F496103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1938 | 767 | 1692 | 371 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8006964411|8006965006 |
| Length | 436 |
| Sequence | SMLTASFRVRLEVILKSGNFLNRKLARRYQLWLVRDRFDKAIRRAEPGVSQRYRPRVGIVSGDPTLERIARGNGLALCAAGSWTARFAPVLERMVADAEKLSGTRPNILIDVSQVSKLDTFGAWLIERLRRSLTQGGIEAQIAGLSANYSSLVDEVRRVKAEPIIETDRVTITGILDQIGRAVASIGGTLIGLIDMLGAVLAAAAHVLIRPRNFRLTSTIHHLEQVCWRAVPIVVLITFLIGCIISQQGIFHFRKFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRTMGFDPIEVLILPRMLALVLALPILAFLGAMAALYGGGLVAWLYGGVEPEAFLLRLRDAISIDHFIVGLIKAPVMAAVIGIVACVEGLAVQGSAESLGQHTTSSVVKGIFFVIVMDGVFAIFFASIGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 14 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 15 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 16 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 17 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 18 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 19 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 20 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 21 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 22 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 23 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 24 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 25 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 26 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 27 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 28 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 29 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 30 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 31 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 32 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 33 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 34 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 35 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 36 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 37 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 38 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 39 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 40 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 41 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 42 | 2791355199 | |||
| 43 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 44 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 45 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 46 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 47 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 48 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 49 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 50 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 51 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 52 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 53 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 54 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 55 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 56 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 57 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 58 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 59 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 60 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 61 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 62 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 63 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 64 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 65 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 66 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 67 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 68 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 69 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 70 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 71 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 72 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 73 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 74 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 75 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 76 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 77 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 78 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 79 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 80 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 81 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 82 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 83 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 84 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 85 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 86 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 87 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 88 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 89 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 90 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 91 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 92 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 93 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 94 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 95 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 96 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 97 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 98 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 99 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 100 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 101 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 102 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 103 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 104 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 105 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 106 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 107 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 108 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 109 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 110 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 111 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 112 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 113 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 114 | 2904699407 | |||
| 115 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 116 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 117 | 2906610324 | |||
| 118 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 119 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 120 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 121 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 122 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 123 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 124 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 125 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 126 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 127 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 128 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 129 | 2922368715 | |||
| 130 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 131 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 132 | 2922425934 | |||
| 133 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 134 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 135 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 136 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 137 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 138 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 139 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 140 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 141 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 142 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 143 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 144 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 145 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 146 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 147 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 148 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 149 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 150 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 151 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 152 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 153 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 154 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 155 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 156 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 157 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 158 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 159 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 160 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 161 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 162 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 163 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 164 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 165 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 166 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 167 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 168 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 169 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 170 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 171 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 172 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 173 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 174 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 175 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 176 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 177 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 178 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 179 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 180 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 181 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 182 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 183 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 184 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 185 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 186 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 187 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 188 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 189 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 190 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 191 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 192 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 193 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 194 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 195 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 196 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 197 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 198 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 199 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 200 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 201 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 202 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 203 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 204 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 205 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 206 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 207 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 209 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 210 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 211 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 212 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 213 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 214 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 215 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 216 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 217 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 218 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 219 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 220 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 221 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 222 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 223 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 224 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 225 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 226 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 227 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 228 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 229 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 230 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 231 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 233 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 234 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 237 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 239 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 241 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 243 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 245 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 254 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 257 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 259 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 260 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 264 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 265 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 269 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 270 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 271 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 272 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 273 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 274 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 275 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 276 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 278 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 279 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 283 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 284 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 286 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 287 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 288 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 290 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 291 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 292 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 293 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 294 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 295 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 296 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 297 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 298 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 299 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 300 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 301 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 302 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 303 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 305 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 306 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 307 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 308 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 309 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 310 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 311 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 312 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 313 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 314 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 316 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 317 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 318 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 319 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 320 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 321 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 322 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 323 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 324 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 326 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 327 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 328 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 329 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 334 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 344 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 360 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 361 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 362 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 363 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 364 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 365 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 366 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 367 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 368 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 369 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 375 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 443 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 444 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 445 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 446 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 453 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 457 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 458 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 459 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 460 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 461 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 462 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 463 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 464 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 465 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 466 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 467 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 468 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 469 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 470 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 471 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 472 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 473 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 474 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 475 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 476 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 477 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 478 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 479 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 480 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 481 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 482 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 483 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 484 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 485 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 486 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 487 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 488 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 489 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 490 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 491 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 492 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 493 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 494 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 495 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 496 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 497 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 498 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 499 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 500 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 501 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 502 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 503 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 504 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 505 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 506 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 507 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 508 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 509 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 510 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 511 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 512 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 513 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 514 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 515 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 516 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 517 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 518 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 519 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 520 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 521 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 522 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 523 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 524 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 525 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 526 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 527 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 528 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 529 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 530 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 531 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 532 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 533 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 534 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 535 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 536 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 537 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 538 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 539 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 540 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 541 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 542 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 543 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 544 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 545 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 546 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 547 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 548 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 549 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 550 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 551 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 620 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 621 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 622 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 623 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 624 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 625 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 626 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 627 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 628 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 629 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 630 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 631 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 632 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 633 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 634 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 635 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 636 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 637 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 638 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 639 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 640 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 641 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 642 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 643 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 644 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 645 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 648 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 649 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 653 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 658 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 659 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 660 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 662 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 663 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 665 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 667 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 668 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 669 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 670 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 671 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 676 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 677 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 678 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 679 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 680 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 681 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 682 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 683 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 684 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 685 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 686 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 687 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 688 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 689 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 690 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 691 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 696 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 697 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 698 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 699 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 700 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 701 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 702 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 703 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 704 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 705 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 706 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 707 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 708 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 709 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 710 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 711 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 712 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 713 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 714 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 715 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 716 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 717 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 718 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 719 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 720 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 721 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 722 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 723 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 724 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 725 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 726 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 727 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 728 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 729 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 730 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 731 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 732 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 733 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 734 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 735 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 736 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 737 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 738 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 739 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 740 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 741 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 742 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 743 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 744 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 745 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 746 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 747 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 748 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 749 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 750 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 751 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 752 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 753 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 754 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 755 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 756 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 757 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 758 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 759 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 760 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 761 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 762 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 763 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 764 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 765 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 766 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 767 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.53 |
| Metatranscriptomes | 0 |
| Isolates | 12.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 9.7 |
| Rhizoplane | 5.01 |
| Rhizosphere | 72.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544935 | 2209111006 | Bacteria | 6286 |
| 2 | ARSoilYngRDRAFT_c00089 | 3300000042 | Bacteria | 15393 |
| 3 | ARSoilOldRDRAFT_c000300 | 3300000044 | Bacteria | 6790 |
| 4 | ARSoilOldRDRAFT_c000339 | 3300000044 | Bacteria | 6016 |
| 5 | ARCol0oldRDRAFT_c00174 | 3300000045 | Bacteria | 5852 |
| 6 | ARCol0yngRDRAFT_1000107 | 3300000652 | Bacteria | 15394 |
| 7 | JGI24741J21665_1013626 | 3300001915 | Bacteria | 1376 |
| 8 | JGI24746J21847_1000182 | 3300001977 | Bacteria | 8294 |
| 9 | JGI24747J21853_1002123 | 3300001978 | Bacteria | 1576 |
| 10 | JGI24739J22299_10002319 | 3300001989 | Bacteria | 7334 |
| 11 | JGI24737J22298_10007743 | 3300001990 | Bacteria | 3622 |
| 12 | JGI24737J22298_10010552 | 3300001990 | Bacteria | 3047 |
| 13 | JGI24737J22298_10023654 | 3300001990 | Bacteria | 1948 |
| 14 | JGI24750J21931_1000513 | 3300002070 | Bacteria | 6023 |
| 15 | JGI24750J21931_1000665 | 3300002070 | Bacteria | 5085 |
| 16 | JGI24745J21846_1000274 | 3300002073 | Bacteria | 4375 |
| 17 | JGI24738J21930_10000052 | 3300002075 | Bacteria | 23911 |
| 18 | JGI24749J21850_1002731 | 3300002076 | Bacteria | 2474 |
| 19 | JGI24744J21845_10001379 | 3300002077 | Bacteria | 4810 |
| 20 | JGI24035J26624_1000226 | 3300002126 | Bacteria | 5170 |
| 21 | JGI24033J26618_1002616 | 3300002155 | Bacteria | 1852 |
| 22 | JGI24742J22300_10001173 | 3300002244 | Bacteria | 4083 |
| 23 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 24 | JGI25160J50197_1006147 | 3300003354 | Bacteria | 4890 |
| 25 | JGI25160J50197_1006602 | 3300003354 | Bacteria | 4674 |
| 26 | JGI25404J52841_10009833 | 3300003659 | Bacteria | 2051 |
| 27 | JGI25404J52841_10011033 | 3300003659 | Bacteria | 1945 |
| 28 | Ga0055542_1003874 | 3300003762 | Bacteria | 3855 |
| 29 | Ga0065165_1024748 | 3300005262 | Bacteria | 2011 |
| 30 | Ga0065704_10090369 | 3300005289 | Bacteria | 2792 |
| 31 | Ga0065712_10003538 | 3300005290 | Bacteria | 5261 |
| 32 | Ga0065712_10015554 | 3300005290 | Bacteria | 1991 |
| 33 | Ga0065712_10068990 | 3300005290 | Bacteria | 8358 |
| 34 | Ga0065712_10083170 | 3300005290 | Bacteria | 2858 |
| 35 | Ga0065712_10099300 | 3300005290 | Bacteria | 2085 |
| 36 | Ga0065715_10089733 | 3300005293 | Bacteria | 8685 |
| 37 | Ga0065715_10104580 | 3300005293 | Bacteria | 2951 |
| 38 | Ga0065707_10092121 | 3300005295 | Bacteria | 3822 |
| 39 | Ga0070676_10001246 | 3300005328 | Bacteria | 12817 |
| 40 | Ga0070683_100003790 | 3300005329 | Bacteria | 12347 |
| 41 | Ga0070683_100012630 | 3300005329 | Bacteria | 7342 |
| 42 | Ga0070683_100036431 | 3300005329 | Bacteria | 4501 |
| 43 | Ga0070683_100041700 | 3300005329 | Bacteria | 4224 |
| 44 | Ga0070690_100004565 | 3300005330 | Bacteria | 7694 |
| 45 | Ga0070690_100004629 | 3300005330 | Bacteria | 7656 |
| 46 | Ga0070690_100134507 | 3300005330 | Bacteria | 1673 |
| 47 | Ga0070670_100002085 | 3300005331 | Bacteria | 16387 |
| 48 | Ga0070670_100037991 | 3300005331 | Bacteria | 4140 |
| 49 | Ga0070670_100042623 | 3300005331 | Bacteria | 3902 |
| 50 | Ga0070670_100100990 | 3300005331 | Bacteria | 2484 |
| 51 | Ga0070670_100144944 | 3300005331 | Bacteria | 2054 |
| 52 | Ga0070670_100263878 | 3300005331 | Bacteria | 1501 |
| 53 | Ga0070677_10000009 | 3300005333 | Bacteria | 65648 |
| 54 | Ga0068869_100002305 | 3300005334 | Bacteria | 11486 |
| 55 | Ga0068869_100040444 | 3300005334 | Bacteria | 3334 |
| 56 | Ga0070666_10007715 | 3300005335 | Bacteria | 6646 |
| 57 | Ga0070666_10009200 | 3300005335 | Bacteria | 6158 |
