc:mga0n895_90744_c1 nmdc:mga0n895_90744_c1_1731_2864 377
1906 3300050513 nmdc:mga0rr50_115027_c1 nmdc:mga0rr50_115027_c1_223_1356 377
1907 3300050513 nmdc:mga0rr50_22191_c1 nmdc:mga0rr50_22191_c1_1486_2619 377
1908 3300050515 nmdc:mga0a205_146535_c1 nmdc:mga0a205_146535_c1_231_1376 377
1909 3300050515 nmdc:mga0a205_1990_c1 nmdc:mga0a205_1990_c1_10927_12060 377
1910 3300050515 nmdc:mga0a205_421_c1 nmdc:mga0a205_421_c1_6483_7616 377
1911 3300050515 nmdc:mga0a205_58386_c1 nmdc:mga0a205_58386_c1_2298_3431 377
1912 3300053077 Ga0495601_0002952 Ga0495601_0002952_7476_8609 377
1913 3300053077 Ga0495601_0003050 Ga0495601_0003050_4409_5542 377
1914 3300053077 Ga0495601_0003088 Ga0495601_0003088_141_1277 377
1915 3300053077 Ga0495601_0016054 Ga0495601_0016054_1679_2929 377
1916 3300053077 Ga0495601_0039165 Ga0495601_0039165_12_1145 377
1917 3300053077 Ga0495601_0044749 Ga0495601_0044749_530_1663 377
1918 3300053078 Ga0495612_0000786 Ga0495612_0000786_9399_10532 377
1919 3300053078 Ga0495612_0001076 Ga0495612_0001076_5288_6421 377
1920 3300053078 Ga0495612_0010919 Ga0495612_0010919_1004_2137 377
1921 3300053078 Ga0495612_0056308 Ga0495612_0056308_189_1322 377
1922 3300053078 Ga0495612_0071921 Ga0495612_0071921_76_1326 377
1923 3300053084 Ga0495595_0000223 Ga0495595_0000223_14590_15723 377
1924 3300053084 Ga0495595_0000984 Ga0495595_0000984_6944_8077 377
1925 3300053084 Ga0495595_0001629 Ga0495595_0001629_1287_2420 377
1926 3300053084 Ga0495595_0006421 Ga0495595_0006421_3078_4214 377
1927 3300053084 Ga0495595_0028170 Ga0495595_0028170_1310_2446 377
1928 3300053085 Ga0495619_0001087 Ga0495619_0001087_4007_5140 377
1929 3300053085 Ga0495619_0001653 Ga0495619_0001653_1893_3026 377
1930 3300053085 Ga0495619_0005901 Ga0495619_0005901_1016_2152 377
1931 3300053085 Ga0495619_0006095 Ga0495619_0006095_568_1704 377
1932 3300053085 Ga0495619_0010207 Ga0495619_0010207_2474_3724 377
1933 3300053085 Ga0495619_0023993 Ga0495619_0023993_116_1249 377
1934 3300053085 Ga0495619_0080845 Ga0495619_0080845_475_1608 377
1935 3300053096 Ga0500641_0005584 Ga0500641_0005584_3185_4402 377
1936 3300053096 Ga0500641_0010283 Ga0500641_0010283_360_1496 377
1937 3300053153 Ga0500616_0008359 Ga0500616_0008359_4468_5610 377
1938 3300060353 Ga0501082_0039669 Ga0501082_0039669_54_1190 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

219

430

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.9072 127 370
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8918 125 371
7d08-assembly1.cif.gz_A acinetobacter mlafedb complex in atp-bound vtrans1 conformation 0.8787 115 367
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8716 125 371
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.8699 123 370
ID Description Score Start End Superfamily
af_D3ZXL0_527_672_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8319 10 97 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7924 2 97 3.30.750.24
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7883 7 87 3.30.750.24
1t6rA00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7859 1 101 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.785 3 101 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A520ZKN9-F1-model_v4 ABC transporter permease 0.9791 180 377 GO:0005548
GO:0043190
AF-A0A231MUA8-F1-model_v4 deleted 0.9781 114 377
AF-A0A351T1X7-F1-model_v4 ABC transporter permease 0.9748 156 377 GO:0005548
GO:0043190
AF-A0A348MP27-F1-model_v4 deleted 0.9697 155 372
AF-A0A520ZKN9-F1-model_v4 ABC transporter permease 0.9694 180 377 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
88.17 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map