| 58 | Ga0070680_100004098 | 3300005336 | Bacteria | 10915 |
| 59 | Ga0070680_100018156 | 3300005336 | Bacteria | 5556 |
| 60 | Ga0070680_100063307 | 3300005336 | Bacteria | 3029 |
| 61 | Ga0070680_100069347 | 3300005336 | Bacteria | 2895 |
| 62 | Ga0070682_100000116 | 3300005337 | Bacteria | 69952 |
| 63 | Ga0070682_100000979 | 3300005337 | Bacteria | 16545 |
| 64 | Ga0070682_100034485 | 3300005337 | Bacteria | 3083 |
| 65 | Ga0068868_100003854 | 3300005338 | Bacteria | 10469 |
| 66 | Ga0068868_100052544 | 3300005338 | Bacteria | 3208 |
| 67 | Ga0068868_100118518 | 3300005338 | Bacteria | 2158 |
| 68 | Ga0068868_100121868 | 3300005338 | Bacteria | 2128 |
| 69 | Ga0070660_100003331 | 3300005339 | Bacteria | 11041 |
| 70 | Ga0070660_100019816 | 3300005339 | Bacteria | 4934 |
| 71 | Ga0070660_100086700 | 3300005339 | Bacteria | 2463 |
| 72 | Ga0070689_100003558 | 3300005340 | Bacteria | 10371 |
| 73 | Ga0070689_100010855 | 3300005340 | Bacteria | 6511 |
| 74 | Ga0070689_100111071 | 3300005340 | Bacteria | 2180 |
| 75 | Ga0070689_100194892 | 3300005340 | Bacteria | 1651 |
| 76 | Ga0070691_10003923 | 3300005341 | Bacteria | 6732 |
| 77 | Ga0070691_10018597 | 3300005341 | Bacteria | 3203 |
| 78 | Ga0070691_10019647 | 3300005341 | Bacteria | 3119 |
| 79 | Ga0070687_100000789 | 3300005343 | Bacteria | 10526 |
| 80 | Ga0070687_100023301 | 3300005343 | Bacteria | 2941 |
| 81 | Ga0070661_100001106 | 3300005344 | Bacteria | 18965 |
| 82 | Ga0070661_100040659 | 3300005344 | Bacteria | 3393 |
| 83 | Ga0070692_10000072 | 3300005345 | Bacteria | 20566 |
| 84 | Ga0070692_10014992 | 3300005345 | Bacteria | 3656 |
| 85 | Ga0070668_100101369 | 3300005347 | Bacteria | 2282 |
| 86 | Ga0070669_100006413 | 3300005353 | Bacteria | 8465 |
| 87 | Ga0070669_100023793 | 3300005353 | Bacteria | 4390 |
| 88 | Ga0070675_100002349 | 3300005354 | Bacteria | 14066 |
| 89 | Ga0070675_100075291 | 3300005354 | Bacteria | 2806 |
| 90 | Ga0070671_100000438 | 3300005355 | Bacteria | 28920 |
| 91 | Ga0070671_100022090 | 3300005355 | Bacteria | 5198 |
| 92 | Ga0070671_100050350 | 3300005355 | Bacteria | 3464 |
| 93 | Ga0070671_100101976 | 3300005355 | Bacteria | 2408 |
| 94 | Ga0070671_100103037 | 3300005355 | Bacteria | 2394 |
| 95 | Ga0070674_100010977 | 3300005356 | Bacteria | 5495 |
| 96 | Ga0070674_100082631 | 3300005356 | Bacteria | 2298 |
| 97 | Ga0070674_100134883 | 3300005356 | Bacteria | 1845 |
| 98 | Ga0070673_100013957 | 3300005364 | Bacteria | 5578 |
| 99 | Ga0070673_100081869 | 3300005364 | Bacteria | 2619 |
| 100 | Ga0070673_100108718 | 3300005364 | Bacteria | 2296 |
| 101 | Ga0070673_100129260 | 3300005364 | Bacteria | 2117 |
| 102 | Ga0070688_100002434 | 3300005365 | Bacteria | 9408 |
| 103 | Ga0070688_100011673 | 3300005365 | Bacteria | 4891 |
| 104 | Ga0070688_100024430 | 3300005365 | Bacteria | 3566 |
| 105 | Ga0070688_100089378 | 3300005365 | Bacteria | 2010 |
| 106 | Ga0070688_100144809 | 3300005365 | Bacteria | 1618 |
| 107 | Ga0070659_100004384 | 3300005366 | Bacteria | 10078 |
| 108 | Ga0070659_100008591 | 3300005366 | Bacteria | 7468 |
| 109 | Ga0070659_100031077 | 3300005366 | Bacteria | 4135 |
| 110 | Ga0070667_100022200 | 3300005367 | Bacteria | 5265 |
| 111 | Ga0070667_100028213 | 3300005367 | Bacteria | 4672 |
| 112 | Ga0070667_100132488 | 3300005367 | Bacteria | 2177 |
| 113 | Ga0070667_100162549 | 3300005367 | Bacteria | 1967 |
| 114 | Ga0070709_10002732 | 3300005434 | Bacteria | 9543 |
| 115 | Ga0070709_10045389 | 3300005434 | Bacteria | 2727 |
| 116 | Ga0070709_10081750 | 3300005434 | Bacteria | 2110 |
| 117 | Ga0070709_10083770 | 3300005434 | Bacteria | 2086 |
| 118 | Ga0070714_100019598 | 3300005435 | Bacteria | 5515 |
| 119 | Ga0070714_100056531 | 3300005435 | Bacteria | 3356 |
| 120 | Ga0070714_100184654 | 3300005435 | Bacteria | 1900 |
| 121 | Ga0070713_100019289 | 3300005436 | Bacteria | 5202 |
| 122 | Ga0070713_100035925 | 3300005436 | Bacteria | 3994 |
| 123 | Ga0070713_100064129 | 3300005436 | Bacteria | 3082 |
| 124 | Ga0070713_100169074 | 3300005436 | Bacteria | 1957 |
| 125 | Ga0070710_10005268 | 3300005437 | Bacteria | 6133 |
| 126 | Ga0070710_10011405 | 3300005437 | Bacteria | 4389 |
| 127 | Ga0070701_10000749 | 3300005438 | Bacteria | 11526 |
| 128 | Ga0070701_10029566 | 3300005438 | Bacteria | 2703 |
| 129 | Ga0070711_100004717 | 3300005439 | Bacteria | 8070 |
| 130 | Ga0070711_100006985 | 3300005439 | Bacteria | 6847 |
| 131 | Ga0070711_100012265 | 3300005439 | Bacteria | 5348 |
| 132 | Ga0070711_100014964 | 3300005439 | Bacteria | 4901 |
| 133 | Ga0070711_100096662 | 3300005439 | Bacteria | 2140 |
| 134 | Ga0070711_100115530 | 3300005439 | Bacteria | 1976 |
| 135 | Ga0070711_100131993 | 3300005439 | Bacteria | 1861 |
| 136 | Ga0070705_100001548 | 3300005440 | Bacteria | 12063 |
| 137 | Ga0070705_100008627 | 3300005440 | Bacteria | 5047 |
| 138 | Ga0070700_100002431 | 3300005441 | Bacteria | 9474 |
| 139 | Ga0070700_100005261 | 3300005441 | Bacteria | 6844 |
| 140 | Ga0070694_100008016 | 3300005444 | Bacteria | 6454 |
| 141 | Ga0070694_100020661 | 3300005444 | Bacteria | 4199 |
| 142 | Ga0070663_100002701 | 3300005455 | Bacteria | 10040 |
| 143 | Ga0070663_100028958 | 3300005455 | Bacteria | 3777 |
| 144 | Ga0070663_100071948 | 3300005455 | Bacteria | 2517 |
| 145 | Ga0070678_100003996 | 3300005456 | Bacteria | 8295 |
| 146 | Ga0070678_100021420 | 3300005456 | Bacteria | 4262 |
| 147 | Ga0070678_100029939 | 3300005456 | Bacteria | 3735 |
| 148 | Ga0070662_100013570 | 3300005457 | Bacteria | 5424 |
| 149 | Ga0070662_100032477 | 3300005457 | Bacteria | 3669 |
| 150 | Ga0070681_10008360 | 3300005458 | Bacteria | 10138 |
| 151 | Ga0070681_10027797 | 3300005458 | Bacteria | 5687 |
| 152 | Ga0070681_10046810 | 3300005458 | Bacteria | 4323 |
| 153 | Ga0070681_10049000 | 3300005458 | Bacteria | 4220 |
| 154 | Ga0068867_100003047 | 3300005459 | Bacteria | 11816 |
| 155 | Ga0068867_100087539 | 3300005459 | Bacteria | 2359 |
| 156 | Ga0068867_100133071 | 3300005459 | Bacteria | 1935 |
| 157 | Ga0070685_10006097 | 3300005466 | Bacteria | 6143 |
| 158 | Ga0070685_10022040 | 3300005466 | Bacteria | 3468 |
| 159 | Ga0070685_10023246 | 3300005466 | Bacteria | 3392 |
| 160 | Ga0070685_10052006 | 3300005466 | Bacteria | 2370 |
| 161 | Ga0070685_10056001 | 3300005466 | Bacteria | 2291 |
| 162 | Ga0070698_100230579 | 3300005471 | Bacteria | 1785 |
| 163 | Ga0070698_100310135 | 3300005471 | Bacteria | 1509 |
| 164 | Ga0070679_100012488 | 3300005530 | Bacteria | 8120 |
| 165 | Ga0070679_100012608 | 3300005530 | Bacteria | 8083 |
| 166 | Ga0070679_100045348 | 3300005530 | Bacteria | 4380 |
| 167 | Ga0070679_100066163 | 3300005530 | Bacteria | 3602 |
| 168 | Ga0070679_100091000 | 3300005530 | Bacteria | 3039 |
| 169 | Ga0070679_100174934 | 3300005530 | Bacteria | 2119 |
| 170 | Ga0070684_100043470 | 3300005535 | Bacteria | 3880 |
| 171 | Ga0070684_100147360 | 3300005535 | Bacteria | 2131 |
| 172 | Ga0070684_100265552 | 3300005535 | Bacteria | 1570 |
| 173 | Ga0070697_100001151 | 3300005536 | Bacteria | 20042 |
| 174 | Ga0068853_100000659 | 3300005539 | Bacteria | 23749 |
| 175 | Ga0068853_100004427 | 3300005539 | Bacteria | 10875 |
| 176 | Ga0068853_100005475 | 3300005539 | Bacteria | 9947 |
| 177 | Ga0068853_100039671 | 3300005539 | Bacteria | 4017 |
| 178 | Ga0068853_100142783 | 3300005539 | Bacteria | 2150 |
| 179 | Ga0068853_100179625 | 3300005539 | Bacteria | 1919 |
| 180 | Ga0070672_100003650 | 3300005543 | Bacteria | 9997 |
| 181 | Ga0070672_100072586 | 3300005543 | Bacteria | 2740 |
| 182 | Ga0070672_100097229 | 3300005543 | Bacteria | 2383 |
| 183 | Ga0070672_100148955 | 3300005543 | Bacteria | 1935 |
| 184 | Ga0070686_100001755 | 3300005544 | Bacteria | 12140 |
| 185 | Ga0070686_100015274 | 3300005544 | Bacteria | 4442 |
| 186 | Ga0070686_100042821 | 3300005544 | Bacteria | 2838 |
| 187 | Ga0070686_100058573 | 3300005544 | Bacteria | 2479 |
| 188 | Ga0070686_100068040 | 3300005544 | Bacteria | 2322 |
| 189 | Ga0070695_100003819 | 3300005545 | Bacteria | 8784 |
| 190 | Ga0070695_100013267 | 3300005545 | Bacteria | 4950 |
| 191 | Ga0070695_100014726 | 3300005545 | Bacteria | 4717 |
| 192 | Ga0070696_100021998 | 3300005546 | Bacteria | 4328 |
| 193 | Ga0070696_100022292 | 3300005546 | Bacteria | 4301 |
| 194 | Ga0070696_100043536 | 3300005546 | Bacteria | 3106 |
| 195 | Ga0070696_100225897 | 3300005546 | Bacteria | 1407 |
| 196 | Ga0070693_100000988 | 3300005547 | Bacteria | 12664 |
| 197 | Ga0070693_100002396 | 3300005547 | Bacteria | 8622 |
| 198 | Ga0070693_100054369 | 3300005547 | Bacteria | 2302 |
| 199 | Ga0070693_100089785 | 3300005547 | Bacteria | 1850 |
| 200 | Ga0070665_100006275 | 3300005548 | Bacteria | 12150 |
| 201 | Ga0070665_100047526 | 3300005548 | Bacteria | 4307 |
| 202 | Ga0070665_100058037 | 3300005548 | Bacteria | 3880 |
| 203 | Ga0070665_100060124 | 3300005548 | Bacteria | 3809 |
| 204 | Ga0070665_100187906 | 3300005548 | Bacteria | 2067 |
| 205 | Ga0070704_100002150 | 3300005549 | Bacteria | 10978 |
| 206 | Ga0070704_100006558 | 3300005549 | Bacteria | 6863 |
| 207 | Ga0070704_100030161 | 3300005549 | Bacteria | 3631 |
| 208 | Ga0070704_100132809 | 3300005549 | Bacteria | 1932 |
| 209 | Ga0068855_100015636 | 3300005563 | Bacteria | 9131 |
| 210 | Ga0068855_100039924 | 3300005563 | Bacteria | 5571 |
| 211 | Ga0068855_100064883 | 3300005563 | Bacteria | 4258 |
| 212 | Ga0068855_100082470 | 3300005563 | Bacteria | 3726 |
| 213 | Ga0068855_100118529 | 3300005563 | Bacteria | 3031 |
| 214 | Ga0068855_100268339 | 3300005563 | Bacteria | 1898 |
| 215 | Ga0070664_100065325 | 3300005564 | Bacteria | 3104 |
| 216 | Ga0070664_100080119 | 3300005564 | Bacteria | 2812 |
| 217 | Ga0070664_100165374 | 3300005564 | Bacteria | 1960 |
| 218 | Ga0068857_100000295 | 3300005577 | Bacteria | 34486 |
| 219 | Ga0068857_100012531 | 3300005577 | Bacteria | 7383 |
| 220 | Ga0068857_100051056 | 3300005577 | Bacteria | 3667 |
| 221 | Ga0068854_100000260 | 3300005578 | Bacteria | 35995 |
| 222 | Ga0068854_100054196 | 3300005578 | Bacteria | 2883 |
| 223 | Ga0068854_100056325 | 3300005578 | Bacteria | 2833 |
| 224 | Ga0068856_100008963 | 3300005614 | Bacteria | 9734 |
| 225 | Ga0068856_100037475 | 3300005614 | Bacteria | 4758 |
| 226 | Ga0068856_100067052 | 3300005614 | Bacteria | 3546 |
| 227 | Ga0068856_100293657 | 3300005614 | Bacteria | 1642 |
| 228 | Ga0070702_100000267 | 3300005615 | Bacteria | 17761 |
| 229 | Ga0070702_100069352 | 3300005615 | Bacteria | 2077 |
| 230 | Ga0068859_100016349 | 3300005617 | Bacteria | 7454 |
| 231 | Ga0068859_100031702 | 3300005617 | Bacteria | 5308 |
| 232 | Ga0068859_100161711 | 3300005617 | Bacteria | 2318 |
| 233 | Ga0068864_100001366 | 3300005618 | Bacteria | 20286 |
| 234 | Ga0068864_100262041 | 3300005618 | Bacteria | 1608 |
| 235 | Ga0068866_10001935 | 3300005718 | Bacteria | 8641 |
| 236 | Ga0068866_10025008 | 3300005718 | Bacteria | 2802 |
| 237 | Ga0068861_100001047 | 3300005719 | Bacteria | 16998 |
| 238 | Ga0068861_100080421 | 3300005719 | Bacteria | 2550 |
| 239 | Ga0068851_10009190 | 3300005834 | Bacteria | 4590 |
| 240 | Ga0068870_10000404 | 3300005840 | Bacteria | 16242 |
| 241 | Ga0068870_10036806 | 3300005840 | Bacteria | 2519 |
| 242 | Ga0068863_100007320 | 3300005841 | Bacteria | 10808 |
| 243 | Ga0068863_100091617 | 3300005841 | Bacteria | 2883 |
| 244 | Ga0068863_100192569 | 3300005841 | Bacteria | 1960 |
| 245 | Ga0068863_100246853 | 3300005841 | Bacteria | 1724 |
| 246 | Ga0068858_100004119 | 3300005842 | Bacteria | 14313 |
| 247 | Ga0068858_100037563 | 3300005842 | Bacteria | 4492 |
| 248 | Ga0068858_100049400 | 3300005842 | Bacteria | 3896 |
| 249 | Ga0068858_100088219 | 3300005842 | Bacteria | 2886 |
| 250 | Ga0068858_100121995 | 3300005842 | Bacteria | 2438 |
| 251 | Ga0068858_100167218 | 3300005842 | Bacteria | 2073 |
| 252 | Ga0068860_100000562 | 3300005843 | Bacteria | 44958 |
| 253 | Ga0068860_100007370 | 3300005843 | Bacteria | 11000 |
| 254 | Ga0068860_100062258 | 3300005843 | Bacteria | 3545 |
| 255 | Ga0068860_100101582 | 3300005843 | Bacteria | 2744 |
| 256 | Ga0068860_100309147 | 3300005843 | Bacteria | 1550 |
| 257 | Ga0068862_100005293 | 3300005844 | Bacteria | 10814 |
| 258 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 259 | Ga0081455_10000419 | 3300005937 | Bacteria | 55807 |
| 260 | Ga0081455_10004709 | 3300005937 | Bacteria | 15165 |
| 261 | Ga0081455_10007131 | 3300005937 | Bacteria | 11831 |
| 262 | Ga0081455_10007757 | 3300005937 | Bacteria | 11254 |
| 263 | Ga0081455_10007799 | 3300005937 | Bacteria | 11212 |
| 264 | Ga0081455_10042462 | 3300005937 | Bacteria | 3988 |
| 265 | Ga0081455_10085171 | 3300005937 | Bacteria | 2578 |
| 266 | Ga0081538_10012089 | 3300005981 | Bacteria | 6944 |
| 267 | Ga0081538_10020591 | 3300005981 | Bacteria | 4846 |
| 268 | Ga0081538_10036175 | 3300005981 | Bacteria | 3227 |
| 269 | Ga0081540_1000003 | 3300005983 | Bacteria | 233942 |
| 270 | Ga0081540_1000585 | 3300005983 | Bacteria | 35126 |
| 271 | Ga0081540_1006269 | 3300005983 | Bacteria | 8704 |
| 272 | Ga0081540_1014526 | 3300005983 | Bacteria | 5037 |
| 273 | Ga0081540_1015307 | 3300005983 | Bacteria | 4861 |
| 274 | Ga0081540_1017136 | 3300005983 | Bacteria | 4497 |
| 275 | Ga0081540_1020861 | 3300005983 | Bacteria | 3925 |
| 276 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 277 | Ga0070717_10002456 | 3300006028 | Bacteria | 13077 |
| 278 | Ga0075365_10002418 | 3300006038 | Bacteria | 9149 |
| 279 | Ga0075365_10021887 | 3300006038 | Bacteria | 3996 |
| 280 | Ga0075365_10090220 | 3300006038 | Bacteria | 2087 |
| 281 | Ga0075365_10147405 | 3300006038 | Bacteria | 1636 |
| 282 | Ga0075365_10222012 | 3300006038 | Bacteria | 1326 |
| 283 | Ga0075368_10005197 | 3300006042 | Bacteria | 4464 |
| 284 | Ga0075368_10006102 | 3300006042 | Bacteria | 4188 |
| 285 | Ga0075368_10012790 | 3300006042 | Bacteria | 3074 |
| 286 | Ga0075363_100004607 | 3300006048 | Bacteria | 6054 |
| 287 | Ga0075363_100095898 | 3300006048 | Bacteria | 1637 |
| 288 | Ga0075364_10005987 | 3300006051 | Bacteria | 7107 |
| 289 | Ga0075364_10022670 | 3300006051 | Bacteria | 3969 |
| 290 | Ga0075364_10051487 | 3300006051 | Bacteria | 2690 |
| 291 | Ga0075364_10125572 | 3300006051 | Bacteria | 1720 |
| 292 | Ga0075364_10166750 | 3300006051 | Bacteria | 1488 |
| 293 | Ga0070715_10008835 | 3300006163 | Bacteria | 3526 |
| 294 | Ga0070716_100004186 | 3300006173 | Bacteria | 6861 |
| 295 | Ga0070716_100031647 | 3300006173 | Bacteria | 2879 |
| 296 | Ga0070716_100103903 | 3300006173 | Bacteria | 1748 |
| 297 | Ga0070712_100030142 | 3300006175 | Bacteria | 3643 |
| 298 | Ga0070712_100096908 | 3300006175 | Bacteria | 2172 |
| 299 | Ga0070712_100101329 | 3300006175 | Bacteria | 2130 |
| 300 | Ga0070712_100195450 | 3300006175 | Bacteria | 1586 |
| 301 | Ga0075367_10000969 | 3300006178 | Bacteria | 11723 |
| 302 | Ga0075367_10038585 | 3300006178 | Bacteria | 2781 |
| 303 | Ga0075367_10051435 | 3300006178 | Bacteria | 2435 |
| 304 | Ga0075367_10068864 | 3300006178 | Bacteria | 2123 |
| 305 | Ga0075367_10082613 | 3300006178 | Bacteria | 1945 |
| 306 | Ga0075367_10097893 | 3300006178 | Bacteria | 1790 |
| 307 | Ga0075367_10176390 | 3300006178 | Bacteria | 1332 |
| 308 | Ga0075369_10009443 | 3300006186 | Bacteria | 3790 |
| 309 | Ga0075369_10023578 | 3300006186 | Bacteria | 2545 |
| 310 | Ga0075369_10035439 | 3300006186 | Bacteria | 2121 |
| 311 | Ga0075369_10046899 | 3300006186 | Bacteria | 1862 |
| 312 | Ga0075366_10041025 | 3300006195 | Bacteria | 2739 |
| 313 | Ga0075366_10105801 | 3300006195 | Bacteria | 1691 |
| 314 | Ga0097621_100000421 | 3300006237 | Bacteria | 29460 |
| 315 | Ga0097621_100002992 | 3300006237 | Bacteria | 11612 |
| 316 | Ga0097621_100063763 | 3300006237 | Bacteria | 3029 |
| 317 | Ga0075370_10010442 | 3300006353 | Bacteria | 4856 |
| 318 | Ga0075370_10041822 | 3300006353 | Bacteria | 2588 |
| 319 | Ga0075370_10052846 | 3300006353 | Bacteria | 2306 |
| 320 | Ga0075370_10058740 | 3300006353 | Bacteria | 2188 |
| 321 | Ga0068871_100000879 | 3300006358 | Bacteria | 20044 |
| 322 | Ga0068871_100025095 | 3300006358 | Bacteria | 4632 |
| 323 | Ga0068871_100087672 | 3300006358 | Bacteria | 2588 |
| 324 | Ga0068871_100124931 | 3300006358 | Bacteria | 2177 |
| 325 | Ga0075428_100011825 | 3300006844 | Bacteria | 9715 |
| 326 | Ga0075430_100005350 | 3300006846 | Bacteria | 10840 |
| 327 | Ga0075431_100000774 | 3300006847 | Bacteria | 27749 |
| 328 | Ga0075431_100004764 | 3300006847 | Bacteria | 13342 |
| 329 | Ga0075431_100097870 | 3300006847 | Bacteria | 3029 |
| 330 | Ga0075433_10036921 | 3300006852 | Bacteria | 4212 |
| 331 | Ga0075433_10072998 | 3300006852 | Bacteria | 3018 |
| 332 | Ga0075433_10086516 | 3300006852 | Bacteria | 2767 |
| 333 | Ga0075434_100002590 | 3300006871 | Bacteria | 15967 |
| 334 | Ga0075434_100005762 | 3300006871 | Bacteria | 11314 |
| 335 | Ga0075434_100046214 | 3300006871 | Bacteria | 4321 |
| 336 | Ga0075434_100100350 | 3300006871 | Bacteria | 2901 |
| 337 | Ga0075429_100002604 | 3300006880 | Bacteria | 15220 |
| 338 | Ga0075429_100019740 | 3300006880 | Bacteria | 5842 |
| 339 | Ga0075429_100177792 | 3300006880 | Bacteria | 1865 |
| 340 | Ga0068865_100003376 | 3300006881 | Bacteria | 9563 |
| 341 | Ga0068865_100013454 | 3300006881 | Bacteria | 5170 |
| 342 | Ga0068865_100111081 | 3300006881 | Bacteria | 2022 |
| 343 | Ga0097620_100016349 | 3300006931 | Bacteria | 7454 |
| 344 | Ga0097620_100031702 | 3300006931 | Bacteria | 5308 |
| 345 | Ga0097620_100161714 | 3300006931 | Bacteria | 2318 |
| 346 | Ga0099824_1006244 | 3300006942 | Bacteria | 16446 |
| 347 | Ga0099824_1025327 | 3300006942 | Bacteria | 3271 |
| 348 | Ga0099822_1004519 | 3300006943 | Bacteria | 18114 |
| 349 | Ga0099823_1020076 | 3300006944 | Bacteria | 6335 |
| 350 | Ga0075435_100031352 | 3300007076 | Bacteria | 4187 |
| 351 | Ga0075435_100064028 | 3300007076 | Bacteria | 2987 |
| 352 | Ga0075435_100237785 | 3300007076 | Bacteria | 1548 |
| 353 | Ga0105251_10007401 | 3300009011 | Bacteria | 6769 |
| 354 | Ga0105240_10003963 | 3300009093 | Bacteria | 22864 |
| 355 | Ga0105240_10015053 | 3300009093 | Bacteria | 10529 |
| 356 | Ga0105240_10082733 | 3300009093 | Bacteria | 3941 |
| 357 | Ga0105240_10189027 | 3300009093 | Bacteria | 2423 |
| 358 | Ga0105240_10522574 | 3300009093 | Bacteria | 1317 |
| 359 | Ga0111539_10000373 | 3300009094 | Bacteria | 55466 |
| 360 | Ga0111539_10003962 | 3300009094 | Bacteria | 19452 |
| 361 | Ga0111539_10009860 | 3300009094 | Bacteria | 12053 |
| 362 | Ga0111539_10152393 | 3300009094 | Bacteria | 2706 |
| 363 | Ga0111539_10162494 | 3300009094 | Bacteria | 2612 |
| 364 | Ga0105245_10013128 | 3300009098 | Bacteria | 7217 |
| 365 | Ga0105245_10019119 | 3300009098 | Bacteria | 5997 |
| 366 | Ga0105245_10024300 | 3300009098 | Bacteria | 5320 |
| 367 | Ga0105245_10049447 | 3300009098 | Bacteria | 3765 |
| 368 | Ga0105245_10069230 | 3300009098 | Bacteria | 3199 |
| 369 | Ga0105245_10162754 | 3300009098 | Bacteria | 2118 |
| 370 | Ga0105247_10009472 | 3300009101 | Bacteria | 5909 |
| 371 | Ga0105247_10012428 | 3300009101 | Bacteria | 5113 |
| 372 | Ga0105247_10012564 | 3300009101 | Bacteria | 5087 |
| 373 | Ga0105247_10014958 | 3300009101 | Bacteria | 4652 |
| 374 | Ga0105247_10042332 | 3300009101 | Bacteria | 2790 |
| 375 | Ga0114129_10000170 | 3300009147 | Bacteria | 70817 |
| 376 | Ga0114129_10023543 | 3300009147 | Bacteria | 8728 |
| 377 | Ga0114129_10060452 | 3300009147 | Bacteria | 5298 |
| 378 | Ga0114129_10167898 | 3300009147 | Bacteria | 2993 |
| 379 | Ga0114129_10178319 | 3300009147 | Bacteria | 2893 |
| 380 | Ga0105243_10018313 | 3300009148 | Bacteria | 5303 |
| 381 | Ga0105243_10037937 | 3300009148 | Bacteria | 3749 |
| 382 | Ga0105241_10002379 | 3300009174 | Bacteria | 14125 |
| 383 | Ga0105241_10009140 | 3300009174 | Bacteria | 7293 |
| 384 | Ga0105241_10080881 | 3300009174 | Bacteria | 2544 |
| 385 | Ga0105242_10004099 | 3300009176 | Bacteria | 11330 |
| 386 | Ga0105242_10045993 | 3300009176 | Bacteria | 3539 |
| 387 | Ga0105242_10138945 | 3300009176 | Bacteria | 2106 |
| 388 | Ga0105242_10184154 | 3300009176 | Bacteria | 1844 |
| 389 | Ga0105248_10000821 | 3300009177 | Bacteria | 34849 |
| 390 | Ga0105248_10021823 | 3300009177 | Bacteria | 7095 |
| 391 | Ga0105248_10025465 | 3300009177 | Bacteria | 6579 |
| 392 | Ga0105248_10160609 | 3300009177 | Bacteria | 2535 |
| 393 | Ga0105248_10391109 | 3300009177 | Bacteria | 1565 |
| 394 | Ga0105237_10001028 | 3300009545 | Bacteria | 37573 |
| 395 | Ga0105237_10028415 | 3300009545 | Bacteria | 5697 |
| 396 | Ga0105237_10129840 | 3300009545 | Bacteria | 2514 |
| 397 | Ga0105237_10205311 | 3300009545 | Bacteria | 1971 |
| 398 | Ga0105237_10209164 | 3300009545 | Bacteria | 1951 |
| 399 | Ga0105237_10369684 | 3300009545 | Bacteria | 1439 |
| 400 | Ga0105238_10059607 | 3300009551 | Bacteria | 3823 |
| 401 | Ga0105238_10060156 | 3300009551 | Bacteria | 3804 |
| 402 | Ga0105238_10121038 | 3300009551 | Bacteria | 2597 |
| 403 | Ga0105238_10148860 | 3300009551 | Bacteria | 2317 |
| 404 | Ga0105238_10369881 | 3300009551 | Bacteria | 1424 |
| 405 | Ga0105249_10001420 | 3300009553 | Bacteria | 20968 |
| 406 | Ga0105249_10008599 | 3300009553 | Bacteria | 8897 |
| 407 | Ga0105249_10009911 | 3300009553 | Bacteria | 8351 |
| 408 | Ga0105249_10035195 | 3300009553 | Bacteria | 4541 |
| 409 | Ga0105249_10099953 | 3300009553 | Bacteria | 2727 |
| 410 | Ga0105249_10178816 | 3300009553 | Bacteria | 2062 |
| 411 | Ga0105239_10020537 | 3300010375 | Bacteria | 7286 |
| 412 | Ga0105239_10040794 | 3300010375 | Bacteria | 5086 |
| 413 | Ga0105239_10053277 | 3300010375 | Bacteria | 4438 |
| 414 | Ga0105239_10062737 | 3300010375 | Bacteria | 4079 |
| 415 | Ga0105239_10090619 | 3300010375 | Bacteria | 3373 |
| 416 | Ga0105239_10130296 | 3300010375 | Bacteria | 2797 |
| 417 | Ga0105246_10000011 | 3300011119 | Bacteria | 68021 |
| 418 | Ga0105246_10003642 | 3300011119 | Bacteria | 9322 |
| 419 | Ga0105246_10033401 | 3300011119 | Bacteria | 3420 |
| 420 | Ga0105246_10035325 | 3300011119 | Bacteria | 3340 |
| 421 | Ga0105246_10341826 | 3300011119 | Bacteria | 1223 |
| 422 | Ga0157373_10003303 | 3300013100 | Bacteria | 12186 |
| 423 | Ga0157373_10072583 | 3300013100 | Bacteria | 2429 |
| 424 | Ga0157373_10086093 | 3300013100 | Bacteria | 2214 |
| 425 | Ga0157371_10007729 | 3300013102 | Bacteria | 8646 |
| 426 | Ga0157371_10050467 | 3300013102 | Bacteria | 2957 |
| 427 | Ga0157370_10019379 | 3300013104 | Bacteria | 6826 |
| 428 | Ga0157370_10053454 | 3300013104 | Bacteria | 3851 |
| 429 | Ga0157370_10066296 | 3300013104 | Bacteria | 3414 |
| 430 | Ga0157369_10034405 | 3300013105 | Bacteria | 5561 |
| 431 | Ga0157369_10112993 | 3300013105 | Bacteria | 2885 |
| 432 | Ga0157374_10005683 | 3300013296 | Bacteria | 10515 |
| 433 | Ga0157374_10025470 | 3300013296 | Bacteria | 5312 |
| 434 | Ga0157374_10045777 | 3300013296 | Bacteria | 4049 |
| 435 | Ga0157374_10099820 | 3300013296 | Bacteria | 2781 |
| 436 | Ga0157378_10002005 | 3300013297 | Bacteria | 18210 |
| 437 | Ga0157378_10108505 | 3300013297 | Bacteria | 2542 |
| 438 | Ga0163162_10005215 | 3300013306 | Bacteria | 12531 |
| 439 | Ga0163162_10027897 | 3300013306 | Bacteria | 5585 |
| 440 | Ga0163162_10039343 | 3300013306 | Bacteria | 4725 |
| 441 | Ga0163162_10060561 | 3300013306 | Bacteria | 3821 |
| 442 | Ga0163162_10112055 | 3300013306 | Bacteria | 2827 |
| 443 | Ga0163162_10351051 | 3300013306 | Bacteria | 1608 |
| 444 | Ga0163162_10385325 | 3300013306 | Bacteria | 1535 |
| 445 | Ga0157372_10005179 | 3300013307 | Bacteria | 13867 |
| 446 | Ga0157372_10034995 | 3300013307 | Bacteria | 5527 |
| 447 | Ga0157372_10077343 | 3300013307 | Bacteria | 3758 |
| 448 | Ga0157372_10251571 | 3300013307 | Bacteria | 2051 |
| 449 | Ga0157375_10012425 | 3300013308 | Bacteria | 7555 |
| 450 | Ga0157375_10016062 | 3300013308 | Bacteria | 6717 |
| 451 | Ga0157375_10021671 | 3300013308 | Bacteria | 5898 |
| 452 | Ga0157375_10042851 | 3300013308 | Bacteria | 4385 |
| 453 | Ga0157375_10059563 | 3300013308 | Bacteria | 3784 |
| 454 | Ga0157375_10060259 | 3300013308 | Bacteria | 3763 |
| 455 | Ga0157375_10657650 | 3300013308 | Bacteria | 1204 |
| 456 | Ga0163163_10004718 | 3300014325 | Bacteria | 11678 |
| 457 | Ga0163163_10005008 | 3300014325 | Bacteria | 11416 |
| 458 | Ga0163163_10032891 | 3300014325 | Bacteria | 5011 |
| 459 | Ga0163163_10032906 | 3300014325 | Bacteria | 5010 |
| 460 | Ga0163163_10058563 | 3300014325 | Bacteria | 3809 |
| 461 | Ga0157380_10005074 | 3300014326 | Bacteria | 9196 |
| 462 | Ga0157380_10047528 | 3300014326 | Bacteria | 3376 |
| 463 | Ga0157377_10000398 | 3300014745 | Bacteria | 18793 |
| 464 | Ga0157377_10035335 | 3300014745 | Bacteria | 2741 |
| 465 | Ga0157379_10006255 | 3300014968 | Bacteria | 10251 |
| 466 | Ga0157379_10008086 | 3300014968 | Bacteria | 9136 |
| 467 | Ga0157379_10014948 | 3300014968 | Bacteria | 6807 |
| 468 | Ga0157379_10022881 | 3300014968 | Bacteria | 5540 |
| 469 | Ga0157379_10026095 | 3300014968 | Bacteria | 5199 |
| 470 | Ga0157379_10032074 | 3300014968 | Bacteria | 4681 |
| 471 | Ga0157379_10033391 | 3300014968 | Bacteria | 4589 |
| 472 | Ga0157379_10039533 | 3300014968 | Bacteria | 4208 |
| 473 | Ga0157376_10003372 | 3300014969 | Bacteria | 10997 |
| 474 | Ga0157376_10011670 | 3300014969 | Bacteria | 6486 |
| 475 | Ga0157376_10077049 | 3300014969 | Bacteria | 2851 |
| 476 | Ga0163161_10002430 | 3300017792 | Bacteria | 13315 |
| 477 | Ga0163161_10048001 | 3300017792 | Bacteria | 3083 |
| 478 | Ga0163161_10129959 | 3300017792 | Bacteria | 1899 |
| 479 | Ga0214544_1000467 | 3300021320 | Bacteria | 73360 |
| 480 | Ga0214542_1000185 | 3300021321 | Bacteria | 96676 |
| 481 | Ga0214545_1000102 | 3300021324 | Bacteria | 96676 |
| 482 | Ga0214545_1023945 | 3300021324 | Bacteria | 3887 |
| 483 | Ga0214543_1000211 | 3300021327 | Bacteria | 87600 |
| 484 | Ga0213873_10005190 | 3300021358 | Bacteria | 2482 |
| 485 | Ga0213872_10064105 | 3300021361 | Bacteria | 1660 |
| 486 | Ga0213874_10027120 | 3300021377 | Bacteria | 1627 |
| 487 | Ga0213876_10002883 | 3300021384 | Bacteria | 9985 |
| 488 | Ga0213876_10003126 | 3300021384 | Bacteria | 9562 |
| 489 | Ga0213875_10001986 | 3300021388 | Bacteria | 12652 |
| 490 | Ga0228598_1002460 | 3300024227 | Bacteria | 4035 |
| 491 | Ga0209677_100138 | 3300025253 | Bacteria | 67992 |
| 492 | Ga0209148_1001411 | 3300025254 | Bacteria | 12316 |
| 493 | Ga0209233_1001323 | 3300025261 | Bacteria | 9891 |
| 494 | Ga0209233_1008287 | 3300025261 | Bacteria | 3228 |
| 495 | Ga0207666_1000038 | 3300025271 | Bacteria | 26508 |
| 496 | Ga0207666_1001350 | 3300025271 | Bacteria | 2889 |
| 497 | Ga0207673_1000111 | 3300025290 | Bacteria | 7514 |
| 498 | Ga0209564_1000792 | 3300025295 | Bacteria | 43539 |
| 499 | Ga0209564_1005226 | 3300025295 | Bacteria | 7511 |
| 500 | Ga0209564_1010806 | 3300025295 | Bacteria | 4159 |
| 501 | Ga0209564_1020885 | 3300025295 | Bacteria | 2381 |
| 502 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 503 | Ga0209758_1000187 | 3300025297 | Bacteria | 138759 |
| 504 | Ga0209758_1015233 | 3300025297 | Bacteria | 4003 |
| 505 | Ga0207426_1000422 | 3300025302 | Bacteria | 69436 |
| 506 | Ga0207426_1004240 | 3300025302 | Bacteria | 7117 |
| 507 | Ga0209257_1002081 | 3300025304 | Bacteria | 21090 |
| 508 | Ga0207697_10001943 | 3300025315 | Bacteria | 10987 |
| 509 | Ga0207697_10010836 | 3300025315 | Bacteria | 3878 |
| 510 | Ga0207713_1027411 | 3300025735 | Bacteria | 2588 |
| 511 | Ga0207653_10003072 | 3300025885 | Bacteria | 5290 |
| 512 | Ga0207682_10000071 | 3300025893 | Bacteria | 44843 |
| 513 | Ga0207692_10004905 | 3300025898 | Bacteria | 5325 |
| 514 | Ga0207692_10038205 | 3300025898 | Bacteria | 2354 |
| 515 | Ga0207710_10006950 | 3300025900 | Bacteria | 4813 |
| 516 | Ga0207710_10010732 | 3300025900 | Bacteria | 3857 |
| 517 | Ga0207710_10030249 | 3300025900 | Bacteria | 2361 |
| 518 | Ga0207710_10039149 | 3300025900 | Bacteria | 2097 |
| 519 | Ga0207688_10001967 | 3300025901 | Bacteria | 11016 |
| 520 | Ga0207680_10008702 | 3300025903 | Bacteria | 4997 |
| 521 | Ga0207680_10060801 | 3300025903 | Bacteria | 2301 |
| 522 | Ga0207647_10001241 | 3300025904 | Bacteria | 19628 |
| 523 | Ga0207647_10021971 | 3300025904 | Bacteria | 4246 |
| 524 | Ga0207647_10024633 | 3300025904 | Bacteria | 3966 |
| 525 | Ga0207685_10003844 | 3300025905 | Bacteria | 3718 |
| 526 | Ga0207699_10015399 | 3300025906 | Bacteria | 3970 |
| 527 | Ga0207699_10020526 | 3300025906 | Bacteria | 3543 |
| 528 | Ga0207699_10047620 | 3300025906 | Bacteria | 2514 |
| 529 | Ga0207699_10133082 | 3300025906 | Bacteria | 1625 |
| 530 | Ga0207645_10000779 | 3300025907 | Bacteria | 26604 |
| 531 | Ga0207645_10091820 | 3300025907 | Bacteria | 1953 |
| 532 | Ga0207643_10000434 | 3300025908 | Bacteria | 27428 |
| 533 | Ga0207654_10000498 | 3300025911 | Bacteria | 22492 |
| 534 | Ga0207654_10016873 | 3300025911 | Bacteria | 3810 |
| 535 | Ga0207654_10115520 | 3300025911 | Bacteria | 1677 |
| 536 | Ga0207707_10000454 | 3300025912 | Bacteria | 42654 |
| 537 | Ga0207707_10008330 | 3300025912 | Bacteria | 8994 |
| 538 | Ga0207707_10018940 | 3300025912 | Bacteria | 6002 |
| 539 | Ga0207707_10035836 | 3300025912 | Bacteria | 4338 |
| 540 | Ga0207707_10058775 | 3300025912 | Bacteria | 3346 |
| 541 | Ga0207707_10226787 | 3300025912 | Bacteria | 1626 |
| 542 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 543 | Ga0207695_10008792 | 3300025913 | Bacteria | 12590 |
| 544 | Ga0207695_10042402 | 3300025913 | Bacteria | 4861 |
| 545 | Ga0207695_10122854 | 3300025913 | Bacteria | 2562 |
| 546 | Ga0207695_10300689 | 3300025913 | Bacteria | 1496 |
| 547 | Ga0207671_10012690 | 3300025914 | Bacteria | 6759 |
| 548 | Ga0207671_10046290 | 3300025914 | Bacteria | 3218 |
| 549 | Ga0207671_10154394 | 3300025914 | Bacteria | 1775 |
| 550 | Ga0207693_10018787 | 3300025915 | Bacteria | 5500 |
| 551 | Ga0207693_10019955 | 3300025915 | Bacteria | 5331 |
| 552 | Ga0207693_10037739 | 3300025915 | Bacteria | 3807 |
| 553 | Ga0207693_10056832 | 3300025915 | Bacteria | 3067 |
| 554 | Ga0207693_10132937 | 3300025915 | Bacteria | 1956 |
| 555 | Ga0207693_10297195 | 3300025915 | Bacteria | 1265 |
| 556 | Ga0207663_10018979 | 3300025916 | Bacteria | 3864 |
| 557 | Ga0207663_10033876 | 3300025916 | Bacteria | 3047 |
| 558 | Ga0207663_10067713 | 3300025916 | Bacteria | 2291 |
| 559 | Ga0207663_10084777 | 3300025916 | Bacteria | 2084 |
| 560 | Ga0207663_10109089 | 3300025916 | Bacteria | 1875 |
| 561 | Ga0207660_10000006 | 3300025917 | Bacteria | 106298 |
| 562 | Ga0207660_10008770 | 3300025917 | Bacteria | 6535 |
| 563 | Ga0207660_10202593 | 3300025917 | Bacteria | 1551 |
| 564 | Ga0207662_10003236 | 3300025918 | Bacteria | 8341 |
| 565 | Ga0207662_10009842 | 3300025918 | Bacteria | 5275 |
| 566 | Ga0207657_10007747 | 3300025919 | Bacteria | 10967 |
| 567 | Ga0207657_10012757 | 3300025919 | Bacteria | 8275 |
| 568 | Ga0207657_10016589 | 3300025919 | Bacteria | 7096 |
| 569 | Ga0207657_10027550 | 3300025919 | Bacteria | 5203 |
| 570 | Ga0207657_10033828 | 3300025919 | Bacteria | 4603 |
| 571 | Ga0207649_10000049 | 3300025920 | Bacteria | 109723 |
| 572 | Ga0207649_10212697 | 3300025920 | Bacteria | 1373 |
| 573 | Ga0207652_10024012 | 3300025921 | Bacteria | 5057 |
| 574 | Ga0207652_10088380 | 3300025921 | Bacteria | 2719 |
| 575 | Ga0207652_10177262 | 3300025921 | Bacteria | 1914 |
| 576 | Ga0207652_10197783 | 3300025921 | Bacteria | 1809 |
| 577 | Ga0207681_10000731 | 3300025923 | Bacteria | 21513 |
| 578 | Ga0207694_10000275 | 3300025924 | Bacteria | 48774 |
| 579 | Ga0207694_10071276 | 3300025924 | Bacteria | 2715 |
| 580 | Ga0207650_10000908 | 3300025925 | Bacteria | 22316 |
| 581 | Ga0207650_10018326 | 3300025925 | Bacteria | 4912 |
| 582 | Ga0207650_10117079 | 3300025925 | Bacteria | 2070 |
| 583 | Ga0207659_10000143 | 3300025926 | Bacteria | 42200 |
| 584 | Ga0207659_10113532 | 3300025926 | Bacteria | 2064 |
| 585 | Ga0207687_10000428 | 3300025927 | Bacteria | 28486 |
| 586 | Ga0207687_10040298 | 3300025927 | Bacteria | 3201 |
| 587 | Ga0207687_10058843 | 3300025927 | Bacteria | 2705 |
| 588 | Ga0207687_10257746 | 3300025927 | Bacteria | 1389 |
| 589 | Ga0207700_10006307 | 3300025928 | Bacteria | 7155 |
| 590 | Ga0207700_10068851 | 3300025928 | Bacteria | 2714 |
| 591 | Ga0207700_10201039 | 3300025928 | Bacteria | 1679 |
| 592 | Ga0207700_10212747 | 3300025928 | Bacteria | 1635 |
| 593 | Ga0207664_10073102 | 3300025929 | Bacteria | 2766 |
| 594 | Ga0207664_10106137 | 3300025929 | Bacteria | 2329 |
| 595 | Ga0207664_10234476 | 3300025929 | Bacteria | 1596 |
| 596 | Ga0207664_10333725 | 3300025929 | Bacteria | 1340 |
| 597 | Ga0207644_10002382 | 3300025931 | Bacteria | 12134 |
| 598 | Ga0207644_10008425 | 3300025931 | Bacteria | 6745 |
| 599 | Ga0207644_10046328 | 3300025931 | Bacteria | 3097 |
| 600 | Ga0207690_10005325 | 3300025932 | Bacteria | 7584 |
| 601 | Ga0207690_10006061 | 3300025932 | Bacteria | 7161 |
| 602 | Ga0207690_10112686 | 3300025932 | Bacteria | 1962 |
| 603 | Ga0207690_10150206 | 3300025932 | Bacteria | 1726 |
| 604 | Ga0207706_10001338 | 3300025933 | Bacteria | 24639 |
| 605 | Ga0207706_10014198 | 3300025933 | Bacteria | 7220 |
| 606 | Ga0207706_10030620 | 3300025933 | Bacteria | 4798 |
| 607 | Ga0207706_10082603 | 3300025933 | Bacteria | 2824 |
| 608 | Ga0207706_10111964 | 3300025933 | Bacteria | 2401 |
| 609 | Ga0207686_10000340 | 3300025934 | Bacteria | 33599 |
| 610 | Ga0207686_10015136 | 3300025934 | Bacteria | 4308 |
| 611 | Ga0207709_10003778 | 3300025935 | Bacteria | 8900 |
| 612 | Ga0207709_10105445 | 3300025935 | Bacteria | 1873 |
| 613 | Ga0207670_10000464 | 3300025936 | Bacteria | 22603 |
| 614 | Ga0207670_10019883 | 3300025936 | Bacteria | 4112 |
| 615 | Ga0207669_10000240 | 3300025937 | Bacteria | 24886 |
| 616 | Ga0207669_10059649 | 3300025937 | Bacteria | 2335 |
| 617 | Ga0207704_10000456 | 3300025938 | Bacteria | 18284 |
| 618 | Ga0207665_10001537 | 3300025939 | Bacteria | 15519 |
| 619 | Ga0207665_10041282 | 3300025939 | Bacteria | 3080 |
| 620 | Ga0207665_10201864 | 3300025939 | Bacteria | 1449 |
| 621 | Ga0207691_10006817 | 3300025940 | Bacteria | 11013 |
| 622 | Ga0207691_10014637 | 3300025940 | Bacteria | 7479 |
| 623 | Ga0207691_10019931 | 3300025940 | Bacteria | 6344 |
| 624 | Ga0207691_10066544 | 3300025940 | Bacteria | 3260 |
| 625 | Ga0207711_10001303 | 3300025941 | Bacteria | 23595 |
| 626 | Ga0207711_10021861 | 3300025941 | Bacteria | 5344 |
| 627 | Ga0207711_10035377 | 3300025941 | Bacteria | 4233 |
| 628 | Ga0207711_10068294 | 3300025941 | Bacteria | 3078 |
| 629 | Ga0207711_10087829 | 3300025941 | Bacteria | 2729 |
| 630 | Ga0207711_10114544 | 3300025941 | Bacteria | 2401 |
| 631 | Ga0207711_10283378 | 3300025941 | Bacteria | 1526 |
| 632 | Ga0207689_10000440 | 3300025942 | Bacteria | 38932 |
| 633 | Ga0207689_10126100 | 3300025942 | Bacteria | 2106 |
| 634 | Ga0207661_10000885 | 3300025944 | Bacteria | 19697 |
| 635 | Ga0207661_10000945 | 3300025944 | Bacteria | 19134 |
| 636 | Ga0207661_10043653 | 3300025944 | Bacteria | 3539 |
| 637 | Ga0207661_10124475 | 3300025944 | Bacteria | 2200 |
| 638 | Ga0207661_10181476 | 3300025944 | Bacteria | 1839 |
| 639 | Ga0207679_10000131 | 3300025945 | Bacteria | 61363 |
| 640 | Ga0207679_10019284 | 3300025945 | Bacteria | 4579 |
| 641 | Ga0207667_10021708 | 3300025949 | Bacteria | 7113 |
| 642 | Ga0207667_10027726 | 3300025949 | Bacteria | 6161 |
| 643 | Ga0207667_10064284 | 3300025949 | Bacteria | 3831 |
| 644 | Ga0207667_10072770 | 3300025949 | Bacteria | 3572 |
| 645 | Ga0207667_10105403 | 3300025949 | Bacteria | 2908 |
| 646 | Ga0207667_10190655 | 3300025949 | Bacteria | 2103 |
| 647 | Ga0207667_10222717 | 3300025949 | Bacteria | 1933 |
| 648 | Ga0207667_10280892 | 3300025949 | Bacteria | 1701 |
| 649 | Ga0207651_10017245 | 3300025960 | Bacteria | 4260 |
| 650 | Ga0207651_10069164 | 3300025960 | Bacteria | 2492 |
| 651 | Ga0207651_10100599 | 3300025960 | Bacteria | 2143 |
| 652 | Ga0207712_10010140 | 3300025961 | Bacteria | 5975 |
| 653 | Ga0207712_10027320 | 3300025961 | Bacteria | 3810 |
| 654 | Ga0207668_10000065 | 3300025972 | Bacteria | 86273 |
| 655 | Ga0207640_10000762 | 3300025981 | Bacteria | 18417 |
| 656 | Ga0207640_10077037 | 3300025981 | Bacteria | 2266 |
| 657 | Ga0207658_10001114 | 3300025986 | Bacteria | 21721 |
| 658 | Ga0207658_10047302 | 3300025986 | Bacteria | 3148 |
| 659 | Ga0207677_10001753 | 3300026023 | Bacteria | 11481 |
| 660 | Ga0207703_10000217 | 3300026035 | Bacteria | 66826 |
| 661 | Ga0207703_10014014 | 3300026035 | Bacteria | 6249 |
| 662 | Ga0207703_10033248 | 3300026035 | Bacteria | 4087 |
| 663 | Ga0207703_10094610 | 3300026035 | Bacteria | 2519 |
| 664 | Ga0207639_10008016 | 3300026041 | Bacteria | 7217 |
| 665 | Ga0207639_10097624 | 3300026041 | Bacteria | 2366 |
| 666 | Ga0207639_10110182 | 3300026041 | Bacteria | 2242 |
| 667 | Ga0207639_10209987 | 3300026041 | Bacteria | 1675 |
| 668 | Ga0207678_10000944 | 3300026067 | Bacteria | 26538 |
| 669 | Ga0207678_10005274 | 3300026067 | Bacteria | 11576 |
| 670 | Ga0207678_10013610 | 3300026067 | Bacteria | 7147 |
| 671 | Ga0207678_10018969 | 3300026067 | Bacteria | 6042 |
| 672 | Ga0207678_10020774 | 3300026067 | Bacteria | 5756 |
| 673 | Ga0207678_10025054 | 3300026067 | Bacteria | 5209 |
| 674 | Ga0207678_10043863 | 3300026067 | Bacteria | 3869 |
| 675 | Ga0207708_10005368 | 3300026075 | Bacteria | 9444 |
| 676 | Ga0207708_10027519 | 3300026075 | Bacteria | 4304 |
| 677 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 678 | Ga0207702_10000854 | 3300026078 | Bacteria | 31830 |
| 679 | Ga0207702_10003744 | 3300026078 | Bacteria | 13741 |
| 680 | Ga0207702_10107934 | 3300026078 | Bacteria | 2469 |
| 681 | Ga0207641_10001313 | 3300026088 | Bacteria | 24577 |
| 682 | Ga0207641_10014435 | 3300026088 | Bacteria | 6472 |
| 683 | Ga0207641_10034442 | 3300026088 | Bacteria | 4213 |
| 684 | Ga0207641_10165979 | 3300026088 | Bacteria | 2011 |
| 685 | Ga0207648_10011217 | 3300026089 | Bacteria | 8450 |
| 686 | Ga0207648_10052763 | 3300026089 | Bacteria | 3555 |
| 687 | Ga0207648_10105082 | 3300026089 | Bacteria | 2477 |
| 688 | Ga0207676_10002017 | 3300026095 | Bacteria | 14776 |
| 689 | Ga0207676_10007816 | 3300026095 | Bacteria | 7606 |
| 690 | Ga0207674_10000331 | 3300026116 | Bacteria | 60301 |
| 691 | Ga0207674_10002364 | 3300026116 | Bacteria | 23847 |
| 692 | Ga0207674_10002526 | 3300026116 | Bacteria | 23063 |
| 693 | Ga0207674_10159944 | 3300026116 | Bacteria | 2207 |
| 694 | Ga0207674_10165571 | 3300026116 | Bacteria | 2165 |
| 695 | Ga0207675_100012773 | 3300026118 | Bacteria | 7845 |
| 696 | Ga0207675_100031017 | 3300026118 | Bacteria | 4978 |
| 697 | Ga0207675_100100344 | 3300026118 | Bacteria | 2727 |
| 698 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 699 | Ga0207683_10009425 | 3300026121 | Bacteria | 8320 |
| 700 | Ga0207683_10011706 | 3300026121 | Bacteria | 7489 |
| 701 | Ga0207683_10152480 | 3300026121 | Bacteria | 2086 |
| 702 | Ga0207698_10079451 | 3300026142 | Bacteria | 2638 |
| 703 | Ga0209389_1000003 | 3300027296 | Bacteria | 268927 |
| 704 | Ga0209389_1000126 | 3300027296 | Bacteria | 67848 |
| 705 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 706 | Ga0209589_1000209 | 3300027357 | Bacteria | 69389 |
| 707 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 708 | Ga0209489_100022 | 3300027361 | Bacteria | 202016 |
| 709 | Ga0209489_100144 | 3300027361 | Bacteria | 106729 |
| 710 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 711 | Ga0209700_100023 | 3300027363 | Bacteria | 229662 |
| 712 | Ga0209999_1007703 | 3300027543 | Bacteria | 1937 |
| 713 | Ga0209982_1001558 | 3300027552 | Bacteria | 3149 |
| 714 | Ga0210002_1004248 | 3300027617 | Bacteria | 2126 |
| 715 | Ga0209971_1017847 | 3300027682 | Bacteria | 1683 |
| 716 | Ga0209966_1002020 | 3300027695 | Bacteria | 3395 |
| 717 | Ga0209813_10014707 | 3300027866 | Bacteria | 2111 |
| 718 | Ga0209813_10016556 | 3300027866 | Bacteria | 2013 |
| 719 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 720 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 721 | Ga0207428_10000289 | 3300027907 | Bacteria | 67465 |
| 722 | Ga0268266_10009846 | 3300028379 | Bacteria | 8403 |
| 723 | Ga0268266_10033448 | 3300028379 | Bacteria | 4370 |
| 724 | Ga0268266_10050734 | 3300028379 | Bacteria | 3560 |
| 725 | Ga0268266_10159492 | 3300028379 | Bacteria | 2040 |
| 726 | Ga0268266_10235769 | 3300028379 | Bacteria | 1687 |
| 727 | Ga0268265_10004222 | 3300028380 | Bacteria | 10036 |
| 728 | Ga0268265_10018419 | 3300028380 | Bacteria | 4838 |
| 729 | Ga0268264_10000096 | 3300028381 | Bacteria | 230188 |
| 730 | Ga0268264_10067578 | 3300028381 | Bacteria | 3017 |
| 731 | Ga0268264_10123826 | 3300028381 | Bacteria | 2282 |
| 732 | Ga0268264_10324733 | 3300028381 | Bacteria | 1456 |
| 733 | Ga0268264_10467745 | 3300028381 | Bacteria | 1224 |
| 734 | Ga0265337_1007261 | 3300028556 | Bacteria | 4159 |
| 735 | Ga0265319_1015026 | 3300028563 | Bacteria | 3017 |
| 736 | Ga0265323_10000788 | 3300028653 | Bacteria | 16961 |
| 737 | Ga0265336_10005161 | 3300028666 | Bacteria | 4854 |
| 738 | Ga0307517_10000315 | 3300028786 | Bacteria | 84020 |
| 739 | Ga0307515_10018508 | 3300028794 | Bacteria | 12594 |
| 740 | Ga0265338_10001265 | 3300028800 | Bacteria | 41690 |
| 741 | Ga0265338_10037858 | 3300028800 | Bacteria | 4580 |
| 742 | Ga0265338_10171689 | 3300028800 | Bacteria | 1662 |
| 743 | Ga0265324_10006833 | 3300029957 | Bacteria | 4703 |
| 744 | Ga0265330_10037409 | 3300031235 | Bacteria | 2161 |
| 745 | Ga0265330_10039666 | 3300031235 | Bacteria | 2092 |
| 746 | Ga0265332_10002650 | 3300031238 | Bacteria | 8989 |
| 747 | Ga0265325_10002126 | 3300031241 | Bacteria | 13522 |
| 748 | Ga0265325_10003615 | 3300031241 | Bacteria | 10034 |
| 749 | Ga0265325_10006932 | 3300031241 | Bacteria | 6838 |
| 750 | Ga0265325_10012689 | 3300031241 | Bacteria | 4812 |
| 751 | Ga0265325_10024274 | 3300031241 | Bacteria | 3300 |
| 752 | Ga0265325_10058055 | 3300031241 | Bacteria | 1972 |
| 753 | Ga0265325_10090525 | 3300031241 | Bacteria | 1509 |
| 754 | Ga0265340_10000765 | 3300031247 | Bacteria | 18294 |
| 755 | Ga0265340_10015947 | 3300031247 | Bacteria | 3896 |
| 756 | Ga0265340_10018100 | 3300031247 | Bacteria | 3638 |
| 757 | Ga0265340_10030594 | 3300031247 | Bacteria | 2697 |
| 758 | Ga0265339_10000158 | 3300031249 | Bacteria | 56155 |
| 759 | Ga0265339_10003907 | 3300031249 | Bacteria | 10317 |
| 760 | Ga0265339_10011755 | 3300031249 | Bacteria | 5372 |
| 761 | Ga0265339_10024234 | 3300031249 | Bacteria | 3500 |
| 762 | Ga0265339_10034700 | 3300031249 | Bacteria | 2833 |
| 763 | Ga0265339_10061601 | 3300031249 | Bacteria | 2019 |
| 764 | Ga0265339_10075589 | 3300031249 | Bacteria | 1788 |
| 765 | Ga0265331_10032161 | 3300031250 | Bacteria | 2602 |
| 766 | Ga0265331_10034472 | 3300031250 | Bacteria | 2497 |
| 767 | Ga0265331_10063434 | 3300031250 | Bacteria | 1741 |
| 768 | Ga0265316_10011375 | 3300031344 | Bacteria | 8031 |
| 769 | Ga0265316_10041390 | 3300031344 | Bacteria | 3688 |
| 770 | Ga0265316_10096701 | 3300031344 | Bacteria | 2248 |
| 771 | Ga0265316_10113638 | 3300031344 | Bacteria | 2049 |
| 772 | Ga0265316_10167878 | 3300031344 | Bacteria | 1638 |
| 773 | Ga0307513_10033286 | 3300031456 | Bacteria | 5794 |
| 774 | Ga0307408_100007113 | 3300031548 | Bacteria | 7407 |
| 775 | Ga0265313_10000027 | 3300031595 | Bacteria | 133281 |
| 776 | Ga0265313_10000426 | 3300031595 | Bacteria | 45023 |
| 777 | Ga0265313_10014337 | 3300031595 | Bacteria | 4688 |
| 778 | Ga0265313_10019090 | 3300031595 | Bacteria | 3831 |
| 779 | Ga0265313_10048917 | 3300031595 | Bacteria | 2037 |
| 780 | Ga0307508_10048516 | 3300031616 | Bacteria | 3782 |
| 781 | Ga0316575_10015584 | 3300031665 | Bacteria | 2867 |
| 782 | Ga0316579_10003798 | 3300031691 | Bacteria | 5948 |
| 783 | Ga0316579_10107757 | 3300031691 | Bacteria | 1336 |
| 784 | Ga0265314_10004473 | 3300031711 | Bacteria | 12962 |
| 785 | Ga0265314_10010907 | 3300031711 | Bacteria | 7551 |
| 786 | Ga0265314_10027160 | 3300031711 | Bacteria | 4289 |
| 787 | Ga0265342_10000093 | 3300031712 | Bacteria | 98424 |
| 788 | Ga0265342_10000761 | 3300031712 | Bacteria | 32930 |
| 789 | Ga0265342_10028573 | 3300031712 | Bacteria | 3472 |
| 790 | Ga0265342_10068055 | 3300031712 | Bacteria | 2082 |
| 791 | Ga0307409_100240406 | 3300031995 | Bacteria | 1648 |
| 792 | Ga0307416_100436891 | 3300032002 | Bacteria | 1358 |
| 793 | Ga0373948_0000360 | 3300034817 | Bacteria | 5607 |
| 794 | Ga0373948_0005292 | 3300034817 | Bacteria | 2084 |
| 795 | Ga0373950_0000868 | 3300034818 | Bacteria | 3801 |
| 796 | Ga0373958_0000309 | 3300034819 | Bacteria | 5887 |
| 797 | Ga0373938_0000238 | 3300034957 | Bacteria | 8590 |
| 798 | Ga0373938_0001315 | 3300034957 | Bacteria | 3990 |
| 799 | Ga0373926_0003404 | 3300035083 | Bacteria | 5126 |
| 800 | Ga0373926_0009583 | 3300035083 | Bacteria | 3235 |
| 801 | Ga0373928_0001415 | 3300035084 | Bacteria | 4681 |
| 802 | Ga0373928_0016122 | 3300035084 | Bacteria | 1526 |
| 803 | Ga0373929_0001680 | 3300035085 | Bacteria | 4177 |
| 804 | Ga0373934_0018659 | 3300035086 | Bacteria | 2656 |
| 805 | Ga0373940_0007476 | 3300035088 | Bacteria | 2467 |
| 806 | Ga0373940_0012269 | 3300035088 | Bacteria | 2050 |
| 807 | Ga0373949_0002060 | 3300035090 | Bacteria | 5325 |
| 808 | Ga0373949_0002127 | 3300035090 | Bacteria | 5207 |
| 809 | Ga0373951_0000607 | 3300035091 | Bacteria | 9857 |
| 810 | Ga0373951_0004013 | 3300035091 | Bacteria | 3527 |
| 811 | Ga0373952_0000334 | 3300035092 | Bacteria | 7960 |
| 812 | Ga0373952_0000549 | 3300035092 | Bacteria | 6606 |
| 813 | Ga0373952_0001719 | 3300035092 | Bacteria | 3985 |
| 814 | Ga0373923_0005521 | 3300035111 | Bacteria | 4298 |
| 815 | Ga0373923_0057269 | 3300035111 | Bacteria | 1648 |
| 816 | Ga0373923_0057850 | 3300035111 | Bacteria | 1640 |
| 817 | Ga0373923_0064335 | 3300035111 | Bacteria | 1564 |
| 818 | Ga0373932_0001896 | 3300035112 | Bacteria | 5588 |
| 819 | Ga0373936_0015253 | 3300035113 | Bacteria | 2943 |
| 820 | Ga0373939_0001870 | 3300035114 | Bacteria | 5027 |
| 821 | Ga0373939_0016894 | 3300035114 | Bacteria | 1930 |
| 822 | Ga0373941_0000803 | 3300035115 | Bacteria | 6459 |
| 823 | Ga0373941_0000977 | 3300035115 | Bacteria | 5917 |
| 824 | Ga0373941_0032082 | 3300035115 | Bacteria | 1570 |
| 825 | Ga0373945_0004003 | 3300035116 | Bacteria | 4660 |
| 826 | Ga0373945_0012819 | 3300035116 | Bacteria | 2790 |
| 827 | Ga0373945_0028606 | 3300035116 | Bacteria | 1953 |
| 828 | Ga0373945_0031233 | 3300035116 | Bacteria | 1881 |
| 829 | Ga0373953_0001305 | 3300035117 | Bacteria | 7138 |
| 830 | Ga0373953_0011755 | 3300035117 | Bacteria | 3083 |
| 831 | Ga0373953_0030857 | 3300035117 | Bacteria | 2081 |
| 832 | Ga0373953_0064333 | 3300035117 | Bacteria | 1504 |
| 833 | Ga0373954_0016151 | 3300035118 | Bacteria | 3340 |
| 834 | Ga0373954_0018425 | 3300035118 | Bacteria | 3143 |
| 835 | Ga0373954_0070277 | 3300035118 | Bacteria | 1663 |
| 836 | Ga0373956_0004249 | 3300035119 | Bacteria | 5753 |
| 837 | Ga0373956_0004598 | 3300035119 | Bacteria | 5515 |
| 838 | Ga0373956_0032556 | 3300035119 | Bacteria | 2287 |
| 839 | Ga0373956_0057893 | 3300035119 | Bacteria | 1752 |
| 840 | Ga0373956_0067231 | 3300035119 | Bacteria | 1631 |
| 841 | Ga0373957_0000689 | 3300035120 | Bacteria | 8721 |
| 842 | Ga0373957_0014655 | 3300035120 | Bacteria | 2684 |
| 843 | Ga0373957_0019954 | 3300035120 | Bacteria | 2364 |
| 844 | Ga0373957_0039688 | 3300035120 | Bacteria | 1767 |
| 845 | Ga0373960_0001746 | 3300035121 | Bacteria | 4866 |
| 846 | Ga0373943_0000476 | 3300035170 | Bacteria | 17084 |
| 847 | Ga0373943_0003076 | 3300035170 | Bacteria | 7576 |
| 848 | Ga0373943_0008345 | 3300035170 | Bacteria | 4649 |
| 849 | Ga0373943_0011759 | 3300035170 | Bacteria | 3939 |
| 850 | Ga0373943_0050791 | 3300035170 | Bacteria | 2039 |
| 851 | Ga0373946_0005522 | 3300035171 | Bacteria | 4560 |
| 852 | Ga0373946_0019699 | 3300035171 | Bacteria | 2602 |
| 853 | Ga0373946_0026198 | 3300035171 | Bacteria | 2298 |
| 854 | Ga0373946_0028471 | 3300035171 | Bacteria | 2216 |
| 855 | Ga0373955_0000213 | 3300035172 | Bacteria | 24300 |
| 856 | Ga0373955_0017485 | 3300035172 | Bacteria | 3551 |
| 857 | Ga0373955_0056656 | 3300035172 | Bacteria | 2150 |
| 858 | Ga0373942_0002320 | 3300035207 | Bacteria | 4647 |
| 859 | Ga0373942_0003894 | 3300035207 | Bacteria | 3491 |
| 860 | Ga0373942_0011273 | 3300035207 | Bacteria | 2119 |
| 861 | Ga0373961_0005873 | 3300035241 | Bacteria | 2949 |
| 862 | Ga0373962_0000684 | 3300035242 | Bacteria | 7658 |
| 863 | Ga0373962_0004790 | 3300035242 | Bacteria | 3266 |
| 864 | Ga0316574_0007201 | 3300035398 | Bacteria | 6080 |
| 865 | Ga0316574_0065256 | 3300035398 | Bacteria | 2292 |
| 866 | Ga0373924_0000686 | 3300035410 | Bacteria | 10535 |
| 867 | Ga0373924_0023112 | 3300035410 | Bacteria | 2435 |
| 868 | Ga0373931_0000832 | 3300035691 | Bacteria | 12966 |
| 869 | Ga0373931_0008912 | 3300035691 | Bacteria | 4780 |
| 870 | Ga0373931_0016415 | 3300035691 | Bacteria | 3643 |
| 871 | Ga0373935_0000131 | 3300035692 | Bacteria | 34019 |
| 872 | Ga0373935_0005953 | 3300035692 | Bacteria | 7233 |
| 873 | Ga0373935_0008740 | 3300035692 | Bacteria | 6069 |
| 874 | Ga0373935_0015233 | 3300035692 | Bacteria | 4645 |
| 875 | Ga0373935_0050879 | 3300035692 | Bacteria | 2630 |
| 876 | Ga0373935_0073906 | 3300035692 | Bacteria | 2203 |
| 877 | Ga0373935_0099940 | 3300035692 | Bacteria | 1911 |
| 878 | Ga0373935_0195985 | 3300035692 | Bacteria | 1393 |
| 879 | Ga0373927_0001598 | 3300035695 | Bacteria | 16984 |
| 880 | Ga0373927_0013741 | 3300035695 | Bacteria | 5375 |
| 881 | Ga0373927_0014431 | 3300035695 | Bacteria | 5228 |
| 882 | Ga0373927_0025227 | 3300035695 | Bacteria | 3885 |
| 883 | Ga0373927_0026721 | 3300035695 | Bacteria | 3772 |
| 884 | Ga0373927_0032564 | 3300035695 | Bacteria | 3395 |
| 885 | Ga0373933_0004580 | 3300035724 | Bacteria | 7571 |
| 886 | Ga0373933_0014822 | 3300035724 | Bacteria | 4337 |
| 887 | Ga0373933_0018214 | 3300035724 | Bacteria | 3947 |
| 888 | Ga0373933_0050042 | 3300035724 | Bacteria | 2493 |
| 889 | Ga0373947_0001677 | 3300035725 | Bacteria | 13553 |
| 890 | Ga0373947_0002287 | 3300035725 | Bacteria | 11579 |
| 891 | Ga0373947_0002523 | 3300035725 | Bacteria | 11003 |
| 892 | Ga0373947_0013576 | 3300035725 | Bacteria | 4666 |
| 893 | Ga0373947_0015845 | 3300035725 | Bacteria | 4330 |
| 894 | Ga0373947_0028815 | 3300035725 | Bacteria | 3256 |
| 895 | Ga0373947_0098428 | 3300035725 | Bacteria | 1835 |
| 896 | Ga0373947_0105141 | 3300035725 | Bacteria | 1778 |
| 897 | Ga0373947_0107546 | 3300035725 | Bacteria | 1759 |
| 898 | Ga0373937_0000293 | 3300036401 | Bacteria | 47507 |
| 899 | Ga0373937_0000907 | 3300036401 | Bacteria | 25212 |
| 900 | Ga0373937_0001336 | 3300036401 | Bacteria | 20629 |
| 901 | Ga0373937_0020586 | 3300036401 | Bacteria | 5914 |
| 902 | Ga0373937_0024713 | 3300036401 | Bacteria | 5421 |
| 903 | Ga0373937_0026411 | 3300036401 | Bacteria | 5247 |
| 904 | Ga0373937_0041608 | 3300036401 | Bacteria | 4191 |
| 905 | Ga0373937_0052057 | 3300036401 | Bacteria | 3753 |
| 906 | Ga0373937_0067560 | 3300036401 | Bacteria | 3294 |
| 907 | Ga0373937_0074856 | 3300036401 | Bacteria | 3125 |
| 908 | Ga0316582_0134982 | 3300036647 | Bacteria | 1660 |
| 909 | Ga0316584_0014165 | 3300036712 | Bacteria | 5667 |
| 910 | Ga0316584_0016716 | 3300036712 | Bacteria | 5264 |
| 911 | Ga0373925_0000087 | 3300037068 | Bacteria | 99043 |
| 912 | Ga0373925_0007402 | 3300037068 | Bacteria | 8010 |
| 913 | Ga0373925_0008544 | 3300037068 | Bacteria | 7462 |
| 914 | Ga0373925_0009531 | 3300037068 | Bacteria | 7069 |
| 915 | Ga0373925_0013371 | 3300037068 | Bacteria | 5939 |
| 916 | Ga0373925_0014125 | 3300037068 | Bacteria | 5779 |
| 917 | Ga0373925_0016683 | 3300037068 | Bacteria | 5318 |
| 918 | Ga0373925_0053411 | 3300037068 | Bacteria | 3020 |
| 919 | Ga0373925_0079028 | 3300037068 | Bacteria | 2498 |
| 920 | Ga0373925_0087648 | 3300037068 | Bacteria | 2376 |
| 921 | Ga0373925_0134921 | 3300037068 | Bacteria | 1928 |
| 922 | Ga0395899_0013310 | 3300037312 | Bacteria | 6293 |
| 923 | Ga0395900_0015919 | 3300037418 | Bacteria | 7662 |
| 924 | Ga0395900_0024496 | 3300037418 | Bacteria | 6180 |
| 925 | Ga0395900_0028027 | 3300037418 | Bacteria | 5767 |
| 926 | Ga0395900_0044317 | 3300037418 | Bacteria | 4584 |
| 927 | Ga0395900_0139623 | 3300037418 | Bacteria | 2482 |
| 928 | Ga0395900_0280832 | 3300037418 | Bacteria | 1657 |
| 929 | Ga0395898_0030804 | 3300037466 | Bacteria | 5366 |
| 930 | Ga0395898_0046786 | 3300037466 | Bacteria | 4249 |
| 931 | Ga0395898_0051497 | 3300037466 | Bacteria | 4026 |
| 932 | Ga0395898_0136672 | 3300037466 | Bacteria | 2347 |
| 933 | Ga0395898_0141147 | 3300037466 | Bacteria | 2306 |
| 934 | Ga0395905_0210773 | 3300037471 | Bacteria | 1820 |
| 935 | Ga0436364_1105330 | 3300037853 | Bacteria | 5632 |
| 936 | Ga0436364_1228736 | 3300037853 | Bacteria | 4750 |
| 937 | Ga0436364_1346974 | 3300037853 | Bacteria | 3423 |
| 938 | Ga0395901_0017419 | 3300038443 | Bacteria | 7334 |
| 939 | Ga0395901_0045424 | 3300038443 | Bacteria | 4558 |
| 940 | Ga0400488_27481 | 3300038741 | Bacteria | 1563 |
| 941 | Ga0400486_05920 | 3300038742 | Bacteria | 1718 |
| 942 | Ga0436365_0156475 | 3300039437 | Bacteria | 37868 |
| 943 | Ga0436365_0352932 | 3300039437 | Bacteria | 2187 |
| 944 | Ga0436365_0356842 | 3300039437 | Bacteria | 18396 |
| 945 | Ga0436365_0621937 | 3300039437 | Bacteria | 2046 |
| 946 | Ga0436365_1392756 | 3300039437 | Bacteria | 4163 |
| 947 | Ga0436361_0721014 | 3300039447 | Bacteria | 1338 |
| 948 | Ga0436363_0077061 | 3300039450 | Bacteria | 9960 |
| 949 | Ga0436363_0538450 | 3300039450 | Bacteria | 22269 |
| 950 | Ga0436363_1324669 | 3300039450 | Bacteria | 1905 |
| 951 | Ga0436363_1434115 | 3300039450 | Bacteria | 1632 |
| 952 | Ga0436363_1520052 | 3300039450 | Bacteria | 6158 |
| 953 | Ga0436362_0582461 | 3300039453 | Bacteria | 7924 |
| 954 | Ga0436362_0668050 | 3300039453 | Bacteria | 5148 |
| 955 | Ga0439453_0002956 | 3300041408 | Bacteria | 2400 |
| 956 | Ga0439465_0007239 | 3300041413 | Bacteria | 3527 |
| 957 | Ga0439448_0053025 | 3300042005 | Bacteria | 1330 |
| 958 | Ga0439450_005169 | 3300042008 | Bacteria | 2279 |
| 959 | Ga0439455_0005312 | 3300042012 | Bacteria | 2609 |
| 960 | Ga0439463_004402 | 3300042016 | Bacteria | 3532 |
| 961 | Ga0439435_0002684 | 3300042436 | Bacteria | 3577 |
| 962 | Ga0439464_0003806 | 3300042439 | Bacteria | 3835 |
| 963 | Ga0439440_0007885 | 3300042993 | Bacteria | 2174 |
| 964 | Ga0466969_0031674 | 3300044656 | Bacteria | 2691 |
| 965 | Ga0466965_0091243 | 3300044683 | Bacteria | 1550 |
| 966 | Ga0466966_0000524 | 3300044684 | Bacteria | 24457 |
| 967 | Ga0466966_0036712 | 3300044684 | Bacteria | 3163 |
| 968 | Ga0466961_0000795 | 3300044693 | Bacteria | 19721 |
| 969 | Ga0466963_0020679 | 3300044694 | Bacteria | 4141 |
| 970 | Ga0466963_0083566 | 3300044694 | Bacteria | 2165 |
| 971 | Ga0453684_0030479 | 3300044712 | Bacteria | 7619 |
| 972 | Ga0466971_0081638 | 3300044719 | Bacteria | 1475 |
| 973 | Ga0466971_0114284 | 3300044719 | Bacteria | 1247 |
| 974 | Ga0451576_0064931 | 3300045051 | Bacteria | 3801 |
| 975 | Ga0466967_0033042 | 3300045976 | Bacteria | 4376 |
| 976 | Ga0466967_0198851 | 3300045976 | Bacteria | 1897 |
| 977 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 978 | Ga0495592_0001841 | 3300046454 | Bacteria | 14911 |
| 979 | Ga0495592_0013967 | 3300046454 | Bacteria | 6099 |
| 980 | Ga0495592_0033557 | 3300046454 | Bacteria | 3870 |
| 981 | Ga0495592_0060163 | 3300046454 | Bacteria | 2794 |
| 982 | Ga0495592_0122353 | 3300046454 | Bacteria | 1829 |
| 983 | Ga0495603_0001190 | 3300046455 | Bacteria | 15171 |
| 984 | Ga0495603_0009828 | 3300046455 | Bacteria | 5789 |
| 985 | Ga0495603_0012015 | 3300046455 | Bacteria | 5242 |
| 986 | Ga0495603_0035241 | 3300046455 | Bacteria | 3006 |
| 987 | Ga0495603_0050838 | 3300046455 | Bacteria | 2464 |
| 988 | Ga0495603_0081354 | 3300046455 | Bacteria | 1898 |
| 989 | Ga0495603_0084110 | 3300046455 | Bacteria | 1863 |
| 990 | Ga0495590_0054329 | 3300046457 | Bacteria | 1399 |
| 991 | Ga0495629_0001140 | 3300046459 | Bacteria | 20980 |
| 992 | Ga0495629_0001999 | 3300046459 | Bacteria | 15839 |
| 993 | Ga0495629_0002775 | 3300046459 | Bacteria | 13386 |
| 994 | Ga0495629_0004187 | 3300046459 | Bacteria | 10830 |
| 995 | Ga0495629_0010498 | 3300046459 | Bacteria | 6737 |
| 996 | Ga0495629_0012888 | 3300046459 | Bacteria | 6047 |
| 997 | Ga0495629_0079117 | 3300046459 | Bacteria | 2295 |
| 998 | Ga0495629_0176388 | 3300046459 | Bacteria | 1482 |
| 999 | Ga0495638_0099888 | 3300046460 | Bacteria | 1736 |
| 1000 | Ga0495641_0010906 | 3300046461 | Bacteria | 5222 |
| 1001 | Ga0495641_0015118 | 3300046461 | Bacteria | 4142 |
| 1002 | Ga0495651_0001352 | 3300046462 | Bacteria | 18966 |
| 1003 | Ga0495651_0001675 | 3300046462 | Bacteria | 17143 |
| 1004 | Ga0495651_0004254 | 3300046462 | Bacteria | 10975 |
| 1005 | Ga0495651_0011156 | 3300046462 | Bacteria | 6909 |
| 1006 | Ga0495651_0011201 | 3300046462 | Bacteria | 6892 |
| 1007 | Ga0495651_0050646 | 3300046462 | Bacteria | 3203 |
| 1008 | Ga0495651_0055722 | 3300046462 | Bacteria | 3037 |
| 1009 | Ga0495651_0079504 | 3300046462 | Bacteria | 2478 |
| 1010 | Ga0495651_0145529 | 3300046462 | Bacteria | 1714 |
| 1011 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 1012 | Ga0495653_0002480 | 3300046463 | Bacteria | 14680 |
| 1013 | Ga0495653_0015503 | 3300046463 | Bacteria | 6211 |
| 1014 | Ga0495653_0024482 | 3300046463 | Bacteria | 4864 |
| 1015 | Ga0495653_0028470 | 3300046463 | Bacteria | 4467 |
| 1016 | Ga0495653_0031990 | 3300046463 | Bacteria | 4180 |
| 1017 | Ga0495653_0073254 | 3300046463 | Bacteria | 2556 |
| 1018 | Ga0495653_0132237 | 3300046463 | Bacteria | 1765 |
| 1019 | Ga0495653_0166647 | 3300046463 | Bacteria | 1524 |
| 1020 | Ga0495580_0001797 | 3300046472 | Bacteria | 18844 |
| 1021 | Ga0495580_0007274 | 3300046472 | Bacteria | 8902 |
| 1022 | Ga0495580_0055036 | 3300046472 | Bacteria | 2804 |
| 1023 | Ga0495580_0060482 | 3300046472 | Bacteria | 2661 |
| 1024 | Ga0495582_0000379 | 3300046473 | Bacteria | 24152 |
| 1025 | Ga0495582_0001266 | 3300046473 | Bacteria | 14206 |
| 1026 | Ga0495582_0015534 | 3300046473 | Bacteria | 4182 |
| 1027 | Ga0495582_0016954 | 3300046473 | Bacteria | 3988 |
| 1028 | Ga0495582_0017780 | 3300046473 | Bacteria | 3886 |
| 1029 | Ga0495582_0040384 | 3300046473 | Bacteria | 2570 |
| 1030 | Ga0495582_0070927 | 3300046473 | Bacteria | 1928 |
| 1031 | Ga0495582_0125974 | 3300046473 | Bacteria | 1445 |
| 1032 | Ga0495639_0001456 | 3300046475 | Bacteria | 10575 |
| 1033 | Ga0495639_0005394 | 3300046475 | Bacteria | 5505 |
| 1034 | Ga0495639_0016315 | 3300046475 | Bacteria | 3223 |
| 1035 | Ga0495639_0019184 | 3300046475 | Bacteria | 2983 |
| 1036 | Ga0495662_0000546 | 3300046476 | Bacteria | 17257 |
| 1037 | Ga0495662_0000957 | 3300046476 | Bacteria | 14125 |
| 1038 | Ga0495662_0002259 | 3300046476 | Bacteria | 9706 |
| 1039 | Ga0495662_0011084 | 3300046476 | Bacteria | 4404 |
| 1040 | Ga0495662_0048054 | 3300046476 | Bacteria | 2060 |
| 1041 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 1042 | Ga0495664_0004745 | 3300046477 | Bacteria | 7431 |
| 1043 | Ga0495664_0017355 | 3300046477 | Bacteria | 4113 |
| 1044 | Ga0495664_0038399 | 3300046477 | Bacteria | 2827 |
| 1045 | Ga0495664_0047781 | 3300046477 | Bacteria | 2540 |
| 1046 | Ga0495664_0104693 | 3300046477 | Bacteria | 1705 |
| 1047 | Ga0495664_0152003 | 3300046477 | Bacteria | 1404 |
| 1048 | Ga0495664_0186930 | 3300046477 | Bacteria | 1256 |
| 1049 | Ga0495584_0126509 | 3300046491 | Bacteria | 1296 |
| 1050 | Ga0495584_0140992 | 3300046491 | Bacteria | 1224 |
| 1051 | Ga0495585_0006641 | 3300046492 | Bacteria | 7150 |
| 1052 | Ga0495594_0000628 | 3300046499 | Bacteria | 18193 |
| 1053 | Ga0495594_0003379 | 3300046499 | Bacteria | 8250 |
| 1054 | Ga0495594_0012022 | 3300046499 | Bacteria | 4506 |
| 1055 | Ga0495594_0014248 | 3300046499 | Bacteria | 4162 |
| 1056 | Ga0495594_0036536 | 3300046499 | Bacteria | 2679 |
| 1057 | Ga0495607_0008588 | 3300046501 | Bacteria | 6974 |
| 1058 | Ga0495607_0020117 | 3300046501 | Bacteria | 4225 |
| 1059 | Ga0495608_0000066 | 3300046511 | Bacteria | 81664 |
| 1060 | Ga0495608_0000442 | 3300046511 | Bacteria | 28963 |
| 1061 | Ga0495608_0008363 | 3300046511 | Bacteria | 7254 |
| 1062 | Ga0495608_0023088 | 3300046511 | Bacteria | 4264 |
| 1063 | Ga0495608_0027103 | 3300046511 | Bacteria | 3901 |
| 1064 | Ga0495608_0154623 | 3300046511 | Bacteria | 1460 |
| 1065 | Ga0495610_0015826 | 3300046512 | Bacteria | 4366 |
| 1066 | Ga0495616_0007418 | 3300046513 | Bacteria | 6563 |
| 1067 | Ga0495616_0091344 | 3300046513 | Bacteria | 1441 |
| 1068 | Ga0495618_0000021 | 3300046514 | Bacteria | 129750 |
| 1069 | Ga0495618_0002560 | 3300046514 | Bacteria | 11655 |
| 1070 | Ga0495618_0002632 | 3300046514 | Bacteria | 11483 |
| 1071 | Ga0495618_0004146 | 3300046514 | Bacteria | 8948 |
| 1072 | Ga0495618_0011384 | 3300046514 | Bacteria | 5393 |
| 1073 | Ga0495618_0038302 | 3300046514 | Bacteria | 3012 |
| 1074 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 1075 | Ga0495628_0003222 | 3300046516 | Bacteria | 14635 |
| 1076 | Ga0495628_0011329 | 3300046516 | Bacteria | 7547 |
| 1077 | Ga0495628_0111604 | 3300046516 | Bacteria | 2102 |
| 1078 | Ga0495628_0128179 | 3300046516 | Bacteria | 1943 |
| 1079 | Ga0495630_0000254 | 3300046517 | Bacteria | 43049 |
| 1080 | Ga0495630_0002564 | 3300046517 | Bacteria | 12597 |
| 1081 | Ga0495630_0039762 | 3300046517 | Bacteria | 3516 |
| 1082 | Ga0495630_0057574 | 3300046517 | Bacteria | 2913 |
| 1083 | Ga0495630_0092975 | 3300046517 | Bacteria | 2279 |
| 1084 | Ga0495630_0179692 | 3300046517 | Bacteria | 1613 |
| 1085 | Ga0495630_0219843 | 3300046517 | Bacteria | 1450 |
| 1086 | Ga0495630_0266997 | 3300046517 | Bacteria | 1307 |
| 1087 | Ga0495631_0052300 | 3300046518 | Bacteria | 1784 |
| 1088 | Ga0495644_0004713 | 3300046523 | Bacteria | 5360 |
| 1089 | Ga0495648_0005337 | 3300046524 | Bacteria | 10711 |
| 1090 | Ga0495666_0001574 | 3300046526 | Bacteria | 11221 |
| 1091 | Ga0495666_0006471 | 3300046526 | Bacteria | 5896 |
| 1092 | Ga0495666_0019193 | 3300046526 | Bacteria | 3396 |
| 1093 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 1094 | Ga0495652_0003251 | 3300046529 | Bacteria | 16195 |
| 1095 | Ga0495652_0014533 | 3300046529 | Bacteria | 7064 |
| 1096 | Ga0495652_0016208 | 3300046529 | Bacteria | 6666 |
| 1097 | Ga0495652_0050982 | 3300046529 | Bacteria | 3536 |
| 1098 | Ga0495652_0076711 | 3300046529 | Bacteria | 2772 |
| 1099 | Ga0495652_0089248 | 3300046529 | Bacteria | 2524 |
| 1100 | Ga0495652_0102123 | 3300046529 | Bacteria | 2323 |
| 1101 | Ga0495652_0152603 | 3300046529 | Bacteria | 1802 |
| 1102 | Ga0495665_0000387 | 3300046531 | Bacteria | 22327 |
| 1103 | Ga0495665_0004256 | 3300046531 | Bacteria | 7731 |
| 1104 | Ga0495665_0009547 | 3300046531 | Bacteria | 5257 |
| 1105 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 1106 | Ga0495640_0006068 | 3300046533 | Bacteria | 9582 |
| 1107 | Ga0495640_0014924 | 3300046533 | Bacteria | 5859 |
| 1108 | Ga0495640_0019531 | 3300046533 | Bacteria | 4999 |
| 1109 | Ga0495640_0045494 | 3300046533 | Bacteria | 3045 |
| 1110 | Ga0495640_0060368 | 3300046533 | Bacteria | 2579 |
| 1111 | Ga0495640_0072032 | 3300046533 | Bacteria | 2316 |
| 1112 | Ga0495640_0140441 | 3300046533 | Bacteria | 1557 |
| 1113 | Ga0495586_0016632 | 3300046535 | Bacteria | 3911 |
| 1114 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 1115 | Ga0495587_0001204 | 3300046536 | Bacteria | 17140 |
| 1116 | Ga0495587_0003023 | 3300046536 | Bacteria | 11245 |
| 1117 | Ga0495587_0012911 | 3300046536 | Bacteria | 5252 |
| 1118 | Ga0495587_0033102 | 3300046536 | Bacteria | 3122 |
| 1119 | Ga0495587_0044458 | 3300046536 | Bacteria | 2642 |
| 1120 | Ga0495587_0147463 | 3300046536 | Bacteria | 1341 |
| 1121 | Ga0495609_0042528 | 3300046538 | Bacteria | 2041 |
| 1122 | Ga0495645_0000041 | 3300046543 | Bacteria | 92278 |
| 1123 | Ga0495645_0001743 | 3300046543 | Bacteria | 14779 |
| 1124 | Ga0495645_0003505 | 3300046543 | Bacteria | 10619 |
| 1125 | Ga0495645_0020519 | 3300046543 | Bacteria | 4769 |
| 1126 | Ga0495645_0069726 | 3300046543 | Bacteria | 2537 |
| 1127 | Ga0495622_0024844 | 3300046557 | Bacteria | 2798 |
| 1128 | Ga0495622_0028163 | 3300046557 | Bacteria | 2623 |
| 1129 | Ga0495622_0029274 | 3300046557 | Bacteria | 2573 |
| 1130 | Ga0495633_0016941 | 3300046558 | Bacteria | 3738 |
| 1131 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 1132 | Ga0495667_0000365 | 3300046559 | Bacteria | 28797 |
| 1133 | Ga0495667_0001732 | 3300046559 | Bacteria | 14498 |
| 1134 | Ga0495667_0006271 | 3300046559 | Bacteria | 8065 |
| 1135 | Ga0495667_0010665 | 3300046559 | Bacteria | 6212 |
| 1136 | Ga0495667_0011498 | 3300046559 | Bacteria | 5992 |
| 1137 | Ga0495667_0041089 | 3300046559 | Bacteria | 3068 |
| 1138 | Ga0495667_0048217 | 3300046559 | Bacteria | 2813 |
| 1139 | Ga0495656_0000167 | 3300046615 | Bacteria | 23487 |
| 1140 | Ga0495656_0122334 | 3300046615 | Bacteria | 1230 |
| 1141 | Ga0495668_0087184 | 3300046616 | Bacteria | 1712 |
| 1142 | Ga0495668_0164476 | 3300046616 | Bacteria | 1215 |
| 1143 | Ga0495634_0000624 | 3300046642 | Bacteria | 34336 |
| 1144 | Ga0495634_0002816 | 3300046642 | Bacteria | 14283 |
| 1145 | Ga0495634_0003795 | 3300046642 | Bacteria | 12004 |
| 1146 | Ga0495634_0005914 | 3300046642 | Bacteria | 9345 |
| 1147 | Ga0495634_0008856 | 3300046642 | Bacteria | 7463 |
| 1148 | Ga0495634_0018765 | 3300046642 | Bacteria | 4919 |
| 1149 | Ga0495634_0039315 | 3300046642 | Bacteria | 3221 |
| 1150 | Ga0495634_0137849 | 3300046642 | Bacteria | 1551 |
| 1151 | Ga0495634_0162865 | 3300046642 | Bacteria | 1405 |
| 1152 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 1153 | Ga0495635_0000981 | 3300046663 | Bacteria | 18808 |
| 1154 | Ga0495635_0001522 | 3300046663 | Bacteria | 15511 |
| 1155 | Ga0495635_0002092 | 3300046663 | Bacteria | 13549 |
| 1156 | Ga0495635_0012948 | 3300046663 | Bacteria | 5839 |
| 1157 | Ga0495635_0016633 | 3300046663 | Bacteria | 5138 |
| 1158 | Ga0495635_0019774 | 3300046663 | Bacteria | 4691 |
| 1159 | Ga0495635_0028616 | 3300046663 | Bacteria | 3874 |
| 1160 | Ga0495635_0033558 | 3300046663 | Bacteria | 3560 |
| 1161 | Ga0495659_0000357 | 3300046664 | Bacteria | 17886 |
| 1162 | Ga0495661_0027692 | 3300046665 | Bacteria | 3635 |
| 1163 | Ga0495661_0052158 | 3300046665 | Bacteria | 2465 |
| 1164 | Ga0495588_0015611 | 3300046674 | Bacteria | 3660 |
| 1165 | Ga0495588_0077723 | 3300046674 | Bacteria | 1731 |
| 1166 | Ga0495657_0000047 | 3300046675 | Bacteria | 104362 |
| 1167 | Ga0495657_0007791 | 3300046675 | Bacteria | 8226 |
| 1168 | Ga0495657_0013213 | 3300046675 | Bacteria | 6099 |
| 1169 | Ga0495657_0032813 | 3300046675 | Bacteria | 3620 |
| 1170 | Ga0495657_0063861 | 3300046675 | Bacteria | 2427 |
| 1171 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 1172 | Ga0495599_0005483 | 3300046678 | Bacteria | 7588 |
| 1173 | Ga0495599_0018968 | 3300046678 | Bacteria | 4287 |
| 1174 | Ga0495599_0073349 | 3300046678 | Bacteria | 2136 |
| 1175 | Ga0495599_0188571 | 3300046678 | Bacteria | 1269 |
| 1176 | Ga0495623_0000023 | 3300046679 | Bacteria | 96650 |
| 1177 | Ga0495623_0000281 | 3300046679 | Bacteria | 33061 |
| 1178 | Ga0495623_0025726 | 3300046679 | Bacteria | 3791 |
| 1179 | Ga0495623_0072195 | 3300046679 | Bacteria | 2146 |
| 1180 | Ga0495623_0128608 | 3300046679 | Bacteria | 1519 |
| 1181 | Ga0495646_0000024 | 3300046680 | Bacteria | 107836 |
| 1182 | Ga0495646_0000794 | 3300046680 | Bacteria | 17647 |
| 1183 | Ga0495646_0006978 | 3300046680 | Bacteria | 7170 |
| 1184 | Ga0495646_0008319 | 3300046680 | Bacteria | 6597 |
| 1185 | Ga0495646_0010351 | 3300046680 | Bacteria | 5932 |
| 1186 | Ga0495646_0018443 | 3300046680 | Bacteria | 4419 |
| 1187 | Ga0495646_0078071 | 3300046680 | Bacteria | 1936 |
| 1188 | Ga0495647_0000516 | 3300046681 | Bacteria | 11276 |
| 1189 | Ga0495647_0000985 | 3300046681 | Bacteria | 8652 |
| 1190 | Ga0495647_0010622 | 3300046681 | Bacteria | 3139 |
| 1191 | Ga0495647_0010627 | 3300046681 | Bacteria | 3138 |
| 1192 | Ga0495647_0012548 | 3300046681 | Bacteria | 2919 |
| 1193 | Ga0495647_0042747 | 3300046681 | Bacteria | 1732 |
| 1194 | Ga0495658_0000210 | 3300046683 | Bacteria | 33648 |
| 1195 | Ga0495658_0001195 | 3300046683 | Bacteria | 13670 |
| 1196 | Ga0495658_0023094 | 3300046683 | Bacteria | 3299 |
| 1197 | Ga0495658_0060153 | 3300046683 | Bacteria | 2178 |
| 1198 | Ga0495613_0013591 | 3300046689 | Bacteria | 6044 |
| 1199 | Ga0495613_0015398 | 3300046689 | Bacteria | 5687 |
| 1200 | Ga0495613_0018004 | 3300046689 | Bacteria | 5265 |
| 1201 | Ga0495613_0064648 | 3300046689 | Bacteria | 2675 |
| 1202 | Ga0495613_0073149 | 3300046689 | Bacteria | 2498 |
| 1203 | Ga0495624_0003648 | 3300046690 | Bacteria | 11385 |
| 1204 | Ga0495624_0004943 | 3300046690 | Bacteria | 9663 |
| 1205 | Ga0495624_0030701 | 3300046690 | Bacteria | 3498 |
| 1206 | Ga0495624_0032910 | 3300046690 | Bacteria | 3359 |
| 1207 | Ga0495624_0137502 | 3300046690 | Bacteria | 1497 |
| 1208 | Ga0495670_0002677 | 3300046691 | Bacteria | 8789 |
| 1209 | Ga0495670_0004128 | 3300046691 | Bacteria | 7121 |
| 1210 | Ga0495600_0000013 | 3300046809 | Bacteria | 119404 |
| 1211 | Ga0495600_0000388 | 3300046809 | Bacteria | 22724 |
| 1212 | Ga0495600_0002666 | 3300046809 | Bacteria | 10315 |
| 1213 | Ga0495600_0011043 | 3300046809 | Bacteria | 5621 |
| 1214 | Ga0495600_0044885 | 3300046809 | Bacteria | 2883 |
| 1215 | Ga0495600_0047443 | 3300046809 | Bacteria | 2801 |
| 1216 | Ga0495600_0098805 | 3300046809 | Bacteria | 1903 |
| 1217 | Ga0495600_0099298 | 3300046809 | Bacteria | 1897 |
| 1218 | Ga0495581_0001283 | 3300047315 | Bacteria | 13848 |
| 1219 | Ga0495581_0001772 | 3300047315 | Bacteria | 12062 |
| 1220 | Ga0495581_0003342 | 3300047315 | Bacteria | 9216 |
| 1221 | Ga0495581_0029188 | 3300047315 | Bacteria | 3197 |
| 1222 | Ga0495581_0167389 | 3300047315 | Bacteria | 1285 |
| 1223 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 1224 | Ga0495604_0000422 | 3300047317 | Bacteria | 38179 |
| 1225 | Ga0495604_0002563 | 3300047317 | Bacteria | 14535 |
| 1226 | Ga0495604_0004482 | 3300047317 | Bacteria | 11061 |
| 1227 | Ga0495604_0014260 | 3300047317 | Bacteria | 6335 |
| 1228 | Ga0495604_0026128 | 3300047317 | Bacteria | 4649 |
| 1229 | Ga0495604_0029470 | 3300047317 | Bacteria | 4367 |
| 1230 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 1231 | Ga0495674_0001490 | 3300047319 | Bacteria | 22945 |
| 1232 | Ga0495674_0004401 | 3300047319 | Bacteria | 13544 |
| 1233 | Ga0495674_0008877 | 3300047319 | Bacteria | 9562 |
| 1234 | Ga0495674_0009425 | 3300047319 | Bacteria | 9279 |
| 1235 | Ga0495674_0015781 | 3300047319 | Bacteria | 7050 |
| 1236 | Ga0495674_0022729 | 3300047319 | Bacteria | 5780 |
| 1237 | Ga0495674_0045990 | 3300047319 | Bacteria | 3875 |
| 1238 | Ga0495674_0049741 | 3300047319 | Bacteria | 3702 |
| 1239 | Ga0495674_0060922 | 3300047319 | Bacteria | 3291 |
| 1240 | Ga0495674_0069601 | 3300047319 | Bacteria | 3042 |
| 1241 | Ga0495672_0019795 | 3300047320 | Bacteria | 4429 |
| 1242 | Ga0495676_0006651 | 3300047321 | Bacteria | 10656 |
| 1243 | Ga0495676_0025913 | 3300047321 | Bacteria | 5054 |
| 1244 | Ga0495676_0045629 | 3300047321 | Bacteria | 3565 |
| 1245 | Ga0495676_0081445 | 3300047321 | Bacteria | 2454 |
| 1246 | Ga0495676_0221358 | 3300047321 | Bacteria | 1304 |
| 1247 | Ga0495680_0001437 | 3300047322 | Bacteria | 25662 |
| 1248 | Ga0495680_0002318 | 3300047322 | Bacteria | 19524 |
| 1249 | Ga0495680_0006216 | 3300047322 | Bacteria | 11133 |
| 1250 | Ga0495680_0006978 | 3300047322 | Bacteria | 10418 |
| 1251 | Ga0495680_0010055 | 3300047322 | Bacteria | 8460 |
| 1252 | Ga0495680_0012387 | 3300047322 | Bacteria | 7503 |
| 1253 | Ga0495680_0031794 | 3300047322 | Bacteria | 4291 |
| 1254 | Ga0495680_0045097 | 3300047322 | Bacteria | 3483 |
| 1255 | Ga0495680_0059489 | 3300047322 | Bacteria | 2949 |
| 1256 | Ga0495680_0192008 | 3300047322 | Bacteria | 1469 |
| 1257 | Ga0495675_0000014 | 3300047444 | Bacteria | 137646 |
| 1258 | Ga0495675_0003130 | 3300047444 | Bacteria | 9934 |
| 1259 | Ga0495675_0015559 | 3300047444 | Bacteria | 4810 |
| 1260 | Ga0495675_0016294 | 3300047444 | Bacteria | 4701 |
| 1261 | Ga0495675_0110810 | 3300047444 | Bacteria | 1713 |
| 1262 | Ga0495677_0044149 | 3300047445 | Bacteria | 1634 |
| 1263 | Ga0495679_011554 | 3300047446 | Bacteria | 3401 |
| 1264 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 1265 | Ga0495684_0001385 | 3300047471 | Bacteria | 19460 |
| 1266 | Ga0495684_0002100 | 3300047471 | Bacteria | 15987 |
| 1267 | Ga0495684_0041636 | 3300047471 | Bacteria | 3520 |
| 1268 | Ga0495684_0061574 | 3300047471 | Bacteria | 2855 |
| 1269 | Ga0495684_0083196 | 3300047471 | Bacteria | 2427 |
| 1270 | Ga0495684_0246151 | 3300047471 | Bacteria | 1302 |
| 1271 | Ga0495686_0022878 | 3300047472 | Bacteria | 4130 |
| 1272 | Ga0495686_0147645 | 3300047472 | Bacteria | 1383 |
| 1273 | Ga0495593_0001105 | 3300047673 | Bacteria | 15740 |
| 1274 | Ga0495593_0002819 | 3300047673 | Bacteria | 10465 |
| 1275 | Ga0495593_0013949 | 3300047673 | Bacteria | 4577 |
| 1276 | Ga0495593_0019288 | 3300047673 | Bacteria | 3823 |
| 1277 | Ga0495593_0026134 | 3300047673 | Bacteria | 3226 |
| 1278 | Ga0495593_0041838 | 3300047673 | Bacteria | 2462 |
| 1279 | Ga0495593_0112767 | 3300047673 | Bacteria | 1387 |
| 1280 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 1281 | Ga0495602_0004101 | 3300048088 | Bacteria | 15167 |
| 1282 | Ga0495602_0004126 | 3300048088 | Bacteria | 15131 |
| 1283 | Ga0495602_0015358 | 3300048088 | Bacteria | 7733 |
| 1284 | Ga0495602_0024539 | 3300048088 | Bacteria | 5850 |
| 1285 | Ga0495602_0037412 | 3300048088 | Bacteria | 4505 |
| 1286 | Ga0495614_0043135 | 3300048089 | Bacteria | 1934 |
| 1287 | Ga0495614_0094754 | 3300048089 | Bacteria | 1301 |
| 1288 | Ga0496100_0000759 | 3300048903 | Bacteria | 15303 |
| 1289 | Ga0496100_0002801 | 3300048903 | Bacteria | 8925 |
| 1290 | Ga0496100_0004107 | 3300048903 | Bacteria | 7679 |
| 1291 | Ga0496100_0004431 | 3300048903 | Bacteria | 7442 |
| 1292 | Ga0496101_0000351 | 3300048904 | Bacteria | 31046 |
| 1293 | Ga0496101_0006685 | 3300048904 | Bacteria | 7435 |
| 1294 | Ga0496101_0109431 | 3300048904 | Bacteria | 2078 |
| 1295 | Ga0496101_0124871 | 3300048904 | Bacteria | 1949 |
| 1296 | Ga0496102_0007915 | 3300048905 | Bacteria | 9084 |
| 1297 | Ga0496102_0012361 | 3300048905 | Bacteria | 7388 |
| 1298 | Ga0496102_0015414 | 3300048905 | Bacteria | 6657 |
| 1299 | Ga0496102_0062698 | 3300048905 | Bacteria | 3404 |
| 1300 | Ga0496102_0069583 | 3300048905 | Bacteria | 3230 |
| 1301 | Ga0496102_0174949 | 3300048905 | Bacteria | 2021 |
| 1302 | Ga0496103_0000998 | 3300048906 | Bacteria | 19896 |
| 1303 | Ga0496103_0024424 | 3300048906 | Bacteria | 3649 |
| 1304 | Ga0496104_0001036 | 3300048907 | Bacteria | 23773 |
| 1305 | Ga0496104_0005252 | 3300048907 | Bacteria | 11322 |
| 1306 | Ga0496104_0030422 | 3300048907 | Bacteria | 5017 |
| 1307 | Ga0496104_0044027 | 3300048907 | Bacteria | 4194 |
| 1308 | Ga0496104_0068258 | 3300048907 | Bacteria | 3378 |
| 1309 | Ga0496104_0110000 | 3300048907 | Bacteria | 2641 |
| 1310 | Ga0496104_0124548 | 3300048907 | Bacteria | 2474 |
| 1311 | Ga0496105_0003481 | 3300048908 | Bacteria | 11650 |
| 1312 | Ga0496105_0025477 | 3300048908 | Bacteria | 4814 |
| 1313 | Ga0496105_0033535 | 3300048908 | Bacteria | 4217 |
| 1314 | Ga0496106_0006851 | 3300048909 | Bacteria | 8435 |
| 1315 | Ga0496106_0015179 | 3300048909 | Bacteria | 5700 |
| 1316 | Ga0496106_0024213 | 3300048909 | Bacteria | 4512 |
| 1317 | Ga0496106_0059357 | 3300048909 | Bacteria | 2898 |
| 1318 | Ga0496106_0148896 | 3300048909 | Bacteria | 1845 |
| 1319 | Ga0496106_0187769 | 3300048909 | Bacteria | 1642 |
| 1320 | Ga0496107_0001455 | 3300048910 | Bacteria | 14645 |
| 1321 | Ga0496107_0006115 | 3300048910 | Bacteria | 8270 |
| 1322 | Ga0496107_0010499 | 3300048910 | Bacteria | 6436 |
| 1323 | Ga0496107_0022779 | 3300048910 | Bacteria | 4428 |
| 1324 | Ga0496107_0029566 | 3300048910 | Bacteria | 3899 |
| 1325 | Ga0496108_0000643 | 3300048911 | Bacteria | 27192 |
| 1326 | Ga0496108_0007552 | 3300048911 | Bacteria | 8810 |
| 1327 | Ga0496108_0018138 | 3300048911 | Bacteria | 5758 |
| 1328 | Ga0496108_0025776 | 3300048911 | Bacteria | 4848 |
| 1329 | Ga0496108_0031626 | 3300048911 | Bacteria | 4392 |
| 1330 | Ga0496108_0048205 | 3300048911 | Bacteria | 3561 |
| 1331 | Ga0496108_0148532 | 3300048911 | Bacteria | 2022 |
| 1332 | Ga0496109_0000359 | 3300048912 | Bacteria | 42297 |
| 1333 | Ga0496109_0000976 | 3300048912 | Bacteria | 23658 |
| 1334 | Ga0496109_0002174 | 3300048912 | Bacteria | 16294 |
| 1335 | Ga0496109_0004488 | 3300048912 | Bacteria | 11664 |
| 1336 | Ga0496109_0005374 | 3300048912 | Bacteria | 10705 |
| 1337 | Ga0496109_0026508 | 3300048912 | Bacteria | 5169 |
| 1338 | Ga0496109_0026931 | 3300048912 | Bacteria | 5128 |
| 1339 | Ga0496109_0031587 | 3300048912 | Bacteria | 4754 |
| 1340 | Ga0496109_0166736 | 3300048912 | Bacteria | 2065 |
| 1341 | Ga0496110_0020531 | 3300048913 | Bacteria | 5578 |
| 1342 | Ga0496110_0071193 | 3300048913 | Bacteria | 3083 |
| 1343 | Ga0496110_0104271 | 3300048913 | Bacteria | 2544 |
| 1344 | Ga0496110_0300022 | 3300048913 | Bacteria | 1463 |
| 1345 | Ga0496111_0019946 | 3300048914 | Bacteria | 4663 |
| 1346 | Ga0496111_0025729 | 3300048914 | Bacteria | 4152 |
| 1347 | Ga0496111_0040961 | 3300048914 | Bacteria | 3323 |
| 1348 | Ga0496111_0221339 | 3300048914 | Bacteria | 1406 |
| 1349 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 1350 | Ga0496112_0006455 | 3300048915 | Bacteria | 10294 |
| 1351 | Ga0496112_0013996 | 3300048915 | Bacteria | 7424 |
| 1352 | Ga0496112_0015924 | 3300048915 | Bacteria | 7027 |
| 1353 | Ga0496112_0031659 | 3300048915 | Bacteria | 5132 |
| 1354 | Ga0496112_0064226 | 3300048915 | Bacteria | 3622 |
| 1355 | Ga0496112_0065980 | 3300048915 | Bacteria | 3572 |
| 1356 | Ga0496112_0116480 | 3300048915 | Bacteria | 2643 |
| 1357 | Ga0496112_0166345 | 3300048915 | Bacteria | 2171 |
| 1358 | Ga0496112_0258513 | 3300048915 | Bacteria | 1691 |
| 1359 | Ga0496112_0327625 | 3300048915 | Bacteria | 1475 |
| 1360 | Ga0496113_0000533 | 3300048916 | Bacteria | 18753 |
| 1361 | Ga0496113_0002168 | 3300048916 | Bacteria | 11333 |
| 1362 | Ga0496113_0003135 | 3300048916 | Bacteria | 9839 |
| 1363 | Ga0496113_0015918 | 3300048916 | Bacteria | 5183 |
| 1364 | Ga0496113_0038507 | 3300048916 | Bacteria | 3516 |
| 1365 | Ga0496113_0054420 | 3300048916 | Bacteria | 2996 |
| 1366 | Ga0496114_0035566 | 3300048917 | Bacteria | 4113 |
| 1367 | Ga0496114_0038438 | 3300048917 | Bacteria | 3960 |
| 1368 | Ga0496114_0058816 | 3300048917 | Bacteria | 3210 |
| 1369 | Ga0496114_0127032 | 3300048917 | Bacteria | 2199 |
| 1370 | Ga0496114_0146287 | 3300048917 | Bacteria | 2048 |
| 1371 | Ga0496114_0194068 | 3300048917 | Bacteria | 1777 |
| 1372 | Ga0496114_0381658 | 3300048917 | Bacteria | 1247 |
| 1373 | Ga0496115_0001160 | 3300048918 | Bacteria | 18961 |
| 1374 | Ga0496115_0002750 | 3300048918 | Bacteria | 12640 |
| 1375 | Ga0496115_0008610 | 3300048918 | Bacteria | 7554 |
| 1376 | Ga0496115_0014364 | 3300048918 | Bacteria | 5994 |
| 1377 | Ga0496115_0020665 | 3300048918 | Bacteria | 5079 |
| 1378 | Ga0496115_0037010 | 3300048918 | Bacteria | 3866 |
| 1379 | Ga0496115_0037987 | 3300048918 | Bacteria | 3819 |
| 1380 | Ga0496115_0074660 | 3300048918 | Bacteria | 2753 |
| 1381 | Ga0496115_0148844 | 3300048918 | Bacteria | 1932 |
| 1382 | Ga0496115_0196383 | 3300048918 | Bacteria | 1667 |
| 1383 | Ga0496116_0001381 | 3300048919 | Bacteria | 27411 |
| 1384 | Ga0496117_0071314 | 3300048920 | Bacteria | 2329 |
| 1385 | Ga0496117_0096234 | 3300048920 | Bacteria | 1889 |
| 1386 | Ga0496118_0039843 | 3300048921 | Bacteria | 3743 |
| 1387 | Ga0496118_0043118 | 3300048921 | Bacteria | 3551 |
| 1388 | Ga0496118_0082381 | 3300048921 | Bacteria | 2254 |
| 1389 | Ga0496119_0002237 | 3300048922 | Bacteria | 21538 |
| 1390 | Ga0496119_0039685 | 3300048922 | Bacteria | 3023 |
| 1391 | Ga0496121_0001934 | 3300048924 | Bacteria | 33033 |
| 1392 | Ga0496121_0004951 | 3300048924 | Bacteria | 17472 |
| 1393 | Ga0496121_0008559 | 3300048924 | Bacteria | 11991 |
| 1394 | Ga0496121_0012773 | 3300048924 | Bacteria | 9097 |
| 1395 | Ga0496121_0061811 | 3300048924 | Bacteria | 3071 |
| 1396 | Ga0496121_0074916 | 3300048924 | Bacteria | 2705 |
| 1397 | Ga0496121_0129371 | 3300048924 | Bacteria | 1893 |
| 1398 | Ga0496121_0132298 | 3300048924 | Bacteria | 1864 |
| 1399 | Ga0496122_0000624 | 3300048925 | Bacteria | 72348 |
| 1400 | Ga0496122_0078647 | 3300048925 | Bacteria | 2309 |
| 1401 | Ga0496123_0000569 | 3300048926 | Bacteria | 63009 |
| 1402 | Ga0496124_0009281 | 3300048927 | Bacteria | 10143 |
| 1403 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 1404 | Ga0496125_0000829 | 3300048928 | Bacteria | 49885 |
| 1405 | Ga0496125_0003409 | 3300048928 | Bacteria | 19321 |
| 1406 | Ga0496125_0008104 | 3300048928 | Bacteria | 11066 |
| 1407 | Ga0496125_0050358 | 3300048928 | Bacteria | 3449 |
| 1408 | Ga0496125_0060665 | 3300048928 | Bacteria | 3038 |
| 1409 | Ga0496126_0090086 | 3300048929 | Bacteria | 2699 |
| 1410 | Ga0496126_0096775 | 3300048929 | Bacteria | 2587 |
| 1411 | Ga0496126_0115143 | 3300048929 | Bacteria | 2338 |
| 1412 | Ga0496126_0160985 | 3300048929 | Bacteria | 1918 |
| 1413 | Ga0501031_0000296 | 3300049568 | Bacteria | 28394 |
| 1414 | Ga0501032_0000244 | 3300049569 | Bacteria | 45114 |
| 1415 | Ga0501032_0055262 | 3300049569 | Bacteria | 2670 |
| 1416 | Ga0501033_0001015 | 3300049570 | Bacteria | 25486 |
| 1417 | Ga0501033_0030771 | 3300049570 | Bacteria | 4033 |
| 1418 | Ga0501033_0131470 | 3300049570 | Bacteria | 1813 |
| 1419 | Ga0501034_0001010 | 3300049571 | Bacteria | 40327 |
| 1420 | Ga0501034_0041774 | 3300049571 | Bacteria | 4640 |
| 1421 | Ga0501034_0096808 | 3300049571 | Bacteria | 2947 |
| 1422 | Ga0501034_0164405 | 3300049571 | Bacteria | 2188 |
| 1423 | Ga0501034_0210784 | 3300049571 | Bacteria | 1898 |
| 1424 | Ga0501034_0382279 | 3300049571 | Bacteria | 1333 |
| 1425 | Ga0501034_0492565 | 3300049571 | Bacteria | 1140 |
| 1426 | Ga0501036_0000405 | 3300049572 | Bacteria | 30399 |
| 1427 | Ga0501036_0043680 | 3300049572 | Bacteria | 3796 |
| 1428 | Ga0501036_0058962 | 3300049572 | Bacteria | 3252 |
| 1429 | Ga0501036_0083358 | 3300049572 | Bacteria | 2702 |
| 1430 | Ga0501037_0000139 | 3300049573 | Bacteria | 67890 |
| 1431 | Ga0501037_0051819 | 3300049573 | Bacteria | 3001 |
| 1432 | Ga0501037_0115164 | 3300049573 | Bacteria | 1935 |
| 1433 | Ga0501038_0000404 | 3300049574 | Bacteria | 37454 |
| 1434 | Ga0501038_0024056 | 3300049574 | Bacteria | 5437 |
| 1435 | Ga0501038_0042165 | 3300049574 | Bacteria | 3975 |
| 1436 | Ga0501038_0054679 | 3300049574 | Bacteria | 3432 |
| 1437 | Ga0501038_0339167 | 3300049574 | Bacteria | 1172 |
| 1438 | Ga0501039_0030683 | 3300049575 | Bacteria | 4145 |
| 1439 | Ga0501039_0270729 | 3300049575 | Bacteria | 1335 |
| 1440 | Ga0501040_0039520 | 3300049576 | Bacteria | 3208 |
| 1441 | Ga0501041_0052106 | 3300049577 | Bacteria | 2495 |
| 1442 | Ga0501041_0075333 | 3300049577 | Bacteria | 2075 |
| 1443 | Ga0501042_0107777 | 3300049578 | Bacteria | 2005 |
| 1444 | Ga0501043_0000021 | 3300049579 | Bacteria | 155025 |
| 1445 | Ga0501043_0029175 | 3300049579 | Bacteria | 4332 |
| 1446 | Ga0501043_0041962 | 3300049579 | Bacteria | 3594 |
| 1447 | Ga0501043_0064795 | 3300049579 | Bacteria | 2869 |
| 1448 | Ga0501043_0138582 | 3300049579 | Bacteria | 1905 |
| 1449 | Ga0501046_0000905 | 3300049580 | Bacteria | 28947 |
| 1450 | Ga0501046_0041933 | 3300049580 | Bacteria | 3649 |
| 1451 | Ga0501046_0090980 | 3300049580 | Bacteria | 2347 |
| 1452 | Ga0501046_0167050 | 3300049580 | Bacteria | 1653 |
| 1453 | Ga0501047_0000041 | 3300049581 | Bacteria | 184355 |
| 1454 | Ga0501047_0094992 | 3300049581 | Bacteria | 2860 |
| 1455 | Ga0501047_0096235 | 3300049581 | Bacteria | 2839 |
| 1456 | Ga0501047_0104574 | 3300049581 | Bacteria | 2711 |
| 1457 | Ga0501047_0113080 | 3300049581 | Bacteria | 2597 |
| 1458 | Ga0501047_0156960 | 3300049581 | Bacteria | 2149 |
| 1459 | Ga0501048_0000077 | 3300049582 | Bacteria | 51021 |
| 1460 | Ga0501048_0003551 | 3300049582 | Bacteria | 11855 |
| 1461 | Ga0501048_0027330 | 3300049582 | Bacteria | 4148 |
| 1462 | Ga0501067_0000360 | 3300049583 | Bacteria | 24898 |
| 1463 | Ga0501067_0000771 | 3300049583 | Bacteria | 17207 |
| 1464 | Ga0501067_0011133 | 3300049583 | Bacteria | 4975 |
| 1465 | Ga0501067_0027958 | 3300049583 | Bacteria | 3126 |
| 1466 | Ga0501067_0075829 | 3300049583 | Bacteria | 1863 |
| 1467 | Ga0501069_0000444 | 3300049585 | Bacteria | 18810 |
| 1468 | Ga0501070_0002561 | 3300049586 | Bacteria | 15914 |
| 1469 | Ga0501070_0008055 | 3300049586 | Bacteria | 8919 |
| 1470 | Ga0501070_0068849 | 3300049586 | Bacteria | 2930 |
| 1471 | Ga0501070_0088098 | 3300049586 | Bacteria | 2569 |
| 1472 | Ga0501072_0007776 | 3300049588 | Bacteria | 8142 |
| 1473 | Ga0501072_0010225 | 3300049588 | Bacteria | 7148 |
| 1474 | Ga0501072_0083803 | 3300049588 | Bacteria | 2527 |
| 1475 | Ga0501073_0001489 | 3300049589 | Bacteria | 17352 |
| 1476 | Ga0501073_0020718 | 3300049589 | Bacteria | 4742 |
| 1477 | Ga0501073_0025360 | 3300049589 | Bacteria | 4252 |
| 1478 | Ga0501073_0037651 | 3300049589 | Bacteria | 3432 |
| 1479 | Ga0501074_0001762 | 3300049590 | Bacteria | 14778 |
| 1480 | Ga0501074_0077587 | 3300049590 | Bacteria | 2384 |
| 1481 | Ga0501074_0082198 | 3300049590 | Bacteria | 2310 |
| 1482 | Ga0501074_0083318 | 3300049590 | Bacteria | 2292 |
| 1483 | Ga0501076_0061488 | 3300049592 | Bacteria | 2989 |
| 1484 | Ga0501076_0284849 | 3300049592 | Bacteria | 1354 |
| 1485 | Ga0501077_0002633 | 3300049593 | Bacteria | 10750 |
| 1486 | Ga0501077_0004224 | 3300049593 | Bacteria | 8679 |
| 1487 | Ga0501077_0006796 | 3300049593 | Bacteria | 7039 |
| 1488 | Ga0501077_0011452 | 3300049593 | Bacteria | 5540 |
| 1489 | Ga0501079_0002042 | 3300049741 | Bacteria | 14462 |
| 1490 | Ga0501079_0038773 | 3300049741 | Bacteria | 3674 |
| 1491 | Ga0501079_0039035 | 3300049741 | Bacteria | 3662 |
| 1492 | Ga0501079_0137642 | 3300049741 | Bacteria | 1902 |
| 1493 | Ga0501079_0238025 | 3300049741 | Bacteria | 1422 |
| 1494 | Ga0501080_0108320 | 3300049742 | Bacteria | 2575 |
| 1495 | Ga0501080_0121593 | 3300049742 | Bacteria | 2419 |
| 1496 | Ga0501080_0154419 | 3300049742 | Bacteria | 2120 |
| 1497 | Ga0501080_0192634 | 3300049742 | Bacteria | 1873 |
| 1498 | Ga0501080_0292089 | 3300049742 | Bacteria | 1480 |
| 1499 | Ga0501081_0006165 | 3300049743 | Bacteria | 7764 |
| 1500 | Ga0501081_0054467 | 3300049743 | Bacteria | 2764 |
| 1501 | Ga0501083_0000708 | 3300049744 | Bacteria | 21721 |
| 1502 | Ga0501083_0002409 | 3300049744 | Bacteria | 12787 |
| 1503 | Ga0501083_0005494 | 3300049744 | Bacteria | 8979 |
| 1504 | Ga0501083_0059136 | 3300049744 | Bacteria | 2564 |
| 1505 | Ga0501083_0072999 | 3300049744 | Bacteria | 2280 |
| 1506 | Ga0501035_0000090 | 3300049822 | Bacteria | 112445 |
| 1507 | Ga0501035_0000267 | 3300049822 | Bacteria | 61712 |
| 1508 | Ga0501035_0021609 | 3300049822 | Bacteria | 5918 |
| 1509 | Ga0501035_0121893 | 3300049822 | Bacteria | 2278 |
| 1510 | Ga0501035_0174629 | 3300049822 | Bacteria | 1854 |
| 1511 | Ga0501035_0183049 | 3300049822 | Bacteria | 1804 |
| 1512 | Ga0501035_0332735 | 3300049822 | Bacteria | 1274 |
| 1513 | Ga0501044_0000054 | 3300049823 | Bacteria | 141399 |
| 1514 | Ga0501044_0036131 | 3300049823 | Bacteria | 5169 |
| 1515 | Ga0501044_0040089 | 3300049823 | Bacteria | 4883 |
| 1516 | Ga0501044_0077406 | 3300049823 | Bacteria | 3373 |
| 1517 | Ga0501044_0136394 | 3300049823 | Bacteria | 2445 |
| 1518 | Ga0501044_0148209 | 3300049823 | Bacteria | 2330 |
| 1519 | Ga0501044_0211473 | 3300049823 | Bacteria | 1894 |
| 1520 | Ga0501044_0247679 | 3300049823 | Bacteria | 1724 |
| 1521 | Ga0501045_0007035 | 3300049824 | Bacteria | 7799 |
| 1522 | Ga0501045_0008407 | 3300049824 | Bacteria | 7195 |
| 1523 | Ga0501045_0012653 | 3300049824 | Bacteria | 5941 |
| 1524 | Ga0501045_0066126 | 3300049824 | Bacteria | 2655 |
| 1525 | nmdc:mga03n38_10860_c1 | 3300050490 | Bacteria | 3369 |
| 1526 | nmdc:mga03n38_151332_c1 | 3300050490 | Bacteria | 1168 |
| 1527 | nmdc:mga03n38_18250_c1 | 3300050490 | Bacteria | 2766 |
| 1528 | nmdc:mga03n38_2618_c1 | 3300050490 | Bacteria | 5611 |
| 1529 | nmdc:mga03n38_5130_c1 | 3300050490 | Bacteria | 4425 |
| 1530 | nmdc:mga00v17_161450_c1 | 3300050491 | Bacteria | 1443 |
| 1531 | nmdc:mga00v17_194944_c1 | 3300050491 | Bacteria | 1309 |
| 1532 | nmdc:mga00v17_204192_c1 | 3300050491 | Bacteria | 1278 |
| 1533 | nmdc:mga00v17_91310_c1 | 3300050491 | Bacteria | 1913 |
| 1534 | nmdc:mga00v17_9734_c1 | 3300050491 | Bacteria | 5216 |
| 1535 | nmdc:mga0yw44_100983_c1 | 3300050492 | Bacteria | 1838 |
| 1536 | nmdc:mga0yw44_121307_c1 | 3300050492 | Bacteria | 1318 |
| 1537 | nmdc:mga0yw44_131569_c1 | 3300050492 | Bacteria | 1620 |
| 1538 | nmdc:mga0yw44_151537_c1 | 3300050492 | Bacteria | 1513 |
| 1539 | nmdc:mga0yw44_18270_c1 | 3300050492 | Bacteria | 3835 |
| 1540 | nmdc:mga0yw44_31020_c1 | 3300050492 | Bacteria | 3104 |
| 1541 | nmdc:mga0yw44_78344_c1 | 3300050492 | Bacteria | 2067 |
| 1542 | nmdc:mga0k408_222223_c1 | 3300050493 | Bacteria | 1127 |
| 1543 | nmdc:mga0k408_77720_c1 | 3300050493 | Bacteria | 1941 |
| 1544 | nmdc:mga06z11_1223_c1 | 3300050494 | Bacteria | 9481 |
| 1545 | nmdc:mga06z11_2319_c1 | 3300050494 | Bacteria | 7245 |
| 1546 | nmdc:mga06z11_44560_c1 | 3300050494 | Bacteria | 2238 |
| 1547 | nmdc:mga04h51_39942_c1 | 3300050495 | Bacteria | 1527 |
| 1548 | nmdc:mga07m45_62632_c1 | 3300050496 | Bacteria | 2108 |
| 1549 | nmdc:mga07m45_9394_c1 | 3300050496 | Bacteria | 5071 |
| 1550 | nmdc:mga05p37_102_c1 | 3300050507 | Bacteria | 69207 |
| 1551 | nmdc:mga05p37_103644_c1 | 3300050507 | Bacteria | 3501 |
| 1552 | nmdc:mga05p37_124_c1 | 3300050507 | Bacteria | 69907 |
| 1553 | nmdc:mga05p37_322101_c1 | 3300050507 | Bacteria | 1829 |
| 1554 | nmdc:mga09592_14658_c1 | 3300050508 | Bacteria | 6396 |
| 1555 | nmdc:mga09592_3352_c3 | 3300050508 | Bacteria | 7345 |
| 1556 | nmdc:mga09592_752_c1 | 3300050508 | Bacteria | 24935 |
| 1557 | nmdc:mga0qj67_119_c1 | 3300050509 | Bacteria | 51910 |
| 1558 | nmdc:mga06r32_1767_c1 | 3300050510 | Bacteria | 19402 |
| 1559 | nmdc:mga06r32_621_c1 | 3300050510 | Bacteria | 30912 |
| 1560 | nmdc:mga06r32_847_c1 | 3300050510 | Bacteria | 27075 |
| 1561 | nmdc:mga08y16_1991_c1 | 3300050511 | Bacteria | 20864 |
| 1562 | nmdc:mga08y16_30913_c1 | 3300050511 | Bacteria | 5631 |
| 1563 | nmdc:mga08y16_3532_c1 | 3300050511 | Bacteria | 16232 |
| 1564 | nmdc:mga0n895_1270_c1 | 3300050512 | Bacteria | 18661 |
| 1565 | nmdc:mga0n895_192896_c1 | 3300050512 | Bacteria | 2068 |
| 1566 | nmdc:mga0n895_2196_c1 | 3300050512 | Bacteria | 15097 |
| 1567 | nmdc:mga0n895_45416_c1 | 3300050512 | Bacteria | 4287 |
| 1568 | nmdc:mga0n895_90744_c1 | 3300050512 | Bacteria | 3058 |
| 1569 | nmdc:mga0n895_97669_c1 | 3300050512 | Bacteria | 2943 |
| 1570 | nmdc:mga0rr50_115027_c1 | 3300050513 | Bacteria | 2134 |
| 1571 | nmdc:mga0rr50_187439_c1 | 3300050513 | Bacteria | 1694 |
| 1572 | nmdc:mga0rr50_22191_c1 | 3300050513 | Bacteria | 4352 |
| 1573 | nmdc:mga0rr50_54179_c1 | 3300050513 | Bacteria | 2987 |
| 1574 | nmdc:mga0rr50_55627_c1 | 3300050513 | Bacteria | 2953 |
| 1575 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 1576 | nmdc:mga0a205_146535_c1 | 3300050515 | Bacteria | 2261 |
| 1577 | nmdc:mga0a205_1990_c1 | 3300050515 | Bacteria | 17809 |
| 1578 | nmdc:mga0a205_421_c1 | 3300050515 | Bacteria | 32493 |
| 1579 | nmdc:mga0a205_58386_c1 | 3300050515 | Bacteria | 3727 |
| 1580 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 1581 | Ga0495601_0000549 | 3300053077 | Bacteria | 19855 |
| 1582 | Ga0495601_0002952 | 3300053077 | Bacteria | 9664 |
| 1583 | Ga0495601_0003050 | 3300053077 | Bacteria | 9548 |
| 1584 | Ga0495601_0003088 | 3300053077 | Bacteria | 9504 |
| 1585 | Ga0495601_0015181 | 3300053077 | Bacteria | 4654 |
| 1586 | Ga0495601_0016054 | 3300053077 | Bacteria | 4531 |
| 1587 | Ga0495601_0019185 | 3300053077 | Bacteria | 4169 |
| 1588 | Ga0495601_0036801 | 3300053077 | Bacteria | 3058 |
| 1589 | Ga0495601_0039165 | 3300053077 | Bacteria | 2967 |
| 1590 | Ga0495601_0043124 | 3300053077 | Bacteria | 2833 |
| 1591 | Ga0495601_0044633 | 3300053077 | Bacteria | 2786 |
| 1592 | Ga0495601_0044749 | 3300053077 | Bacteria | 2782 |
| 1593 | Ga0495601_0085039 | 3300053077 | Bacteria | 2032 |
| 1594 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 1595 | Ga0495612_0000786 | 3300053078 | Bacteria | 12913 |
| 1596 | Ga0495612_0001076 | 3300053078 | Bacteria | 11181 |
| 1597 | Ga0495612_0010919 | 3300053078 | Bacteria | 3669 |
| 1598 | Ga0495612_0011648 | 3300053078 | Bacteria | 3544 |
| 1599 | Ga0495612_0015944 | 3300053078 | Bacteria | 3011 |
| 1600 | Ga0495612_0056308 | 3300053078 | Bacteria | 1622 |
| 1601 | Ga0495612_0071921 | 3300053078 | Bacteria | 1443 |
| 1602 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 1603 | Ga0495595_0000223 | 3300053084 | Bacteria | 22663 |
| 1604 | Ga0495595_0000603 | 3300053084 | Bacteria | 13668 |
| 1605 | Ga0495595_0000984 | 3300053084 | Bacteria | 10988 |
| 1606 | Ga0495595_0001629 | 3300053084 | Bacteria | 8778 |
| 1607 | Ga0495595_0002822 | 3300053084 | Bacteria | 6832 |
| 1608 | Ga0495595_0006421 | 3300053084 | Bacteria | 4795 |
| 1609 | Ga0495595_0022366 | 3300053084 | Bacteria | 2775 |
| 1610 | Ga0495595_0028170 | 3300053084 | Bacteria | 2508 |
| 1611 | Ga0495595_0105066 | 3300053084 | Bacteria | 1365 |
| 1612 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 1613 | Ga0495619_0000229 | 3300053085 | Bacteria | 40785 |
| 1614 | Ga0495619_0001087 | 3300053085 | Bacteria | 17853 |
| 1615 | Ga0495619_0001121 | 3300053085 | Bacteria | 17592 |
| 1616 | Ga0495619_0001556 | 3300053085 | Bacteria | 15090 |
| 1617 | Ga0495619_0001653 | 3300053085 | Bacteria | 14709 |
| 1618 | Ga0495619_0005901 | 3300053085 | Bacteria | 7760 |
| 1619 | Ga0495619_0006095 | 3300053085 | Bacteria | 7634 |
| 1620 | Ga0495619_0010207 | 3300053085 | Bacteria | 5915 |
| 1621 | Ga0495619_0023993 | 3300053085 | Bacteria | 3911 |
| 1622 | Ga0495619_0080845 | 3300053085 | Bacteria | 2187 |
| 1623 | Ga0495619_0109671 | 3300053085 | Bacteria | 1885 |
| 1624 | Ga0495619_0126123 | 3300053085 | Bacteria | 1757 |
| 1625 | Ga0495619_0159242 | 3300053085 | Bacteria | 1559 |
| 1626 | Ga0495619_0264599 | 3300053085 | Bacteria | 1192 |
| 1627 | Ga0500578_0076118 | 3300053086 | Bacteria | 2137 |
| 1628 | Ga0500643_002090 | 3300053087 | Bacteria | 10629 |
| 1629 | Ga0500643_019553 | 3300053087 | Bacteria | 2227 |
| 1630 | Ga0500644_0000716 | 3300053088 | Bacteria | 11750 |
| 1631 | Ga0500644_0009687 | 3300053088 | Bacteria | 2585 |
| 1632 | Ga0500646_0008367 | 3300053090 | Bacteria | 2645 |
| 1633 | Ga0500651_0013266 | 3300053093 | Bacteria | 5015 |
| 1634 | Ga0500651_0031175 | 3300053093 | Bacteria | 3358 |
| 1635 | Ga0500651_0105146 | 3300053093 | Bacteria | 1728 |
| 1636 | Ga0500566_0001394 | 3300053094 | Bacteria | 14132 |
| 1637 | Ga0500566_0032406 | 3300053094 | Bacteria | 3048 |
| 1638 | Ga0500566_0070936 | 3300053094 | Bacteria | 1955 |
| 1639 | Ga0500641_0005584 | 3300053096 | Bacteria | 4454 |
| 1640 | Ga0500641_0007479 | 3300053096 | Bacteria | 3897 |
| 1641 | Ga0500641_0010283 | 3300053096 | Bacteria | 3377 |
| 1642 | Ga0500650_0001791 | 3300053098 | Bacteria | 6706 |
| 1643 | Ga0500650_0022327 | 3300053098 | Bacteria | 2799 |
| 1644 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 1645 | Ga0500556_0000036 | 3300053104 | Bacteria | 144864 |
| 1646 | Ga0500569_019211 | 3300053109 | Bacteria | 1775 |
| 1647 | Ga0500572_004035 | 3300053111 | Bacteria | 3338 |
| 1648 | Ga0500592_006308 | 3300053116 | Bacteria | 1889 |
| 1649 | Ga0500595_000083 | 3300053119 | Bacteria | 66474 |
| 1650 | Ga0500595_003722 | 3300053119 | Bacteria | 7033 |
| 1651 | Ga0500595_005423 | 3300053119 | Bacteria | 5567 |
| 1652 | Ga0500607_064381 | 3300053121 | Bacteria | 1909 |
| 1653 | Ga0500608_015771 | 3300053122 | Bacteria | 3402 |
| 1654 | Ga0500642_0000044 | 3300053130 | Bacteria | 82877 |
| 1655 | Ga0500642_0012395 | 3300053130 | Bacteria | 3090 |
| 1656 | Ga0500652_000006 | 3300053131 | Bacteria | 167437 |
| 1657 | Ga0500652_000639 | 3300053131 | Bacteria | 11973 |
| 1658 | Ga0500652_016010 | 3300053131 | Bacteria | 2719 |
| 1659 | Ga0500559_0000130 | 3300053136 | Bacteria | 58494 |
| 1660 | Ga0500559_0000596 | 3300053136 | Bacteria | 24584 |
| 1661 | Ga0500559_0017573 | 3300053136 | Bacteria | 3020 |
| 1662 | Ga0500568_0006894 | 3300053139 | Bacteria | 5646 |
| 1663 | Ga0500568_0027980 | 3300053139 | Bacteria | 2353 |
| 1664 | Ga0500577_0000032 | 3300053142 | Bacteria | 33173 |
| 1665 | Ga0500586_002283 | 3300053145 | Bacteria | 4278 |
| 1666 | Ga0500603_038286 | 3300053150 | Bacteria | 1269 |
| 1667 | Ga0500604_0000656 | 3300053151 | Bacteria | 9492 |
| 1668 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1669 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 1670 | Ga0500616_0008359 | 3300053153 | Bacteria | 6439 |
| 1671 | Ga0500622_0063860 | 3300053156 | Bacteria | 1873 |
| 1672 | Ga0500634_0079328 | 3300053161 | Bacteria | 1696 |
| 1673 | Ga0500639_002824 | 3300053163 | Bacteria | 8739 |
| 1674 | Ga0500636_0000047 | 3300053177 | Bacteria | 62796 |
| 1675 | Ga0500636_0003542 | 3300053177 | Bacteria | 8790 |
| 1676 | Ga0500636_0010447 | 3300053177 | Bacteria | 5417 |
| 1677 | Ga0500645_001743 | 3300053730 | Bacteria | 10554 |
| 1678 | Ga0500645_015410 | 3300053730 | Bacteria | 2421 |
| 1679 | Ga0500645_018168 | 3300053730 | Bacteria | 2198 |
| 1680 | Ga0500645_031589 | 3300053730 | Bacteria | 1590 |
| 1681 | Ga0501084_0031729 | 3300054114 | Bacteria | 4418 |
| 1682 | Ga0501084_0032546 | 3300054114 | Bacteria | 4362 |
| 1683 | Ga0501084_0085733 | 3300054114 | Bacteria | 2644 |
| 1684 | Ga0501084_0215866 | 3300054114 | Bacteria | 1618 |
| 1685 | Ga0501084_0283099 | 3300054114 | Bacteria | 1400 |
| 1686 | Ga0501082_0001613 | 3300060353 | Bacteria | 19861 |
| 1687 | Ga0501082_0004836 | 3300060353 | Bacteria | 11746 |
| 1688 | Ga0501082_0026365 | 3300060353 | Bacteria | 5007 |
| 1689 | Ga0501082_0039669 | 3300060353 | Bacteria | 4062 |
| 1690 | Ga0501082_0043153 | 3300060353 | Bacteria | 3888 |
| 1691 | Ga0501082_0052291 | 3300060353 | Bacteria | 3521 |
| 1692 | Ga0501082_0137353 | 3300060353 | Bacteria | 2121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0283099 | Ga0501084_0283099_383_1363 | 307 |
| 2 | 3300006038 | Ga0075365_10222012 | Ga0075365_102220122 | 308 |
| 3 | 3300050492 | nmdc:mga0yw44_121307_c1 | nmdc:mga0yw44_121307_c1_310_1296 | 308 |
| 4 | 3300046459 | Ga0495629_0176388 | Ga0495629_0176388_307_1353 | 317 |
| 5 | 3300049823 | Ga0501044_0136394 | Ga0501044_0136394_673_1707 | 320 |
| 6 | 3300046683 | Ga0495658_0023094 | Ga0495658_0023094_1435_2409 | 323 |
| 7 | 3300005981 | Ga0081538_10020591 | Ga0081538_100205915 | 324 |
| 8 | 3300053131 | Ga0500652_016010 | Ga0500652_016010_51_1028 | 325 |
| 9 | 3300005548 | Ga0070665_100006275 | Ga0070665_1000062759 | 326 |
| 10 | 3300028379 | Ga0268266_10009846 | Ga0268266_100098466 | 326 |
| 11 | 3300047673 | Ga0495593_0112767 | Ga0495593_0112767_34_1014 | 326 |
| 12 | 3300050490 | nmdc:mga03n38_151332_c1 | nmdc:mga03n38_151332_c1_139_1119 | 326 |
| 13 | 3300031249 | Ga0265339_10011755 | Ga0265339_100117554 | 327 |
| 14 | 3300031241 | Ga0265325_10006932 | Ga0265325_100069325 | 328 |
| 15 | 3300049571 | Ga0501034_0492565 | Ga0501034_0492565_103_1098 | 329 |
| 16 | 3300005364 | Ga0070673_100081869 | Ga0070673_1000818693 | 330 |
| 17 | 3300005983 | Ga0081540_1000585 | Ga0081540_100058520 | 330 |
| 18 | 3300048924 | Ga0496121_0004951 | Ga0496121_0004951_16071_17186 | 330 |
| 19 | 3300035111 | Ga0373923_0005521 | Ga0373923_0005521_1301_2506 | 331 |
| 20 | 3300035117 | Ga0373953_0001305 | Ga0373953_0001305_2773_3978 | 331 |
| 21 | 3300035118 | Ga0373954_0018425 | Ga0373954_0018425_61_1194 | 331 |
| 22 | 3300035120 | Ga0373957_0019954 | Ga0373957_0019954_1178_2311 | 331 |
| 23 | 3300035170 | Ga0373943_0011759 | Ga0373943_0011759_2342_3547 | 331 |
| 24 | 3300035172 | Ga0373955_0000213 | Ga0373955_0000213_21473_22678 | 331 |
| 25 | 3300035410 | Ga0373924_0000686 | Ga0373924_0000686_8721_9926 | 331 |
| 26 | 3300035692 | Ga0373935_0000131 | Ga0373935_0000131_12309_13514 | 331 |
| 27 | 3300035695 | Ga0373927_0025227 | Ga0373927_0025227_1403_2608 | 331 |
| 28 | 3300035725 | Ga0373947_0002523 | Ga0373947_0002523_7158_8363 | 331 |
| 29 | 3300036401 | Ga0373937_0000293 | Ga0373937_0000293_33829_35034 | 331 |
| 30 | 3300037068 | Ga0373925_0000087 | Ga0373925_0000087_67129_68334 | 331 |
| 31 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_278447_279652 | 331 |
| 32 | 3300046459 | Ga0495629_0010498 | Ga0495629_0010498_3932_5137 | 331 |
| 33 | 3300046462 | Ga0495651_0001675 | Ga0495651_0001675_5541_6746 | 331 |
| 34 | 3300046463 | Ga0495653_0000015 | Ga0495653_0000015_40736_41941 | 331 |
| 35 | 3300046476 | Ga0495662_0000957 | Ga0495662_0000957_2051_3256 | 331 |
| 36 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_36708_37913 | 331 |
| 37 | 3300046511 | Ga0495608_0000066 | Ga0495608_0000066_13219_14424 | 331 |
| 38 | 3300046514 | Ga0495618_0000021 | Ga0495618_0000021_5618_6823 | 331 |
| 39 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_288709_289914 | 331 |
| 40 | 3300046517 | Ga0495630_0000254 | Ga0495630_0000254_6430_7635 | 331 |
| 41 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_789252_790457 | 331 |
| 42 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_236888_238093 | 331 |
| 43 | 3300046536 | Ga0495587_0000012 | Ga0495587_0000012_130893_132098 | 331 |
| 44 | 3300046543 | Ga0495645_0000041 | Ga0495645_0000041_22356_23561 | 331 |
| 45 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_629220_630425 | 331 |
| 46 | 3300046642 | Ga0495634_0000624 | Ga0495634_0000624_9358_10563 | 331 |
| 47 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_61242_62447 | 331 |
| 48 | 3300046675 | Ga0495657_0000047 | Ga0495657_0000047_80591_81796 | 331 |
| 49 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_128294_129499 | 331 |
| 50 | 3300046679 | Ga0495623_0000023 | Ga0495623_0000023_69167_70372 | 331 |
| 51 | 3300046680 | Ga0495646_0000024 | Ga0495646_0000024_70076_71281 | 331 |
| 52 | 3300046809 | Ga0495600_0000013 | Ga0495600_0000013_100104_101309 | 331 |
| 53 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_156302_157507 | 331 |
| 54 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_236645_237850 | 331 |
| 55 | 3300047322 | Ga0495680_0001437 | Ga0495680_0001437_18770_19975 | 331 |
| 56 | 3300047444 | Ga0495675_0000014 | Ga0495675_0000014_110841_112046 | 331 |
| 57 | 3300047471 | Ga0495684_0000027 | Ga0495684_0000027_55065_56270 | 331 |
| 58 | 3300047673 | Ga0495593_0002819 | Ga0495593_0002819_2640_3845 | 331 |
| 59 | 3300048088 | Ga0495602_0000004 | Ga0495602_0000004_130936_132141 | 331 |
| 60 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_76695_77900 | 331 |
| 61 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_236760_237965 | 331 |
| 62 | 3300053084 | Ga0495595_0000006 | Ga0495595_0000006_164206_165411 | 331 |
| 63 | 3300053085 | Ga0495619_0000011 | Ga0495619_0000011_194766_195971 | 331 |
| 64 | 3300031711 | Ga0265314_10010907 | Ga0265314_100109076 | 332 |
| 65 | 3300031595 | Ga0265313_10000027 | Ga0265313_1000002722 | 333 |
| 66 | iso_pu_bacteria | 2904690495 | 2904695215 | 333 |
| 67 | 3300026078 | Ga0207702_10000854 | Ga0207702_1000085411 | 334 |
| 68 | 3300028786 | Ga0307517_10000315 | Ga0307517_1000031564 | 335 |
| 69 | 3300028794 | Ga0307515_10018508 | Ga0307515_1001850810 | 335 |
| 70 | 3300049593 | Ga0501077_0002633 | Ga0501077_0002633_3978_5066 | 335 |
| 71 | 3300050493 | nmdc:mga0k408_222223_c1 | nmdc:mga0k408_222223_c1_90_1097 | 335 |
| 72 | iso_pu_bacteria | 2909042592 | 2909047939 | 336 |
| 73 | 3300046642 | Ga0495634_0162865 | Ga0495634_0162865_371_1387 | 337 |
| 74 | 3300050492 | nmdc:mga0yw44_18270_c1 | nmdc:mga0yw44_18270_c1_2023_3114 | 338 |
| 75 | 3300005937 | Ga0081455_10007131 | Ga0081455_100071316 | 339 |
| 76 | 3300006038 | Ga0075365_10090220 | Ga0075365_100902201 | 339 |
| 77 | 3300009147 | Ga0114129_10000170 | Ga0114129_1000017053 | 339 |
| 78 | 3300050490 | nmdc:mga03n38_5130_c1 | nmdc:mga03n38_5130_c1_954_2045 | 339 |
| 79 | 3300050494 | nmdc:mga06z11_1223_c1 | nmdc:mga06z11_1223_c1_4608_5699 | 339 |
| 80 | 3300050496 | nmdc:mga07m45_9394_c1 | nmdc:mga07m45_9394_c1_2872_3963 | 339 |
| 81 | 3300050507 | nmdc:mga05p37_124_c1 | nmdc:mga05p37_124_c1_17466_18584 | 339 |
| 82 | 3300050508 | nmdc:mga09592_3352_c3 | nmdc:mga09592_3352_c3_1350_2468 | 339 |
| 83 | 3300050510 | nmdc:mga06r32_847_c1 | nmdc:mga06r32_847_c1_20970_22088 | 339 |
| 84 | 3300031616 | Ga0307508_10048516 | Ga0307508_100485162 | 340 |
| 85 | 3300009094 | Ga0111539_10003962 | Ga0111539_1000396221 | 341 |
| 86 | 3300032002 | Ga0307416_100436891 | Ga0307416_1004368911 | 342 |
| 87 | 3300005841 | Ga0068863_100246853 | Ga0068863_1002468532 | 343 |
| 88 | 3300009101 | Ga0105247_10042332 | Ga0105247_100423322 | 343 |
| 89 | 3300026088 | Ga0207641_10165979 | Ga0207641_101659792 | 343 |
| 90 | 3300035695 | Ga0373927_0026721 | Ga0373927_0026721_41_1174 | 343 |
| 91 | 3300037068 | Ga0373925_0013371 | Ga0373925_0013371_4579_5763 | 343 |
| 92 | 3300005937 | Ga0081455_10042462 | Ga0081455_100424623 | 344 |
| 93 | 3300006871 | Ga0075434_100100350 | Ga0075434_1001003503 | 344 |
| 94 | 3300046681 | Ga0495647_0042747 | Ga0495647_0042747_562_1716 | 344 |
| 95 | 3300050512 | nmdc:mga0n895_97669_c1 | nmdc:mga0n895_97669_c1_668_1804 | 344 |
| 96 | 3300025915 | Ga0207693_10018787 | Ga0207693_100187875 | 345 |
| 97 | 3300035171 | Ga0373946_0026198 | Ga0373946_0026198_189_1388 | 345 |
| 98 | 3300046455 | Ga0495603_0050838 | Ga0495603_0050838_80_1222 | 345 |
| 99 | 3300046476 | Ga0495662_0048054 | Ga0495662_0048054_424_1623 | 345 |
| 100 | 3300046616 | Ga0495668_0087184 | Ga0495668_0087184_109_1320 | 345 |
| 101 | 3300046642 | Ga0495634_0018765 | Ga0495634_0018765_2248_3384 | 345 |
| 102 | 3300049572 | Ga0501036_0058962 | Ga0501036_0058962_62_1189 | 345 |
| 103 | 3300049573 | Ga0501037_0115164 | Ga0501037_0115164_270_1397 | 345 |
| 104 | 3300049575 | Ga0501039_0270729 | Ga0501039_0270729_177_1304 | 345 |
| 105 | 3300049589 | Ga0501073_0020718 | Ga0501073_0020718_3312_4439 | 345 |
| 106 | 3300049742 | Ga0501080_0192634 | Ga0501080_0192634_192_1319 | 345 |
| 107 | 3300049822 | Ga0501035_0332735 | Ga0501035_0332735_61_1188 | 345 |
| 108 | 3300053085 | Ga0495619_0126123 | Ga0495619_0126123_171_1370 | 345 |
| 109 | 3300013104 | Ga0157370_10066296 | Ga0157370_100662963 | 346 |
| 110 | 3300013307 | Ga0157372_10077343 | Ga0157372_100773433 | 346 |
| 111 | 3300048929 | Ga0496126_0115143 | Ga0496126_0115143_612_1754 | 346 |
| 112 | 3300049568 | Ga0501031_0000296 | Ga0501031_0000296_10163_11278 | 346 |
| 113 | 3300049569 | Ga0501032_0000244 | Ga0501032_0000244_34382_35497 | 346 |
| 114 | 3300049570 | Ga0501033_0001015 | Ga0501033_0001015_13298_14413 | 346 |
| 115 | 3300049571 | Ga0501034_0001010 | Ga0501034_0001010_13166_14281 | 346 |
| 116 | 3300049572 | Ga0501036_0000405 | Ga0501036_0000405_18083_19198 | 346 |
| 117 | 3300049573 | Ga0501037_0000139 | Ga0501037_0000139_32784_33899 | 346 |
| 118 | 3300049574 | Ga0501038_0000404 | Ga0501038_0000404_34099_35214 | 346 |
| 119 | 3300049579 | Ga0501043_0000021 | Ga0501043_0000021_126310_127425 | 346 |
| 120 | 3300049580 | Ga0501046_0000905 | Ga0501046_0000905_26271_27386 | 346 |
| 121 | 3300049581 | Ga0501047_0000041 | Ga0501047_0000041_26047_27162 | 346 |
| 122 | 3300049582 | Ga0501048_0000077 | Ga0501048_0000077_17101_18216 | 346 |
| 123 | 3300049583 | Ga0501067_0000360 | Ga0501067_0000360_23703_24818 | 346 |
| 124 | 3300049585 | Ga0501069_0000444 | Ga0501069_0000444_6831_7946 | 346 |
| 125 | 3300049586 | Ga0501070_0002561 | Ga0501070_0002561_13717_14832 | 346 |
| 126 | 3300049586 | Ga0501070_0068849 | Ga0501070_0068849_1183_2298 | 346 |
| 127 | 3300049589 | Ga0501073_0001489 | Ga0501073_0001489_13997_15112 | 346 |
| 128 | 3300049590 | Ga0501074_0001762 | Ga0501074_0001762_809_1924 | 346 |
| 129 | 3300049741 | Ga0501079_0002042 | Ga0501079_0002042_12346_13461 | 346 |
| 130 | 3300049744 | Ga0501083_0000708 | Ga0501083_0000708_10881_11996 | 346 |
| 131 | 3300049822 | Ga0501035_0000090 | Ga0501035_0000090_78579_79694 | 346 |
| 132 | 3300049823 | Ga0501044_0000054 | Ga0501044_0000054_114238_115353 | 346 |
| 133 | 3300049824 | Ga0501045_0007035 | Ga0501045_0007035_761_1876 | 346 |
| 134 | 3300060353 | Ga0501082_0026365 | Ga0501082_0026365_3400_4515 | 346 |
| 135 | 3300005434 | Ga0070709_10045389 | Ga0070709_100453892 | 347 |
| 136 | 3300005439 | Ga0070711_100006985 | Ga0070711_1000069854 | 347 |
| 137 | 3300005614 | Ga0068856_100037475 | Ga0068856_1000374754 | 347 |
| 138 | 3300005843 | Ga0068860_100000562 | Ga0068860_1000005628 | 347 |
| 139 | 3300013105 | Ga0157369_10034405 | Ga0157369_100344054 | 347 |
| 140 | 3300025913 | Ga0207695_10042402 | Ga0207695_100424023 | 347 |
| 141 | 3300025915 | Ga0207693_10132937 | Ga0207693_101329372 | 347 |
| 142 | 3300025944 | Ga0207661_10181476 | Ga0207661_101814761 | 347 |
| 143 | 3300026142 | Ga0207698_10079451 | Ga0207698_100794511 | 347 |
| 144 | 3300028381 | Ga0268264_10000096 | Ga0268264_1000009675 | 347 |
| 145 | 3300037418 | Ga0395900_0028027 | Ga0395900_0028027_1449_2582 | 347 |
| 146 | 3300037466 | Ga0395898_0141147 | Ga0395898_0141147_778_1911 | 347 |
| 147 | 3300049744 | Ga0501083_0002409 | Ga0501083_0002409_3487_4578 | 347 |
| 148 | 3300037418 | Ga0395900_0024496 | Ga0395900_0024496_2680_3813 | 348 |
| 149 | 3300037466 | Ga0395898_0136672 | Ga0395898_0136672_993_2126 | 348 |
| 150 | 3300044683 | Ga0466965_0091243 | Ga0466965_0091243_54_1187 | 348 |
| 151 | 3300048929 | Ga0496126_0090086 | Ga0496126_0090086_547_1680 | 348 |
| 152 | 3300053094 | Ga0500566_0070936 | Ga0500566_0070936_406_1539 | 348 |
| 153 | 3300053111 | Ga0500572_004035 | Ga0500572_004035_504_1637 | 348 |
| 154 | 3300053136 | Ga0500559_0017573 | Ga0500559_0017573_1688_2821 | 348 |
| 155 | 3300053177 | Ga0500636_0000047 | Ga0500636_0000047_45662_46795 | 348 |
| 156 | 3300005336 | Ga0070680_100063307 | Ga0070680_1000633073 | 349 |
| 157 | 3300005535 | Ga0070684_100043470 | Ga0070684_1000434701 | 349 |
| 158 | 3300005563 | Ga0068855_100118529 | Ga0068855_1001185293 | 349 |
| 159 | 3300005842 | Ga0068858_100121995 | Ga0068858_1001219952 | 349 |
| 160 | 3300006847 | Ga0075431_100000774 | Ga0075431_10000077413 | 349 |
| 161 | 3300006880 | Ga0075429_100019740 | Ga0075429_1000197408 | 349 |
| 162 | 3300013105 | Ga0157369_10112993 | Ga0157369_101129931 | 349 |
| 163 | 3300014968 | Ga0157379_10033391 | Ga0157379_100333913 | 349 |
| 164 | 3300025949 | Ga0207667_10105403 | Ga0207667_101054031 | 349 |
| 165 | 3300026116 | Ga0207674_10165571 | Ga0207674_101655712 | 349 |
| 166 | 3300035116 | Ga0373945_0028606 | Ga0373945_0028606_59_1192 | 349 |
| 167 | 3300035170 | Ga0373943_0050791 | Ga0373943_0050791_342_1475 | 349 |
| 168 | 3300046690 | Ga0495624_0032910 | Ga0495624_0032910_1336_2469 | 349 |
| 169 | 3300048908 | Ga0496105_0033535 | Ga0496105_0033535_129_1379 | 349 |
| 170 | 3300048909 | Ga0496106_0059357 | Ga0496106_0059357_1630_2880 | 349 |
| 171 | 3300048912 | Ga0496109_0026508 | Ga0496109_0026508_1950_3200 | 349 |
| 172 | 3300048915 | Ga0496112_0015924 | Ga0496112_0015924_1738_2988 | 349 |
| 173 | 3300048915 | Ga0496112_0166345 | Ga0496112_0166345_841_1974 | 349 |
| 174 | 3300048918 | Ga0496115_0037010 | Ga0496115_0037010_1279_2529 | 349 |
| 175 | 3300009093 | Ga0105240_10522574 | Ga0105240_105225741 | 350 |
| 176 | 3300049742 | Ga0501080_0121593 | Ga0501080_0121593_735_1874 | 350 |
| 177 | 3300005262 | Ga0065165_1024748 | Ga0065165_10247482 | 351 |
| 178 | 3300005435 | Ga0070714_100056531 | Ga0070714_1000565312 | 351 |
| 179 | 3300006038 | Ga0075365_10147405 | Ga0075365_101474052 | 351 |
| 180 | 3300049581 | Ga0501047_0113080 | Ga0501047_0113080_255_1385 | 351 |
| 181 | 3300049583 | Ga0501067_0075829 | Ga0501067_0075829_753_1841 | 351 |
| 182 | 3300050490 | nmdc:mga03n38_18250_c1 | nmdc:mga03n38_18250_c1_1549_2712 | 351 |
| 183 | 3300050492 | nmdc:mga0yw44_131569_c1 | nmdc:mga0yw44_131569_c1_417_1580 | 351 |
| 184 | 3300005329 | Ga0070683_100012630 | Ga0070683_1000126303 | 352 |
| 185 | 3300005535 | Ga0070684_100147360 | Ga0070684_1001473602 | 352 |
| 186 | 3300005563 | Ga0068855_100268339 | Ga0068855_1002683393 | 352 |
| 187 | 3300006048 | Ga0075363_100004607 | Ga0075363_1000046076 | 352 |
| 188 | 3300006051 | Ga0075364_10166750 | Ga0075364_101667502 | 352 |
| 189 | 3300006178 | Ga0075367_10000969 | Ga0075367_100009696 | 352 |
| 190 | 3300006353 | Ga0075370_10052846 | Ga0075370_100528463 | 352 |
| 191 | 3300006942 | Ga0099824_1006244 | Ga0099824_10062444 | 352 |
| 192 | 3300006943 | Ga0099822_1004519 | Ga0099822_10045193 | 352 |
| 193 | 3300021320 | Ga0214544_1000467 | Ga0214544_100046741 | 352 |
| 194 | 3300021321 | Ga0214542_1000185 | Ga0214542_100018541 | 352 |
| 195 | 3300021324 | Ga0214545_1000102 | Ga0214545_100010241 | 352 |
| 196 | 3300021324 | Ga0214545_1023945 | Ga0214545_10239452 | 352 |
| 197 | 3300021327 | Ga0214543_1000211 | Ga0214543_100021139 | 352 |
| 198 | 3300025921 | Ga0207652_10197783 | Ga0207652_101977832 | 352 |
| 199 | 3300025929 | Ga0207664_10234476 | Ga0207664_102344761 | 352 |
| 200 | 3300025944 | Ga0207661_10000945 | Ga0207661_100009459 | 352 |
| 201 | 3300025949 | Ga0207667_10222717 | Ga0207667_102227172 | 352 |
| 202 | 3300027357 | Ga0209589_1000004 | Ga0209589_100000427 | 352 |
| 203 | 3300027361 | Ga0209489_100004 | Ga0209489_10000427 | 352 |
| 204 | 3300027363 | Ga0209700_100004 | Ga0209700_10000427 | 352 |
| 205 | 3300031238 | Ga0265332_10002650 | Ga0265332_100026509 | 352 |
| 206 | 3300031247 | Ga0265340_10000765 | Ga0265340_1000076518 | 352 |
| 207 | 3300031249 | Ga0265339_10075589 | Ga0265339_100755892 | 352 |
| 208 | 3300031250 | Ga0265331_10034472 | Ga0265331_100344723 | 352 |
| 209 | 3300031344 | Ga0265316_10113638 | Ga0265316_101136383 | 352 |
| 210 | 3300031712 | Ga0265342_10000093 | Ga0265342_1000009338 | 352 |
| 211 | 3300035695 | Ga0373927_0014431 | Ga0373927_0014431_3599_4732 | 352 |
| 212 | 3300035725 | Ga0373947_0015845 | Ga0373947_0015845_2807_3940 | 352 |
| 213 | 3300037418 | Ga0395900_0139623 | Ga0395900_0139623_1175_2395 | 352 |
| 214 | 3300049575 | Ga0501039_0030683 | Ga0501039_0030683_2102_3268 | 352 |
| 215 | 3300049577 | Ga0501041_0075333 | Ga0501041_0075333_544_1710 | 352 |
| 216 | 3300049580 | Ga0501046_0090980 | Ga0501046_0090980_335_1465 | 352 |
| 217 | 3300049581 | Ga0501047_0156960 | Ga0501047_0156960_341_1489 | 352 |
| 218 | 3300049586 | Ga0501070_0008055 | Ga0501070_0008055_1556_2746 | 352 |
| 219 | 3300049588 | Ga0501072_0010225 | Ga0501072_0010225_5531_6697 | 352 |
| 220 | 3300049593 | Ga0501077_0006796 | Ga0501077_0006796_5088_6218 | 352 |
| 221 | 3300049743 | Ga0501081_0054467 | Ga0501081_0054467_1233_2399 | 352 |
| 222 | 3300049822 | Ga0501035_0000267 | Ga0501035_0000267_48173_49363 | 352 |
| 223 | 3300049824 | Ga0501045_0008407 | Ga0501045_0008407_3643_4773 | 352 |
| 224 | 3300050492 | nmdc:mga0yw44_31020_c1 | nmdc:mga0yw44_31020_c1_1673_2803 | 352 |
| 225 | 3300053142 | Ga0500577_0000032 | Ga0500577_0000032_19520_20680 | 352 |
| 226 | 3300054114 | Ga0501084_0032546 | Ga0501084_0032546_3022_4188 | 352 |
| 227 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_1000001473 | 353 |
| 228 | 3300005435 | Ga0070714_100184654 | Ga0070714_1001846542 | 353 |
| 229 | 3300005937 | Ga0081455_10085171 | Ga0081455_100851713 | 353 |
| 230 | 3300005983 | Ga0081540_1006269 | Ga0081540_10062694 | 353 |
| 231 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008215 | 353 |
| 232 | 3300006038 | Ga0075365_10021887 | Ga0075365_100218873 | 353 |
| 233 | 3300006173 | Ga0070716_100103903 | Ga0070716_1001039032 | 353 |
| 234 | 3300006871 | Ga0075434_100046214 | Ga0075434_1000462143 | 353 |
| 235 | 3300007076 | Ga0075435_100064028 | Ga0075435_1000640283 | 353 |
| 236 | 3300025295 | Ga0209564_1000792 | Ga0209564_10007928 | 353 |
| 237 | 3300025295 | Ga0209564_1005226 | Ga0209564_10052261 | 353 |
| 238 | 3300025302 | Ga0207426_1004240 | Ga0207426_10042404 | 353 |
| 239 | 3300025912 | Ga0207707_10008330 | Ga0207707_100083304 | 353 |
| 240 | 3300025912 | Ga0207707_10058775 | Ga0207707_100587752 | 353 |
| 241 | 3300025929 | Ga0207664_10106137 | Ga0207664_101061372 | 353 |
| 242 | 3300031712 | Ga0265342_10028573 | Ga0265342_100285732 | 353 |
| 243 | 3300035170 | Ga0373943_0000476 | Ga0373943_0000476_7424_8557 | 353 |
| 244 | 3300035692 | Ga0373935_0005953 | Ga0373935_0005953_1777_2910 | 353 |
| 245 | 3300035695 | Ga0373927_0001598 | Ga0373927_0001598_8136_9269 | 353 |
| 246 | 3300035725 | Ga0373947_0001677 | Ga0373947_0001677_7147_8280 | 353 |
| 247 | 3300036401 | Ga0373937_0052057 | Ga0373937_0052057_1718_2851 | 353 |
| 248 | 3300037068 | Ga0373925_0007402 | Ga0373925_0007402_3307_4440 | 353 |
| 249 | 3300037418 | Ga0395900_0280832 | Ga0395900_0280832_391_1524 | 353 |
| 250 | 3300037466 | Ga0395898_0051497 | Ga0395898_0051497_2324_3457 | 353 |
| 251 | 3300039437 | Ga0436365_0621937 | Ga0436365_0621937_234_1367 | 353 |
| 252 | 3300039437 | Ga0436365_1392756 | Ga0436365_1392756_949_2112 | 353 |
| 253 | 3300044684 | Ga0466966_0036712 | Ga0466966_0036712_667_1800 | 353 |
| 254 | 3300046455 | Ga0495603_0001190 | Ga0495603_0001190_5383_6516 | 353 |
| 255 | 3300046459 | Ga0495629_0002775 | Ga0495629_0002775_7908_9041 | 353 |
| 256 | 3300046461 | Ga0495641_0010906 | Ga0495641_0010906_1554_2687 | 353 |
| 257 | 3300046472 | Ga0495580_0001797 | Ga0495580_0001797_5383_6516 | 353 |
| 258 | 3300046473 | Ga0495582_0001266 | Ga0495582_0001266_11480_12613 | 353 |
| 259 | 3300046475 | Ga0495639_0019184 | Ga0495639_0019184_589_1722 | 353 |
| 260 | 3300046476 | Ga0495662_0000546 | Ga0495662_0000546_7810_8943 | 353 |
| 261 | 3300046516 | Ga0495628_0011329 | Ga0495628_0011329_1277_2410 | 353 |
| 262 | 3300046529 | Ga0495652_0076711 | Ga0495652_0076711_329_1462 | 353 |
| 263 | 3300046531 | Ga0495665_0000387 | Ga0495665_0000387_14187_15320 | 353 |
| 264 | 3300046543 | Ga0495645_0020519 | Ga0495645_0020519_2959_4074 | 353 |
| 265 | 3300046557 | Ga0495622_0029274 | Ga0495622_0029274_1429_2562 | 353 |
| 266 | 3300046642 | Ga0495634_0002816 | Ga0495634_0002816_7885_9018 | 353 |
| 267 | 3300046663 | Ga0495635_0001522 | Ga0495635_0001522_8539_9672 | 353 |
| 268 | 3300046674 | Ga0495588_0077723 | Ga0495588_0077723_35_1168 | 353 |
| 269 | 3300046680 | Ga0495646_0018443 | Ga0495646_0018443_3112_4245 | 353 |
| 270 | 3300046681 | Ga0495647_0000516 | Ga0495647_0000516_6275_7408 | 353 |
| 271 | 3300046689 | Ga0495613_0013591 | Ga0495613_0013591_3325_4458 | 353 |
| 272 | 3300046690 | Ga0495624_0003648 | Ga0495624_0003648_2161_3294 | 353 |
| 273 | 3300047315 | Ga0495581_0001283 | Ga0495581_0001283_11581_12714 | 353 |
| 274 | 3300047319 | Ga0495674_0069601 | Ga0495674_0069601_750_1883 | 353 |
| 275 | 3300047471 | Ga0495684_0061574 | Ga0495684_0061574_1073_2206 | 353 |
| 276 | 3300047472 | Ga0495686_0147645 | Ga0495686_0147645_26_1192 | 353 |
| 277 | 3300047673 | Ga0495593_0001105 | Ga0495593_0001105_1368_2501 | 353 |
| 278 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_307256_308404 | 353 |
| 279 | 3300048918 | Ga0496115_0196383 | Ga0496115_0196383_13_1224 | 353 |
| 280 | 3300048920 | Ga0496117_0071314 | Ga0496117_0071314_846_1979 | 353 |
| 281 | 3300048921 | Ga0496118_0039843 | Ga0496118_0039843_1800_2933 | 353 |
| 282 | 3300048922 | Ga0496119_0039685 | Ga0496119_0039685_1295_2428 | 353 |
| 283 | 3300048924 | Ga0496121_0001934 | Ga0496121_0001934_20614_21747 | 353 |
| 284 | 3300048924 | Ga0496121_0129371 | Ga0496121_0129371_469_1602 | 353 |
| 285 | 3300048929 | Ga0496126_0160985 | Ga0496126_0160985_774_1904 | 353 |
| 286 | 3300049571 | Ga0501034_0382279 | Ga0501034_0382279_140_1279 | 353 |
| 287 | 3300049579 | Ga0501043_0029175 | Ga0501043_0029175_148_1281 | 353 |
| 288 | 3300049822 | Ga0501035_0021609 | Ga0501035_0021609_2291_3472 | 353 |
| 289 | 3300049823 | Ga0501044_0148209 | Ga0501044_0148209_608_1789 | 353 |
| 290 | 3300050512 | nmdc:mga0n895_45416_c1 | nmdc:mga0n895_45416_c1_2194_3327 | 353 |
| 291 | 3300050513 | nmdc:mga0rr50_54179_c1 | nmdc:mga0rr50_54179_c1_1313_2446 | 353 |
| 292 | 3300053077 | Ga0495601_0019185 | Ga0495601_0019185_754_1869 | 353 |
| 293 | 3300053093 | Ga0500651_0013266 | Ga0500651_0013266_2332_3465 | 353 |
| 294 | 3300053098 | Ga0500650_0001791 | Ga0500650_0001791_3083_4198 | 353 |
| 295 | 3300053116 | Ga0500592_006308 | Ga0500592_006308_250_1383 | 353 |
| 296 | 3300053119 | Ga0500595_005423 | Ga0500595_005423_2443_3576 | 353 |
| 297 | 3300053130 | Ga0500642_0012395 | Ga0500642_0012395_220_1353 | 353 |
| 298 | 3300053139 | Ga0500568_0006894 | Ga0500568_0006894_3566_4681 | 353 |
| 299 | 3300053150 | Ga0500603_038286 | Ga0500603_038286_78_1211 | 353 |
| 300 | 3300053151 | Ga0500604_0000656 | Ga0500604_0000656_33_1148 | 353 |
| 301 | 3300053730 | Ga0500645_015410 | Ga0500645_015410_928_2067 | 353 |
| 302 | 3300003354 | JGI25160J50197_1006602 | JGI25160J50197_10066024 | 354 |
| 303 | 3300003659 | JGI25404J52841_10009833 | JGI25404J52841_100098332 | 354 |
| 304 | 3300003659 | JGI25404J52841_10011033 | JGI25404J52841_100110332 | 354 |
| 305 | 3300003762 | Ga0055542_1003874 | Ga0055542_10038743 | 354 |
| 306 | 3300005331 | Ga0070670_100144944 | Ga0070670_1001449442 | 354 |
| 307 | 3300005334 | Ga0068869_100040444 | Ga0068869_1000404442 | 354 |
| 308 | 3300005439 | Ga0070711_100012265 | Ga0070711_1000122655 | 354 |
| 309 | 3300005455 | Ga0070663_100071948 | Ga0070663_1000719483 | 354 |
| 310 | 3300005471 | Ga0070698_100230579 | Ga0070698_1002305791 | 354 |
| 311 | 3300005548 | Ga0070665_100058037 | Ga0070665_1000580374 | 354 |
| 312 | 3300005563 | Ga0068855_100064883 | Ga0068855_1000648833 | 354 |
| 313 | 3300005578 | Ga0068854_100056325 | Ga0068854_1000563252 | 354 |
| 314 | 3300005937 | Ga0081455_10004709 | Ga0081455_1000470917 | 354 |
| 315 | 3300005983 | Ga0081540_1014526 | Ga0081540_10145262 | 354 |
| 316 | 3300005983 | Ga0081540_1020861 | Ga0081540_10208613 | 354 |
| 317 | 3300006038 | Ga0075365_10002418 | Ga0075365_100024184 | 354 |
| 318 | 3300006048 | Ga0075363_100095898 | Ga0075363_1000958981 | 354 |
| 319 | 3300006051 | Ga0075364_10005987 | Ga0075364_100059874 | 354 |
| 320 | 3300006178 | Ga0075367_10068864 | Ga0075367_100688642 | 354 |
| 321 | 3300006178 | Ga0075367_10176390 | Ga0075367_101763901 | 354 |
| 322 | 3300006195 | Ga0075366_10041025 | Ga0075366_100410253 | 354 |
| 323 | 3300006353 | Ga0075370_10010442 | Ga0075370_100104423 | 354 |
| 324 | 3300006353 | Ga0075370_10041822 | Ga0075370_100418222 | 354 |
| 325 | 3300009093 | Ga0105240_10003963 | Ga0105240_1000396317 | 354 |
| 326 | 3300009098 | Ga0105245_10162754 | Ga0105245_101627542 | 354 |
| 327 | 3300009174 | Ga0105241_10080881 | Ga0105241_100808811 | 354 |
| 328 | 3300009176 | Ga0105242_10184154 | Ga0105242_101841542 | 354 |
| 329 | 3300009545 | Ga0105237_10001028 | Ga0105237_100010288 | 354 |
| 330 | 3300025254 | Ga0209148_1001411 | Ga0209148_10014113 | 354 |
| 331 | 3300025295 | Ga0209564_1010806 | Ga0209564_10108062 | 354 |
| 332 | 3300025297 | Ga0209758_1000075 | Ga0209758_1000075255 | 354 |
| 333 | 3300025297 | Ga0209758_1000187 | Ga0209758_10001874 | 354 |
| 334 | 3300025302 | Ga0207426_1000422 | Ga0207426_100042262 | 354 |
| 335 | 3300025304 | Ga0209257_1002081 | Ga0209257_10020814 | 354 |
| 336 | 3300025735 | Ga0207713_1027411 | Ga0207713_10274113 | 354 |
| 337 | 3300025911 | Ga0207654_10016873 | Ga0207654_100168733 | 354 |
| 338 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029301 | 354 |
| 339 | 3300025913 | Ga0207695_10122854 | Ga0207695_101228542 | 354 |
| 340 | 3300025914 | Ga0207671_10012690 | Ga0207671_100126907 | 354 |
| 341 | 3300025914 | Ga0207671_10046290 | Ga0207671_100462903 | 354 |
| 342 | 3300025916 | Ga0207663_10067713 | Ga0207663_100677132 | 354 |
| 343 | 3300025941 | Ga0207711_10021861 | Ga0207711_100218614 | 354 |
| 344 | 3300025949 | Ga0207667_10064284 | Ga0207667_100642843 | 354 |
| 345 | 3300025981 | Ga0207640_10077037 | Ga0207640_100770372 | 354 |
| 346 | 3300026116 | Ga0207674_10159944 | Ga0207674_101599441 | 354 |
| 347 | 3300026121 | Ga0207683_10152480 | Ga0207683_101524801 | 354 |
| 348 | 3300035116 | Ga0373945_0012819 | Ga0373945_0012819_293_1435 | 354 |
| 349 | 3300035692 | Ga0373935_0099940 | Ga0373935_0099940_480_1622 | 354 |
| 350 | 3300035695 | Ga0373927_0032564 | Ga0373927_0032564_458_1600 | 354 |
| 351 | 3300037068 | Ga0373925_0087648 | Ga0373925_0087648_325_1467 | 354 |
| 352 | 3300044656 | Ga0466969_0031674 | Ga0466969_0031674_565_1698 | 354 |
| 353 | 3300044684 | Ga0466966_0000524 | Ga0466966_0000524_8190_9323 | 354 |
| 354 | 3300044693 | Ga0466961_0000795 | Ga0466961_0000795_7850_8983 | 354 |
| 355 | 3300044694 | Ga0466963_0083566 | Ga0466963_0083566_909_2057 | 354 |
| 356 | 3300044719 | Ga0466971_0114284 | Ga0466971_0114284_33_1166 | 354 |
| 357 | 3300046455 | Ga0495603_0084110 | Ga0495603_0084110_321_1535 | 354 |
| 358 | 3300046518 | Ga0495631_0052300 | Ga0495631_0052300_388_1521 | 354 |
| 359 | 3300046679 | Ga0495623_0128608 | Ga0495623_0128608_305_1438 | 354 |
| 360 | 3300048905 | Ga0496102_0174949 | Ga0496102_0174949_53_1195 | 354 |
| 361 | 3300048909 | Ga0496106_0148896 | Ga0496106_0148896_590_1732 | 354 |
| 362 | 3300048909 | Ga0496106_0187769 | Ga0496106_0187769_354_1496 | 354 |
| 363 | 3300048912 | Ga0496109_0166736 | Ga0496109_0166736_236_1579 | 354 |
| 364 | 3300048915 | Ga0496112_0258513 | Ga0496112_0258513_407_1543 | 354 |
| 365 | 3300048924 | Ga0496121_0074916 | Ga0496121_0074916_1041_2351 | 354 |
| 366 | 3300048928 | Ga0496125_0060665 | Ga0496125_0060665_1441_2574 | 354 |
| 367 | 3300049569 | Ga0501032_0055262 | Ga0501032_0055262_119_1255 | 354 |
| 368 | 3300049570 | Ga0501033_0030771 | Ga0501033_0030771_1697_2884 | 354 |
| 369 | 3300049571 | Ga0501034_0164405 | Ga0501034_0164405_423_1559 | 354 |
| 370 | 3300049571 | Ga0501034_0210784 | Ga0501034_0210784_55_1191 | 354 |
| 371 | 3300049572 | Ga0501036_0083358 | Ga0501036_0083358_656_1792 | 354 |
| 372 | 3300049573 | Ga0501037_0051819 | Ga0501037_0051819_119_1255 | 354 |
| 373 | 3300049574 | Ga0501038_0024056 | Ga0501038_0024056_3586_4722 | 354 |
| 374 | 3300049574 | Ga0501038_0042165 | Ga0501038_0042165_1093_2229 | 354 |
| 375 | 3300049574 | Ga0501038_0054679 | Ga0501038_0054679_1327_2463 | 354 |
| 376 | 3300049576 | Ga0501040_0039520 | Ga0501040_0039520_1721_2857 | 354 |
| 377 | 3300049578 | Ga0501042_0107777 | Ga0501042_0107777_582_1718 | 354 |
| 378 | 3300049579 | Ga0501043_0041962 | Ga0501043_0041962_1385_2521 | 354 |
| 379 | 3300049579 | Ga0501043_0064795 | Ga0501043_0064795_1191_2327 | 354 |
| 380 | 3300049579 | Ga0501043_0138582 | Ga0501043_0138582_350_1486 | 354 |
| 381 | 3300049580 | Ga0501046_0041933 | Ga0501046_0041933_1544_2680 | 354 |
| 382 | 3300049582 | Ga0501048_0027330 | Ga0501048_0027330_2537_3673 | 354 |
| 383 | 3300049583 | Ga0501067_0011133 | Ga0501067_0011133_2710_3846 | 354 |
| 384 | 3300049586 | Ga0501070_0088098 | Ga0501070_0088098_985_2121 | 354 |
| 385 | 3300049588 | Ga0501072_0083803 | Ga0501072_0083803_220_1356 | 354 |
| 386 | 3300049589 | Ga0501073_0037651 | Ga0501073_0037651_119_1255 | 354 |
| 387 | 3300049590 | Ga0501074_0083318 | Ga0501074_0083318_1118_2254 | 354 |
| 388 | 3300049742 | Ga0501080_0108320 | Ga0501080_0108320_479_1615 | 354 |
| 389 | 3300049744 | Ga0501083_0072999 | Ga0501083_0072999_1097_2233 | 354 |
| 390 | 3300049822 | Ga0501035_0121893 | Ga0501035_0121893_684_1820 | 354 |
| 391 | 3300049822 | Ga0501035_0183049 | Ga0501035_0183049_248_1384 | 354 |
| 392 | 3300049823 | Ga0501044_0077406 | Ga0501044_0077406_1057_2193 | 354 |
| 393 | 3300049824 | Ga0501045_0012653 | Ga0501045_0012653_1740_2876 | 354 |
| 394 | 3300050490 | nmdc:mga03n38_2618_c1 | nmdc:mga03n38_2618_c1_1343_2485 | 354 |
| 395 | 3300050491 | nmdc:mga00v17_161450_c1 | nmdc:mga00v17_161450_c1_138_1280 | 354 |
| 396 | 3300050491 | nmdc:mga00v17_194944_c1 | nmdc:mga00v17_194944_c1_110_1252 | 354 |
| 397 | 3300050491 | nmdc:mga00v17_9734_c1 | nmdc:mga00v17_9734_c1_3494_4639 | 354 |
| 398 | 3300050494 | nmdc:mga06z11_44560_c1 | nmdc:mga06z11_44560_c1_865_2007 | 354 |
| 399 | 3300053085 | Ga0495619_0159242 | Ga0495619_0159242_119_1240 | 354 |
| 400 | 3300054114 | Ga0501084_0085733 | Ga0501084_0085733_1400_2536 | 354 |
| 401 | 3300005937 | Ga0081455_10000419 | Ga0081455_1000041936 | 355 |
| 402 | 3300031249 | Ga0265339_10061601 | Ga0265339_100616011 | 355 |
| 403 | 3300031250 | Ga0265331_10032161 | Ga0265331_100321612 | 355 |
| 404 | 3300031344 | Ga0265316_10167878 | Ga0265316_101678782 | 355 |
| 405 | 3300042436 | Ga0439435_0002684 | Ga0439435_0002684_2041_3207 | 355 |
| 406 | 3300049744 | Ga0501083_0005494 | Ga0501083_0005494_1538_2656 | 355 |
| 407 | iso_pu_bacteria | 3003665799 | 3003668041 | 355 |
| 408 | 3300031548 | Ga0307408_100007113 | Ga0307408_1000071135 | 356 |
| 409 | 3300049571 | Ga0501034_0041774 | Ga0501034_0041774_1618_2748 | 356 |
| 410 | 3300049581 | Ga0501047_0096235 | Ga0501047_0096235_604_1734 | 356 |
| 411 | 3300049590 | Ga0501074_0082198 | Ga0501074_0082198_778_1908 | 356 |
| 412 | 3300049822 | Ga0501035_0174629 | Ga0501035_0174629_147_1277 | 356 |
| 413 | 3300053098 | Ga0500650_0022327 | Ga0500650_0022327_736_1869 | 356 |
| 414 | 3300005842 | Ga0068858_100167218 | Ga0068858_1001672182 | 357 |
| 415 | 3300005981 | Ga0081538_10012089 | Ga0081538_100120892 | 357 |
| 416 | 3300006944 | Ga0099823_1020076 | Ga0099823_10200763 | 357 |
| 417 | 3300027296 | Ga0209389_1000003 | Ga0209389_100000335 | 357 |
| 418 | 3300027361 | Ga0209489_100022 | Ga0209489_10002211 | 357 |
| 419 | 3300027363 | Ga0209700_100023 | Ga0209700_10002334 | 357 |
| 420 | 3300049583 | Ga0501067_0000771 | Ga0501067_0000771_12925_14016 | 357 |
| 421 | 3300049590 | Ga0501074_0077587 | Ga0501074_0077587_570_1661 | 357 |
| 422 | 3300005539 | Ga0068853_100004427 | Ga0068853_1000044275 | 358 |
| 423 | 3300005577 | Ga0068857_100012531 | Ga0068857_1000125314 | 358 |
| 424 | 3300005578 | Ga0068854_100054196 | Ga0068854_1000541962 | 358 |
| 425 | 3300005614 | Ga0068856_100067052 | Ga0068856_1000670523 | 358 |
| 426 | 3300005834 | Ga0068851_10009190 | Ga0068851_100091901 | 358 |
| 427 | 3300009174 | Ga0105241_10002379 | Ga0105241_1000237910 | 358 |
| 428 | 3300010375 | Ga0105239_10053277 | Ga0105239_100532771 | 358 |
| 429 | 3300021361 | Ga0213872_10064105 | Ga0213872_100641052 | 358 |
| 430 | 3300025913 | Ga0207695_10008792 | Ga0207695_100087923 | 358 |
| 431 | 3300025924 | Ga0207694_10000275 | Ga0207694_1000027537 | 358 |
| 432 | 3300025949 | Ga0207667_10021708 | Ga0207667_100217082 | 358 |
| 433 | 3300026041 | Ga0207639_10097624 | Ga0207639_100976242 | 358 |
| 434 | 3300026067 | Ga0207678_10020774 | Ga0207678_100207743 | 358 |
| 435 | 3300026078 | Ga0207702_10000026 | Ga0207702_10000026171 | 358 |
| 436 | 3300026116 | Ga0207674_10002526 | Ga0207674_100025265 | 358 |
| 437 | 3300039447 | Ga0436361_0721014 | Ga0436361_0721014_176_1309 | 358 |
| 438 | 3300046460 | Ga0495638_0099888 | Ga0495638_0099888_566_1696 | 358 |
| 439 | 3300046501 | Ga0495607_0020117 | Ga0495607_0020117_1631_2761 | 358 |
| 440 | 3300046512 | Ga0495610_0015826 | Ga0495610_0015826_2393_3523 | 358 |
| 441 | 3300046513 | Ga0495616_0007418 | Ga0495616_0007418_980_2110 | 358 |
| 442 | 3300046616 | Ga0495668_0164476 | Ga0495668_0164476_45_1175 | 358 |
| 443 | 3300046665 | Ga0495661_0052158 | Ga0495661_0052158_435_1565 | 358 |
| 444 | 3300046691 | Ga0495670_0004128 | Ga0495670_0004128_467_1597 | 358 |
| 445 | 3300047472 | Ga0495686_0022878 | Ga0495686_0022878_1087_2217 | 358 |
| 446 | 3300048924 | Ga0496121_0008559 | Ga0496121_0008559_5768_6898 | 358 |
| 447 | 3300048925 | Ga0496122_0078647 | Ga0496122_0078647_94_1224 | 358 |
| 448 | 3300048928 | Ga0496125_0003409 | Ga0496125_0003409_8365_9495 | 358 |
| 449 | 3300050492 | nmdc:mga0yw44_151537_c1 | nmdc:mga0yw44_151537_c1_278_1408 | 358 |
| 450 | 3300053086 | Ga0500578_0076118 | Ga0500578_0076118_659_1789 | 358 |
| 451 | 3300053087 | Ga0500643_002090 | Ga0500643_002090_5191_6321 | 358 |
| 452 | 3300053087 | Ga0500643_019553 | Ga0500643_019553_1068_2198 | 358 |
| 453 | 3300053088 | Ga0500644_0009687 | Ga0500644_0009687_355_1485 | 358 |
| 454 | 3300053090 | Ga0500646_0008367 | Ga0500646_0008367_1212_2342 | 358 |
| 455 | 3300053094 | Ga0500566_0001394 | Ga0500566_0001394_8413_9543 | 358 |
| 456 | 3300053094 | Ga0500566_0032406 | Ga0500566_0032406_1256_2386 | 358 |
| 457 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_77525_78655 | 358 |
| 458 | 3300053109 | Ga0500569_019211 | Ga0500569_019211_424_1554 | 358 |
| 459 | 3300053119 | Ga0500595_000083 | Ga0500595_000083_58173_59303 | 358 |
| 460 | 3300053119 | Ga0500595_003722 | Ga0500595_003722_2453_3658 | 358 |
| 461 | 3300053122 | Ga0500608_015771 | Ga0500608_015771_2173_3303 | 358 |
| 462 | 3300053130 | Ga0500642_0000044 | Ga0500642_0000044_76947_78077 | 358 |
| 463 | 3300053131 | Ga0500652_000006 | Ga0500652_000006_115006_116211 | 358 |
| 464 | 3300053131 | Ga0500652_000639 | Ga0500652_000639_5951_7081 | 358 |
| 465 | 3300053136 | Ga0500559_0000130 | Ga0500559_0000130_14335_15465 | 358 |
| 466 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_152893_154023 | 358 |
| 467 | 3300053156 | Ga0500622_0063860 | Ga0500622_0063860_526_1656 | 358 |
| 468 | 3300053161 | Ga0500634_0079328 | Ga0500634_0079328_131_1261 | 358 |
| 469 | 3300053177 | Ga0500636_0003542 | Ga0500636_0003542_7621_8754 | 358 |
| 470 | 3300053177 | Ga0500636_0010447 | Ga0500636_0010447_1870_3075 | 358 |
| 471 | 3300053730 | Ga0500645_031589 | Ga0500645_031589_145_1275 | 358 |
| 472 | 3300006942 | Ga0099824_1025327 | Ga0099824_10253273 | 359 |
| 473 | 3300025261 | Ga0209233_1008287 | Ga0209233_10082873 | 359 |
| 474 | 3300025297 | Ga0209758_1015233 | Ga0209758_10152332 | 359 |
| 475 | 3300027296 | Ga0209389_1000126 | Ga0209389_100012612 | 359 |
| 476 | 3300027357 | Ga0209589_1000209 | Ga0209589_100020913 | 359 |
| 477 | 3300027361 | Ga0209489_100144 | Ga0209489_10014444 | 359 |
| 478 | 3300046524 | Ga0495648_0005337 | Ga0495648_0005337_1152_2285 | 359 |
| 479 | 3300049577 | Ga0501041_0052106 | Ga0501041_0052106_25_1131 | 359 |
| 480 | 3300049593 | Ga0501077_0004224 | Ga0501077_0004224_7297_8403 | 359 |
| 481 | 3300049741 | Ga0501079_0038773 | Ga0501079_0038773_687_1793 | 359 |
| 482 | 3300049743 | Ga0501081_0006165 | Ga0501081_0006165_1899_3005 | 359 |
| 483 | 3300003354 | JGI25160J50197_1006147 | JGI25160J50197_10061473 | 360 |
| 484 | 3300005336 | Ga0070680_100069347 | Ga0070680_1000693472 | 360 |
| 485 | 3300005339 | Ga0070660_100086700 | Ga0070660_1000867002 | 360 |
| 486 | 3300005458 | Ga0070681_10046810 | Ga0070681_100468102 | 360 |
| 487 | 3300005530 | Ga0070679_100066163 | Ga0070679_1000661631 | 360 |
| 488 | 3300005563 | Ga0068855_100039924 | Ga0068855_1000399245 | 360 |
| 489 | 3300025919 | Ga0207657_10012757 | Ga0207657_100127574 | 360 |
| 490 | 3300025949 | Ga0207667_10027726 | Ga0207667_100277264 | 360 |
| 491 | 3300031595 | Ga0265313_10019090 | Ga0265313_100190904 | 360 |
| 492 | 3300031712 | Ga0265342_10000761 | Ga0265342_1000076130 | 360 |
| 493 | 3300039437 | Ga0436365_0356842 | Ga0436365_0356842_13124_14209 | 360 |
| 494 | 3300039450 | Ga0436363_0538450 | Ga0436363_0538450_7280_8365 | 360 |
| 495 | 3300046491 | Ga0495584_0140992 | Ga0495584_0140992_113_1201 | 360 |
| 496 | 3300005546 | Ga0070696_100225897 | Ga0070696_1002258971 | 361 |
| 497 | 3300009553 | Ga0105249_10035195 | Ga0105249_100351951 | 361 |
| 498 | 3300035725 | Ga0373947_0098428 | Ga0373947_0098428_255_1343 | 361 |
| 499 | 3300037853 | Ga0436364_1228736 | Ga0436364_1228736_1205_2293 | 361 |
| 500 | 3300041408 | Ga0439453_0002956 | Ga0439453_0002956_1236_2372 | 361 |
| 501 | 3300048907 | Ga0496104_0030422 | Ga0496104_0030422_792_1880 | 361 |
| 502 | 3300048908 | Ga0496105_0025477 | Ga0496105_0025477_3308_4396 | 361 |
| 503 | 3300048911 | Ga0496108_0018138 | Ga0496108_0018138_2196_3284 | 361 |
| 504 | 3300048912 | Ga0496109_0002174 | Ga0496109_0002174_6780_7868 | 361 |
| 505 | 3300048914 | Ga0496111_0025729 | Ga0496111_0025729_2375_3463 | 361 |
| 506 | 3300048916 | Ga0496113_0015918 | Ga0496113_0015918_3239_4327 | 361 |
| 507 | 3300048917 | Ga0496114_0127032 | Ga0496114_0127032_215_1303 | 361 |
| 508 | 3300050490 | nmdc:mga03n38_10860_c1 | nmdc:mga03n38_10860_c1_138_1283 | 361 |
| 509 | 3300050494 | nmdc:mga06z11_2319_c1 | nmdc:mga06z11_2319_c1_1765_2910 | 361 |
| 510 | 3300006042 | Ga0075368_10006102 | Ga0075368_100061024 | 362 |
| 511 | 3300006173 | Ga0070716_100031647 | Ga0070716_1000316472 | 362 |
| 512 | 3300006178 | Ga0075367_10082613 | Ga0075367_100826132 | 362 |
| 513 | 3300006186 | Ga0075369_10035439 | Ga0075369_100354392 | 362 |
| 514 | 3300006237 | Ga0097621_100063763 | Ga0097621_1000637632 | 362 |
| 515 | 3300009098 | Ga0105245_10019119 | Ga0105245_100191195 | 362 |
| 516 | 3300013296 | Ga0157374_10025470 | Ga0157374_100254706 | 362 |
| 517 | 3300013306 | Ga0163162_10027897 | Ga0163162_100278975 | 362 |
| 518 | 3300013308 | Ga0157375_10042851 | Ga0157375_100428513 | 362 |
| 519 | 3300014325 | Ga0163163_10032906 | Ga0163163_100329065 | 362 |
| 520 | 3300014968 | Ga0157379_10022881 | Ga0157379_100228815 | 362 |
| 521 | 3300014969 | Ga0157376_10011670 | Ga0157376_100116704 | 362 |
| 522 | 3300025927 | Ga0207687_10058843 | Ga0207687_100588432 | 362 |
| 523 | 3300025939 | Ga0207665_10201864 | Ga0207665_102018642 | 362 |
| 524 | 3300031344 | Ga0265316_10096701 | Ga0265316_100967012 | 362 |
| 525 | 3300044694 | Ga0466963_0020679 | Ga0466963_0020679_1262_2392 | 362 |
| 526 | 3300045976 | Ga0466967_0033042 | Ga0466967_0033042_1181_2311 | 362 |
| 527 | 3300046536 | Ga0495587_0012911 | Ga0495587_0012911_4150_5241 | 362 |
| 528 | 3300048905 | Ga0496102_0007915 | Ga0496102_0007915_2984_4075 | 362 |
| 529 | 3300048909 | Ga0496106_0015179 | Ga0496106_0015179_2974_4065 | 362 |
| 530 | 3300048912 | Ga0496109_0026931 | Ga0496109_0026931_2157_3248 | 362 |
| 531 | 3300048914 | Ga0496111_0019946 | Ga0496111_0019946_2627_3718 | 362 |
| 532 | 3300048917 | Ga0496114_0381658 | Ga0496114_0381658_90_1181 | 362 |
| 533 | 3300050492 | nmdc:mga0yw44_78344_c1 | nmdc:mga0yw44_78344_c1_837_1988 | 362 |
| 534 | 3300053085 | Ga0495619_0264599 | Ga0495619_0264599_83_1174 | 362 |
| 535 | 3300009551 | Ga0105238_10059607 | Ga0105238_100596072 | 363 |
| 536 | 3300025929 | Ga0207664_10073102 | Ga0207664_100731023 | 363 |
| 537 | iso_pu_bacteria | 2523231067 | 2523469747 | 363 |
| 538 | iso_pu_bacteria | 2922386360 | 2922386804 | 363 |
| 539 | 3300005434 | Ga0070709_10083770 | Ga0070709_100837702 | 364 |
| 540 | 3300009551 | Ga0105238_10060156 | Ga0105238_100601564 | 364 |
| 541 | 3300039450 | Ga0436363_1324669 | Ga0436363_1324669_647_1786 | 364 |
| 542 | 3300039453 | Ga0436362_0668050 | Ga0436362_0668050_716_1849 | 364 |
| 543 | 3300048927 | Ga0496124_0009281 | Ga0496124_0009281_6974_8107 | 364 |
| 544 | 3300048928 | Ga0496125_0050358 | Ga0496125_0050358_659_1792 | 364 |
| 545 | 3300049741 | Ga0501079_0238025 | Ga0501079_0238025_128_1264 | 364 |
| 546 | 3300049823 | Ga0501044_0247679 | Ga0501044_0247679_302_1438 | 364 |
| 547 | 3300053077 | Ga0495601_0085039 | Ga0495601_0085039_433_1566 | 364 |
| 548 | 3300021384 | Ga0213876_10003126 | Ga0213876_100031264 | 365 |
| 549 | 3300025929 | Ga0207664_10333725 | Ga0207664_103337251 | 365 |
| 550 | 3300031235 | Ga0265330_10037409 | Ga0265330_100374093 | 365 |
| 551 | 3300031241 | Ga0265325_10003615 | Ga0265325_100036155 | 365 |
| 552 | 3300031247 | Ga0265340_10015947 | Ga0265340_100159474 | 365 |
| 553 | 3300031247 | Ga0265340_10030594 | Ga0265340_100305942 | 365 |
| 554 | 3300031249 | Ga0265339_10024234 | Ga0265339_100242342 | 365 |
| 555 | 3300031712 | Ga0265342_10068055 | Ga0265342_100680552 | 365 |
| 556 | 3300037471 | Ga0395905_0210773 | Ga0395905_0210773_79_1212 | 365 |
| 557 | 3300053096 | Ga0500641_0007479 | Ga0500641_0007479_1777_2949 | 365 |
| 558 | 3300037853 | Ga0436364_1105330 | Ga0436364_1105330_643_1746 | 366 |
| 559 | 3300037853 | Ga0436364_1346974 | Ga0436364_1346974_1806_2909 | 366 |
| 560 | 3300039437 | Ga0436365_0156475 | Ga0436365_0156475_1398_2501 | 366 |
| 561 | 3300039450 | Ga0436363_1520052 | Ga0436363_1520052_1617_2720 | 366 |
| 562 | 3300039453 | Ga0436362_0582461 | Ga0436362_0582461_1437_2540 | 366 |
| 563 | 3300045976 | Ga0466967_0198851 | Ga0466967_0198851_703_1836 | 366 |
| 564 | 3300047322 | Ga0495680_0192008 | Ga0495680_0192008_146_1279 | 366 |
| 565 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_165802_166935 | 366 |
| 566 | 3300050513 | nmdc:mga0rr50_187439_c1 | nmdc:mga0rr50_187439_c1_49_1167 | 366 |
| 567 | 3300031241 | Ga0265325_10090525 | Ga0265325_100905252 | 367 |
| 568 | 3300031247 | Ga0265340_10018100 | Ga0265340_100181002 | 367 |
| 569 | 3300031995 | Ga0307409_100240406 | Ga0307409_1002404062 | 367 |
| 570 | 3300039450 | Ga0436363_1434115 | Ga0436363_1434115_311_1432 | 367 |
| 571 | 3300046477 | Ga0495664_0186930 | Ga0495664_0186930_60_1196 | 367 |
| 572 | iso_pu_bacteria | 2513237087 | 2513589065 | 367 |
| 573 | 3300005337 | Ga0070682_100000979 | Ga0070682_1000009796 | 368 |
| 574 | 3300005341 | Ga0070691_10019647 | Ga0070691_100196472 | 368 |
| 575 | 3300005366 | Ga0070659_100008591 | Ga0070659_1000085916 | 368 |
| 576 | 3300005458 | Ga0070681_10008360 | Ga0070681_100083605 | 368 |
| 577 | 3300005530 | Ga0070679_100012608 | Ga0070679_1000126085 | 368 |
| 578 | 3300005539 | Ga0068853_100000659 | Ga0068853_1000006599 | 368 |
| 579 | 3300005547 | Ga0070693_100000988 | Ga0070693_1000009885 | 368 |
| 580 | 3300009545 | Ga0105237_10209164 | Ga0105237_102091643 | 368 |
| 581 | 3300013100 | Ga0157373_10003303 | Ga0157373_100033032 | 368 |
| 582 | 3300013104 | Ga0157370_10019379 | Ga0157370_100193792 | 368 |
| 583 | 3300013307 | Ga0157372_10005179 | Ga0157372_100051796 | 368 |
| 584 | 3300025912 | Ga0207707_10018940 | Ga0207707_100189406 | 368 |
| 585 | 3300025921 | Ga0207652_10024012 | Ga0207652_100240125 | 368 |
| 586 | 3300025921 | Ga0207652_10088380 | Ga0207652_100883803 | 368 |
| 587 | 3300025932 | Ga0207690_10005325 | Ga0207690_100053255 | 368 |
| 588 | 3300025949 | Ga0207667_10072770 | Ga0207667_100727704 | 368 |
| 589 | 3300031344 | Ga0265316_10011375 | Ga0265316_100113755 | 368 |
| 590 | 3300031711 | Ga0265314_10027160 | Ga0265314_100271602 | 368 |
| 591 | 3300049588 | Ga0501072_0007776 | Ga0501072_0007776_1536_2672 | 368 |
| 592 | 3300054114 | Ga0501084_0215866 | Ga0501084_0215866_471_1607 | 368 |
| 593 | 3300060353 | Ga0501082_0043153 | Ga0501082_0043153_1172_2308 | 368 |
| 594 | 3300013104 | Ga0157370_10053454 | Ga0157370_100534542 | 369 |
| 595 | 3300048922 | Ga0496119_0002237 | Ga0496119_0002237_16881_18005 | 369 |
| 596 | 3300048925 | Ga0496122_0000624 | Ga0496122_0000624_4996_6120 | 369 |
| 597 | 3300048926 | Ga0496123_0000569 | Ga0496123_0000569_18017_19141 | 369 |
| 598 | 3300049574 | Ga0501038_0339167 | Ga0501038_0339167_22_1134 | 369 |
| 599 | 3300049580 | Ga0501046_0167050 | Ga0501046_0167050_202_1314 | 369 |
| 600 | 3300053104 | Ga0500556_0000036 | Ga0500556_0000036_18032_19156 | 369 |
| 601 | 3300053730 | Ga0500645_018168 | Ga0500645_018168_444_1568 | 369 |
| 602 | 3300060353 | Ga0501082_0001613 | Ga0501082_0001613_2281_3420 | 369 |
| 603 | iso_pu_bacteria | 2828305725 | 2828309493 | 369 |
| 604 | iso_pu_bacteria | 643348564 | 643602601 | 369 |
| 605 | 3300048921 | Ga0496118_0043118 | Ga0496118_0043118_2127_3242 | 370 |
| 606 | 3300048924 | Ga0496121_0061811 | Ga0496121_0061811_1656_2771 | 370 |
| 607 | 3300048924 | Ga0496121_0132298 | Ga0496121_0132298_166_1281 | 370 |
| 608 | 3300053085 | Ga0495619_0109671 | Ga0495619_0109671_573_1703 | 370 |
| 609 | 3300053093 | Ga0500651_0105146 | Ga0500651_0105146_562_1698 | 370 |
| 610 | 3300006186 | Ga0075369_10009443 | Ga0075369_100094433 | 371 |
| 611 | 3300009011 | Ga0105251_10007401 | Ga0105251_100074016 | 371 |
| 612 | 3300009545 | Ga0105237_10205311 | Ga0105237_102053111 | 371 |
| 613 | 3300010375 | Ga0105239_10062737 | Ga0105239_100627374 | 371 |
| 614 | 3300011119 | Ga0105246_10003642 | Ga0105246_100036425 | 371 |
| 615 | 3300013306 | Ga0163162_10351051 | Ga0163162_103510512 | 371 |
| 616 | 3300013308 | Ga0157375_10012425 | Ga0157375_100124252 | 371 |
| 617 | 3300014968 | Ga0157379_10008086 | Ga0157379_100080866 | 371 |
| 618 | 3300025944 | Ga0207661_10043653 | Ga0207661_100436533 | 371 |
| 619 | 3300034957 | Ga0373938_0001315 | Ga0373938_0001315_1457_2590 | 371 |
| 620 | 3300035084 | Ga0373928_0016122 | Ga0373928_0016122_286_1419 | 371 |
| 621 | 3300035088 | Ga0373940_0012269 | Ga0373940_0012269_707_1840 | 371 |
| 622 | 3300035091 | Ga0373951_0004013 | Ga0373951_0004013_316_1449 | 371 |
| 623 | 3300035092 | Ga0373952_0001719 | Ga0373952_0001719_2654_3787 | 371 |
| 624 | 3300035115 | Ga0373941_0032082 | Ga0373941_0032082_71_1204 | 371 |
| 625 | 3300035207 | Ga0373942_0011273 | Ga0373942_0011273_695_1828 | 371 |
| 626 | 3300035398 | Ga0316574_0007201 | Ga0316574_0007201_2485_3603 | 371 |
| 627 | 3300035691 | Ga0373931_0016415 | Ga0373931_0016415_695_1828 | 371 |
| 628 | 3300035725 | Ga0373947_0105141 | Ga0373947_0105141_389_1522 | 371 |
| 629 | 3300036712 | Ga0316584_0016716 | Ga0316584_0016716_1597_2715 | 371 |
| 630 | 3300037068 | Ga0373925_0014125 | Ga0373925_0014125_4323_5456 | 371 |
| 631 | 3300046455 | Ga0495603_0035241 | Ga0495603_0035241_1689_2822 | 371 |
| 632 | 3300046459 | Ga0495629_0001999 | Ga0495629_0001999_5461_6594 | 371 |
| 633 | 3300046473 | Ga0495582_0015534 | Ga0495582_0015534_1240_2373 | 371 |
| 634 | 3300046491 | Ga0495584_0126509 | Ga0495584_0126509_54_1214 | 371 |
| 635 | 3300046499 | Ga0495594_0003379 | Ga0495594_0003379_897_2030 | 371 |
| 636 | 3300046681 | Ga0495647_0010627 | Ga0495647_0010627_167_1300 | 371 |
| 637 | 3300046683 | Ga0495658_0001195 | Ga0495658_0001195_10492_11625 | 371 |
| 638 | 3300046689 | Ga0495613_0015398 | Ga0495613_0015398_1322_2455 | 371 |
| 639 | 3300046809 | Ga0495600_0044885 | Ga0495600_0044885_108_1241 | 371 |
| 640 | 3300047315 | Ga0495581_0167389 | Ga0495581_0167389_84_1217 | 371 |
| 641 | 3300047322 | Ga0495680_0006216 | Ga0495680_0006216_6806_7939 | 371 |
| 642 | 3300047471 | Ga0495684_0246151 | Ga0495684_0246151_145_1278 | 371 |
| 643 | 3300047673 | Ga0495593_0019288 | Ga0495593_0019288_2604_3737 | 371 |
| 644 | 3300048905 | Ga0496102_0012361 | Ga0496102_0012361_5973_7106 | 371 |
| 645 | 3300048906 | Ga0496103_0024424 | Ga0496103_0024424_668_1801 | 371 |
| 646 | 3300048907 | Ga0496104_0005252 | Ga0496104_0005252_5919_7052 | 371 |
| 647 | 3300048908 | Ga0496105_0003481 | Ga0496105_0003481_4650_5783 | 371 |
| 648 | 3300048909 | Ga0496106_0024213 | Ga0496106_0024213_359_1492 | 371 |
| 649 | 3300048910 | Ga0496107_0010499 | Ga0496107_0010499_2427_3560 | 371 |
| 650 | 3300048911 | Ga0496108_0048205 | Ga0496108_0048205_1473_2606 | 371 |
| 651 | 3300048912 | Ga0496109_0004488 | Ga0496109_0004488_3412_4545 | 371 |
| 652 | 3300048913 | Ga0496110_0104271 | Ga0496110_0104271_1150_2283 | 371 |
| 653 | 3300048915 | Ga0496112_0006455 | Ga0496112_0006455_3319_4452 | 371 |
| 654 | 3300048915 | Ga0496112_0065980 | Ga0496112_0065980_1858_2979 | 371 |
| 655 | 3300048916 | Ga0496113_0002168 | Ga0496113_0002168_5755_6888 | 371 |
| 656 | 3300048918 | Ga0496115_0008610 | Ga0496115_0008610_449_1582 | 371 |
| 657 | 3300050512 | nmdc:mga0n895_192896_c1 | nmdc:mga0n895_192896_c1_849_1982 | 371 |
| 658 | 3300050513 | nmdc:mga0rr50_55627_c1 | nmdc:mga0rr50_55627_c1_1739_2872 | 371 |
| 659 | 3300053085 | Ga0495619_0000229 | Ga0495619_0000229_31134_32267 | 371 |
| 660 | iso_pu_bacteria | 2602042107 | 2603860783 | 371 |
| 661 | iso_pu_bacteria | 2738543031 | 2739348934 | 371 |
| 662 | iso_pu_bacteria | 2824696289 | 2824704342 | 371 |
| 663 | iso_pu_bacteria | 2857524615 | 2857524773 | 371 |
| 664 | iso_pu_bacteria | 2893066018 | 2893069293 | 371 |
| 665 | iso_pu_bacteria | 2919073203 | 2919078657 | 371 |
| 666 | 3300005981 | Ga0081538_10036175 | Ga0081538_100361753 | 372 |
| 667 | 3300025925 | Ga0207650_10018326 | Ga0207650_100183264 | 372 |
| 668 | 3300035118 | Ga0373954_0016151 | Ga0373954_0016151_1998_3119 | 372 |
| 669 | 3300035119 | Ga0373956_0004598 | Ga0373956_0004598_516_1637 | 372 |
| 670 | 3300035172 | Ga0373955_0056656 | Ga0373955_0056656_457_1578 | 372 |
| 671 | 3300035724 | Ga0373933_0014822 | Ga0373933_0014822_2820_3941 | 372 |
| 672 | 3300036401 | Ga0373937_0024713 | Ga0373937_0024713_1172_2293 | 372 |
| 673 | 3300036401 | Ga0373937_0026411 | Ga0373937_0026411_1791_2909 | 372 |
| 674 | 3300036401 | Ga0373937_0067560 | Ga0373937_0067560_79_1200 | 372 |
| 675 | 3300046462 | Ga0495651_0055722 | Ga0495651_0055722_1903_3024 | 372 |
| 676 | 3300046462 | Ga0495651_0145529 | Ga0495651_0145529_43_1161 | 372 |
| 677 | 3300046463 | Ga0495653_0132237 | Ga0495653_0132237_175_1296 | 372 |
| 678 | 3300046511 | Ga0495608_0154623 | Ga0495608_0154623_310_1428 | 372 |
| 679 | 3300046516 | Ga0495628_0128179 | Ga0495628_0128179_463_1581 | 372 |
| 680 | 3300046533 | Ga0495640_0060368 | Ga0495640_0060368_1412_2530 | 372 |
| 681 | 3300046536 | Ga0495587_0044458 | Ga0495587_0044458_424_1545 | 372 |
| 682 | 3300046559 | Ga0495667_0048217 | Ga0495667_0048217_928_2046 | 372 |
| 683 | 3300046663 | Ga0495635_0019774 | Ga0495635_0019774_1920_3038 | 372 |
| 684 | 3300046809 | Ga0495600_0099298 | Ga0495600_0099298_93_1214 | 372 |
| 685 | 3300047319 | Ga0495674_0049741 | Ga0495674_0049741_381_1499 | 372 |
| 686 | 3300047444 | Ga0495675_0110810 | Ga0495675_0110810_487_1608 | 372 |
| 687 | 3300048088 | Ga0495602_0037412 | Ga0495602_0037412_1192_2313 | 372 |
| 688 | 3300048917 | Ga0496114_0146287 | Ga0496114_0146287_767_1885 | 372 |
| 689 | 3300049582 | Ga0501048_0003551 | Ga0501048_0003551_1501_2673 | 372 |
| 690 | 3300049592 | Ga0501076_0284849 | Ga0501076_0284849_83_1204 | 372 |
| 691 | 3300049741 | Ga0501079_0137642 | Ga0501079_0137642_412_1536 | 372 |
| 692 | 3300050507 | nmdc:mga05p37_322101_c1 | nmdc:mga05p37_322101_c1_232_1353 | 372 |
| 693 | 3300053077 | Ga0495601_0000549 | Ga0495601_0000549_11817_12935 | 372 |
| 694 | 3300053077 | Ga0495601_0015181 | Ga0495601_0015181_809_1930 | 372 |
| 695 | 3300053078 | Ga0495612_0011648 | Ga0495612_0011648_83_1204 | 372 |
| 696 | 3300053078 | Ga0495612_0015944 | Ga0495612_0015944_1745_2863 | 372 |
| 697 | 3300053084 | Ga0495595_0002822 | Ga0495595_0002822_3342_4463 | 372 |
| 698 | 3300053085 | Ga0495619_0001121 | Ga0495619_0001121_3116_4234 | 372 |
| 699 | 3300053139 | Ga0500568_0027980 | Ga0500568_0027980_974_2107 | 372 |
| 700 | iso_pu_bacteria | 2507262055 | 2507510234 | 372 |
| 701 | iso_pu_bacteria | 2508501009 | 2508544245 | 372 |
| 702 | iso_pu_bacteria | 2508501042 | 2508697817 | 372 |
| 703 | iso_pu_bacteria | 2508501128 | 2509151155 | 372 |
| 704 | iso_pu_bacteria | 2511231028 | 2511400764 | 372 |
| 705 | iso_pu_bacteria | 2513237092 | 2513628134 | 372 |
| 706 | iso_pu_bacteria | 2513237094 | 2513640383 | 372 |
| 707 | iso_pu_bacteria | 2513237095 | 2513648765 | 372 |
| 708 | iso_pu_bacteria | 2513237096 | 2513659010 | 372 |
| 709 | iso_pu_bacteria | 2513237098 | 2513673213 | 372 |
| 710 | iso_pu_bacteria | 2513237101 | 2513695393 | 372 |
| 711 | iso_pu_bacteria | 2513237102 | 2513700384 | 372 |
| 712 | iso_pu_bacteria | 2513237104 | 2513716047 | 372 |
| 713 | iso_pu_bacteria | 2513237137 | 2513860373 | 372 |
| 714 | iso_pu_bacteria | 2513237139 | 2513878566 | 372 |
| 715 | iso_pu_bacteria | 2513237141 | 2513891846 | 372 |
| 716 | iso_pu_bacteria | 2513237145 | 2513921273 | 372 |
| 717 | iso_pu_bacteria | 2513237161 | 2514013436 | 372 |
| 718 | iso_pu_bacteria | 2515154112 | 2515630756 | 372 |
| 719 | iso_pu_bacteria | 2517093001 | 2517105303 | 372 |
| 720 | iso_pu_bacteria | 2517572143 | 2517894154 | 372 |
| 721 | iso_pu_bacteria | 2524023205 | 2524439275 | 372 |
| 722 | iso_pu_bacteria | 2524023210 | 2524466108 | 372 |
| 723 | iso_pu_bacteria | 2528768022 | 2528856930 | 372 |
| 724 | iso_pu_bacteria | 2617270735 | 2617349813 | 372 |
| 725 | iso_pu_bacteria | 2617270741 | 2617379170 | 372 |
| 726 | iso_pu_bacteria | 2643221651 | 2644287663 | 372 |
| 727 | iso_pu_bacteria | 2667528175 | 2671123468 | 372 |
| 728 | iso_pu_bacteria | 2721755755 | 2723843776 | 372 |
| 729 | iso_pu_bacteria | 2744054633 | 2745076676 | 372 |
| 730 | iso_pu_bacteria | 2791355196 | 2793065035 | 372 |
| 731 | iso_pu_bacteria | 2791355197 | 2793073136 | 372 |
| 732 | iso_pu_bacteria | 2802429603 | 2805917304 | 372 |
| 733 | iso_pu_bacteria | 2816332527 | 2818241818 | 372 |
| 734 | iso_pu_bacteria | 2824600985 | 2824609129 | 372 |
| 735 | iso_pu_bacteria | 2824609381 | 2824617747 | 372 |
| 736 | iso_pu_bacteria | 2824617872 | 2824621130 | 372 |
| 737 | iso_pu_bacteria | 2824626560 | 2824629757 | 372 |
| 738 | iso_pu_bacteria | 2824635225 | 2824643828 | 372 |
| 739 | iso_pu_bacteria | 2824644064 | 2824652615 | 372 |
| 740 | iso_pu_bacteria | 2824653114 | 2824661099 | 372 |
| 741 | iso_pu_bacteria | 2824661429 | 2824671198 | 372 |
| 742 | iso_pu_bacteria | 2824671348 | 2824679427 | 372 |
| 743 | iso_pu_bacteria | 2824679649 | 2824687228 | 372 |
| 744 | iso_pu_bacteria | 2824687955 | 2824695446 | 372 |
| 745 | iso_pu_bacteria | 2824704595 | 2824714035 | 372 |
| 746 | iso_pu_bacteria | 2824714736 | 2824723257 | 372 |
| 747 | iso_pu_bacteria | 2824723954 | 2824732559 | 372 |
| 748 | iso_pu_bacteria | 2824732956 | 2824740552 | 372 |
| 749 | iso_pu_bacteria | 2824746037 | 2824751781 | 372 |
| 750 | iso_pu_bacteria | 2824753945 | 2824760512 | 372 |
| 751 | iso_pu_bacteria | 2824763712 | 2824771311 | 372 |
| 752 | iso_pu_bacteria | 2824773399 | 2824778350 | 372 |
| 753 | iso_pu_bacteria | 2838122688 | 2838125583 | 372 |
| 754 | iso_pu_bacteria | 2841941048 | 2841941753 | 372 |
| 755 | iso_pu_bacteria | 2841949485 | 2841951184 | 372 |
| 756 | iso_pu_bacteria | 2841957949 | 2841959252 | 372 |
| 757 | iso_pu_bacteria | 2841966195 | 2841968825 | 372 |
| 758 | iso_pu_bacteria | 2841974524 | 2841975979 | 372 |
| 759 | iso_pu_bacteria | 2841983080 | 2841989166 | 372 |
| 760 | iso_pu_bacteria | 2842038055 | 2842045286 | 372 |
| 761 | iso_pu_bacteria | 2842045827 | 2842049052 | 372 |
| 762 | iso_pu_bacteria | 2844315083 | 2844317505 | 372 |
| 763 | iso_pu_bacteria | 2847930680 | 2847934299 | 372 |
| 764 | iso_pu_bacteria | 2847939898 | 2847944882 | 372 |
| 765 | iso_pu_bacteria | 2849076700 | 2849080914 | 372 |
| 766 | iso_pu_bacteria | 2857509624 | 2857509732 | 372 |
| 767 | iso_pu_bacteria | 2874590934 | 2874591998 | 372 |
| 768 | iso_pu_bacteria | 2874604998 | 2874612236 | 372 |
| 769 | iso_pu_bacteria | 2874612657 | 2874617775 | 372 |
| 770 | iso_pu_bacteria | 2874620515 | 2874623939 | 372 |
| 771 | iso_pu_bacteria | 2874628541 | 2874632750 | 372 |
| 772 | iso_pu_bacteria | 2874645413 | 2874646594 | 372 |
| 773 | iso_pu_bacteria | 2876761206 | 2876767862 | 372 |
| 774 | iso_pu_bacteria | 2876771140 | 2876772212 | 372 |
| 775 | iso_pu_bacteria | 2876808645 | 2876811362 | 372 |
| 776 | iso_pu_bacteria | 2876818435 | 2876819590 | 372 |
| 777 | iso_pu_bacteria | 2879074833 | 2879076099 | 372 |
| 778 | iso_pu_bacteria | 2879083081 | 2879086731 | 372 |
| 779 | iso_pu_bacteria | 2879099564 | 2879109956 | 372 |
| 780 | iso_pu_bacteria | 2879110137 | 2879114764 | 372 |
| 781 | iso_pu_bacteria | 2879127579 | 2879128846 | 372 |
| 782 | iso_pu_bacteria | 2879142872 | 2879144132 | 372 |
| 783 | iso_pu_bacteria | 2881364244 | 2881369242 | 372 |
| 784 | iso_pu_bacteria | 2881665667 | 2881669847 | 372 |
| 785 | iso_pu_bacteria | 2885366525 | 2885367567 | 372 |
| 786 | iso_pu_bacteria | 2885374607 | 2885379600 | 372 |
| 787 | iso_pu_bacteria | 2885409591 | 2885412792 | 372 |
| 788 | iso_pu_bacteria | 2888378607 | 2888382210 | 372 |
| 789 | iso_pu_bacteria | 2888388044 | 2888388466 | 372 |
| 790 | iso_pu_bacteria | 2888419890 | 2888422818 | 372 |
| 791 | iso_pu_bacteria | 2889033259 | 2889042020 | 372 |
| 792 | iso_pu_bacteria | 2903727486 | 2903733106 | 372 |
| 793 | iso_pu_bacteria | 2903748898 | 2903757558 | 372 |
| 794 | iso_pu_bacteria | 2904666416 | 2904673638 | 372 |
| 795 | iso_pu_bacteria | 2904690495 | 2904697413 | 372 |
| 796 | iso_pu_bacteria | 2904711408 | 2904718704 | 372 |
| 797 | iso_pu_bacteria | 2906602504 | 2906603958 | 372 |
| 798 | iso_pu_bacteria | 2906610324 | 2906610972 | 372 |
| 799 | iso_pu_bacteria | 2906626472 | 2906633372 | 372 |
| 800 | iso_pu_bacteria | 2906635258 | 2906639566 | 372 |
| 801 | iso_pu_bacteria | 2906643746 | 2906649293 | 372 |
| 802 | iso_pu_bacteria | 2906660503 | 2906661768 | 372 |
| 803 | iso_pu_bacteria | 2908739725 | 2908744482 | 372 |
| 804 | iso_pu_bacteria | 2908756301 | 2908762379 | 372 |
| 805 | iso_pu_bacteria | 2908775508 | 2908778489 | 372 |
| 806 | iso_pu_bacteria | 2922361189 | 2922366110 | 372 |
| 807 | iso_pu_bacteria | 2922368715 | 2922375812 | 372 |
| 808 | iso_pu_bacteria | 2922393267 | 2922399118 | 372 |
| 809 | iso_pu_bacteria | 2922425934 | 2922428349 | 372 |
| 810 | iso_pu_bacteria | 2929615660 | 2929616507 | 372 |
| 811 | iso_pu_bacteria | 2929624759 | 2929625251 | 372 |
| 812 | iso_pu_bacteria | 2932784394 | 2932786822 | 372 |
| 813 | iso_pu_bacteria | 2932794094 | 2932798941 | 372 |
| 814 | iso_pu_bacteria | 2932801729 | 2932804998 | 372 |
| 815 | iso_pu_bacteria | 2932809354 | 2932811024 | 372 |
| 816 | iso_pu_bacteria | 2932818245 | 2932825983 | 372 |
| 817 | iso_pu_bacteria | 2932828146 | 2932832588 | 372 |
| 818 | iso_pu_bacteria | 2933577622 | 2933578210 | 372 |
| 819 | iso_pu_bacteria | 2935608549 | 2935610849 | 372 |
| 820 | iso_pu_bacteria | 2935616580 | 2935619290 | 372 |
| 821 | iso_pu_bacteria | 2935630451 | 2935637839 | 372 |
| 822 | iso_pu_bacteria | 2935638405 | 2935645323 | 372 |
| 823 | iso_pu_bacteria | 2935648319 | 2935655481 | 372 |
| 824 | iso_pu_bacteria | 2935656913 | 2935664348 | 372 |
| 825 | iso_pu_bacteria | 2935665750 | 2935671421 | 372 |
| 826 | iso_pu_bacteria | 2935675223 | 2935683781 | 372 |
| 827 | iso_pu_bacteria | 2935684952 | 2935691914 | 372 |
| 828 | iso_pu_bacteria | 2935694250 | 2935695133 | 372 |
| 829 | iso_pu_bacteria | 2935703347 | 2935708060 | 372 |
| 830 | iso_pu_bacteria | 2935713505 | 2935719982 | 372 |
| 831 | iso_pu_bacteria | 2935722832 | 2935729251 | 372 |
| 832 | iso_pu_bacteria | 2935732158 | 2935738889 | 372 |
| 833 | iso_pu_bacteria | 2935741537 | 2935747926 | 372 |
| 834 | iso_pu_bacteria | 2935750917 | 2935756510 | 372 |
| 835 | iso_pu_bacteria | 2935760218 | 2935761511 | 372 |
| 836 | iso_pu_bacteria | 2935769743 | 2935776808 | 372 |
| 837 | iso_pu_bacteria | 2935777560 | 2935783397 | 372 |
| 838 | iso_pu_bacteria | 2935785616 | 2935792685 | 372 |
| 839 | iso_pu_bacteria | 2935793552 | 2935800712 | 372 |
| 840 | iso_pu_bacteria | 2935801545 | 2935805009 | 372 |
| 841 | iso_pu_bacteria | 2935810662 | 2935812172 | 372 |
| 842 | iso_pu_bacteria | 2935819856 | 2935820333 | 372 |
| 843 | iso_pu_bacteria | 2935827899 | 2935834834 | 372 |
| 844 | iso_pu_bacteria | 2935837841 | 2935838955 | 372 |
| 845 | iso_pu_bacteria | 2935847175 | 2935849657 | 372 |
| 846 | iso_pu_bacteria | 2935855204 | 2935857655 | 372 |
| 847 | iso_pu_bacteria | 2935864058 | 2935865209 | 372 |
| 848 | iso_pu_bacteria | 2935873716 | 2935881555 | 372 |
| 849 | iso_pu_bacteria | 2935883170 | 2935889331 | 372 |
| 850 | iso_pu_bacteria | 2935908558 | 2935911549 | 372 |
| 851 | iso_pu_bacteria | 2935916978 | 2935919203 | 372 |
| 852 | iso_pu_bacteria | 2935926038 | 2935928578 | 372 |
| 853 | iso_pu_bacteria | 2935934488 | 2935938223 | 372 |
| 854 | iso_pu_bacteria | 2935942939 | 2935945885 | 372 |
| 855 | iso_pu_bacteria | 2935951376 | 2935954508 | 372 |
| 856 | iso_pu_bacteria | 2935959822 | 2935966115 | 372 |
| 857 | iso_pu_bacteria | 2935967501 | 2935970395 | 372 |
| 858 | iso_pu_bacteria | 2935975950 | 2935979882 | 372 |
| 859 | iso_pu_bacteria | 2935984226 | 2935987643 | 372 |
| 860 | iso_pu_bacteria | 2935992306 | 2935997419 | 372 |
| 861 | iso_pu_bacteria | 2936002035 | 2936005202 | 372 |
| 862 | iso_pu_bacteria | 2936011229 | 2936018418 | 372 |
| 863 | iso_pu_bacteria | 2936019824 | 2936026949 | 372 |
| 864 | iso_pu_bacteria | 2936028420 | 2936035831 | 372 |
| 865 | iso_pu_bacteria | 2936037263 | 2936038766 | 372 |
| 866 | iso_pu_bacteria | 2936046547 | 2936053910 | 372 |
| 867 | iso_pu_bacteria | 2936055302 | 2936061962 | 372 |
| 868 | iso_pu_bacteria | 2940556831 | 2940562424 | 372 |
| 869 | iso_pu_bacteria | 2941507105 | 2941514512 | 372 |
| 870 | iso_pu_bacteria | 2941515067 | 2941522408 | 372 |
| 871 | iso_pu_bacteria | 2941523033 | 2941530279 | 372 |
| 872 | iso_pu_bacteria | 2941531003 | 2941537815 | 372 |
| 873 | iso_pu_bacteria | 2941538514 | 2941539645 | 372 |
| 874 | iso_pu_bacteria | 3005474847 | 3005478333 | 372 |
| 875 | iso_pu_bacteria | 3005483717 | 3005486523 | 372 |
| 876 | iso_pu_bacteria | 3005506211 | 3005512327 | 372 |
| 877 | iso_pu_bacteria | 3005587118 | 3005593517 | 372 |
| 878 | iso_pu_bacteria | 3005594810 | 3005597237 | 372 |
| 879 | iso_pu_bacteria | 3005710791 | 3005713273 | 372 |
| 880 | iso_pu_bacteria | 3005718088 | 3005720621 | 372 |
| 881 | iso_pu_bacteria | 8006926726 | 8006931512 | 372 |
| 882 | iso_pu_bacteria | 8006933436 | 8006942887 | 372 |
| 883 | iso_pu_bacteria | 8006973647 | 8006982607 | 372 |
| 884 | iso_pu_bacteria | 8006984368 | 8006988654 | 372 |
| 885 | iso_pu_bacteria | 8016511872 | 8016515412 | 372 |
| 886 | iso_pu_bacteria | 8016522445 | 8016523119 | 372 |
| 887 | iso_pu_bacteria | 8016530956 | 8016536591 | 372 |
| 888 | iso_pu_bacteria | 8016548790 | 8016552377 | 372 |
| 889 | iso_pu_bacteria | 8016557553 | 8016560759 | 372 |
| 890 | iso_pu_bacteria | 8016566248 | 8016566263 | 372 |
| 891 | iso_pu_bacteria | 8016575299 | 8016579022 | 372 |
| 892 | iso_pu_bacteria | 8016583857 | 8016590581 | 372 |
| 893 | iso_pu_bacteria | 8016595262 | 8016598639 | 372 |
| 894 | iso_pu_bacteria | 8016603502 | 8016612462 | 372 |
| 895 | iso_pu_bacteria | 8016613128 | 8016621347 | 372 |
| 896 | iso_pu_bacteria | 8016630954 | 8016632812 | 372 |
| 897 | iso_pu_bacteria | 8017057580 | 8017061066 | 372 |
| 898 | iso_pu_bacteria | 8019530166 | 8019536300 | 372 |
| 899 | iso_pu_bacteria | 8019538911 | 8019543161 | 372 |
| 900 | iso_pu_bacteria | 8019547302 | 8019555764 | 372 |
| 901 | iso_pu_bacteria | 8019555841 | 8019558669 | 372 |
| 902 | iso_pu_bacteria | 8019565922 | 8019566632 | 372 |
| 903 | iso_pu_bacteria | 8019576017 | 8019580539 | 372 |
| 904 | iso_pu_bacteria | 8019586578 | 8019588259 | 372 |
| 905 | iso_pu_bacteria | 8019597564 | 8019603080 | 372 |
| 906 | iso_pu_bacteria | 8019608314 | 8019615457 | 372 |
| 907 | iso_pu_bacteria | 8019629233 | 8019636214 | 372 |
| 908 | iso_pu_bacteria | 8019648815 | 8019656254 | 372 |
| 909 | iso_pu_bacteria | 8019659431 | 8019663983 | 372 |
| 910 | iso_pu_bacteria | 8019668869 | 8019673612 | 372 |
| 911 | iso_pu_bacteria | 8019678201 | 8019682521 | 372 |
| 912 | iso_pu_bacteria | 8019687851 | 8019688178 | 372 |
| 913 | iso_pu_bacteria | 8055742211 | 8055748153 | 372 |
| 914 | iso_pu_bacteria | 8056673599 | 8056679855 | 372 |
| 915 | iso_pu_bacteria | 8056681323 | 8056686505 | 372 |
| 916 | iso_pu_bacteria | 8056967851 | 8056968964 | 372 |
| 917 | 3300005471 | Ga0070698_100310135 | Ga0070698_1003101351 | 373 |
| 918 | 3300009094 | Ga0111539_10152393 | Ga0111539_101523933 | 373 |
| 919 | 3300036712 | Ga0316584_0014165 | Ga0316584_0014165_4022_5161 | 373 |
| 920 | 3300049589 | Ga0501073_0025360 | Ga0501073_0025360_2021_3148 | 373 |
| 921 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_272108_273235 | 373 |
| 922 | iso_pu_bacteria | 2643221547 | 2643755382 | 373 |
| 923 | iso_pu_bacteria | 8006994254 | 8006994369 | 373 |
| 924 | 3300005290 | Ga0065712_10003538 | Ga0065712_100035382 | 374 |
| 925 | 3300005365 | Ga0070688_100089378 | Ga0070688_1000893781 | 374 |
| 926 | 3300005367 | Ga0070667_100132488 | Ga0070667_1001324882 | 374 |
| 927 | 3300005549 | Ga0070704_100030161 | Ga0070704_1000301613 | 374 |
| 928 | 3300005937 | Ga0081455_10007799 | Ga0081455_100077994 | 374 |
| 929 | 3300006042 | Ga0075368_10012790 | Ga0075368_100127903 | 374 |
| 930 | 3300006051 | Ga0075364_10051487 | Ga0075364_100514873 | 374 |
| 931 | 3300006178 | Ga0075367_10038585 | Ga0075367_100385852 | 374 |
| 932 | 3300006353 | Ga0075370_10058740 | Ga0075370_100587403 | 374 |
| 933 | 3300009101 | Ga0105247_10009472 | Ga0105247_100094727 | 374 |
| 934 | 3300009177 | Ga0105248_10025465 | Ga0105248_100254659 | 374 |
| 935 | 3300009553 | Ga0105249_10001420 | Ga0105249_1000142015 | 374 |
| 936 | 3300011119 | Ga0105246_10341826 | Ga0105246_103418261 | 374 |
| 937 | 3300014325 | Ga0163163_10004718 | Ga0163163_1000471810 | 374 |
| 938 | 3300014968 | Ga0157379_10026095 | Ga0157379_100260956 | 374 |
| 939 | 3300025900 | Ga0207710_10030249 | Ga0207710_100302492 | 374 |
| 940 | 3300025941 | Ga0207711_10035377 | Ga0207711_100353772 | 374 |
| 941 | 3300026067 | Ga0207678_10025054 | Ga0207678_100250543 | 374 |
| 942 | 3300027866 | Ga0209813_10016556 | Ga0209813_100165562 | 374 |
| 943 | 3300031456 | Ga0307513_10033286 | Ga0307513_100332862 | 374 |
| 944 | 3300037068 | Ga0373925_0079028 | Ga0373925_0079028_81_1208 | 374 |
| 945 | 3300042005 | Ga0439448_0053025 | Ga0439448_0053025_173_1300 | 374 |
| 946 | 3300042012 | Ga0439455_0005312 | Ga0439455_0005312_938_2065 | 374 |
| 947 | 3300046472 | Ga0495580_0055036 | Ga0495580_0055036_291_1418 | 374 |
| 948 | 3300046473 | Ga0495582_0017780 | Ga0495582_0017780_1401_2528 | 374 |
| 949 | 3300046475 | Ga0495639_0016315 | Ga0495639_0016315_368_1495 | 374 |
| 950 | 3300046517 | Ga0495630_0266997 | Ga0495630_0266997_65_1192 | 374 |
| 951 | 3300046526 | Ga0495666_0019193 | Ga0495666_0019193_1934_3061 | 374 |
| 952 | 3300046533 | Ga0495640_0014924 | Ga0495640_0014924_1644_2771 | 374 |
| 953 | 3300046615 | Ga0495656_0122334 | Ga0495656_0122334_15_1142 | 374 |
| 954 | 3300048907 | Ga0496104_0124548 | Ga0496104_0124548_422_1549 | 374 |
| 955 | 3300048911 | Ga0496108_0007552 | Ga0496108_0007552_3191_4318 | 374 |
| 956 | 3300048915 | Ga0496112_0013996 | Ga0496112_0013996_4757_5884 | 374 |
| 957 | 3300048916 | Ga0496113_0003135 | Ga0496113_0003135_5097_6224 | 374 |
| 958 | 3300049570 | Ga0501033_0131470 | Ga0501033_0131470_651_1790 | 374 |
| 959 | 3300049572 | Ga0501036_0043680 | Ga0501036_0043680_1702_2841 | 374 |
| 960 | 3300049581 | Ga0501047_0104574 | Ga0501047_0104574_1230_2369 | 374 |
| 961 | 3300049583 | Ga0501067_0027958 | Ga0501067_0027958_1202_2341 | 374 |
| 962 | 3300049823 | Ga0501044_0036131 | Ga0501044_0036131_484_1623 | 374 |
| 963 | 3300050495 | nmdc:mga04h51_39942_c1 | nmdc:mga04h51_39942_c1_312_1439 | 374 |
| 964 | 3300050496 | nmdc:mga07m45_62632_c1 | nmdc:mga07m45_62632_c1_964_2091 | 374 |
| 965 | 3300053093 | Ga0500651_0031175 | Ga0500651_0031175_1461_2594 | 374 |
| 966 | 3300054114 | Ga0501084_0031729 | Ga0501084_0031729_51_1178 | 374 |
| 967 | 3300060353 | Ga0501082_0004836 | Ga0501082_0004836_6353_7492 | 374 |
| 968 | 3300060353 | Ga0501082_0137353 | Ga0501082_0137353_337_1476 | 374 |
| 969 | iso_pu_bacteria | 2919450847 | 2919454615 | 374 |
| 970 | iso_pu_bacteria | 8001845381 | 8001849689 | 374 |
| 971 | 3300005329 | Ga0070683_100036431 | Ga0070683_1000364314 | 375 |
| 972 | 3300005364 | Ga0070673_100129260 | Ga0070673_1001292602 | 375 |
| 973 | 3300005439 | Ga0070711_100096662 | Ga0070711_1000966622 | 375 |
| 974 | 3300005530 | Ga0070679_100091000 | Ga0070679_1000910001 | 375 |
| 975 | 3300005983 | Ga0081540_1000003 | Ga0081540_100000333 | 375 |
| 976 | 3300006051 | Ga0075364_10125572 | Ga0075364_101255722 | 375 |
| 977 | 3300006175 | Ga0070712_100101329 | Ga0070712_1001013292 | 375 |
| 978 | 3300006186 | Ga0075369_10046899 | Ga0075369_100468992 | 375 |
| 979 | 3300009093 | Ga0105240_10082733 | Ga0105240_100827334 | 375 |
| 980 | 3300009177 | Ga0105248_10391109 | Ga0105248_103911092 | 375 |
| 981 | 3300009551 | Ga0105238_10121038 | Ga0105238_101210383 | 375 |
| 982 | 3300013100 | Ga0157373_10072583 | Ga0157373_100725831 | 375 |
| 983 | 3300013307 | Ga0157372_10251571 | Ga0157372_102515711 | 375 |
| 984 | 3300021358 | Ga0213873_10005190 | Ga0213873_100051901 | 375 |
| 985 | 3300021384 | Ga0213876_10002883 | Ga0213876_100028835 | 375 |
| 986 | 3300021388 | Ga0213875_10001986 | Ga0213875_100019864 | 375 |
| 987 | 3300024227 | Ga0228598_1002460 | Ga0228598_10024604 | 375 |
| 988 | 3300025295 | Ga0209564_1020885 | Ga0209564_10208853 | 375 |
| 989 | 3300025906 | Ga0207699_10020526 | Ga0207699_100205263 | 375 |
| 990 | 3300025906 | Ga0207699_10133082 | Ga0207699_101330821 | 375 |
| 991 | 3300025915 | Ga0207693_10056832 | Ga0207693_100568322 | 375 |
| 992 | 3300025932 | Ga0207690_10112686 | Ga0207690_101126861 | 375 |
| 993 | 3300025944 | Ga0207661_10124475 | Ga0207661_101244752 | 375 |
| 994 | 3300025949 | Ga0207667_10280892 | Ga0207667_102808921 | 375 |
| 995 | 3300031241 | Ga0265325_10024274 | Ga0265325_100242741 | 375 |
| 996 | 3300031241 | Ga0265325_10058055 | Ga0265325_100580552 | 375 |
| 997 | 3300031249 | Ga0265339_10034700 | Ga0265339_100347002 | 375 |
| 998 | 3300031250 | Ga0265331_10063434 | Ga0265331_100634342 | 375 |
| 999 | 3300031595 | Ga0265313_10048917 | Ga0265313_100489172 | 375 |
| 1000 | 3300031665 | Ga0316575_10015584 | Ga0316575_100155841 | 375 |
| 1001 | 3300031691 | Ga0316579_10107757 | Ga0316579_101077571 | 375 |
| 1002 | 3300035725 | Ga0373947_0107546 | Ga0373947_0107546_392_1522 | 375 |
| 1003 | 3300037312 | Ga0395899_0013310 | Ga0395899_0013310_3821_4951 | 375 |
| 1004 | 3300037418 | Ga0395900_0015919 | Ga0395900_0015919_1733_2863 | 375 |
| 1005 | 3300037418 | Ga0395900_0044317 | Ga0395900_0044317_158_1288 | 375 |
| 1006 | 3300037466 | Ga0395898_0030804 | Ga0395898_0030804_4079_5209 | 375 |
| 1007 | 3300037466 | Ga0395898_0046786 | Ga0395898_0046786_305_1435 | 375 |
| 1008 | 3300038443 | Ga0395901_0017419 | Ga0395901_0017419_4558_5688 | 375 |
| 1009 | 3300038443 | Ga0395901_0045424 | Ga0395901_0045424_2509_3639 | 375 |
| 1010 | 3300044719 | Ga0466971_0081638 | Ga0466971_0081638_129_1259 | 375 |
| 1011 | 3300046473 | Ga0495582_0070927 | Ga0495582_0070927_305_1438 | 375 |
| 1012 | 3300046689 | Ga0495613_0073149 | Ga0495613_0073149_252_1385 | 375 |
| 1013 | 3300047319 | Ga0495674_0060922 | Ga0495674_0060922_2082_3212 | 375 |
| 1014 | 3300048918 | Ga0496115_0037987 | Ga0496115_0037987_723_1853 | 375 |
| 1015 | 3300048919 | Ga0496116_0001381 | Ga0496116_0001381_17500_18630 | 375 |
| 1016 | 3300048920 | Ga0496117_0096234 | Ga0496117_0096234_675_1805 | 375 |
| 1017 | 3300048921 | Ga0496118_0082381 | Ga0496118_0082381_126_1256 | 375 |
| 1018 | 3300048928 | Ga0496125_0008104 | Ga0496125_0008104_4538_5668 | 375 |
| 1019 | 3300050491 | nmdc:mga00v17_204192_c1 | nmdc:mga00v17_204192_c1_37_1167 | 375 |
| 1020 | 3300050492 | nmdc:mga0yw44_100983_c1 | nmdc:mga0yw44_100983_c1_85_1215 | 375 |
| 1021 | 3300053077 | Ga0495601_0036801 | Ga0495601_0036801_296_1426 | 375 |
| 1022 | 3300053088 | Ga0500644_0000716 | Ga0500644_0000716_9864_10994 | 375 |
| 1023 | 3300053121 | Ga0500607_064381 | Ga0500607_064381_560_1690 | 375 |
| 1024 | 3300053145 | Ga0500586_002283 | Ga0500586_002283_1631_2761 | 375 |
| 1025 | 3300053730 | Ga0500645_001743 | Ga0500645_001743_8000_9130 | 375 |
| 1026 | iso_pu_bacteria | 2545555834 | 2545674327 | 375 |
| 1027 | iso_pu_bacteria | 2885383462 | 2885392207 | 375 |
| 1028 | iso_pu_bacteria | 2903768456 | 2903772781 | 375 |
| 1029 | iso_pu_bacteria | 641522639 | 641645069 | 375 |
| 1030 | iso_pu_bacteria | 8056689827 | 8056694724 | 375 |
| 1031 | 3300001990 | JGI24737J22298_10010552 | JGI24737J22298_100105521 | 376 |
| 1032 | 3300005331 | Ga0070670_100037991 | Ga0070670_1000379912 | 376 |
| 1033 | 3300005340 | Ga0070689_100111071 | Ga0070689_1001110711 | 376 |
| 1034 | 3300005355 | Ga0070671_100103037 | Ga0070671_1001030373 | 376 |
| 1035 | 3300005365 | Ga0070688_100144809 | Ga0070688_1001448092 | 376 |
| 1036 | 3300005434 | Ga0070709_10081750 | Ga0070709_100817501 | 376 |
| 1037 | 3300005435 | Ga0070714_100019598 | Ga0070714_1000195982 | 376 |
| 1038 | 3300005437 | Ga0070710_10011405 | Ga0070710_100114053 | 376 |
| 1039 | 3300005439 | Ga0070711_100004717 | Ga0070711_1000047174 | 376 |
| 1040 | 3300005530 | Ga0070679_100012488 | Ga0070679_1000124883 | 376 |
| 1041 | 3300005539 | Ga0068853_100039671 | Ga0068853_1000396711 | 376 |
| 1042 | 3300005543 | Ga0070672_100097229 | Ga0070672_1000972293 | 376 |
| 1043 | 3300005548 | Ga0070665_100047526 | Ga0070665_1000475263 | 376 |
| 1044 | 3300005548 | Ga0070665_100187906 | Ga0070665_1001879062 | 376 |
| 1045 | 3300005563 | Ga0068855_100015636 | Ga0068855_1000156365 | 376 |
| 1046 | 3300005577 | Ga0068857_100051056 | Ga0068857_1000510562 | 376 |
| 1047 | 3300005614 | Ga0068856_100293657 | Ga0068856_1002936572 | 376 |
| 1048 | 3300005719 | Ga0068861_100080421 | Ga0068861_1000804212 | 376 |
| 1049 | 3300005841 | Ga0068863_100091617 | Ga0068863_1000916174 | 376 |
| 1050 | 3300006042 | Ga0075368_10005197 | Ga0075368_100051973 | 376 |
| 1051 | 3300006051 | Ga0075364_10022670 | Ga0075364_100226702 | 376 |
| 1052 | 3300006175 | Ga0070712_100096908 | Ga0070712_1000969082 | 376 |
| 1053 | 3300006178 | Ga0075367_10097893 | Ga0075367_100978931 | 376 |
| 1054 | 3300006186 | Ga0075369_10023578 | Ga0075369_100235782 | 376 |
| 1055 | 3300006195 | Ga0075366_10105801 | Ga0075366_101058012 | 376 |
| 1056 | 3300009093 | Ga0105240_10015053 | Ga0105240_1001505311 | 376 |
| 1057 | 3300009147 | Ga0114129_10178319 | Ga0114129_101783192 | 376 |
| 1058 | 3300009545 | Ga0105237_10369684 | Ga0105237_103696841 | 376 |
| 1059 | 3300009551 | Ga0105238_10369881 | Ga0105238_103698811 | 376 |
| 1060 | 3300010375 | Ga0105239_10020537 | Ga0105239_100205372 | 376 |
| 1061 | 3300021377 | Ga0213874_10027120 | Ga0213874_100271202 | 376 |
| 1062 | 3300025253 | Ga0209677_100138 | Ga0209677_10013834 | 376 |
| 1063 | 3300025261 | Ga0209233_1001323 | Ga0209233_10013236 | 376 |
| 1064 | 3300025898 | Ga0207692_10038205 | Ga0207692_100382052 | 376 |
| 1065 | 3300025904 | Ga0207647_10001241 | Ga0207647_1000124116 | 376 |
| 1066 | 3300025906 | Ga0207699_10047620 | Ga0207699_100476202 | 376 |
| 1067 | 3300025915 | Ga0207693_10019955 | Ga0207693_100199553 | 376 |
| 1068 | 3300025916 | Ga0207663_10033876 | Ga0207663_100338763 | 376 |
| 1069 | 3300025917 | Ga0207660_10202593 | Ga0207660_102025932 | 376 |
| 1070 | 3300025920 | Ga0207649_10212697 | Ga0207649_102126971 | 376 |
| 1071 | 3300025924 | Ga0207694_10071276 | Ga0207694_100712762 | 376 |
| 1072 | 3300025925 | Ga0207650_10117079 | Ga0207650_101170792 | 376 |
| 1073 | 3300025931 | Ga0207644_10046328 | Ga0207644_100463282 | 376 |
| 1074 | 3300025933 | Ga0207706_10082603 | Ga0207706_100826032 | 376 |
| 1075 | 3300025940 | Ga0207691_10066544 | Ga0207691_100665442 | 376 |
| 1076 | 3300025949 | Ga0207667_10190655 | Ga0207667_101906551 | 376 |
| 1077 | 3300025960 | Ga0207651_10069164 | Ga0207651_100691642 | 376 |
| 1078 | 3300026035 | Ga0207703_10033248 | Ga0207703_100332483 | 376 |
| 1079 | 3300026041 | Ga0207639_10110182 | Ga0207639_101101821 | 376 |
| 1080 | 3300026078 | Ga0207702_10107934 | Ga0207702_101079341 | 376 |
| 1081 | 3300026116 | Ga0207674_10002364 | Ga0207674_1000236416 | 376 |
| 1082 | 3300026118 | Ga0207675_100100344 | Ga0207675_1001003442 | 376 |
| 1083 | 3300027866 | Ga0209813_10014707 | Ga0209813_100147072 | 376 |
| 1084 | 3300028379 | Ga0268266_10050734 | Ga0268266_100507342 | 376 |
| 1085 | 3300028563 | Ga0265319_1015026 | Ga0265319_10150263 | 376 |
| 1086 | 3300028653 | Ga0265323_10000788 | Ga0265323_100007882 | 376 |
| 1087 | 3300028666 | Ga0265336_10005161 | Ga0265336_100051614 | 376 |
| 1088 | 3300028800 | Ga0265338_10001265 | Ga0265338_1000126533 | 376 |
| 1089 | 3300028800 | Ga0265338_10037858 | Ga0265338_100378582 | 376 |
| 1090 | 3300029957 | Ga0265324_10006833 | Ga0265324_100068334 | 376 |
| 1091 | 3300031235 | Ga0265330_10039666 | Ga0265330_100396662 | 376 |
| 1092 | 3300031241 | Ga0265325_10012689 | Ga0265325_100126893 | 376 |
| 1093 | 3300031249 | Ga0265339_10000158 | Ga0265339_1000015826 | 376 |
| 1094 | 3300031249 | Ga0265339_10003907 | Ga0265339_100039074 | 376 |
| 1095 | 3300031595 | Ga0265313_10000426 | Ga0265313_1000042644 | 376 |
| 1096 | 3300031691 | Ga0316579_10003798 | Ga0316579_100037983 | 376 |
| 1097 | 3300031711 | Ga0265314_10004473 | Ga0265314_100044735 | 376 |
| 1098 | 3300035111 | Ga0373923_0064335 | Ga0373923_0064335_392_1528 | 376 |
| 1099 | 3300035117 | Ga0373953_0011755 | Ga0373953_0011755_990_2123 | 376 |
| 1100 | 3300035117 | Ga0373953_0030857 | Ga0373953_0030857_866_2002 | 376 |
| 1101 | 3300035117 | Ga0373953_0064333 | Ga0373953_0064333_330_1463 | 376 |
| 1102 | 3300035118 | Ga0373954_0070277 | Ga0373954_0070277_442_1578 | 376 |
| 1103 | 3300035119 | Ga0373956_0004249 | Ga0373956_0004249_1200_2333 | 376 |
| 1104 | 3300035120 | Ga0373957_0014655 | Ga0373957_0014655_857_1990 | 376 |
| 1105 | 3300035120 | Ga0373957_0039688 | Ga0373957_0039688_309_1445 | 376 |
| 1106 | 3300035398 | Ga0316574_0065256 | Ga0316574_0065256_1029_2183 | 376 |
| 1107 | 3300035410 | Ga0373924_0023112 | Ga0373924_0023112_999_2132 | 376 |
| 1108 | 3300035692 | Ga0373935_0073906 | Ga0373935_0073906_620_1753 | 376 |
| 1109 | 3300036401 | Ga0373937_0001336 | Ga0373937_0001336_7722_8855 | 376 |
| 1110 | 3300036647 | Ga0316582_0134982 | Ga0316582_0134982_46_1182 | 376 |
| 1111 | 3300037068 | Ga0373925_0008544 | Ga0373925_0008544_1080_2213 | 376 |
| 1112 | 3300038741 | Ga0400488_27481 | Ga0400488_27481_227_1366 | 376 |
| 1113 | 3300038742 | Ga0400486_05920 | Ga0400486_05920_250_1389 | 376 |
| 1114 | 3300039437 | Ga0436365_0352932 | Ga0436365_0352932_324_1457 | 376 |
| 1115 | 3300039450 | Ga0436363_0077061 | Ga0436363_0077061_2263_3423 | 376 |
| 1116 | 3300046454 | Ga0495592_0033557 | Ga0495592_0033557_2685_3821 | 376 |
| 1117 | 3300046459 | Ga0495629_0012888 | Ga0495629_0012888_1860_2993 | 376 |
| 1118 | 3300046462 | Ga0495651_0001352 | Ga0495651_0001352_13821_14954 | 376 |
| 1119 | 3300046462 | Ga0495651_0079504 | Ga0495651_0079504_154_1287 | 376 |
| 1120 | 3300046463 | Ga0495653_0015503 | Ga0495653_0015503_4280_5413 | 376 |
| 1121 | 3300046463 | Ga0495653_0073254 | Ga0495653_0073254_557_1693 | 376 |
| 1122 | 3300046477 | Ga0495664_0152003 | Ga0495664_0152003_67_1200 | 376 |
| 1123 | 3300046511 | Ga0495608_0000442 | Ga0495608_0000442_16672_17805 | 376 |
| 1124 | 3300046514 | Ga0495618_0011384 | Ga0495618_0011384_4077_5210 | 376 |
| 1125 | 3300046516 | Ga0495628_0111604 | Ga0495628_0111604_895_2031 | 376 |
| 1126 | 3300046517 | Ga0495630_0219843 | Ga0495630_0219843_255_1391 | 376 |
| 1127 | 3300046529 | Ga0495652_0152603 | Ga0495652_0152603_585_1718 | 376 |
| 1128 | 3300046533 | Ga0495640_0019531 | Ga0495640_0019531_1827_2960 | 376 |
| 1129 | 3300046536 | Ga0495587_0001204 | Ga0495587_0001204_913_2046 | 376 |
| 1130 | 3300046536 | Ga0495587_0033102 | Ga0495587_0033102_166_1299 | 376 |
| 1131 | 3300046559 | Ga0495667_0001732 | Ga0495667_0001732_3714_4847 | 376 |
| 1132 | 3300046559 | Ga0495667_0011498 | Ga0495667_0011498_3789_4922 | 376 |
| 1133 | 3300046559 | Ga0495667_0041089 | Ga0495667_0041089_753_1889 | 376 |
| 1134 | 3300046642 | Ga0495634_0008856 | Ga0495634_0008856_2157_3290 | 376 |
| 1135 | 3300046663 | Ga0495635_0016633 | Ga0495635_0016633_503_1636 | 376 |
| 1136 | 3300046675 | Ga0495657_0063861 | Ga0495657_0063861_130_1263 | 376 |
| 1137 | 3300046678 | Ga0495599_0073349 | Ga0495599_0073349_239_1372 | 376 |
| 1138 | 3300046679 | Ga0495623_0072195 | Ga0495623_0072195_781_1914 | 376 |
| 1139 | 3300046680 | Ga0495646_0010351 | Ga0495646_0010351_386_1519 | 376 |
| 1140 | 3300047317 | Ga0495604_0000422 | Ga0495604_0000422_24191_25324 | 376 |
| 1141 | 3300047319 | Ga0495674_0004401 | Ga0495674_0004401_922_2055 | 376 |
| 1142 | 3300047320 | Ga0495672_0019795 | Ga0495672_0019795_823_1956 | 376 |
| 1143 | 3300047321 | Ga0495676_0045629 | Ga0495676_0045629_1787_2920 | 376 |
| 1144 | 3300047322 | Ga0495680_0002318 | Ga0495680_0002318_5425_6558 | 376 |
| 1145 | 3300047444 | Ga0495675_0016294 | Ga0495675_0016294_1765_2898 | 376 |
| 1146 | 3300047471 | Ga0495684_0002100 | Ga0495684_0002100_11537_12670 | 376 |
| 1147 | 3300048088 | Ga0495602_0015358 | Ga0495602_0015358_2269_3402 | 376 |
| 1148 | 3300048088 | Ga0495602_0024539 | Ga0495602_0024539_3775_4911 | 376 |
| 1149 | 3300048915 | Ga0496112_0031659 | Ga0496112_0031659_1251_2384 | 376 |
| 1150 | 3300048915 | Ga0496112_0064226 | Ga0496112_0064226_1031_2164 | 376 |
| 1151 | 3300048918 | Ga0496115_0148844 | Ga0496115_0148844_462_1595 | 376 |
| 1152 | 3300048924 | Ga0496121_0012773 | Ga0496121_0012773_5212_6372 | 376 |
| 1153 | 3300048928 | Ga0496125_0000829 | Ga0496125_0000829_47829_48962 | 376 |
| 1154 | 3300048929 | Ga0496126_0096775 | Ga0496126_0096775_1387_2520 | 376 |
| 1155 | 3300049571 | Ga0501034_0096808 | Ga0501034_0096808_1162_2298 | 376 |
| 1156 | 3300049581 | Ga0501047_0094992 | Ga0501047_0094992_155_1303 | 376 |
| 1157 | 3300049592 | Ga0501076_0061488 | Ga0501076_0061488_1776_2912 | 376 |
| 1158 | 3300049741 | Ga0501079_0039035 | Ga0501079_0039035_924_2060 | 376 |
| 1159 | 3300049742 | Ga0501080_0154419 | Ga0501080_0154419_353_1501 | 376 |
| 1160 | 3300049823 | Ga0501044_0040089 | Ga0501044_0040089_2782_3930 | 376 |
| 1161 | 3300049823 | Ga0501044_0211473 | Ga0501044_0211473_281_1417 | 376 |
| 1162 | 3300049824 | Ga0501045_0066126 | Ga0501045_0066126_1124_2260 | 376 |
| 1163 | 3300050491 | nmdc:mga00v17_91310_c1 | nmdc:mga00v17_91310_c1_381_1517 | 376 |
| 1164 | 3300050493 | nmdc:mga0k408_77720_c1 | nmdc:mga0k408_77720_c1_509_1645 | 376 |
| 1165 | 3300053077 | Ga0495601_0043124 | Ga0495601_0043124_1421_2554 | 376 |
| 1166 | 3300053077 | Ga0495601_0044633 | Ga0495601_0044633_400_1533 | 376 |
| 1167 | 3300053084 | Ga0495595_0000603 | Ga0495595_0000603_4306_5439 | 376 |
| 1168 | 3300053084 | Ga0495595_0022366 | Ga0495595_0022366_1288_2421 | 376 |
| 1169 | 3300053084 | Ga0495595_0105066 | Ga0495595_0105066_184_1320 | 376 |
| 1170 | 3300053085 | Ga0495619_0001556 | Ga0495619_0001556_2625_3758 | 376 |
| 1171 | 3300053136 | Ga0500559_0000596 | Ga0500559_0000596_18172_19368 | 376 |
| 1172 | 3300053153 | Ga0500616_0000084 | Ga0500616_0000084_61997_63175 | 376 |
| 1173 | 3300053163 | Ga0500639_002824 | Ga0500639_002824_4324_5520 | 376 |
| 1174 | 3300060353 | Ga0501082_0052291 | Ga0501082_0052291_1843_2979 | 376 |
| 1175 | iso_pu_bacteria | 2524023228 | 2524536119 | 376 |
| 1176 | iso_pu_bacteria | 2728368998 | 2728748750 | 376 |
| 1177 | iso_pu_bacteria | 2791355199 | 2793079385 | 376 |
| 1178 | iso_pu_bacteria | 2891088606 | 2891089030 | 376 |
| 1179 | iso_pu_bacteria | 2904699407 | 2904705272 | 376 |
| 1180 | iso_pu_bacteria | 8006964411 | 8006965006 | 376 |
| 1181 | 2209111006 | 2214544935 | 2213593654 | 377 |
| 1182 | 3300000042 | ARSoilYngRDRAFT_c00089 | ARSoilYngRDRAFT_0008911 | 377 |
| 1183 | 3300000044 | ARSoilOldRDRAFT_c000300 | ARSoilOldRDRAFT_0003005 | 377 |
| 1184 | 3300000044 | ARSoilOldRDRAFT_c000339 | ARSoilOldRDRAFT_0003395 | 377 |
| 1185 | 3300000045 | ARCol0oldRDRAFT_c00174 | ARCol0oldRDRAFT_001744 | 377 |
| 1186 | 3300000652 | ARCol0yngRDRAFT_1000107 | ARCol0yngRDRAFT_100010711 | 377 |
| 1187 | 3300001915 | JGI24741J21665_1013626 | JGI24741J21665_10136262 | 377 |
| 1188 | 3300001977 | JGI24746J21847_1000182 | JGI24746J21847_10001826 | 377 |
| 1189 | 3300001978 | JGI24747J21853_1002123 | JGI24747J21853_10021232 | 377 |
| 1190 | 3300001989 | JGI24739J22299_10002319 | JGI24739J22299_100023194 | 377 |
| 1191 | 3300001990 | JGI24737J22298_10007743 | JGI24737J22298_100077433 | 377 |
| 1192 | 3300001990 | JGI24737J22298_10023654 | JGI24737J22298_100236542 | 377 |
| 1193 | 3300002070 | JGI24750J21931_1000513 | JGI24750J21931_10005133 | 377 |
| 1194 | 3300002070 | JGI24750J21931_1000665 | JGI24750J21931_10006656 | 377 |
| 1195 | 3300002073 | JGI24745J21846_1000274 | JGI24745J21846_10002741 | 377 |
| 1196 | 3300002075 | JGI24738J21930_10000052 | JGI24738J21930_1000005212 | 377 |
| 1197 | 3300002076 | JGI24749J21850_1002731 | JGI24749J21850_10027312 | 377 |
| 1198 | 3300002077 | JGI24744J21845_10001379 | JGI24744J21845_100013792 | 377 |
| 1199 | 3300002126 | JGI24035J26624_1000226 | JGI24035J26624_10002264 | 377 |
| 1200 | 3300002155 | JGI24033J26618_1002616 | JGI24033J26618_10026162 | 377 |
| 1201 | 3300002244 | JGI24742J22300_10001173 | JGI24742J22300_100011733 | 377 |
| 1202 | 3300005289 | Ga0065704_10090369 | Ga0065704_100903691 | 377 |
| 1203 | 3300005290 | Ga0065712_10015554 | Ga0065712_100155542 | 377 |
| 1204 | 3300005290 | Ga0065712_10068990 | Ga0065712_100689905 | 377 |
| 1205 | 3300005290 | Ga0065712_10083170 | Ga0065712_100831703 | 377 |
| 1206 | 3300005290 | Ga0065712_10099300 | Ga0065712_100993002 | 377 |
| 1207 | 3300005293 | Ga0065715_10089733 | Ga0065715_100897335 | 377 |
| 1208 | 3300005293 | Ga0065715_10104580 | Ga0065715_101045803 | 377 |
| 1209 | 3300005295 | Ga0065707_10092121 | Ga0065707_100921213 | 377 |
| 1210 | 3300005328 | Ga0070676_10001246 | Ga0070676_100012466 | 377 |
| 1211 | 3300005329 | Ga0070683_100003790 | Ga0070683_1000037906 | 377 |
| 1212 | 3300005329 | Ga0070683_100041700 | Ga0070683_1000417004 | 377 |
| 1213 | 3300005330 | Ga0070690_100004565 | Ga0070690_1000045652 | 377 |
| 1214 | 3300005330 | Ga0070690_100004629 | Ga0070690_1000046292 | 377 |
| 1215 | 3300005330 | Ga0070690_100134507 | Ga0070690_1001345072 | 377 |
| 1216 | 3300005331 | Ga0070670_100002085 | Ga0070670_10000208511 | 377 |
| 1217 | 3300005331 | Ga0070670_100042623 | Ga0070670_1000426232 | 377 |
| 1218 | 3300005331 | Ga0070670_100100990 | Ga0070670_1001009901 | 377 |
| 1219 | 3300005331 | Ga0070670_100263878 | Ga0070670_1002638781 | 377 |
| 1220 | 3300005333 | Ga0070677_10000009 | Ga0070677_1000000916 | 377 |
| 1221 | 3300005334 | Ga0068869_100002305 | Ga0068869_1000023056 | 377 |
| 1222 | 3300005335 | Ga0070666_10007715 | Ga0070666_100077155 | 377 |
| 1223 | 3300005335 | Ga0070666_10009200 | Ga0070666_100092004 | 377 |
| 1224 | 3300005336 | Ga0070680_100004098 | Ga0070680_1000040985 | 377 |
| 1225 | 3300005336 | Ga0070680_100018156 | Ga0070680_1000181564 | 377 |
| 1226 | 3300005337 | Ga0070682_100000116 | Ga0070682_1000001167 | 377 |
| 1227 | 3300005337 | Ga0070682_100034485 | Ga0070682_1000344853 | 377 |
| 1228 | 3300005338 | Ga0068868_100003854 | Ga0068868_1000038546 | 377 |
| 1229 | 3300005338 | Ga0068868_100052544 | Ga0068868_1000525443 | 377 |
| 1230 | 3300005338 | Ga0068868_100118518 | Ga0068868_1001185182 | 377 |
| 1231 | 3300005338 | Ga0068868_100121868 | Ga0068868_1001218682 | 377 |
| 1232 | 3300005339 | Ga0070660_100003331 | Ga0070660_1000033315 | 377 |
| 1233 | 3300005339 | Ga0070660_100019816 | Ga0070660_1000198164 | 377 |
| 1234 | 3300005340 | Ga0070689_100003558 | Ga0070689_1000035585 | 377 |
| 1235 | 3300005340 | Ga0070689_100010855 | Ga0070689_1000108555 | 377 |
| 1236 | 3300005340 | Ga0070689_100194892 | Ga0070689_1001948921 | 377 |
| 1237 | 3300005341 | Ga0070691_10003923 | Ga0070691_100039233 | 377 |
| 1238 | 3300005341 | Ga0070691_10018597 | Ga0070691_100185973 | 377 |
| 1239 | 3300005343 | Ga0070687_100000789 | Ga0070687_1000007895 | 377 |
| 1240 | 3300005343 | Ga0070687_100023301 | Ga0070687_1000233012 | 377 |
| 1241 | 3300005344 | Ga0070661_100001106 | Ga0070661_10000110612 | 377 |
| 1242 | 3300005344 | Ga0070661_100040659 | Ga0070661_1000406593 | 377 |
| 1243 | 3300005345 | Ga0070692_10000072 | Ga0070692_100000726 | 377 |
| 1244 | 3300005345 | Ga0070692_10014992 | Ga0070692_100149922 | 377 |
| 1245 | 3300005347 | Ga0070668_100101369 | Ga0070668_1001013692 | 377 |
| 1246 | 3300005353 | Ga0070669_100006413 | Ga0070669_1000064135 | 377 |
| 1247 | 3300005353 | Ga0070669_100023793 | Ga0070669_1000237933 | 377 |
| 1248 | 3300005354 | Ga0070675_100002349 | Ga0070675_10000234912 | 377 |
| 1249 | 3300005354 | Ga0070675_100075291 | Ga0070675_1000752912 | 377 |
| 1250 | 3300005355 | Ga0070671_100000438 | Ga0070671_10000043829 | 377 |
| 1251 | 3300005355 | Ga0070671_100022090 | Ga0070671_1000220904 | 377 |
| 1252 | 3300005355 | Ga0070671_100050350 | Ga0070671_1000503502 | 377 |
| 1253 | 3300005355 | Ga0070671_100101976 | Ga0070671_1001019762 | 377 |
| 1254 | 3300005356 | Ga0070674_100010977 | Ga0070674_1000109775 | 377 |
| 1255 | 3300005356 | Ga0070674_100082631 | Ga0070674_1000826312 | 377 |
| 1256 | 3300005356 | Ga0070674_100134883 | Ga0070674_1001348831 | 377 |
| 1257 | 3300005364 | Ga0070673_100013957 | Ga0070673_1000139572 | 377 |
| 1258 | 3300005364 | Ga0070673_100108718 | Ga0070673_1001087181 | 377 |
| 1259 | 3300005365 | Ga0070688_100002434 | Ga0070688_1000024343 | 377 |
| 1260 | 3300005365 | Ga0070688_100011673 | Ga0070688_1000116733 | 377 |
| 1261 | 3300005365 | Ga0070688_100024430 | Ga0070688_1000244301 | 377 |
| 1262 | 3300005366 | Ga0070659_100004384 | Ga0070659_1000043845 | 377 |
| 1263 | 3300005366 | Ga0070659_100031077 | Ga0070659_1000310772 | 377 |
| 1264 | 3300005367 | Ga0070667_100022200 | Ga0070667_1000222001 | 377 |
| 1265 | 3300005367 | Ga0070667_100028213 | Ga0070667_1000282133 | 377 |
| 1266 | 3300005367 | Ga0070667_100162549 | Ga0070667_1001625492 | 377 |
| 1267 | 3300005434 | Ga0070709_10002732 | Ga0070709_100027325 | 377 |
| 1268 | 3300005436 | Ga0070713_100019289 | Ga0070713_1000192894 | 377 |
| 1269 | 3300005436 | Ga0070713_100035925 | Ga0070713_1000359252 | 377 |
| 1270 | 3300005436 | Ga0070713_100064129 | Ga0070713_1000641294 | 377 |
| 1271 | 3300005436 | Ga0070713_100169074 | Ga0070713_1001690741 | 377 |
| 1272 | 3300005437 | Ga0070710_10005268 | Ga0070710_100052685 | 377 |
| 1273 | 3300005438 | Ga0070701_10000749 | Ga0070701_100007495 | 377 |
| 1274 | 3300005438 | Ga0070701_10029566 | Ga0070701_100295662 | 377 |
| 1275 | 3300005439 | Ga0070711_100014964 | Ga0070711_1000149645 | 377 |
| 1276 | 3300005439 | Ga0070711_100115530 | Ga0070711_1001155302 | 377 |
| 1277 | 3300005439 | Ga0070711_100131993 | Ga0070711_1001319932 | 377 |
| 1278 | 3300005440 | Ga0070705_100001548 | Ga0070705_1000015486 | 377 |
| 1279 | 3300005440 | Ga0070705_100008627 | Ga0070705_1000086274 | 377 |
| 1280 | 3300005441 | Ga0070700_100002431 | Ga0070700_1000024315 | 377 |
| 1281 | 3300005441 | Ga0070700_100005261 | Ga0070700_1000052615 | 377 |
| 1282 | 3300005444 | Ga0070694_100008016 | Ga0070694_1000080164 | 377 |
| 1283 | 3300005444 | Ga0070694_100020661 | Ga0070694_1000206614 | 377 |
| 1284 | 3300005455 | Ga0070663_100002701 | Ga0070663_1000027016 | 377 |
| 1285 | 3300005455 | Ga0070663_100028958 | Ga0070663_1000289583 | 377 |
| 1286 | 3300005456 | Ga0070678_100003996 | Ga0070678_1000039964 | 377 |
| 1287 | 3300005456 | Ga0070678_100021420 | Ga0070678_1000214202 | 377 |
| 1288 | 3300005456 | Ga0070678_100029939 | Ga0070678_1000299393 | 377 |
| 1289 | 3300005457 | Ga0070662_100013570 | Ga0070662_1000135703 | 377 |
| 1290 | 3300005457 | Ga0070662_100032477 | Ga0070662_1000324773 | 377 |
| 1291 | 3300005458 | Ga0070681_10027797 | Ga0070681_100277973 | 377 |
| 1292 | 3300005458 | Ga0070681_10049000 | Ga0070681_100490003 | 377 |
| 1293 | 3300005459 | Ga0068867_100003047 | Ga0068867_1000030475 | 377 |
| 1294 | 3300005459 | Ga0068867_100087539 | Ga0068867_1000875392 | 377 |
| 1295 | 3300005459 | Ga0068867_100133071 | Ga0068867_1001330711 | 377 |
| 1296 | 3300005466 | Ga0070685_10006097 | Ga0070685_100060972 | 377 |
| 1297 | 3300005466 | Ga0070685_10022040 | Ga0070685_100220404 | 377 |
| 1298 | 3300005466 | Ga0070685_10023246 | Ga0070685_100232463 | 377 |
| 1299 | 3300005466 | Ga0070685_10052006 | Ga0070685_100520062 | 377 |
| 1300 | 3300005466 | Ga0070685_10056001 | Ga0070685_100560012 | 377 |
| 1301 | 3300005530 | Ga0070679_100045348 | Ga0070679_1000453483 | 377 |
| 1302 | 3300005530 | Ga0070679_100174934 | Ga0070679_1001749342 | 377 |
| 1303 | 3300005535 | Ga0070684_100265552 | Ga0070684_1002655522 | 377 |
| 1304 | 3300005536 | Ga0070697_100001151 | Ga0070697_10000115121 | 377 |
| 1305 | 3300005539 | Ga0068853_100005475 | Ga0068853_1000054756 | 377 |
| 1306 | 3300005539 | Ga0068853_100142783 | Ga0068853_1001427832 | 377 |
| 1307 | 3300005539 | Ga0068853_100179625 | Ga0068853_1001796252 | 377 |
| 1308 | 3300005543 | Ga0070672_100003650 | Ga0070672_1000036503 | 377 |
| 1309 | 3300005543 | Ga0070672_100072586 | Ga0070672_1000725862 | 377 |
| 1310 | 3300005543 | Ga0070672_100148955 | Ga0070672_1001489552 | 377 |
| 1311 | 3300005544 | Ga0070686_100001755 | Ga0070686_1000017555 | 377 |
| 1312 | 3300005544 | Ga0070686_100015274 | Ga0070686_1000152743 | 377 |
| 1313 | 3300005544 | Ga0070686_100042821 | Ga0070686_1000428212 | 377 |
| 1314 | 3300005544 | Ga0070686_100058573 | Ga0070686_1000585731 | 377 |
| 1315 | 3300005544 | Ga0070686_100068040 | Ga0070686_1000680402 | 377 |
| 1316 | 3300005545 | Ga0070695_100003819 | Ga0070695_1000038192 | 377 |
| 1317 | 3300005545 | Ga0070695_100013267 | Ga0070695_1000132673 | 377 |
| 1318 | 3300005545 | Ga0070695_100014726 | Ga0070695_1000147264 | 377 |
| 1319 | 3300005546 | Ga0070696_100021998 | Ga0070696_1000219985 | 377 |
| 1320 | 3300005546 | Ga0070696_100022292 | Ga0070696_1000222923 | 377 |
| 1321 | 3300005546 | Ga0070696_100043536 | Ga0070696_1000435362 | 377 |
| 1322 | 3300005547 | Ga0070693_100002396 | Ga0070693_1000023966 | 377 |
| 1323 | 3300005547 | Ga0070693_100054369 | Ga0070693_1000543692 | 377 |
| 1324 | 3300005547 | Ga0070693_100089785 | Ga0070693_1000897852 | 377 |
| 1325 | 3300005548 | Ga0070665_100060124 | Ga0070665_1000601241 | 377 |
| 1326 | 3300005549 | Ga0070704_100002150 | Ga0070704_1000021505 | 377 |
| 1327 | 3300005549 | Ga0070704_100006558 | Ga0070704_1000065584 | 377 |
| 1328 | 3300005549 | Ga0070704_100132809 | Ga0070704_1001328092 | 377 |
| 1329 | 3300005563 | Ga0068855_100082470 | Ga0068855_1000824703 | 377 |
| 1330 | 3300005564 | Ga0070664_100065325 | Ga0070664_1000653253 | 377 |
| 1331 | 3300005564 | Ga0070664_100080119 | Ga0070664_1000801193 | 377 |
| 1332 | 3300005564 | Ga0070664_100165374 | Ga0070664_1001653742 | 377 |
| 1333 | 3300005577 | Ga0068857_100000295 | Ga0068857_10000029512 | 377 |
| 1334 | 3300005578 | Ga0068854_100000260 | Ga0068854_10000026033 | 377 |
| 1335 | 3300005614 | Ga0068856_100008963 | Ga0068856_1000089636 | 377 |
| 1336 | 3300005615 | Ga0070702_100000267 | Ga0070702_10000026714 | 377 |
| 1337 | 3300005615 | Ga0070702_100069352 | Ga0070702_1000693521 | 377 |
| 1338 | 3300005617 | Ga0068859_100016349 | Ga0068859_1000163495 | 377 |
| 1339 | 3300005617 | Ga0068859_100031702 | Ga0068859_1000317023 | 377 |
| 1340 | 3300005617 | Ga0068859_100161711 | Ga0068859_1001617112 | 377 |
| 1341 | 3300005618 | Ga0068864_100001366 | Ga0068864_1000013666 | 377 |
| 1342 | 3300005618 | Ga0068864_100262041 | Ga0068864_1002620411 | 377 |
| 1343 | 3300005718 | Ga0068866_10001935 | Ga0068866_100019352 | 377 |
| 1344 | 3300005718 | Ga0068866_10025008 | Ga0068866_100250083 | 377 |
| 1345 | 3300005719 | Ga0068861_100001047 | Ga0068861_1000010471 | 377 |
| 1346 | 3300005840 | Ga0068870_10000404 | Ga0068870_100004049 | 377 |
| 1347 | 3300005840 | Ga0068870_10036806 | Ga0068870_100368062 | 377 |
| 1348 | 3300005841 | Ga0068863_100007320 | Ga0068863_1000073204 | 377 |
| 1349 | 3300005841 | Ga0068863_100192569 | Ga0068863_1001925693 | 377 |
| 1350 | 3300005842 | Ga0068858_100004119 | Ga0068858_1000041197 | 377 |
| 1351 | 3300005842 | Ga0068858_100037563 | Ga0068858_1000375632 | 377 |
| 1352 | 3300005842 | Ga0068858_100049400 | Ga0068858_1000494001 | 377 |
| 1353 | 3300005842 | Ga0068858_100088219 | Ga0068858_1000882192 | 377 |
| 1354 | 3300005843 | Ga0068860_100007370 | Ga0068860_1000073705 | 377 |
| 1355 | 3300005843 | Ga0068860_100062258 | Ga0068860_1000622582 | 377 |
| 1356 | 3300005843 | Ga0068860_100101582 | Ga0068860_1001015822 | 377 |
| 1357 | 3300005843 | Ga0068860_100309147 | Ga0068860_1003091471 | 377 |
| 1358 | 3300005844 | Ga0068862_100005293 | Ga0068862_1000052935 | 377 |
| 1359 | 3300005937 | Ga0081455_10000012 | Ga0081455_10000012143 | 377 |
| 1360 | 3300005937 | Ga0081455_10007757 | Ga0081455_1000775711 | 377 |
| 1361 | 3300005983 | Ga0081540_1015307 | Ga0081540_10153074 | 377 |
| 1362 | 3300005983 | Ga0081540_1017136 | Ga0081540_10171362 | 377 |
| 1363 | 3300006028 | Ga0070717_10002456 | Ga0070717_100024566 | 377 |
| 1364 | 3300006163 | Ga0070715_10008835 | Ga0070715_100088352 | 377 |
| 1365 | 3300006173 | Ga0070716_100004186 | Ga0070716_1000041863 | 377 |
| 1366 | 3300006175 | Ga0070712_100030142 | Ga0070712_1000301424 | 377 |
| 1367 | 3300006175 | Ga0070712_100195450 | Ga0070712_1001954501 | 377 |
| 1368 | 3300006178 | Ga0075367_10051435 | Ga0075367_100514352 | 377 |
| 1369 | 3300006237 | Ga0097621_100000421 | Ga0097621_10000042118 | 377 |
| 1370 | 3300006237 | Ga0097621_100002992 | Ga0097621_1000029928 | 377 |
| 1371 | 3300006358 | Ga0068871_100000879 | Ga0068871_1000008794 | 377 |
| 1372 | 3300006358 | Ga0068871_100025095 | Ga0068871_1000250953 | 377 |
| 1373 | 3300006358 | Ga0068871_100087672 | Ga0068871_1000876722 | 377 |
| 1374 | 3300006358 | Ga0068871_100124931 | Ga0068871_1001249312 | 377 |
| 1375 | 3300006844 | Ga0075428_100011825 | Ga0075428_1000118254 | 377 |
| 1376 | 3300006846 | Ga0075430_100005350 | Ga0075430_1000053509 | 377 |
| 1377 | 3300006847 | Ga0075431_100004764 | Ga0075431_1000047643 | 377 |
| 1378 | 3300006847 | Ga0075431_100097870 | Ga0075431_1000978703 | 377 |
| 1379 | 3300006852 | Ga0075433_10036921 | Ga0075433_100369214 | 377 |
| 1380 | 3300006852 | Ga0075433_10072998 | Ga0075433_100729983 | 377 |
| 1381 | 3300006852 | Ga0075433_10086516 | Ga0075433_100865162 | 377 |
| 1382 | 3300006871 | Ga0075434_100002590 | Ga0075434_1000025908 | 377 |
| 1383 | 3300006871 | Ga0075434_100005762 | Ga0075434_1000057625 | 377 |
| 1384 | 3300006880 | Ga0075429_100002604 | Ga0075429_1000026045 | 377 |
| 1385 | 3300006880 | Ga0075429_100177792 | Ga0075429_1001777922 | 377 |
| 1386 | 3300006881 | Ga0068865_100003376 | Ga0068865_1000033764 | 377 |
| 1387 | 3300006881 | Ga0068865_100013454 | Ga0068865_1000134544 | 377 |
| 1388 | 3300006881 | Ga0068865_100111081 | Ga0068865_1001110812 | 377 |
| 1389 | 3300006931 | Ga0097620_100016349 | Ga0097620_1000163495 | 377 |
| 1390 | 3300006931 | Ga0097620_100031702 | Ga0097620_1000317023 | 377 |
| 1391 | 3300006931 | Ga0097620_100161714 | Ga0097620_1001617142 | 377 |
| 1392 | 3300007076 | Ga0075435_100031352 | Ga0075435_1000313525 | 377 |
| 1393 | 3300007076 | Ga0075435_100237785 | Ga0075435_1002377852 | 377 |
| 1394 | 3300009093 | Ga0105240_10189027 | Ga0105240_101890271 | 377 |
| 1395 | 3300009094 | Ga0111539_10000373 | Ga0111539_100003739 | 377 |
| 1396 | 3300009094 | Ga0111539_10009860 | Ga0111539_100098605 | 377 |
| 1397 | 3300009094 | Ga0111539_10162494 | Ga0111539_101624943 | 377 |
| 1398 | 3300009098 | Ga0105245_10013128 | Ga0105245_100131285 | 377 |
| 1399 | 3300009098 | Ga0105245_10024300 | Ga0105245_100243005 | 377 |
| 1400 | 3300009098 | Ga0105245_10049447 | Ga0105245_100494473 | 377 |
| 1401 | 3300009098 | Ga0105245_10069230 | Ga0105245_100692301 | 377 |
| 1402 | 3300009101 | Ga0105247_10012428 | Ga0105247_100124284 | 377 |
| 1403 | 3300009101 | Ga0105247_10012564 | Ga0105247_100125642 | 377 |
| 1404 | 3300009101 | Ga0105247_10014958 | Ga0105247_100149583 | 377 |
| 1405 | 3300009147 | Ga0114129_10023543 | Ga0114129_100235435 | 377 |
| 1406 | 3300009147 | Ga0114129_10060452 | Ga0114129_100604524 | 377 |
| 1407 | 3300009147 | Ga0114129_10167898 | Ga0114129_101678983 | 377 |
| 1408 | 3300009148 | Ga0105243_10018313 | Ga0105243_100183131 | 377 |
| 1409 | 3300009148 | Ga0105243_10037937 | Ga0105243_100379372 | 377 |
| 1410 | 3300009174 | Ga0105241_10009140 | Ga0105241_100091404 | 377 |
| 1411 | 3300009176 | Ga0105242_10004099 | Ga0105242_100040996 | 377 |
| 1412 | 3300009176 | Ga0105242_10045993 | Ga0105242_100459934 | 377 |
| 1413 | 3300009176 | Ga0105242_10138945 | Ga0105242_101389452 | 377 |
| 1414 | 3300009177 | Ga0105248_10000821 | Ga0105248_1000082117 | 377 |
| 1415 | 3300009177 | Ga0105248_10021823 | Ga0105248_100218232 | 377 |
| 1416 | 3300009177 | Ga0105248_10160609 | Ga0105248_101606091 | 377 |
| 1417 | 3300009545 | Ga0105237_10028415 | Ga0105237_100284156 | 377 |
| 1418 | 3300009545 | Ga0105237_10129840 | Ga0105237_101298402 | 377 |
| 1419 | 3300009551 | Ga0105238_10148860 | Ga0105238_101488602 | 377 |
| 1420 | 3300009553 | Ga0105249_10008599 | Ga0105249_100085996 | 377 |
| 1421 | 3300009553 | Ga0105249_10009911 | Ga0105249_100099115 | 377 |
| 1422 | 3300009553 | Ga0105249_10099953 | Ga0105249_100999533 | 377 |
| 1423 | 3300009553 | Ga0105249_10178816 | Ga0105249_101788162 | 377 |
| 1424 | 3300010375 | Ga0105239_10040794 | Ga0105239_100407947 | 377 |
| 1425 | 3300010375 | Ga0105239_10090619 | Ga0105239_100906194 | 377 |
| 1426 | 3300010375 | Ga0105239_10130296 | Ga0105239_101302962 | 377 |
| 1427 | 3300011119 | Ga0105246_10000011 | Ga0105246_100000115 | 377 |
| 1428 | 3300011119 | Ga0105246_10033401 | Ga0105246_100334013 | 377 |
| 1429 | 3300011119 | Ga0105246_10035325 | Ga0105246_100353251 | 377 |
| 1430 | 3300013100 | Ga0157373_10086093 | Ga0157373_100860932 | 377 |
| 1431 | 3300013102 | Ga0157371_10007729 | Ga0157371_100077296 | 377 |
| 1432 | 3300013102 | Ga0157371_10050467 | Ga0157371_100504672 | 377 |
| 1433 | 3300013296 | Ga0157374_10005683 | Ga0157374_100056836 | 377 |
| 1434 | 3300013296 | Ga0157374_10045777 | Ga0157374_100457774 | 377 |
| 1435 | 3300013296 | Ga0157374_10099820 | Ga0157374_100998203 | 377 |
| 1436 | 3300013297 | Ga0157378_10002005 | Ga0157378_100020056 | 377 |
| 1437 | 3300013297 | Ga0157378_10108505 | Ga0157378_101085052 | 377 |
| 1438 | 3300013306 | Ga0163162_10005215 | Ga0163162_100052156 | 377 |
| 1439 | 3300013306 | Ga0163162_10039343 | Ga0163162_100393433 | 377 |
| 1440 | 3300013306 | Ga0163162_10060561 | Ga0163162_100605611 | 377 |
| 1441 | 3300013306 | Ga0163162_10112055 | Ga0163162_101120552 | 377 |
| 1442 | 3300013306 | Ga0163162_10385325 | Ga0163162_103853252 | 377 |
| 1443 | 3300013307 | Ga0157372_10034995 | Ga0157372_100349953 | 377 |
| 1444 | 3300013308 | Ga0157375_10016062 | Ga0157375_100160623 | 377 |
| 1445 | 3300013308 | Ga0157375_10021671 | Ga0157375_100216713 | 377 |
| 1446 | 3300013308 | Ga0157375_10059563 | Ga0157375_100595631 | 377 |
| 1447 | 3300013308 | Ga0157375_10060259 | Ga0157375_100602594 | 377 |
| 1448 | 3300013308 | Ga0157375_10657650 | Ga0157375_106576501 | 377 |
| 1449 | 3300014325 | Ga0163163_10005008 | Ga0163163_100050085 | 377 |
| 1450 | 3300014325 | Ga0163163_10032891 | Ga0163163_100328914 | 377 |
| 1451 | 3300014325 | Ga0163163_10058563 | Ga0163163_100585632 | 377 |
| 1452 | 3300014326 | Ga0157380_10005074 | Ga0157380_100050745 | 377 |
| 1453 | 3300014326 | Ga0157380_10047528 | Ga0157380_100475282 | 377 |
| 1454 | 3300014745 | Ga0157377_10000398 | Ga0157377_1000039814 | 377 |
| 1455 | 3300014745 | Ga0157377_10035335 | Ga0157377_100353353 | 377 |
| 1456 | 3300014968 | Ga0157379_10006255 | Ga0157379_100062554 | 377 |
| 1457 | 3300014968 | Ga0157379_10014948 | Ga0157379_100149484 | 377 |
| 1458 | 3300014968 | Ga0157379_10032074 | Ga0157379_100320741 | 377 |
| 1459 | 3300014968 | Ga0157379_10039533 | Ga0157379_100395332 | 377 |
| 1460 | 3300014969 | Ga0157376_10003372 | Ga0157376_100033725 | 377 |
| 1461 | 3300014969 | Ga0157376_10077049 | Ga0157376_100770492 | 377 |
| 1462 | 3300017792 | Ga0163161_10002430 | Ga0163161_100024308 | 377 |
| 1463 | 3300017792 | Ga0163161_10048001 | Ga0163161_100480013 | 377 |
| 1464 | 3300017792 | Ga0163161_10129959 | Ga0163161_101299592 | 377 |
| 1465 | 3300025271 | Ga0207666_1000038 | Ga0207666_10000386 | 377 |
| 1466 | 3300025271 | Ga0207666_1001350 | Ga0207666_10013503 | 377 |
| 1467 | 3300025290 | Ga0207673_1000111 | Ga0207673_10001115 | 377 |
| 1468 | 3300025315 | Ga0207697_10001943 | Ga0207697_100019435 | 377 |
| 1469 | 3300025315 | Ga0207697_10010836 | Ga0207697_100108362 | 377 |
| 1470 | 3300025885 | Ga0207653_10003072 | Ga0207653_100030724 | 377 |
| 1471 | 3300025893 | Ga0207682_10000071 | Ga0207682_100000717 | 377 |
| 1472 | 3300025898 | Ga0207692_10004905 | Ga0207692_100049053 | 377 |
| 1473 | 3300025900 | Ga0207710_10006950 | Ga0207710_100069504 | 377 |
| 1474 | 3300025900 | Ga0207710_10010732 | Ga0207710_100107322 | 377 |
| 1475 | 3300025900 | Ga0207710_10039149 | Ga0207710_100391491 | 377 |
| 1476 | 3300025901 | Ga0207688_10001967 | Ga0207688_100019675 | 377 |
| 1477 | 3300025903 | Ga0207680_10008702 | Ga0207680_100087024 | 377 |
| 1478 | 3300025903 | Ga0207680_10060801 | Ga0207680_100608013 | 377 |
| 1479 | 3300025904 | Ga0207647_10021971 | Ga0207647_100219711 | 377 |
| 1480 | 3300025904 | Ga0207647_10024633 | Ga0207647_100246334 | 377 |
| 1481 | 3300025905 | Ga0207685_10003844 | Ga0207685_100038443 | 377 |
| 1482 | 3300025906 | Ga0207699_10015399 | Ga0207699_100153991 | 377 |
| 1483 | 3300025907 | Ga0207645_10000779 | Ga0207645_100007796 | 377 |
| 1484 | 3300025907 | Ga0207645_10091820 | Ga0207645_100918202 | 377 |
| 1485 | 3300025908 | Ga0207643_10000434 | Ga0207643_100004343 | 377 |
| 1486 | 3300025911 | Ga0207654_10000498 | Ga0207654_100004988 | 377 |
| 1487 | 3300025911 | Ga0207654_10115520 | Ga0207654_101155202 | 377 |
| 1488 | 3300025912 | Ga0207707_10000454 | Ga0207707_1000045432 | 377 |
| 1489 | 3300025912 | Ga0207707_10035836 | Ga0207707_100358363 | 377 |
| 1490 | 3300025912 | Ga0207707_10226787 | Ga0207707_102267872 | 377 |
| 1491 | 3300025913 | Ga0207695_10300689 | Ga0207695_103006891 | 377 |
| 1492 | 3300025914 | Ga0207671_10154394 | Ga0207671_101543942 | 377 |
| 1493 | 3300025915 | Ga0207693_10037739 | Ga0207693_100377393 | 377 |
| 1494 | 3300025915 | Ga0207693_10297195 | Ga0207693_102971951 | 377 |
| 1495 | 3300025916 | Ga0207663_10018979 | Ga0207663_100189792 | 377 |
| 1496 | 3300025916 | Ga0207663_10084777 | Ga0207663_100847772 | 377 |
| 1497 | 3300025916 | Ga0207663_10109089 | Ga0207663_101090892 | 377 |
| 1498 | 3300025917 | Ga0207660_10000006 | Ga0207660_100000067 | 377 |
| 1499 | 3300025917 | Ga0207660_10008770 | Ga0207660_100087704 | 377 |
| 1500 | 3300025918 | Ga0207662_10003236 | Ga0207662_100032365 | 377 |
| 1501 | 3300025918 | Ga0207662_10009842 | Ga0207662_100098423 | 377 |
| 1502 | 3300025919 | Ga0207657_10007747 | Ga0207657_100077475 | 377 |
| 1503 | 3300025919 | Ga0207657_10016589 | Ga0207657_100165895 | 377 |
| 1504 | 3300025919 | Ga0207657_10027550 | Ga0207657_100275503 | 377 |
| 1505 | 3300025919 | Ga0207657_10033828 | Ga0207657_100338284 | 377 |
| 1506 | 3300025920 | Ga0207649_10000049 | Ga0207649_1000004999 | 377 |
| 1507 | 3300025921 | Ga0207652_10177262 | Ga0207652_101772621 | 377 |
| 1508 | 3300025923 | Ga0207681_10000731 | Ga0207681_100007313 | 377 |
| 1509 | 3300025925 | Ga0207650_10000908 | Ga0207650_100009089 | 377 |
| 1510 | 3300025926 | Ga0207659_10000143 | Ga0207659_100001437 | 377 |
| 1511 | 3300025926 | Ga0207659_10113532 | Ga0207659_101135322 | 377 |
| 1512 | 3300025927 | Ga0207687_10000428 | Ga0207687_1000042817 | 377 |
| 1513 | 3300025927 | Ga0207687_10040298 | Ga0207687_100402981 | 377 |
| 1514 | 3300025927 | Ga0207687_10257746 | Ga0207687_102577461 | 377 |
| 1515 | 3300025928 | Ga0207700_10006307 | Ga0207700_100063075 | 377 |
| 1516 | 3300025928 | Ga0207700_10068851 | Ga0207700_100688513 | 377 |
| 1517 | 3300025928 | Ga0207700_10201039 | Ga0207700_102010391 | 377 |
| 1518 | 3300025928 | Ga0207700_10212747 | Ga0207700_102127472 | 377 |
| 1519 | 3300025931 | Ga0207644_10002382 | Ga0207644_100023829 | 377 |
| 1520 | 3300025931 | Ga0207644_10008425 | Ga0207644_100084255 | 377 |
| 1521 | 3300025932 | Ga0207690_10006061 | Ga0207690_100060614 | 377 |
| 1522 | 3300025932 | Ga0207690_10150206 | Ga0207690_101502061 | 377 |
| 1523 | 3300025933 | Ga0207706_10001338 | Ga0207706_100013385 | 377 |
| 1524 | 3300025933 | Ga0207706_10014198 | Ga0207706_100141986 | 377 |
| 1525 | 3300025933 | Ga0207706_10030620 | Ga0207706_100306204 | 377 |
| 1526 | 3300025933 | Ga0207706_10111964 | Ga0207706_101119642 | 377 |
| 1527 | 3300025934 | Ga0207686_10000340 | Ga0207686_1000034024 | 377 |
| 1528 | 3300025934 | Ga0207686_10015136 | Ga0207686_100151364 | 377 |
| 1529 | 3300025935 | Ga0207709_10003778 | Ga0207709_100037782 | 377 |
| 1530 | 3300025935 | Ga0207709_10105445 | Ga0207709_101054452 | 377 |
| 1531 | 3300025936 | Ga0207670_10000464 | Ga0207670_1000046415 | 377 |
| 1532 | 3300025936 | Ga0207670_10019883 | Ga0207670_100198833 | 377 |
| 1533 | 3300025937 | Ga0207669_10000240 | Ga0207669_100002409 | 377 |
| 1534 | 3300025937 | Ga0207669_10059649 | Ga0207669_100596492 | 377 |
| 1535 | 3300025938 | Ga0207704_10000456 | Ga0207704_100004569 | 377 |
| 1536 | 3300025939 | Ga0207665_10001537 | Ga0207665_100015379 | 377 |
| 1537 | 3300025939 | Ga0207665_10041282 | Ga0207665_100412822 | 377 |
| 1538 | 3300025940 | Ga0207691_10006817 | Ga0207691_100068176 | 377 |
| 1539 | 3300025940 | Ga0207691_10014637 | Ga0207691_100146372 | 377 |
| 1540 | 3300025940 | Ga0207691_10019931 | Ga0207691_100199315 | 377 |
| 1541 | 3300025941 | Ga0207711_10001303 | Ga0207711_100013033 | 377 |
| 1542 | 3300025941 | Ga0207711_10068294 | Ga0207711_100682944 | 377 |
| 1543 | 3300025941 | Ga0207711_10087829 | Ga0207711_100878293 | 377 |
| 1544 | 3300025941 | Ga0207711_10114544 | Ga0207711_101145442 | 377 |
| 1545 | 3300025941 | Ga0207711_10283378 | Ga0207711_102833782 | 377 |
| 1546 | 3300025942 | Ga0207689_10000440 | Ga0207689_100004406 | 377 |
| 1547 | 3300025942 | Ga0207689_10126100 | Ga0207689_101261002 | 377 |
| 1548 | 3300025944 | Ga0207661_10000885 | Ga0207661_100008856 | 377 |
| 1549 | 3300025945 | Ga0207679_10000131 | Ga0207679_1000013116 | 377 |
| 1550 | 3300025945 | Ga0207679_10019284 | Ga0207679_100192844 | 377 |
| 1551 | 3300025960 | Ga0207651_10017245 | Ga0207651_100172453 | 377 |
| 1552 | 3300025960 | Ga0207651_10100599 | Ga0207651_101005992 | 377 |
| 1553 | 3300025961 | Ga0207712_10010140 | Ga0207712_100101405 | 377 |
| 1554 | 3300025961 | Ga0207712_10027320 | Ga0207712_100273203 | 377 |
| 1555 | 3300025972 | Ga0207668_10000065 | Ga0207668_1000006522 | 377 |
| 1556 | 3300025981 | Ga0207640_10000762 | Ga0207640_1000076213 | 377 |
| 1557 | 3300025986 | Ga0207658_10001114 | Ga0207658_1000111414 | 377 |
| 1558 | 3300025986 | Ga0207658_10047302 | Ga0207658_100473022 | 377 |
| 1559 | 3300026023 | Ga0207677_10001753 | Ga0207677_100017536 | 377 |
| 1560 | 3300026035 | Ga0207703_10000217 | Ga0207703_1000021712 | 377 |
| 1561 | 3300026035 | Ga0207703_10014014 | Ga0207703_100140142 | 377 |
| 1562 | 3300026035 | Ga0207703_10094610 | Ga0207703_100946102 | 377 |
| 1563 | 3300026041 | Ga0207639_10008016 | Ga0207639_100080163 | 377 |
| 1564 | 3300026041 | Ga0207639_10209987 | Ga0207639_102099871 | 377 |
| 1565 | 3300026067 | Ga0207678_10000944 | Ga0207678_1000094422 | 377 |
| 1566 | 3300026067 | Ga0207678_10005274 | Ga0207678_100052746 | 377 |
| 1567 | 3300026067 | Ga0207678_10013610 | Ga0207678_100136101 | 377 |
| 1568 | 3300026067 | Ga0207678_10018969 | Ga0207678_100189695 | 377 |
| 1569 | 3300026067 | Ga0207678_10043863 | Ga0207678_100438634 | 377 |
| 1570 | 3300026075 | Ga0207708_10005368 | Ga0207708_100053685 | 377 |
| 1571 | 3300026075 | Ga0207708_10027519 | Ga0207708_100275193 | 377 |
| 1572 | 3300026078 | Ga0207702_10003744 | Ga0207702_100037444 | 377 |
| 1573 | 3300026088 | Ga0207641_10001313 | Ga0207641_1000131319 | 377 |
| 1574 | 3300026088 | Ga0207641_10014435 | Ga0207641_100144355 | 377 |
| 1575 | 3300026088 | Ga0207641_10034442 | Ga0207641_100344421 | 377 |
| 1576 | 3300026089 | Ga0207648_10011217 | Ga0207648_100112176 | 377 |
| 1577 | 3300026089 | Ga0207648_10052763 | Ga0207648_100527633 | 377 |
| 1578 | 3300026089 | Ga0207648_10105082 | Ga0207648_101050822 | 377 |
| 1579 | 3300026095 | Ga0207676_10002017 | Ga0207676_100020178 | 377 |
| 1580 | 3300026095 | Ga0207676_10007816 | Ga0207676_100078164 | 377 |
| 1581 | 3300026116 | Ga0207674_10000331 | Ga0207674_1000033149 | 377 |
| 1582 | 3300026118 | Ga0207675_100012773 | Ga0207675_1000127736 | 377 |
| 1583 | 3300026118 | Ga0207675_100031017 | Ga0207675_1000310172 | 377 |
| 1584 | 3300026121 | Ga0207683_10000001 | Ga0207683_10000001315 | 377 |
| 1585 | 3300026121 | Ga0207683_10009425 | Ga0207683_100094257 | 377 |
| 1586 | 3300026121 | Ga0207683_10011706 | Ga0207683_100117066 | 377 |
| 1587 | 3300027543 | Ga0209999_1007703 | Ga0209999_10077031 | 377 |
| 1588 | 3300027552 | Ga0209982_1001558 | Ga0209982_10015583 | 377 |
| 1589 | 3300027617 | Ga0210002_1004248 | Ga0210002_10042482 | 377 |
| 1590 | 3300027682 | Ga0209971_1017847 | Ga0209971_10178472 | 377 |
| 1591 | 3300027695 | Ga0209966_1002020 | Ga0209966_10020202 | 377 |
| 1592 | 3300027907 | Ga0207428_10000172 | Ga0207428_1000017228 | 377 |
| 1593 | 3300027907 | Ga0207428_10000255 | Ga0207428_1000025517 | 377 |
| 1594 | 3300027907 | Ga0207428_10000289 | Ga0207428_100002895 | 377 |
| 1595 | 3300028379 | Ga0268266_10033448 | Ga0268266_100334482 | 377 |
| 1596 | 3300028379 | Ga0268266_10159492 | Ga0268266_101594922 | 377 |
| 1597 | 3300028379 | Ga0268266_10235769 | Ga0268266_102357691 | 377 |
| 1598 | 3300028380 | Ga0268265_10004222 | Ga0268265_100042224 | 377 |
| 1599 | 3300028380 | Ga0268265_10018419 | Ga0268265_100184194 | 377 |
| 1600 | 3300028381 | Ga0268264_10067578 | Ga0268264_100675781 | 377 |
| 1601 | 3300028381 | Ga0268264_10123826 | Ga0268264_101238262 | 377 |
| 1602 | 3300028381 | Ga0268264_10324733 | Ga0268264_103247331 | 377 |
| 1603 | 3300028381 | Ga0268264_10467745 | Ga0268264_104677451 | 377 |
| 1604 | 3300028556 | Ga0265337_1007261 | Ga0265337_10072613 | 377 |
| 1605 | 3300028800 | Ga0265338_10171689 | Ga0265338_101716891 | 377 |
| 1606 | 3300031241 | Ga0265325_10002126 | Ga0265325_100021267 | 377 |
| 1607 | 3300031344 | Ga0265316_10041390 | Ga0265316_100413903 | 377 |
| 1608 | 3300031595 | Ga0265313_10014337 | Ga0265313_100143373 | 377 |
| 1609 | 3300034817 | Ga0373948_0000360 | Ga0373948_0000360_936_2069 | 377 |
| 1610 | 3300034817 | Ga0373948_0005292 | Ga0373948_0005292_320_1453 | 377 |
| 1611 | 3300034818 | Ga0373950_0000868 | Ga0373950_0000868_1009_2142 | 377 |
| 1612 | 3300034819 | Ga0373958_0000309 | Ga0373958_0000309_1667_2800 | 377 |
| 1613 | 3300034957 | Ga0373938_0000238 | Ga0373938_0000238_1452_2585 | 377 |
| 1614 | 3300035083 | Ga0373926_0003404 | Ga0373926_0003404_3879_5012 | 377 |
| 1615 | 3300035083 | Ga0373926_0009583 | Ga0373926_0009583_345_1478 | 377 |
| 1616 | 3300035084 | Ga0373928_0001415 | Ga0373928_0001415_3274_4407 | 377 |
| 1617 | 3300035085 | Ga0373929_0001680 | Ga0373929_0001680_1990_3123 | 377 |
| 1618 | 3300035086 | Ga0373934_0018659 | Ga0373934_0018659_115_1248 | 377 |
| 1619 | 3300035088 | Ga0373940_0007476 | Ga0373940_0007476_683_1816 | 377 |
| 1620 | 3300035090 | Ga0373949_0002060 | Ga0373949_0002060_2146_3279 | 377 |
| 1621 | 3300035090 | Ga0373949_0002127 | Ga0373949_0002127_3196_4329 | 377 |
| 1622 | 3300035091 | Ga0373951_0000607 | Ga0373951_0000607_2485_3618 | 377 |
| 1623 | 3300035092 | Ga0373952_0000334 | Ga0373952_0000334_1631_2764 | 377 |
| 1624 | 3300035092 | Ga0373952_0000549 | Ga0373952_0000549_4269_5402 | 377 |
| 1625 | 3300035111 | Ga0373923_0057269 | Ga0373923_0057269_302_1435 | 377 |
| 1626 | 3300035111 | Ga0373923_0057850 | Ga0373923_0057850_450_1583 | 377 |
| 1627 | 3300035112 | Ga0373932_0001896 | Ga0373932_0001896_2471_3604 | 377 |
| 1628 | 3300035113 | Ga0373936_0015253 | Ga0373936_0015253_1472_2605 | 377 |
| 1629 | 3300035114 | Ga0373939_0001870 | Ga0373939_0001870_1547_2680 | 377 |
| 1630 | 3300035114 | Ga0373939_0016894 | Ga0373939_0016894_238_1371 | 377 |
| 1631 | 3300035115 | Ga0373941_0000803 | Ga0373941_0000803_1789_2922 | 377 |
| 1632 | 3300035115 | Ga0373941_0000977 | Ga0373941_0000977_3006_4139 | 377 |
| 1633 | 3300035116 | Ga0373945_0004003 | Ga0373945_0004003_2577_3710 | 377 |
| 1634 | 3300035116 | Ga0373945_0031233 | Ga0373945_0031233_320_1453 | 377 |
| 1635 | 3300035119 | Ga0373956_0032556 | Ga0373956_0032556_419_1552 | 377 |
| 1636 | 3300035119 | Ga0373956_0057893 | Ga0373956_0057893_207_1340 | 377 |
| 1637 | 3300035119 | Ga0373956_0067231 | Ga0373956_0067231_357_1493 | 377 |
| 1638 | 3300035120 | Ga0373957_0000689 | Ga0373957_0000689_6425_7558 | 377 |
| 1639 | 3300035121 | Ga0373960_0001746 | Ga0373960_0001746_3496_4629 | 377 |
| 1640 | 3300035170 | Ga0373943_0003076 | Ga0373943_0003076_4242_5375 | 377 |
| 1641 | 3300035170 | Ga0373943_0008345 | Ga0373943_0008345_375_1508 | 377 |
| 1642 | 3300035171 | Ga0373946_0005522 | Ga0373946_0005522_440_1573 | 377 |
| 1643 | 3300035171 | Ga0373946_0019699 | Ga0373946_0019699_818_1954 | 377 |
| 1644 | 3300035171 | Ga0373946_0028471 | Ga0373946_0028471_870_2003 | 377 |
| 1645 | 3300035172 | Ga0373955_0017485 | Ga0373955_0017485_2292_3425 | 377 |
| 1646 | 3300035207 | Ga0373942_0002320 | Ga0373942_0002320_238_1371 | 377 |
| 1647 | 3300035207 | Ga0373942_0003894 | Ga0373942_0003894_2080_3213 | 377 |
| 1648 | 3300035241 | Ga0373961_0005873 | Ga0373961_0005873_443_1576 | 377 |
| 1649 | 3300035242 | Ga0373962_0000684 | Ga0373962_0000684_4733_5866 | 377 |
| 1650 | 3300035242 | Ga0373962_0004790 | Ga0373962_0004790_1596_2729 | 377 |
| 1651 | 3300035691 | Ga0373931_0000832 | Ga0373931_0000832_3407_4540 | 377 |
| 1652 | 3300035691 | Ga0373931_0008912 | Ga0373931_0008912_2508_3641 | 377 |
| 1653 | 3300035692 | Ga0373935_0008740 | Ga0373935_0008740_647_1780 | 377 |
| 1654 | 3300035692 | Ga0373935_0015233 | Ga0373935_0015233_1527_2660 | 377 |
| 1655 | 3300035692 | Ga0373935_0050879 | Ga0373935_0050879_65_1201 | 377 |
| 1656 | 3300035692 | Ga0373935_0195985 | Ga0373935_0195985_133_1266 | 377 |
| 1657 | 3300035695 | Ga0373927_0013741 | Ga0373927_0013741_326_1459 | 377 |
| 1658 | 3300035724 | Ga0373933_0004580 | Ga0373933_0004580_2865_4001 | 377 |
| 1659 | 3300035724 | Ga0373933_0018214 | Ga0373933_0018214_673_1806 | 377 |
| 1660 | 3300035724 | Ga0373933_0050042 | Ga0373933_0050042_596_1729 | 377 |
| 1661 | 3300035725 | Ga0373947_0002287 | Ga0373947_0002287_4253_5386 | 377 |
| 1662 | 3300035725 | Ga0373947_0013576 | Ga0373947_0013576_192_1325 | 377 |
| 1663 | 3300035725 | Ga0373947_0028815 | Ga0373947_0028815_1030_2166 | 377 |
| 1664 | 3300036401 | Ga0373937_0000907 | Ga0373937_0000907_5632_6765 | 377 |
| 1665 | 3300036401 | Ga0373937_0020586 | Ga0373937_0020586_1938_3188 | 377 |
| 1666 | 3300036401 | Ga0373937_0041608 | Ga0373937_0041608_1745_2878 | 377 |
| 1667 | 3300036401 | Ga0373937_0074856 | Ga0373937_0074856_428_1561 | 377 |
| 1668 | 3300037068 | Ga0373925_0009531 | Ga0373925_0009531_2228_3361 | 377 |
| 1669 | 3300037068 | Ga0373925_0016683 | Ga0373925_0016683_2362_3495 | 377 |
| 1670 | 3300037068 | Ga0373925_0053411 | Ga0373925_0053411_1429_2565 | 377 |
| 1671 | 3300037068 | Ga0373925_0134921 | Ga0373925_0134921_178_1311 | 377 |
| 1672 | 3300041413 | Ga0439465_0007239 | Ga0439465_0007239_335_1513 | 377 |
| 1673 | 3300042008 | Ga0439450_005169 | Ga0439450_005169_23_1156 | 377 |
| 1674 | 3300042016 | Ga0439463_004402 | Ga0439463_004402_779_1912 | 377 |
| 1675 | 3300042439 | Ga0439464_0003806 | Ga0439464_0003806_1088_2221 | 377 |
| 1676 | 3300042993 | Ga0439440_0007885 | Ga0439440_0007885_368_1501 | 377 |
| 1677 | 3300044712 | Ga0453684_0030479 | Ga0453684_0030479_518_1651 | 377 |
| 1678 | 3300045051 | Ga0451576_0064931 | Ga0451576_0064931_1884_3017 | 377 |
| 1679 | 3300046454 | Ga0495592_0001841 | Ga0495592_0001841_766_1899 | 377 |
| 1680 | 3300046454 | Ga0495592_0013967 | Ga0495592_0013967_250_1383 | 377 |
| 1681 | 3300046454 | Ga0495592_0060163 | Ga0495592_0060163_1001_2134 | 377 |
| 1682 | 3300046454 | Ga0495592_0122353 | Ga0495592_0122353_629_1762 | 377 |
| 1683 | 3300046455 | Ga0495603_0009828 | Ga0495603_0009828_4188_5321 | 377 |
| 1684 | 3300046455 | Ga0495603_0012015 | Ga0495603_0012015_124_1257 | 377 |
| 1685 | 3300046455 | Ga0495603_0081354 | Ga0495603_0081354_692_1828 | 377 |
| 1686 | 3300046457 | Ga0495590_0054329 | Ga0495590_0054329_130_1263 | 377 |
| 1687 | 3300046459 | Ga0495629_0001140 | Ga0495629_0001140_18275_19408 | 377 |
| 1688 | 3300046459 | Ga0495629_0004187 | Ga0495629_0004187_5692_6825 | 377 |
| 1689 | 3300046459 | Ga0495629_0079117 | Ga0495629_0079117_236_1372 | 377 |
| 1690 | 3300046461 | Ga0495641_0015118 | Ga0495641_0015118_1408_2541 | 377 |
| 1691 | 3300046462 | Ga0495651_0004254 | Ga0495651_0004254_8878_10011 | 377 |
| 1692 | 3300046462 | Ga0495651_0011156 | Ga0495651_0011156_657_1790 | 377 |
| 1693 | 3300046462 | Ga0495651_0011201 | Ga0495651_0011201_3613_4749 | 377 |
| 1694 | 3300046462 | Ga0495651_0050646 | Ga0495651_0050646_316_1449 | 377 |
| 1695 | 3300046463 | Ga0495653_0002480 | Ga0495653_0002480_8034_9167 | 377 |
| 1696 | 3300046463 | Ga0495653_0024482 | Ga0495653_0024482_1344_2477 | 377 |
| 1697 | 3300046463 | Ga0495653_0028470 | Ga0495653_0028470_451_1584 | 377 |
| 1698 | 3300046463 | Ga0495653_0031990 | Ga0495653_0031990_139_1275 | 377 |
| 1699 | 3300046463 | Ga0495653_0166647 | Ga0495653_0166647_260_1393 | 377 |
| 1700 | 3300046472 | Ga0495580_0007274 | Ga0495580_0007274_5411_6544 | 377 |
| 1701 | 3300046472 | Ga0495580_0060482 | Ga0495580_0060482_536_1672 | 377 |
| 1702 | 3300046473 | Ga0495582_0000379 | Ga0495582_0000379_17137_18270 | 377 |
| 1703 | 3300046473 | Ga0495582_0016954 | Ga0495582_0016954_2455_3588 | 377 |
| 1704 | 3300046473 | Ga0495582_0040384 | Ga0495582_0040384_1138_2271 | 377 |
| 1705 | 3300046473 | Ga0495582_0125974 | Ga0495582_0125974_213_1349 | 377 |
| 1706 | 3300046475 | Ga0495639_0001456 | Ga0495639_0001456_1459_2592 | 377 |
| 1707 | 3300046475 | Ga0495639_0005394 | Ga0495639_0005394_78_1211 | 377 |
| 1708 | 3300046476 | Ga0495662_0002259 | Ga0495662_0002259_3017_4150 | 377 |
| 1709 | 3300046476 | Ga0495662_0011084 | Ga0495662_0011084_610_1743 | 377 |
| 1710 | 3300046477 | Ga0495664_0004745 | Ga0495664_0004745_1930_3063 | 377 |
| 1711 | 3300046477 | Ga0495664_0017355 | Ga0495664_0017355_716_1849 | 377 |
| 1712 | 3300046477 | Ga0495664_0038399 | Ga0495664_0038399_512_1645 | 377 |
| 1713 | 3300046477 | Ga0495664_0047781 | Ga0495664_0047781_207_1343 | 377 |
| 1714 | 3300046477 | Ga0495664_0104693 | Ga0495664_0104693_248_1381 | 377 |
| 1715 | 3300046492 | Ga0495585_0006641 | Ga0495585_0006641_296_1429 | 377 |
| 1716 | 3300046499 | Ga0495594_0000628 | Ga0495594_0000628_3577_4710 | 377 |
| 1717 | 3300046499 | Ga0495594_0012022 | Ga0495594_0012022_1067_2203 | 377 |
| 1718 | 3300046499 | Ga0495594_0014248 | Ga0495594_0014248_1104_2237 | 377 |
| 1719 | 3300046499 | Ga0495594_0036536 | Ga0495594_0036536_447_1580 | 377 |
| 1720 | 3300046501 | Ga0495607_0008588 | Ga0495607_0008588_2551_3684 | 377 |
| 1721 | 3300046511 | Ga0495608_0008363 | Ga0495608_0008363_1981_3114 | 377 |
| 1722 | 3300046511 | Ga0495608_0023088 | Ga0495608_0023088_1421_2557 | 377 |
| 1723 | 3300046511 | Ga0495608_0027103 | Ga0495608_0027103_1435_2568 | 377 |
| 1724 | 3300046513 | Ga0495616_0091344 | Ga0495616_0091344_118_1251 | 377 |
| 1725 | 3300046514 | Ga0495618_0002560 | Ga0495618_0002560_4554_5687 | 377 |
| 1726 | 3300046514 | Ga0495618_0002632 | Ga0495618_0002632_4069_5202 | 377 |
| 1727 | 3300046514 | Ga0495618_0004146 | Ga0495618_0004146_1586_2719 | 377 |
| 1728 | 3300046514 | Ga0495618_0038302 | Ga0495618_0038302_1421_2557 | 377 |
| 1729 | 3300046516 | Ga0495628_0003222 | Ga0495628_0003222_12321_13454 | 377 |
| 1730 | 3300046517 | Ga0495630_0002564 | Ga0495630_0002564_6278_7411 | 377 |
| 1731 | 3300046517 | Ga0495630_0039762 | Ga0495630_0039762_242_1375 | 377 |
| 1732 | 3300046517 | Ga0495630_0057574 | Ga0495630_0057574_946_2082 | 377 |
| 1733 | 3300046517 | Ga0495630_0092975 | Ga0495630_0092975_413_1546 | 377 |
| 1734 | 3300046517 | Ga0495630_0179692 | Ga0495630_0179692_219_1355 | 377 |
| 1735 | 3300046523 | Ga0495644_0004713 | Ga0495644_0004713_1663_2796 | 377 |
| 1736 | 3300046526 | Ga0495666_0001574 | Ga0495666_0001574_8265_9398 | 377 |
| 1737 | 3300046526 | Ga0495666_0006471 | Ga0495666_0006471_2958_4091 | 377 |
| 1738 | 3300046529 | Ga0495652_0003251 | Ga0495652_0003251_1061_2194 | 377 |
| 1739 | 3300046529 | Ga0495652_0014533 | Ga0495652_0014533_1823_2956 | 377 |
| 1740 | 3300046529 | Ga0495652_0016208 | Ga0495652_0016208_2018_3151 | 377 |
| 1741 | 3300046529 | Ga0495652_0050982 | Ga0495652_0050982_852_1988 | 377 |
| 1742 | 3300046529 | Ga0495652_0089248 | Ga0495652_0089248_310_1446 | 377 |
| 1743 | 3300046529 | Ga0495652_0102123 | Ga0495652_0102123_530_1663 | 377 |
| 1744 | 3300046531 | Ga0495665_0004256 | Ga0495665_0004256_2110_3243 | 377 |
| 1745 | 3300046531 | Ga0495665_0009547 | Ga0495665_0009547_4069_5202 | 377 |
| 1746 | 3300046533 | Ga0495640_0006068 | Ga0495640_0006068_4007_5140 | 377 |
| 1747 | 3300046533 | Ga0495640_0045494 | Ga0495640_0045494_1687_2823 | 377 |
| 1748 | 3300046533 | Ga0495640_0072032 | Ga0495640_0072032_194_1330 | 377 |
| 1749 | 3300046533 | Ga0495640_0140441 | Ga0495640_0140441_243_1376 | 377 |
| 1750 | 3300046535 | Ga0495586_0016632 | Ga0495586_0016632_1436_2569 | 377 |
| 1751 | 3300046536 | Ga0495587_0003023 | Ga0495587_0003023_2877_4010 | 377 |
| 1752 | 3300046536 | Ga0495587_0147463 | Ga0495587_0147463_31_1164 | 377 |
| 1753 | 3300046538 | Ga0495609_0042528 | Ga0495609_0042528_281_1414 | 377 |
| 1754 | 3300046543 | Ga0495645_0001743 | Ga0495645_0001743_1178_2311 | 377 |
| 1755 | 3300046543 | Ga0495645_0003505 | Ga0495645_0003505_7935_9071 | 377 |
| 1756 | 3300046543 | Ga0495645_0069726 | Ga0495645_0069726_285_1418 | 377 |
| 1757 | 3300046557 | Ga0495622_0024844 | Ga0495622_0024844_1047_2180 | 377 |
| 1758 | 3300046557 | Ga0495622_0028163 | Ga0495622_0028163_72_1205 | 377 |
| 1759 | 3300046558 | Ga0495633_0016941 | Ga0495633_0016941_236_1369 | 377 |
| 1760 | 3300046559 | Ga0495667_0000365 | Ga0495667_0000365_16868_18001 | 377 |
| 1761 | 3300046559 | Ga0495667_0006271 | Ga0495667_0006271_4801_5934 | 377 |
| 1762 | 3300046559 | Ga0495667_0010665 | Ga0495667_0010665_1431_2564 | 377 |
| 1763 | 3300046615 | Ga0495656_0000167 | Ga0495656_0000167_14924_16057 | 377 |
| 1764 | 3300046642 | Ga0495634_0003795 | Ga0495634_0003795_7732_8865 | 377 |
| 1765 | 3300046642 | Ga0495634_0005914 | Ga0495634_0005914_4368_5501 | 377 |
| 1766 | 3300046642 | Ga0495634_0039315 | Ga0495634_0039315_64_1200 | 377 |
| 1767 | 3300046642 | Ga0495634_0137849 | Ga0495634_0137849_169_1302 | 377 |
| 1768 | 3300046663 | Ga0495635_0000981 | Ga0495635_0000981_16629_17762 | 377 |
| 1769 | 3300046663 | Ga0495635_0002092 | Ga0495635_0002092_4824_5960 | 377 |
| 1770 | 3300046663 | Ga0495635_0012948 | Ga0495635_0012948_4253_5386 | 377 |
| 1771 | 3300046663 | Ga0495635_0028616 | Ga0495635_0028616_1211_2344 | 377 |
| 1772 | 3300046663 | Ga0495635_0033558 | Ga0495635_0033558_1275_2408 | 377 |
| 1773 | 3300046664 | Ga0495659_0000357 | Ga0495659_0000357_13211_14344 | 377 |
| 1774 | 3300046665 | Ga0495661_0027692 | Ga0495661_0027692_765_1898 | 377 |
| 1775 | 3300046674 | Ga0495588_0015611 | Ga0495588_0015611_972_2105 | 377 |
| 1776 | 3300046675 | Ga0495657_0007791 | Ga0495657_0007791_5461_6597 | 377 |
| 1777 | 3300046675 | Ga0495657_0013213 | Ga0495657_0013213_4112_5245 | 377 |
| 1778 | 3300046675 | Ga0495657_0032813 | Ga0495657_0032813_2362_3495 | 377 |
| 1779 | 3300046678 | Ga0495599_0005483 | Ga0495599_0005483_952_2085 | 377 |
| 1780 | 3300046678 | Ga0495599_0018968 | Ga0495599_0018968_624_1760 | 377 |
| 1781 | 3300046678 | Ga0495599_0188571 | Ga0495599_0188571_11_1144 | 377 |
| 1782 | 3300046679 | Ga0495623_0000281 | Ga0495623_0000281_1325_2458 | 377 |
| 1783 | 3300046679 | Ga0495623_0025726 | Ga0495623_0025726_1792_2925 | 377 |
| 1784 | 3300046680 | Ga0495646_0000794 | Ga0495646_0000794_9238_10371 | 377 |
| 1785 | 3300046680 | Ga0495646_0006978 | Ga0495646_0006978_3614_4750 | 377 |
| 1786 | 3300046680 | Ga0495646_0008319 | Ga0495646_0008319_1160_2293 | 377 |
| 1787 | 3300046680 | Ga0495646_0078071 | Ga0495646_0078071_19_1152 | 377 |
| 1788 | 3300046681 | Ga0495647_0000985 | Ga0495647_0000985_1824_2957 | 377 |
| 1789 | 3300046681 | Ga0495647_0010622 | Ga0495647_0010622_1336_2472 | 377 |
| 1790 | 3300046681 | Ga0495647_0012548 | Ga0495647_0012548_28_1161 | 377 |
| 1791 | 3300046683 | Ga0495658_0000210 | Ga0495658_0000210_31061_32194 | 377 |
| 1792 | 3300046683 | Ga0495658_0060153 | Ga0495658_0060153_11_1147 | 377 |
| 1793 | 3300046689 | Ga0495613_0018004 | Ga0495613_0018004_3826_4959 | 377 |
| 1794 | 3300046689 | Ga0495613_0064648 | Ga0495613_0064648_579_1715 | 377 |
| 1795 | 3300046690 | Ga0495624_0004943 | Ga0495624_0004943_6861_7994 | 377 |
| 1796 | 3300046690 | Ga0495624_0030701 | Ga0495624_0030701_1443_2576 | 377 |
| 1797 | 3300046690 | Ga0495624_0137502 | Ga0495624_0137502_97_1233 | 377 |
| 1798 | 3300046691 | Ga0495670_0002677 | Ga0495670_0002677_6005_7138 | 377 |
| 1799 | 3300046809 | Ga0495600_0000388 | Ga0495600_0000388_7719_8852 | 377 |
| 1800 | 3300046809 | Ga0495600_0002666 | Ga0495600_0002666_7018_8151 | 377 |
| 1801 | 3300046809 | Ga0495600_0011043 | Ga0495600_0011043_1775_2911 | 377 |
| 1802 | 3300046809 | Ga0495600_0047443 | Ga0495600_0047443_245_1378 | 377 |
| 1803 | 3300046809 | Ga0495600_0098805 | Ga0495600_0098805_578_1828 | 377 |
| 1804 | 3300047315 | Ga0495581_0001772 | Ga0495581_0001772_215_1348 | 377 |
| 1805 | 3300047315 | Ga0495581_0003342 | Ga0495581_0003342_4328_5461 | 377 |
| 1806 | 3300047315 | Ga0495581_0029188 | Ga0495581_0029188_1722_2864 | 377 |
| 1807 | 3300047317 | Ga0495604_0002563 | Ga0495604_0002563_4436_5569 | 377 |
| 1808 | 3300047317 | Ga0495604_0004482 | Ga0495604_0004482_7290_8423 | 377 |
| 1809 | 3300047317 | Ga0495604_0014260 | Ga0495604_0014260_2235_3368 | 377 |
| 1810 | 3300047317 | Ga0495604_0026128 | Ga0495604_0026128_1268_2518 | 377 |
| 1811 | 3300047317 | Ga0495604_0029470 | Ga0495604_0029470_3136_4269 | 377 |
| 1812 | 3300047319 | Ga0495674_0001490 | Ga0495674_0001490_4493_5626 | 377 |
| 1813 | 3300047319 | Ga0495674_0008877 | Ga0495674_0008877_4166_5299 | 377 |
| 1814 | 3300047319 | Ga0495674_0009425 | Ga0495674_0009425_2528_3664 | 377 |
| 1815 | 3300047319 | Ga0495674_0015781 | Ga0495674_0015781_3792_4925 | 377 |
| 1816 | 3300047319 | Ga0495674_0022729 | Ga0495674_0022729_2271_3407 | 377 |
| 1817 | 3300047319 | Ga0495674_0045990 | Ga0495674_0045990_2663_3796 | 377 |
| 1818 | 3300047321 | Ga0495676_0006651 | Ga0495676_0006651_1798_2931 | 377 |
| 1819 | 3300047321 | Ga0495676_0025913 | Ga0495676_0025913_3702_4835 | 377 |
| 1820 | 3300047321 | Ga0495676_0081445 | Ga0495676_0081445_245_1381 | 377 |
| 1821 | 3300047321 | Ga0495676_0221358 | Ga0495676_0221358_82_1215 | 377 |
| 1822 | 3300047322 | Ga0495680_0006978 | Ga0495680_0006978_2347_3480 | 377 |
| 1823 | 3300047322 | Ga0495680_0010055 | Ga0495680_0010055_3391_4524 | 377 |
| 1824 | 3300047322 | Ga0495680_0012387 | Ga0495680_0012387_2196_3329 | 377 |
| 1825 | 3300047322 | Ga0495680_0031794 | Ga0495680_0031794_2981_4114 | 377 |
| 1826 | 3300047322 | Ga0495680_0045097 | Ga0495680_0045097_1482_2732 | 377 |
| 1827 | 3300047322 | Ga0495680_0059489 | Ga0495680_0059489_872_2008 | 377 |
| 1828 | 3300047444 | Ga0495675_0003130 | Ga0495675_0003130_1495_2628 | 377 |
| 1829 | 3300047444 | Ga0495675_0015559 | Ga0495675_0015559_2921_4054 | 377 |
| 1830 | 3300047445 | Ga0495677_0044149 | Ga0495677_0044149_356_1489 | 377 |
| 1831 | 3300047446 | Ga0495679_011554 | Ga0495679_011554_1926_3059 | 377 |
| 1832 | 3300047471 | Ga0495684_0001385 | Ga0495684_0001385_6309_7442 | 377 |
| 1833 | 3300047471 | Ga0495684_0041636 | Ga0495684_0041636_1635_2768 | 377 |
| 1834 | 3300047471 | Ga0495684_0083196 | Ga0495684_0083196_820_1953 | 377 |
| 1835 | 3300047673 | Ga0495593_0013949 | Ga0495593_0013949_2262_3395 | 377 |
| 1836 | 3300047673 | Ga0495593_0026134 | Ga0495593_0026134_1626_2759 | 377 |
| 1837 | 3300047673 | Ga0495593_0041838 | Ga0495593_0041838_873_2009 | 377 |
| 1838 | 3300048088 | Ga0495602_0004101 | Ga0495602_0004101_2546_3682 | 377 |
| 1839 | 3300048088 | Ga0495602_0004126 | Ga0495602_0004126_6050_7183 | 377 |
| 1840 | 3300048089 | Ga0495614_0043135 | Ga0495614_0043135_292_1425 | 377 |
| 1841 | 3300048089 | Ga0495614_0094754 | Ga0495614_0094754_23_1159 | 377 |
| 1842 | 3300048903 | Ga0496100_0000759 | Ga0496100_0000759_1415_2548 | 377 |
| 1843 | 3300048903 | Ga0496100_0002801 | Ga0496100_0002801_635_1768 | 377 |
| 1844 | 3300048903 | Ga0496100_0004107 | Ga0496100_0004107_5585_6718 | 377 |
| 1845 | 3300048903 | Ga0496100_0004431 | Ga0496100_0004431_5004_6143 | 377 |
| 1846 | 3300048904 | Ga0496101_0000351 | Ga0496101_0000351_6778_7911 | 377 |
| 1847 | 3300048904 | Ga0496101_0006685 | Ga0496101_0006685_3498_4631 | 377 |
| 1848 | 3300048904 | Ga0496101_0109431 | Ga0496101_0109431_278_1411 | 377 |
| 1849 | 3300048904 | Ga0496101_0124871 | Ga0496101_0124871_183_1322 | 377 |
| 1850 | 3300048905 | Ga0496102_0015414 | Ga0496102_0015414_1666_2799 | 377 |
| 1851 | 3300048905 | Ga0496102_0062698 | Ga0496102_0062698_2039_3178 | 377 |
| 1852 | 3300048905 | Ga0496102_0069583 | Ga0496102_0069583_1834_2967 | 377 |
| 1853 | 3300048906 | Ga0496103_0000998 | Ga0496103_0000998_5328_6461 | 377 |
| 1854 | 3300048907 | Ga0496104_0001036 | Ga0496104_0001036_9341_10477 | 377 |
| 1855 | 3300048907 | Ga0496104_0044027 | Ga0496104_0044027_2818_3951 | 377 |
| 1856 | 3300048907 | Ga0496104_0068258 | Ga0496104_0068258_496_1635 | 377 |
| 1857 | 3300048907 | Ga0496104_0110000 | Ga0496104_0110000_601_1734 | 377 |
| 1858 | 3300048909 | Ga0496106_0006851 | Ga0496106_0006851_2238_3377 | 377 |
| 1859 | 3300048910 | Ga0496107_0001455 | Ga0496107_0001455_12335_13468 | 377 |
| 1860 | 3300048910 | Ga0496107_0006115 | Ga0496107_0006115_3731_4864 | 377 |
| 1861 | 3300048910 | Ga0496107_0022779 | Ga0496107_0022779_748_1884 | 377 |
| 1862 | 3300048910 | Ga0496107_0029566 | Ga0496107_0029566_1964_3097 | 377 |
| 1863 | 3300048911 | Ga0496108_0000643 | Ga0496108_0000643_23069_24202 | 377 |
| 1864 | 3300048911 | Ga0496108_0025776 | Ga0496108_0025776_1222_2361 | 377 |
| 1865 | 3300048911 | Ga0496108_0031626 | Ga0496108_0031626_557_1690 | 377 |
| 1866 | 3300048911 | Ga0496108_0148532 | Ga0496108_0148532_105_1238 | 377 |
| 1867 | 3300048912 | Ga0496109_0000359 | Ga0496109_0000359_22999_24132 | 377 |
| 1868 | 3300048912 | Ga0496109_0000976 | Ga0496109_0000976_2330_3463 | 377 |
| 1869 | 3300048912 | Ga0496109_0005374 | Ga0496109_0005374_5784_6923 | 377 |
| 1870 | 3300048912 | Ga0496109_0031587 | Ga0496109_0031587_3087_4220 | 377 |
| 1871 | 3300048913 | Ga0496110_0020531 | Ga0496110_0020531_2677_3816 | 377 |
| 1872 | 3300048913 | Ga0496110_0071193 | Ga0496110_0071193_956_2089 | 377 |
| 1873 | 3300048913 | Ga0496110_0300022 | Ga0496110_0300022_251_1384 | 377 |
| 1874 | 3300048914 | Ga0496111_0040961 | Ga0496111_0040961_1057_2196 | 377 |
| 1875 | 3300048914 | Ga0496111_0221339 | Ga0496111_0221339_151_1284 | 377 |
| 1876 | 3300048915 | Ga0496112_0116480 | Ga0496112_0116480_1471_2604 | 377 |
| 1877 | 3300048915 | Ga0496112_0327625 | Ga0496112_0327625_120_1253 | 377 |
| 1878 | 3300048916 | Ga0496113_0000533 | Ga0496113_0000533_11346_12479 | 377 |
| 1879 | 3300048916 | Ga0496113_0038507 | Ga0496113_0038507_437_1576 | 377 |
| 1880 | 3300048916 | Ga0496113_0054420 | Ga0496113_0054420_1010_2143 | 377 |
| 1881 | 3300048917 | Ga0496114_0035566 | Ga0496114_0035566_1598_2731 | 377 |
| 1882 | 3300048917 | Ga0496114_0038438 | Ga0496114_0038438_375_1514 | 377 |
| 1883 | 3300048917 | Ga0496114_0058816 | Ga0496114_0058816_278_1411 | 377 |
| 1884 | 3300048917 | Ga0496114_0194068 | Ga0496114_0194068_599_1735 | 377 |
| 1885 | 3300048918 | Ga0496115_0001160 | Ga0496115_0001160_12701_13834 | 377 |
| 1886 | 3300048918 | Ga0496115_0002750 | Ga0496115_0002750_2397_3533 | 377 |
| 1887 | 3300048918 | Ga0496115_0014364 | Ga0496115_0014364_4381_5514 | 377 |
| 1888 | 3300048918 | Ga0496115_0020665 | Ga0496115_0020665_597_1736 | 377 |
| 1889 | 3300048918 | Ga0496115_0074660 | Ga0496115_0074660_1564_2697 | 377 |
| 1890 | 3300049593 | Ga0501077_0011452 | Ga0501077_0011452_283_1416 | 377 |
| 1891 | 3300049742 | Ga0501080_0292089 | Ga0501080_0292089_306_1442 | 377 |
| 1892 | 3300049744 | Ga0501083_0059136 | Ga0501083_0059136_941_2089 | 377 |
| 1893 | 3300050507 | nmdc:mga05p37_102_c1 | nmdc:mga05p37_102_c1_14072_15205 | 377 |
| 1894 | 3300050507 | nmdc:mga05p37_103644_c1 | nmdc:mga05p37_103644_c1_2075_3208 | 377 |
| 1895 | 3300050508 | nmdc:mga09592_14658_c1 | nmdc:mga09592_14658_c1_2819_3955 | 377 |
| 1896 | 3300050508 | nmdc:mga09592_752_c1 | nmdc:mga09592_752_c1_10638_11771 | 377 |
| 1897 | 3300050509 | nmdc:mga0qj67_119_c1 | nmdc:mga0qj67_119_c1_49028_50161 | 377 |
| 1898 | 3300050510 | nmdc:mga06r32_1767_c1 | nmdc:mga06r32_1767_c1_6033_7169 | 377 |
| 1899 | 3300050510 | nmdc:mga06r32_621_c1 | nmdc:mga06r32_621_c1_23395_24528 | 377 |
| 1900 | 3300050511 | nmdc:mga08y16_1991_c1 | nmdc:mga08y16_1991_c1_15643_16776 | 377 |
| 1901 | 3300050511 | nmdc:mga08y16_30913_c1 | nmdc:mga08y16_30913_c1_1701_2834 | 377 |
| 1902 | 3300050511 | nmdc:mga08y16_3532_c1 | nmdc:mga08y16_3532_c1_10322_11455 | 377 |
| 1903 | 3300050512 | nmdc:mga0n895_1270_c1 | nmdc:mga0n895_1270_c1_13440_14573 | 377 |
| 1904 | 3300050512 | nmdc:mga0n895_2196_c1 | nmdc:mga0n895_2196_c1_10889_12022 | 377 |
| 1905 | 3300050512 | nmdc:mga0n895_90744_c1 | nmdc:mga0n895_90744_c1_1731_2864 | 377 |
| 1906 | 3300050513 | nmdc:mga0rr50_115027_c1 | nmdc:mga0rr50_115027_c1_223_1356 | 377 |
| 1907 | 3300050513 | nmdc:mga0rr50_22191_c1 | nmdc:mga0rr50_22191_c1_1486_2619 | 377 |
| 1908 | 3300050515 | nmdc:mga0a205_146535_c1 | nmdc:mga0a205_146535_c1_231_1376 | 377 |
| 1909 | 3300050515 | nmdc:mga0a205_1990_c1 | nmdc:mga0a205_1990_c1_10927_12060 | 377 |
| 1910 | 3300050515 | nmdc:mga0a205_421_c1 | nmdc:mga0a205_421_c1_6483_7616 | 377 |
| 1911 | 3300050515 | nmdc:mga0a205_58386_c1 | nmdc:mga0a205_58386_c1_2298_3431 | 377 |
| 1912 | 3300053077 | Ga0495601_0002952 | Ga0495601_0002952_7476_8609 | 377 |
| 1913 | 3300053077 | Ga0495601_0003050 | Ga0495601_0003050_4409_5542 | 377 |
| 1914 | 3300053077 | Ga0495601_0003088 | Ga0495601_0003088_141_1277 | 377 |
| 1915 | 3300053077 | Ga0495601_0016054 | Ga0495601_0016054_1679_2929 | 377 |
| 1916 | 3300053077 | Ga0495601_0039165 | Ga0495601_0039165_12_1145 | 377 |
| 1917 | 3300053077 | Ga0495601_0044749 | Ga0495601_0044749_530_1663 | 377 |
| 1918 | 3300053078 | Ga0495612_0000786 | Ga0495612_0000786_9399_10532 | 377 |
| 1919 | 3300053078 | Ga0495612_0001076 | Ga0495612_0001076_5288_6421 | 377 |
| 1920 | 3300053078 | Ga0495612_0010919 | Ga0495612_0010919_1004_2137 | 377 |
| 1921 | 3300053078 | Ga0495612_0056308 | Ga0495612_0056308_189_1322 | 377 |
| 1922 | 3300053078 | Ga0495612_0071921 | Ga0495612_0071921_76_1326 | 377 |
| 1923 | 3300053084 | Ga0495595_0000223 | Ga0495595_0000223_14590_15723 | 377 |
| 1924 | 3300053084 | Ga0495595_0000984 | Ga0495595_0000984_6944_8077 | 377 |
| 1925 | 3300053084 | Ga0495595_0001629 | Ga0495595_0001629_1287_2420 | 377 |
| 1926 | 3300053084 | Ga0495595_0006421 | Ga0495595_0006421_3078_4214 | 377 |
| 1927 | 3300053084 | Ga0495595_0028170 | Ga0495595_0028170_1310_2446 | 377 |
| 1928 | 3300053085 | Ga0495619_0001087 | Ga0495619_0001087_4007_5140 | 377 |
| 1929 | 3300053085 | Ga0495619_0001653 | Ga0495619_0001653_1893_3026 | 377 |
| 1930 | 3300053085 | Ga0495619_0005901 | Ga0495619_0005901_1016_2152 | 377 |
| 1931 | 3300053085 | Ga0495619_0006095 | Ga0495619_0006095_568_1704 | 377 |
| 1932 | 3300053085 | Ga0495619_0010207 | Ga0495619_0010207_2474_3724 | 377 |
| 1933 | 3300053085 | Ga0495619_0023993 | Ga0495619_0023993_116_1249 | 377 |
| 1934 | 3300053085 | Ga0495619_0080845 | Ga0495619_0080845_475_1608 | 377 |
| 1935 | 3300053096 | Ga0500641_0005584 | Ga0500641_0005584_3185_4402 | 377 |
| 1936 | 3300053096 | Ga0500641_0010283 | Ga0500641_0010283_360_1496 | 377 |
| 1937 | 3300053153 | Ga0500616_0008359 | Ga0500616_0008359_4468_5610 | 377 |
| 1938 | 3300060353 | Ga0501082_0039669 | Ga0501082_0039669_54_1190 | 377 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fef-assembly1.cif.gz_J | structure of mce1 transporter from mycobacterium smegmatis (map0) | 0.9072 | 127 | 370 |
| 8fee-assembly1.cif.gz_I | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.8918 | 125 | 371 |
| 7d08-assembly1.cif.gz_A | acinetobacter mlafedb complex in atp-bound vtrans1 conformation | 0.8787 | 115 | 367 |
| 8fee-assembly1.cif.gz_I | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.8716 | 125 | 371 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.8699 | 123 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZXL0_527_672_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8319 | 10 | 97 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7924 | 2 | 97 | 3.30.750.24 |
| 3if5A02 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7883 | 7 | 87 | 3.30.750.24 |
| 1t6rA00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.7859 | 1 | 101 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.785 | 3 | 101 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520ZKN9-F1-model_v4 | ABC transporter permease | 0.9791 | 180 | 377 |
GO:0005548
GO:0043190 |
| AF-A0A231MUA8-F1-model_v4 | deleted | 0.9781 | 114 | 377 |
|
| AF-A0A351T1X7-F1-model_v4 | ABC transporter permease | 0.9748 | 156 | 377 |
GO:0005548
GO:0043190 |
| AF-A0A348MP27-F1-model_v4 | deleted | 0.9697 | 155 | 372 |
|
| AF-A0A520ZKN9-F1-model_v4 | ABC transporter permease | 0.9694 | 180 | 377 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar