F496129
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1948 | 602 | 3897 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0457017|Ga0501067_0457017_64_627 |
| Length | 187 |
| Sequence | LDDPHARIRSLPPEGAPGGFGRPSTTGVGANIHFEDWLALTQLYADYASAVDSGNWDLWPEFFTDDCVYRLVPRENHERGFPLATLSFTSKGMLKDRVYGIKDTLFHDPYYQRHVVGAPVLRKVEAGRFECEANYAVFRTKLSEATVVFNVGRYLDVVVRTPAGLKFAERHCIYDSEMIPNSIIYPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 245 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 246 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 247 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 248 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 249 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 250 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 251 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 252 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 253 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 254 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 258 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 261 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 262 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 264 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 265 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 273 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 274 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 276 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 278 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 300 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 304 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 305 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 315 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 316 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 317 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 318 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 319 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 320 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 321 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 322 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 323 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 324 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 325 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 326 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 327 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 328 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 329 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 330 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 331 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 332 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 333 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 334 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 335 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 336 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 337 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 338 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 339 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 340 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 341 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 342 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 343 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 344 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 345 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 346 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 347 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 348 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 349 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 350 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 351 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 352 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 353 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 354 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 355 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 438 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 439 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 440 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 441 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 442 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 443 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 446 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 447 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 448 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 449 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 450 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 451 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 455 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 456 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 460 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 463 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 464 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 465 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 472 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 473 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 474 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 475 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 476 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 478 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 479 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 480 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 481 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 482 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 483 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 485 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 486 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 487 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 493 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 497 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 498 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 499 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 500 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 501 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 502 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 503 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 505 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 506 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 507 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 508 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 509 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 512 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 513 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 514 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 515 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 516 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 517 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 518 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 521 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 522 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 523 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 524 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 525 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 526 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 527 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 528 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 529 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 530 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 531 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 533 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 534 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 535 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 536 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 539 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 540 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 541 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 542 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 543 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 544 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 545 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 546 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 547 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 548 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 549 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 550 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 551 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 552 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 553 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 554 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 555 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 556 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 557 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 558 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 559 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 560 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 561 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 562 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 563 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 564 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 565 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 566 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 567 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 568 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 569 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 570 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 571 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 572 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 573 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 574 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 575 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 576 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 577 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 578 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 579 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 580 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 581 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 582 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 583 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 584 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 585 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 586 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 587 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 588 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 589 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 590 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 591 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 592 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 593 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 594 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 595 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 596 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 597 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 598 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 599 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 600 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 601 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 602 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.77 |
| Metatranscriptomes | 0 |
| Isolates | 3.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.41 |
| Nodule | 0.1 |
| Rhizoplane | 3.08 |
| Rhizosphere | 66.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0457017 | 3300049583 | Bacteria | 713 |
| 2 | JGI24740J21852_10014352 | 3300001979 | Bacteria | 2924 |
| 3 | JGI24739J22299_10005780 | 3300001989 | Bacteria | 4687 |
| 4 | JGI25155J39150_1000062 | 3300002704 | Bacteria | 70719 |
| 5 | JGI25156J39149_1000012 | 3300002705 | Bacteria | 194393 |
| 6 | JGI25154J39366_1000029 | 3300002738 | Bacteria | 194393 |
| 7 | JGI25154J39366_1000278 | 3300002738 | Bacteria | 31200 |
| 8 | JGI25158J39367_1004986 | 3300002739 | Bacteria | 1962 |
| 9 | JGI25157J39369_1000014 | 3300002741 | Bacteria | 194393 |
| 10 | JGI25152J39213_1001366 | 3300002773 | Bacteria | 10658 |
| 11 | JGI25152J39213_1006035 | 3300002773 | Bacteria | 3387 |
| 12 | JGI25150J39212_1000869 | 3300002774 | Bacteria | 10019 |
| 13 | JGI25150J39212_1014431 | 3300002774 | Bacteria | 1342 |
| 14 | JGI25159J45721_1000054 | 3300002987 | Bacteria | 56576 |
| 15 | JGI25159J45721_1005152 | 3300002987 | Bacteria | 4144 |
| 16 | JGI25151J46595_10000507 | 3300003187 | Bacteria | 36540 |
| 17 | JGI25151J46595_10002599 | 3300003187 | Bacteria | 10658 |
| 18 | JGI25151J46595_10002870 | 3300003187 | Bacteria | 9904 |
| 19 | JGI25151J46595_10004424 | 3300003187 | Bacteria | 7439 |
| 20 | JGI25151J46595_10006031 | 3300003187 | Bacteria | 6171 |
| 21 | JGI25151J46595_10006574 | 3300003187 | Bacteria | 5823 |
| 22 | JGI25153J46596_10002045 | 3300003215 | Bacteria | 11890 |
| 23 | rootL2_10020233 | 3300003322 | Bacteria | 2342 |
| 24 | rootL2_10167114 | 3300003322 | Bacteria | 1191 |
| 25 | rootH1_10030289 | 3300003316 | Bacteria | 4911 |
| 26 | rootH1_10030289 | 3300003323 | Bacteria | 1135 |
| 27 | JGI25160J50197_1000088 | 3300003354 | Bacteria | 93050 |
| 28 | JGI25160J50197_1000119 | 3300003354 | Bacteria | 71366 |
| 29 | JGI25160J50197_1001065 | 3300003354 | Bacteria | 14091 |
| 30 | JGI25160J50197_1005159 | 3300003354 | Bacteria | 5484 |
| 31 | JGI25160J50197_1037137 | 3300003354 | Bacteria | 1171 |
| 32 | JGI25161J50226_1000056 | 3300003374 | Bacteria | 103097 |
| 33 | JGI25161J50226_1003182 | 3300003374 | Bacteria | 3871 |
| 34 | Ga0055532_1013650 | 3300003758 | Bacteria | 923 |
| 35 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 36 | Ga0055535_1000286 | 3300003761 | Bacteria | 53400 |
| 37 | Ga0055535_1001184 | 3300003761 | Bacteria | 15063 |
| 38 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 39 | Ga0055542_1001176 | 3300003762 | Bacteria | 15063 |
| 40 | Ga0055526_1006187 | 3300003771 | Bacteria | 6585 |
| 41 | Ga0055526_1011254 | 3300003771 | Bacteria | 4054 |
| 42 | Ga0055526_1024874 | 3300003771 | Bacteria | 1941 |
| 43 | Ga0055526_1024934 | 3300003771 | Bacteria | 1936 |
| 44 | Ga0055537_1000024 | 3300003773 | Bacteria | 111410 |
| 45 | Ga0055537_1000047 | 3300003773 | Bacteria | 88000 |
| 46 | Ga0055537_1001263 | 3300003773 | Bacteria | 10568 |
| 47 | Ga0055537_1006648 | 3300003773 | Bacteria | 2901 |
| 48 | Ga0055537_1007290 | 3300003773 | Bacteria | 2682 |
| 49 | Ga0055524_1000039 | 3300003775 | Bacteria | 159897 |
| 50 | Ga0055524_1008821 | 3300003775 | Bacteria | 4155 |
| 51 | Ga0055524_1009148 | 3300003775 | Bacteria | 4054 |
| 52 | Ga0055536_1002675 | 3300003781 | Bacteria | 9889 |
| 53 | Ga0055536_1009284 | 3300003781 | Bacteria | 4091 |
| 54 | Ga0055536_1009897 | 3300003781 | Bacteria | 3871 |
| 55 | Ga0055536_1028754 | 3300003781 | Bacteria | 1509 |
| 56 | Ga0055534_1000032 | 3300003784 | Bacteria | 118890 |
| 57 | Ga0055534_1000141 | 3300003784 | Bacteria | 53818 |
| 58 | Ga0055534_1001229 | 3300003784 | Bacteria | 10658 |
| 59 | Ga0055534_1002784 | 3300003784 | Bacteria | 5844 |
| 60 | Ga0055534_1038206 | 3300003784 | Bacteria | 715 |
| 61 | Ga0055528_1002122 | 3300003790 | Bacteria | 10944 |
| 62 | Ga0055528_1002521 | 3300003790 | Bacteria | 9752 |
| 63 | Ga0055528_1002981 | 3300003790 | Bacteria | 8769 |
| 64 | Ga0055528_1009497 | 3300003790 | Bacteria | 4054 |
| 65 | Ga0055530_10000532 | 3300003791 | Bacteria | 33030 |
| 66 | Ga0055530_10002093 | 3300003791 | Bacteria | 13335 |
| 67 | Ga0055530_10004782 | 3300003791 | Bacteria | 6802 |
| 68 | Ga0055530_10022158 | 3300003791 | Bacteria | 1855 |
| 69 | Ga0055530_10024142 | 3300003791 | Bacteria | 1731 |
| 70 | Ga0055530_10053041 | 3300003791 | Bacteria | 933 |
| 71 | Ga0055540_1000047 | 3300003792 | Bacteria | 146914 |
| 72 | Ga0055540_1000365 | 3300003792 | Bacteria | 38078 |
| 73 | Ga0055540_1000440 | 3300003792 | Bacteria | 32622 |
| 74 | Ga0055540_1002293 | 3300003792 | Bacteria | 10309 |
| 75 | Ga0055540_1008010 | 3300003792 | Bacteria | 3871 |
| 76 | Ga0055531_10000454 | 3300003794 | Bacteria | 38078 |
| 77 | Ga0055531_10011051 | 3300003794 | Bacteria | 4407 |
| 78 | Ga0055531_10012021 | 3300003794 | Bacteria | 4111 |
| 79 | Ga0055531_10012911 | 3300003794 | Bacteria | 3891 |
| 80 | Ga0055531_10057654 | 3300003794 | Bacteria | 972 |
| 81 | Ga0055543_1000904 | 3300004625 | Bacteria | 13924 |
| 82 | Ga0055543_1001077 | 3300004625 | Bacteria | 11969 |
| 83 | Ga0055543_1001260 | 3300004625 | Bacteria | 10446 |
| 84 | Ga0065165_1003589 | 3300005262 | Bacteria | 10696 |
| 85 | Ga0065165_1005321 | 3300005262 | Bacteria | 7314 |
| 86 | Ga0065165_1023989 | 3300005262 | Bacteria | 2058 |
| 87 | Ga0065165_1024242 | 3300005262 | Bacteria | 2041 |
| 88 | Ga0065165_1081429 | 3300005262 | Bacteria | 840 |
| 89 | Ga0065714_10066369 | 3300005288 | Bacteria | 6992 |
| 90 | Ga0065715_10244020 | 3300005293 | Bacteria | 1189 |
| 91 | Ga0065707_10087747 | 3300005295 | Bacteria | 4904 |
| 92 | Ga0070658_10125538 | 3300005327 | Bacteria | 2135 |
| 93 | Ga0070658_10176893 | 3300005327 | Bacteria | 1795 |
| 94 | Ga0070676_10004494 | 3300005328 | Bacteria | 7341 |
| 95 | Ga0070676_10032895 | 3300005328 | Bacteria | 2973 |
| 96 | Ga0070676_10203602 | 3300005328 | Bacteria | 1299 |
| 97 | Ga0070676_10285396 | 3300005328 | Bacteria | 1114 |
| 98 | Ga0070683_100131089 | 3300005329 | Bacteria | 2372 |
| 99 | Ga0070683_100154993 | 3300005329 | Bacteria | 2172 |
| 100 | Ga0070690_100037460 | 3300005330 | Bacteria | 3056 |
| 101 | Ga0070690_100165870 | 3300005330 | Bacteria | 1517 |
| 102 | Ga0070690_101040912 | 3300005330 | Bacteria | 647 |
| 103 | Ga0070670_100031372 | 3300005331 | Bacteria | 4576 |
| 104 | Ga0070670_100097851 | 3300005331 | Bacteria | 2524 |
| 105 | Ga0070670_100398756 | 3300005331 | Bacteria | 1214 |
| 106 | Ga0070670_100427560 | 3300005331 | Bacteria | 1171 |
| 107 | Ga0070670_100483723 | 3300005331 | Bacteria | 1099 |
| 108 | Ga0070670_100773935 | 3300005331 | Bacteria | 866 |
| 109 | Ga0070670_101137033 | 3300005331 | Bacteria | 713 |
| 110 | Ga0070677_10020521 | 3300005333 | Bacteria | 2408 |
| 111 | Ga0070677_10096467 | 3300005333 | Bacteria | 1295 |
| 112 | Ga0070677_10284039 | 3300005333 | Bacteria | 835 |
| 113 | Ga0070677_10352729 | 3300005333 | Bacteria | 763 |
| 114 | Ga0068869_100000109 | 3300005334 | Bacteria | 39248 |
| 115 | Ga0068869_100011409 | 3300005334 | Bacteria | 5827 |
| 116 | Ga0068869_100061469 | 3300005334 | Bacteria | 2755 |
| 117 | Ga0068869_100118296 | 3300005334 | Bacteria | 2023 |
| 118 | Ga0068869_100322628 | 3300005334 | Bacteria | 1253 |
| 119 | Ga0068869_100600166 | 3300005334 | Bacteria | 930 |
| 120 | Ga0068869_101125485 | 3300005334 | Bacteria | 688 |
| 121 | Ga0070666_10006231 | 3300005335 | Bacteria | 7339 |
| 122 | Ga0070666_10009271 | 3300005335 | Bacteria | 6133 |
| 123 | Ga0070666_10146619 | 3300005335 | Bacteria | 1645 |
| 124 | Ga0070666_10772301 | 3300005335 | Bacteria | 707 |
| 125 | Ga0070680_100063118 | 3300005336 | Bacteria | 3034 |
| 126 | Ga0070682_100473027 | 3300005337 | Bacteria | 965 |
| 127 | Ga0068868_100000928 | 3300005338 | Bacteria | 19961 |
| 128 | Ga0068868_100002606 | 3300005338 | Bacteria | 12501 |
| 129 | Ga0068868_100009104 | 3300005338 | Bacteria | 7128 |
| 130 | Ga0068868_100043506 | 3300005338 | Bacteria | 3508 |
| 131 | Ga0068868_100068559 | 3300005338 | Bacteria | 2825 |
| 132 | Ga0068868_100094776 | 3300005338 | Bacteria | 2408 |
| 133 | Ga0068868_100327397 | 3300005338 | Bacteria | 1307 |
| 134 | Ga0068868_100618047 | 3300005338 | Bacteria | 962 |
| 135 | Ga0068868_101543346 | 3300005338 | Bacteria | 623 |
| 136 | Ga0070660_100102495 | 3300005339 | Bacteria | 2269 |
| 137 | Ga0070660_100113595 | 3300005339 | Bacteria | 2157 |
| 138 | Ga0070660_101555058 | 3300005339 | Bacteria | 563 |
| 139 | Ga0070687_100121070 | 3300005343 | Bacteria | 1497 |
| 140 | Ga0070661_100071384 | 3300005344 | Bacteria | 2555 |
| 141 | Ga0070661_100098854 | 3300005344 | Bacteria | 2167 |
| 142 | Ga0070661_100098982 | 3300005344 | Bacteria | 2166 |
| 143 | Ga0070661_100760848 | 3300005344 | Bacteria | 793 |
| 144 | Ga0070692_10314546 | 3300005345 | Bacteria | 961 |
| 145 | Ga0070692_10769411 | 3300005345 | Bacteria | 655 |
| 146 | Ga0070668_100005748 | 3300005347 | Bacteria | 9200 |
| 147 | Ga0070668_100493696 | 3300005347 | Bacteria | 1059 |
| 148 | Ga0070668_100612524 | 3300005347 | Bacteria | 954 |
| 149 | Ga0070669_100003867 | 3300005353 | Bacteria | 10823 |
| 150 | Ga0070669_100032291 | 3300005353 | Bacteria | 3782 |
| 151 | Ga0070669_100096210 | 3300005353 | Bacteria | 2228 |
| 152 | Ga0070669_100206889 | 3300005353 | Bacteria | 1546 |
| 153 | Ga0070669_100516365 | 3300005353 | Bacteria | 992 |
| 154 | Ga0070669_101115792 | 3300005353 | Bacteria | 679 |
| 155 | Ga0070675_100000772 | 3300005354 | Bacteria | 22339 |
| 156 | Ga0070675_100018873 | 3300005354 | Bacteria | 5491 |
| 157 | Ga0070675_100038290 | 3300005354 | Bacteria | 3907 |
| 158 | Ga0070675_100145426 | 3300005354 | Bacteria | 2029 |
| 159 | Ga0070675_100224640 | 3300005354 | Bacteria | 1636 |
| 160 | Ga0070675_100348796 | 3300005354 | Bacteria | 1312 |
| 161 | Ga0070675_100485372 | 3300005354 | Bacteria | 1112 |
| 162 | Ga0070671_100006491 | 3300005355 | Bacteria | 9355 |
| 163 | Ga0070671_100011811 | 3300005355 | Bacteria | 7026 |
| 164 | Ga0070671_100030752 | 3300005355 | Bacteria | 4431 |
| 165 | Ga0070671_100127377 | 3300005355 | Bacteria | 2144 |
| 166 | Ga0070671_100249854 | 3300005355 | Bacteria | 1506 |
| 167 | Ga0070671_100411541 | 3300005355 | Bacteria | 1157 |
| 168 | Ga0070671_100422072 | 3300005355 | Bacteria | 1142 |
| 169 | Ga0070674_100014173 | 3300005356 | Bacteria | 4949 |
| 170 | Ga0070674_100146038 | 3300005356 | Bacteria | 1780 |
| 171 | Ga0070673_100007669 | 3300005364 | Bacteria | 7138 |
| 172 | Ga0070673_100077501 | 3300005364 | Bacteria | 2686 |
| 173 | Ga0070673_100086947 | 3300005364 | Bacteria | 2547 |
| 174 | Ga0070673_100129628 | 3300005364 | Bacteria | 2114 |
| 175 | Ga0070673_100229881 | 3300005364 | Bacteria | 1609 |
| 176 | Ga0070673_100316352 | 3300005364 | Bacteria | 1378 |
| 177 | Ga0070673_100434024 | 3300005364 | Bacteria | 1179 |
| 178 | Ga0070673_100496870 | 3300005364 | Bacteria | 1103 |
| 179 | Ga0070673_100653681 | 3300005364 | Bacteria | 962 |
| 180 | Ga0070673_100825658 | 3300005364 | Bacteria | 857 |
| 181 | Ga0070673_100853490 | 3300005364 | Bacteria | 843 |
| 182 | Ga0070673_100926170 | 3300005364 | Bacteria | 809 |
| 183 | Ga0070673_101190219 | 3300005364 | Bacteria | 714 |
| 184 | Ga0070688_100026856 | 3300005365 | Bacteria | 3425 |
| 185 | Ga0070659_100015164 | 3300005366 | Bacteria | 5765 |
| 186 | Ga0070659_100114676 | 3300005366 | Bacteria | 2177 |
| 187 | Ga0070659_100198344 | 3300005366 | Bacteria | 1651 |
| 188 | Ga0070659_101053265 | 3300005366 | Bacteria | 716 |
| 189 | Ga0070667_100005806 | 3300005367 | Bacteria | 10301 |
| 190 | Ga0070667_100007096 | 3300005367 | Bacteria | 9313 |
| 191 | Ga0070667_100064974 | 3300005367 | Bacteria | 3097 |
| 192 | Ga0070667_100125372 | 3300005367 | Bacteria | 2237 |
| 193 | Ga0070667_100188883 | 3300005367 | Bacteria | 1824 |
| 194 | Ga0070667_100484550 | 3300005367 | Bacteria | 1132 |
| 195 | Ga0070667_100999049 | 3300005367 | Bacteria | 781 |
| 196 | Ga0070667_101222092 | 3300005367 | Bacteria | 703 |
| 197 | Ga0070701_10383946 | 3300005438 | Bacteria | 886 |
| 198 | Ga0070708_100135616 | 3300005445 | Bacteria | 2280 |
| 199 | Ga0070663_100003925 | 3300005455 | Bacteria | 8673 |
| 200 | Ga0070663_100313932 | 3300005455 | Bacteria | 1258 |
| 201 | Ga0070663_100371878 | 3300005455 | Bacteria | 1162 |
| 202 | Ga0070678_100004609 | 3300005456 | Bacteria | 7833 |
| 203 | Ga0070678_100035270 | 3300005456 | Bacteria | 3491 |
| 204 | Ga0070678_100420817 | 3300005456 | Bacteria | 1164 |
| 205 | Ga0070678_101010441 | 3300005456 | Bacteria | 765 |
| 206 | Ga0070662_100000552 | 3300005457 | Bacteria | 22694 |
| 207 | Ga0070662_100003920 | 3300005457 | Bacteria | 9330 |
| 208 | Ga0070662_100032880 | 3300005457 | Bacteria | 3649 |
| 209 | Ga0070662_100160037 | 3300005457 | Bacteria | 1760 |
| 210 | Ga0070662_100452663 | 3300005457 | Bacteria | 1066 |
| 211 | Ga0070662_100587568 | 3300005457 | Bacteria | 936 |
| 212 | Ga0068867_100000186 | 3300005459 | Bacteria | 41001 |
| 213 | Ga0068867_100005611 | 3300005459 | Bacteria | 8890 |
| 214 | Ga0068867_100033298 | 3300005459 | Bacteria | 3731 |
| 215 | Ga0068867_100064019 | 3300005459 | Bacteria | 2733 |
| 216 | Ga0068867_100259388 | 3300005459 | Bacteria | 1416 |
| 217 | Ga0068867_100279964 | 3300005459 | Bacteria | 1367 |
| 218 | Ga0068867_100316881 | 3300005459 | Bacteria | 1291 |
| 219 | Ga0068867_100459729 | 3300005459 | Bacteria | 1086 |
| 220 | Ga0068867_100633974 | 3300005459 | Bacteria | 936 |
| 221 | Ga0068867_100832172 | 3300005459 | Bacteria | 826 |
| 222 | Ga0068867_100867902 | 3300005459 | Bacteria | 810 |
| 223 | Ga0068867_100928701 | 3300005459 | Bacteria | 785 |
| 224 | Ga0068867_101856499 | 3300005459 | Bacteria | 567 |
| 225 | Ga0070685_10147935 | 3300005466 | Bacteria | 1486 |
| 226 | Ga0070706_100017115 | 3300005467 | Bacteria | 6699 |
| 227 | Ga0070706_100960143 | 3300005467 | Bacteria | 789 |
| 228 | Ga0070706_101871002 | 3300005467 | Bacteria | 545 |
| 229 | Ga0070707_100064439 | 3300005468 | Bacteria | 3519 |
| 230 | Ga0070707_100154296 | 3300005468 | Bacteria | 2237 |
| 231 | Ga0070699_100116427 | 3300005518 | Bacteria | 2349 |
| 232 | Ga0070679_100003825 | 3300005530 | Bacteria | 13821 |
| 233 | Ga0070684_100023555 | 3300005535 | Bacteria | 5153 |
| 234 | Ga0070684_100248441 | 3300005535 | Bacteria | 1626 |
| 235 | Ga0068853_100011884 | 3300005539 | Bacteria | 7080 |
| 236 | Ga0068853_100059570 | 3300005539 | Bacteria | 3299 |
| 237 | Ga0068853_100189341 | 3300005539 | Bacteria | 1869 |
| 238 | Ga0068853_100437457 | 3300005539 | Bacteria | 1229 |
| 239 | Ga0068853_100898155 | 3300005539 | Bacteria | 851 |
| 240 | Ga0068853_101606701 | 3300005539 | Bacteria | 630 |
| 241 | Ga0070672_100010739 | 3300005543 | Bacteria | 6363 |
| 242 | Ga0070672_100016252 | 3300005543 | Bacteria | 5324 |
| 243 | Ga0070672_100027229 | 3300005543 | Bacteria | 4262 |
| 244 | Ga0070672_100055551 | 3300005543 | Bacteria | 3102 |
| 245 | Ga0070672_100164157 | 3300005543 | Bacteria | 1844 |
| 246 | Ga0070672_100228801 | 3300005543 | Bacteria | 1562 |
| 247 | Ga0070672_100245988 | 3300005543 | Bacteria | 1505 |
| 248 | Ga0070672_100369800 | 3300005543 | Bacteria | 1225 |
| 249 | Ga0070672_100389330 | 3300005543 | Bacteria | 1193 |
| 250 | Ga0070672_100739793 | 3300005543 | Bacteria | 863 |
| 251 | Ga0070672_101241462 | 3300005543 | Bacteria | 664 |
| 252 | Ga0070693_100763512 | 3300005547 | Bacteria | 713 |
| 253 | Ga0070665_100043405 | 3300005548 | Bacteria | 4519 |
| 254 | Ga0070665_100144705 | 3300005548 | Bacteria | 2380 |
| 255 | Ga0070665_100278353 | 3300005548 | Bacteria | 1675 |
| 256 | Ga0070665_100509410 | 3300005548 | Bacteria | 1215 |
| 257 | Ga0070665_100668795 | 3300005548 | Bacteria | 1051 |
| 258 | Ga0068855_100015116 | 3300005563 | Bacteria | 9294 |
| 259 | Ga0068855_100047998 | 3300005563 | Bacteria | 5041 |
| 260 | Ga0068855_100173929 | 3300005563 | Bacteria | 2437 |
| 261 | Ga0070664_100006998 | 3300005564 | Bacteria | 9096 |
| 262 | Ga0070664_100116860 | 3300005564 | Bacteria | 2332 |
| 263 | Ga0070664_100211556 | 3300005564 | Bacteria | 1733 |
| 264 | Ga0070664_100219576 | 3300005564 | Bacteria | 1700 |
| 265 | Ga0070664_100325032 | 3300005564 | Bacteria | 1394 |
| 266 | Ga0070664_100769040 | 3300005564 | Bacteria | 899 |
| 267 | Ga0070664_101313837 | 3300005564 | Bacteria | 683 |
| 268 | Ga0068857_100053902 | 3300005577 | Bacteria | 3567 |
| 269 | Ga0068857_100134323 | 3300005577 | Bacteria | 2233 |
| 270 | Ga0068857_100162697 | 3300005577 | Bacteria | 2025 |
| 271 | Ga0068857_100298227 | 3300005577 | Bacteria | 1485 |
| 272 | Ga0068857_101269641 | 3300005577 | Bacteria | 714 |
| 273 | Ga0068854_100048398 | 3300005578 | Bacteria | 3033 |
| 274 | Ga0068854_100084591 | 3300005578 | Bacteria | 2348 |
| 275 | Ga0068854_100120987 | 3300005578 | Bacteria | 1987 |
| 276 | Ga0068854_100694332 | 3300005578 | Bacteria | 878 |
| 277 | Ga0068854_100841142 | 3300005578 | Bacteria | 803 |
| 278 | Ga0068854_100935849 | 3300005578 | Bacteria | 763 |
| 279 | Ga0068856_100069854 | 3300005614 | Bacteria | 3473 |
| 280 | Ga0068856_100139123 | 3300005614 | Bacteria | 2434 |
| 281 | Ga0068856_100226628 | 3300005614 | Bacteria | 1884 |
| 282 | Ga0068856_101093590 | 3300005614 | Bacteria | 815 |
| 283 | Ga0070702_100026507 | 3300005615 | Bacteria | 3115 |
| 284 | Ga0068852_100012691 | 3300005616 | Bacteria | 6410 |
| 285 | Ga0068852_100014348 | 3300005616 | Bacteria | 6095 |
| 286 | Ga0068852_100018466 | 3300005616 | Bacteria | 5495 |
| 287 | Ga0068852_100097562 | 3300005616 | Bacteria | 2644 |
| 288 | Ga0068852_100227802 | 3300005616 | Bacteria | 1775 |
| 289 | Ga0068852_100250838 | 3300005616 | Bacteria | 1696 |
| 290 | Ga0068852_100274059 | 3300005616 | Bacteria | 1624 |
| 291 | Ga0068852_100517269 | 3300005616 | Bacteria | 1190 |
| 292 | Ga0068852_100913899 | 3300005616 | Bacteria | 895 |
| 293 | Ga0068852_100919057 | 3300005616 | Bacteria | 892 |
| 294 | Ga0068859_100141793 | 3300005617 | Bacteria | 2477 |
| 295 | Ga0068859_100260379 | 3300005617 | Bacteria | 1826 |
| 296 | Ga0068859_100306399 | 3300005617 | Bacteria | 1682 |
| 297 | Ga0068859_100870067 | 3300005617 | Bacteria | 987 |
| 298 | Ga0068864_100000270 | 3300005618 | Bacteria | 46170 |
| 299 | Ga0068864_100010659 | 3300005618 | Bacteria | 7598 |
| 300 | Ga0068864_100053816 | 3300005618 | Bacteria | 3473 |
| 301 | Ga0068864_100065725 | 3300005618 | Bacteria | 3146 |
| 302 | Ga0068864_100207736 | 3300005618 | Bacteria | 1801 |
| 303 | Ga0068864_100837819 | 3300005618 | Bacteria | 905 |
| 304 | Ga0068866_10001571 | 3300005718 | Bacteria | 9705 |
| 305 | Ga0068866_10148194 | 3300005718 | Bacteria | 1356 |
| 306 | Ga0068866_10554989 | 3300005718 | Bacteria | 769 |
| 307 | Ga0068861_100000126 | 3300005719 | Bacteria | 39277 |
| 308 | Ga0068861_100006858 | 3300005719 | Bacteria | 7777 |
| 309 | Ga0068861_100802485 | 3300005719 | Bacteria | 883 |
| 310 | Ga0068851_10012812 | 3300005834 | Bacteria | 3960 |
| 311 | Ga0068851_10019913 | 3300005834 | Bacteria | 3244 |
| 312 | Ga0068851_10072851 | 3300005834 | Bacteria | 1781 |
| 313 | Ga0068851_10090524 | 3300005834 | Bacteria | 1610 |
| 314 | Ga0068851_10325795 | 3300005834 | Bacteria | 889 |
| 315 | Ga0068870_10115031 | 3300005840 | Bacteria | 1541 |
| 316 | Ga0068870_10212735 | 3300005840 | Bacteria | 1179 |
| 317 | Ga0068863_100000679 | 3300005841 | Bacteria | 34412 |
| 318 | Ga0068863_100022577 | 3300005841 | Bacteria | 6009 |
| 319 | Ga0068863_100136576 | 3300005841 | Bacteria | 2343 |
| 320 | Ga0068863_100227727 | 3300005841 | Bacteria | 1797 |
| 321 | Ga0068863_100259471 | 3300005841 | Bacteria | 1680 |
| 322 | Ga0068863_100366894 | 3300005841 | Bacteria | 1404 |
| 323 | Ga0068863_101408982 | 3300005841 | Bacteria | 705 |
| 324 | Ga0068858_100000225 | 3300005842 | Bacteria | 61439 |
| 325 | Ga0068858_100006184 | 3300005842 | Bacteria | 11677 |
| 326 | Ga0068858_100011807 | 3300005842 | Bacteria | 8238 |
| 327 | Ga0068860_100010530 | 3300005843 | Bacteria | 9137 |
| 328 | Ga0068860_100025113 | 3300005843 | Bacteria | 5750 |
| 329 | Ga0068860_100071695 | 3300005843 | Bacteria | 3291 |
| 330 | Ga0068860_100224709 | 3300005843 | Bacteria | 1823 |
| 331 | Ga0068860_100372691 | 3300005843 | Bacteria | 1408 |
| 332 | Ga0068860_100678258 | 3300005843 | Bacteria | 1039 |
| 333 | Ga0068862_100091077 | 3300005844 | Bacteria | 2655 |
| 334 | Ga0068862_100215452 | 3300005844 | Bacteria | 1737 |
| 335 | Ga0068862_100274253 | 3300005844 | Bacteria | 1544 |
| 336 | Ga0068862_100921771 | 3300005844 | Bacteria | 860 |
| 337 | Ga0070717_11108428 | 3300006028 | Bacteria | 721 |
| 338 | Ga0075365_10040246 | 3300006038 | Bacteria | 3047 |
| 339 | Ga0075368_10019359 | 3300006042 | Bacteria | 2569 |
| 340 | Ga0075363_100002613 | 3300006048 | Bacteria | 7422 |
| 341 | Ga0075363_100098285 | 3300006048 | Bacteria | 1618 |
| 342 | Ga0075363_100100513 | 3300006048 | Bacteria | 1600 |
| 343 | Ga0075363_100173312 | 3300006048 | Bacteria | 1225 |
| 344 | Ga0075363_100282609 | 3300006048 | Bacteria | 960 |
| 345 | Ga0075363_100397393 | 3300006048 | Bacteria | 810 |
| 346 | Ga0075364_10154827 | 3300006051 | Bacteria | 1546 |
| 347 | Ga0075432_10028831 | 3300006058 | Bacteria | 1916 |
| 348 | Ga0075432_10186761 | 3300006058 | Bacteria | 814 |
| 349 | Ga0070716_100528969 | 3300006173 | Bacteria | 875 |
| 350 | Ga0075362_10006845 | 3300006177 | Bacteria | 4270 |
| 351 | Ga0075362_10012721 | 3300006177 | Bacteria | 3349 |
| 352 | Ga0075362_10027255 | 3300006177 | Bacteria | 2445 |
| 353 | Ga0075362_10027795 | 3300006177 | Bacteria | 2424 |
| 354 | Ga0075362_10036217 | 3300006177 | Bacteria | 2157 |
| 355 | Ga0075362_10075832 | 3300006177 | Bacteria | 1543 |
| 356 | Ga0075362_10078719 | 3300006177 | Bacteria | 1517 |
| 357 | Ga0075362_10101318 | 3300006177 | Bacteria | 1347 |
| 358 | Ga0075362_10265553 | 3300006177 | Bacteria | 846 |
| 359 | Ga0075362_10268680 | 3300006177 | Bacteria | 842 |
| 360 | Ga0075362_10462436 | 3300006177 | Bacteria | 645 |
| 361 | Ga0075362_10620995 | 3300006177 | Bacteria | 560 |
| 362 | Ga0075367_10003489 | 3300006178 | Bacteria | 7504 |
| 363 | Ga0075367_10023278 | 3300006178 | Bacteria | 3483 |
| 364 | Ga0075367_10065241 | 3300006178 | Bacteria | 2180 |
| 365 | Ga0075367_10086899 | 3300006178 | Bacteria | 1898 |
| 366 | Ga0075367_10485085 | 3300006178 | Bacteria | 784 |
| 367 | Ga0075369_10028290 | 3300006186 | Bacteria | 2349 |
| 368 | Ga0075369_10053864 | 3300006186 | Bacteria | 1746 |
| 369 | Ga0075369_10127102 | 3300006186 | Bacteria | 1156 |
| 370 | Ga0075366_10000903 | 3300006195 | Bacteria | 14366 |
| 371 | Ga0075366_10004367 | 3300006195 | Bacteria | 7582 |
| 372 | Ga0075366_10005063 | 3300006195 | Bacteria | 7126 |
| 373 | Ga0075366_10005254 | 3300006195 | Bacteria | 7012 |
| 374 | Ga0075366_10020888 | 3300006195 | Bacteria | 3803 |
| 375 | Ga0075366_10024928 | 3300006195 | Bacteria | 3490 |
| 376 | Ga0075366_10063986 | 3300006195 | Bacteria | 2187 |
| 377 | Ga0075366_10076436 | 3300006195 | Bacteria | 1998 |
| 378 | Ga0075366_10088553 | 3300006195 | Bacteria | 1854 |
| 379 | Ga0075366_10089581 | 3300006195 | Bacteria | 1843 |
| 380 | Ga0075366_10103288 | 3300006195 | Bacteria | 1711 |
| 381 | Ga0075366_10108492 | 3300006195 | Bacteria | 1669 |
| 382 | Ga0075366_10177989 | 3300006195 | Bacteria | 1291 |
| 383 | Ga0075366_10205769 | 3300006195 | Bacteria | 1197 |
| 384 | Ga0075366_10209479 | 3300006195 | Bacteria | 1186 |
| 385 | Ga0075366_10233960 | 3300006195 | Bacteria | 1120 |
| 386 | Ga0075366_10310856 | 3300006195 | Bacteria | 965 |
| 387 | Ga0075366_10341979 | 3300006195 | Bacteria | 918 |
| 388 | Ga0075366_10408676 | 3300006195 | Bacteria | 836 |
| 389 | Ga0075366_10553356 | 3300006195 | Bacteria | 712 |
| 390 | Ga0075366_10562262 | 3300006195 | Bacteria | 706 |
| 391 | Ga0075366_10938001 | 3300006195 | Bacteria | 539 |
| 392 | Ga0075366_10968446 | 3300006195 | Bacteria | 530 |
| 393 | Ga0097621_100060271 | 3300006237 | Bacteria | 3110 |
| 394 | Ga0097621_100178814 | 3300006237 | Bacteria | 1832 |
| 395 | Ga0097621_100226196 | 3300006237 | Bacteria | 1632 |
| 396 | Ga0097621_100321941 | 3300006237 | Bacteria | 1370 |
| 397 | Ga0097621_100417698 | 3300006237 | Bacteria | 1203 |
| 398 | Ga0097621_100423384 | 3300006237 | Bacteria | 1195 |
| 399 | Ga0075370_10001385 | 3300006353 | Bacteria | 10451 |
| 400 | Ga0075370_10003497 | 3300006353 | Bacteria | 7487 |
| 401 | Ga0075370_10006662 | 3300006353 | Bacteria | 5826 |
| 402 | Ga0075370_10008356 | 3300006353 | Bacteria | 5324 |
| 403 | Ga0075370_10009388 | 3300006353 | Bacteria | 5076 |
| 404 | Ga0075370_10011977 | 3300006353 | Bacteria | 4570 |
| 405 | Ga0075370_10021716 | 3300006353 | Bacteria | 3517 |
| 406 | Ga0075370_10041399 | 3300006353 | Bacteria | 2601 |
| 407 | Ga0075370_10072521 | 3300006353 | Bacteria | 1971 |
| 408 | Ga0075370_10079534 | 3300006353 | Bacteria | 1883 |
| 409 | Ga0075370_10159946 | 3300006353 | Bacteria | 1321 |
| 410 | Ga0075370_10169808 | 3300006353 | Bacteria | 1282 |
| 411 | Ga0075370_10221285 | 3300006353 | Bacteria | 1119 |
| 412 | Ga0075370_10264415 | 3300006353 | Bacteria | 1021 |
| 413 | Ga0075370_10393622 | 3300006353 | Bacteria | 831 |
| 414 | Ga0075370_10518841 | 3300006353 | Bacteria | 720 |
| 415 | Ga0068871_100026429 | 3300006358 | Bacteria | 4529 |
| 416 | Ga0068871_100044440 | 3300006358 | Bacteria | 3573 |
| 417 | Ga0068871_100060141 | 3300006358 | Bacteria | 3098 |
| 418 | Ga0068871_100186123 | 3300006358 | Bacteria | 1787 |
| 419 | Ga0068871_100412930 | 3300006358 | Bacteria | 1204 |
| 420 | Ga0068871_100705121 | 3300006358 | Bacteria | 925 |
| 421 | Ga0068871_100816192 | 3300006358 | Bacteria | 860 |
| 422 | Ga0075430_100464806 | 3300006846 | Bacteria | 1044 |
| 423 | Ga0075430_100742798 | 3300006846 | Bacteria | 809 |
| 424 | Ga0075434_100258587 | 3300006871 | Bacteria | 1760 |
| 425 | Ga0068865_100031632 | 3300006881 | Bacteria | 3529 |
| 426 | Ga0068865_100242195 | 3300006881 | Bacteria | 1420 |
| 427 | Ga0068865_100360419 | 3300006881 | Bacteria | 1180 |
| 428 | Ga0068865_100717727 | 3300006881 | Bacteria | 856 |
| 429 | Ga0097620_100141795 | 3300006931 | Bacteria | 2477 |
| 430 | Ga0097620_100260380 | 3300006931 | Bacteria | 1826 |
| 431 | Ga0097620_100306401 | 3300006931 | Bacteria | 1682 |
| 432 | Ga0097620_100870165 | 3300006931 | Bacteria | 987 |
| 433 | Ga0075435_100684643 | 3300007076 | Bacteria | 891 |
| 434 | Ga0105244_10002369 | 3300009036 | Bacteria | 14300 |
| 435 | Ga0105244_10080538 | 3300009036 | Bacteria | 1613 |
| 436 | Ga0105240_10044244 | 3300009093 | Bacteria | 5660 |
| 437 | Ga0105240_10376389 | 3300009093 | Bacteria | 1604 |
| 438 | Ga0105240_11666270 | 3300009093 | Bacteria | 666 |
| 439 | Ga0111539_10496588 | 3300009094 | Bacteria | 1421 |
| 440 | Ga0111539_11076507 | 3300009094 | Bacteria | 934 |
| 441 | Ga0105245_10011498 | 3300009098 | Bacteria | 7709 |
| 442 | Ga0105245_10044575 | 3300009098 | Bacteria | 3959 |
| 443 | Ga0105245_10429981 | 3300009098 | Bacteria | 1325 |
| 444 | Ga0105245_10478639 | 3300009098 | Bacteria | 1258 |
| 445 | Ga0105245_10578857 | 3300009098 | Bacteria | 1147 |
| 446 | Ga0105245_10587549 | 3300009098 | Bacteria | 1139 |
| 447 | Ga0105245_11031379 | 3300009098 | Bacteria | 868 |
| 448 | Ga0105247_10783640 | 3300009101 | Bacteria | 726 |
| 449 | Ga0105243_10002142 | 3300009148 | Bacteria | 16689 |
| 450 | Ga0105243_10002791 | 3300009148 | Bacteria | 14509 |
| 451 | Ga0105243_10006295 | 3300009148 | Bacteria | 9173 |
| 452 | Ga0105243_10066462 | 3300009148 | Bacteria | 2899 |
| 453 | Ga0105243_10195426 | 3300009148 | Bacteria | 1770 |
| 454 | Ga0105243_10211999 | 3300009148 | Bacteria | 1706 |
| 455 | Ga0105243_10307811 | 3300009148 | Bacteria | 1438 |
| 456 | Ga0105243_10529961 | 3300009148 | Bacteria | 1122 |
| 457 | Ga0105243_10626920 | 3300009148 | Bacteria | 1039 |
| 458 | Ga0105243_10824709 | 3300009148 | Bacteria | 916 |
| 459 | Ga0105243_11023162 | 3300009148 | Bacteria | 830 |
| 460 | Ga0105241_10207015 | 3300009174 | Bacteria | 1642 |
| 461 | Ga0105241_10680647 | 3300009174 | Bacteria | 937 |
| 462 | Ga0105241_11448252 | 3300009174 | Bacteria | 659 |
| 463 | Ga0105242_10179763 | 3300009176 | Bacteria | 1866 |
| 464 | Ga0105242_10785592 | 3300009176 | Bacteria | 941 |
| 465 | Ga0105242_10798183 | 3300009176 | Bacteria | 934 |
| 466 | Ga0105242_11464865 | 3300009176 | Bacteria | 712 |
| 467 | Ga0105248_10020776 | 3300009177 | Bacteria | 7274 |
| 468 | Ga0105248_10069162 | 3300009177 | Bacteria | 3964 |
| 469 | Ga0105248_10103800 | 3300009177 | Bacteria | 3204 |
| 470 | Ga0105248_10140104 | 3300009177 | Bacteria | 2728 |
| 471 | Ga0105248_10223348 | 3300009177 | Bacteria | 2120 |
| 472 | Ga0105248_10381645 | 3300009177 | Bacteria | 1587 |
| 473 | Ga0105248_11065491 | 3300009177 | Bacteria | 913 |
| 474 | Ga0105248_11365687 | 3300009177 | Bacteria | 802 |
| 475 | Ga0105237_10038448 | 3300009545 | Bacteria | 4831 |
| 476 | Ga0105237_10210367 | 3300009545 | Bacteria | 1945 |
| 477 | Ga0105237_10211438 | 3300009545 | Bacteria | 1940 |
| 478 | Ga0105237_10584019 | 3300009545 | Bacteria | 1124 |
| 479 | Ga0105237_11719452 | 3300009545 | Bacteria | 635 |
| 480 | Ga0105238_10007445 | 3300009551 | Bacteria | 10968 |
| 481 | Ga0105238_10237419 | 3300009551 | Bacteria | 1800 |
| 482 | Ga0105238_10554246 | 3300009551 | Bacteria | 1154 |
| 483 | Ga0105238_10765782 | 3300009551 | Bacteria | 980 |
| 484 | Ga0105238_12092877 | 3300009551 | Bacteria | 600 |
| 485 | Ga0105249_10020223 | 3300009553 | Bacteria | 5950 |
| 486 | Ga0105249_10255488 | 3300009553 | Bacteria | 1739 |
| 487 | Ga0105249_10511243 | 3300009553 | Bacteria | 1247 |
| 488 | Ga0105239_10008553 | 3300010375 | Bacteria | 11619 |
| 489 | Ga0105239_10014688 | 3300010375 | Bacteria | 8684 |
| 490 | Ga0105239_10178863 | 3300010375 | Bacteria | 2373 |
| 491 | Ga0105239_11428694 | 3300010375 | Bacteria | 799 |
| 492 | Ga0105239_11885533 | 3300010375 | Bacteria | 693 |
| 493 | Ga0105246_10116212 | 3300011119 | Bacteria | 1974 |
| 494 | Ga0105246_10261339 | 3300011119 | Bacteria | 1379 |
| 495 | Ga0105246_11072474 | 3300011119 | Bacteria | 734 |
| 496 | Ga0105246_11128730 | 3300011119 | Bacteria | 717 |
| 497 | Ga0157347_1007959 | 3300012502 | Bacteria | 1069 |
| 498 | Ga0157373_10000764 | 3300013100 | Bacteria | 24891 |
| 499 | Ga0157373_10073883 | 3300013100 | Bacteria | 2406 |
| 500 | Ga0157373_10289715 | 3300013100 | Bacteria | 1161 |
| 501 | Ga0157371_10102848 | 3300013102 | Bacteria | 2027 |
| 502 | Ga0157371_10524539 | 3300013102 | Bacteria | 876 |
| 503 | Ga0157371_10891869 | 3300013102 | Bacteria | 674 |
| 504 | Ga0157370_10005548 | 3300013104 | Bacteria | 14147 |
| 505 | Ga0157370_10925268 | 3300013104 | Bacteria | 791 |
| 506 | Ga0157374_10149927 | 3300013296 | Bacteria | 2267 |
| 507 | Ga0157374_10576304 | 3300013296 | Bacteria | 1134 |
| 508 | Ga0157374_11938732 | 3300013296 | Bacteria | 615 |
| 509 | Ga0157378_10204597 | 3300013297 | Bacteria | 1869 |
| 510 | Ga0157378_10702504 | 3300013297 | Bacteria | 1031 |
| 511 | Ga0163162_10010080 | 3300013306 | Bacteria | 9185 |
| 512 | Ga0163162_10077396 | 3300013306 | Bacteria | 3390 |
| 513 | Ga0163162_10093880 | 3300013306 | Bacteria | 3086 |
| 514 | Ga0163162_10203206 | 3300013306 | Bacteria | 2110 |
| 515 | Ga0163162_10242856 | 3300013306 | Bacteria | 1932 |
| 516 | Ga0163162_10909509 | 3300013306 | Bacteria | 993 |
| 517 | Ga0157372_10024604 | 3300013307 | Bacteria | 6544 |
| 518 | Ga0157372_10276250 | 3300013307 | Bacteria | 1953 |
| 519 | Ga0157375_10010897 | 3300013308 | Bacteria | 8016 |
| 520 | Ga0157375_10014628 | 3300013308 | Bacteria | 7009 |
| 521 | Ga0157375_10051979 | 3300013308 | Bacteria | 4027 |
| 522 | Ga0157375_10159166 | 3300013308 | Bacteria | 2399 |
| 523 | Ga0157375_10277498 | 3300013308 | Bacteria | 1839 |
| 524 | Ga0157375_10364097 | 3300013308 | Bacteria | 1612 |
| 525 | Ga0157375_10404100 | 3300013308 | Bacteria | 1532 |
| 526 | Ga0157375_10524196 | 3300013308 | Bacteria | 1348 |
| 527 | Ga0157375_10626044 | 3300013308 | Bacteria | 1234 |
| 528 | Ga0157375_10688444 | 3300013308 | Bacteria | 1176 |
| 529 | Ga0163163_10004422 | 3300014325 | Bacteria | 11982 |
| 530 | Ga0163163_10961423 | 3300014325 | Bacteria | 917 |
| 531 | Ga0157380_10001564 | 3300014326 | Bacteria | 15067 |
| 532 | Ga0157380_10016118 | 3300014326 | Bacteria | 5505 |
| 533 | Ga0157380_10343089 | 3300014326 | Bacteria | 1394 |
| 534 | Ga0157380_11397059 | 3300014326 | Bacteria | 750 |
| 535 | Ga0182008_10000794 | 3300014497 | Bacteria | 22137 |
| 536 | Ga0182008_10043908 | 3300014497 | Bacteria | 2224 |
| 537 | Ga0182008_10053057 | 3300014497 | Bacteria | 2008 |
| 538 | Ga0157377_10000464 | 3300014745 | Bacteria | 17471 |
| 539 | Ga0157377_10074914 | 3300014745 | Bacteria | 1965 |
| 540 | Ga0157377_10124000 | 3300014745 | Bacteria | 1569 |
| 541 | Ga0157379_10005033 | 3300014968 | Bacteria | 11338 |
| 542 | Ga0157379_10012124 | 3300014968 | Bacteria | 7527 |
| 543 | Ga0157379_10040104 | 3300014968 | Bacteria | 4178 |
| 544 | Ga0157379_10304460 | 3300014968 | Bacteria | 1453 |
| 545 | Ga0157376_10001974 | 3300014969 | Bacteria | 13725 |
| 546 | Ga0157376_10012956 | 3300014969 | Bacteria | 6209 |
| 547 | Ga0157376_10787806 | 3300014969 | Bacteria | 962 |
| 548 | Ga0157376_11260089 | 3300014969 | Bacteria | 769 |
| 549 | Ga0157376_11488441 | 3300014969 | Bacteria | 710 |
| 550 | Ga0157376_11808905 | 3300014969 | Bacteria | 647 |
| 551 | Ga0182006_1000690 | 3300015261 | Bacteria | 23537 |
| 552 | Ga0182007_10004716 | 3300015262 | Bacteria | 6133 |
| 553 | Ga0182007_10006853 | 3300015262 | Bacteria | 4845 |
| 554 | Ga0182007_10394058 | 3300015262 | Bacteria | 527 |
| 555 | Ga0182005_1027614 | 3300015265 | Bacteria | 1547 |
| 556 | Ga0182005_1082344 | 3300015265 | Bacteria | 889 |
| 557 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 558 | Ga0163161_10000161 | 3300017792 | Bacteria | 61815 |
| 559 | Ga0163161_10016112 | 3300017792 | Bacteria | 5218 |
| 560 | Ga0163161_10039405 | 3300017792 | Bacteria | 3392 |
| 561 | Ga0163161_10067154 | 3300017792 | Bacteria | 2619 |
| 562 | Ga0163161_10071647 | 3300017792 | Bacteria | 2536 |
| 563 | Ga0163161_10341235 | 3300017792 | Bacteria | 1188 |
| 564 | Ga0163161_10352220 | 3300017792 | Bacteria | 1171 |
| 565 | Ga0163161_10851943 | 3300017792 | Bacteria | 769 |
| 566 | Ga0213874_10130485 | 3300021377 | Bacteria | 862 |
| 567 | Ga0213876_10101220 | 3300021384 | Bacteria | 1528 |
| 568 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 569 | Ga0209436_103397 | 3300025208 | Bacteria | 4252 |
| 570 | Ga0209436_106002 | 3300025208 | Bacteria | 2713 |
| 571 | Ga0209672_100711 | 3300025228 | Bacteria | 16556 |
| 572 | Ga0209672_101238 | 3300025228 | Bacteria | 10251 |
| 573 | Ga0209147_100450 | 3300025229 | Bacteria | 25862 |
| 574 | Ga0209147_103013 | 3300025229 | Bacteria | 3586 |
| 575 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 576 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 577 | Ga0209258_100519 | 3300025242 | Bacteria | 37071 |
| 578 | Ga0207425_1001011 | 3300025245 | Bacteria | 13170 |
| 579 | Ga0207425_1001306 | 3300025245 | Bacteria | 10745 |
| 580 | Ga0207425_1004714 | 3300025245 | Bacteria | 4025 |
| 581 | Ga0207425_1022335 | 3300025245 | Bacteria | 1334 |
| 582 | Ga0207425_1023670 | 3300025245 | Bacteria | 1283 |
| 583 | Ga0207425_1038846 | 3300025245 | Bacteria | 913 |
| 584 | Ga0207425_1053424 | 3300025245 | Bacteria | 731 |
| 585 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 586 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 587 | Ga0209026_1000040 | 3300025250 | Bacteria | 277470 |
| 588 | Ga0209026_1013794 | 3300025250 | Bacteria | 1365 |
| 589 | Ga0209677_109163 | 3300025253 | Bacteria | 1812 |
| 590 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 591 | Ga0209148_1000067 | 3300025254 | Bacteria | 338678 |
| 592 | Ga0209148_1000440 | 3300025254 | Bacteria | 45707 |
| 593 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 594 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 595 | Ga0209129_1001645 | 3300025258 | Bacteria | 12118 |
| 596 | Ga0209129_1008680 | 3300025258 | Bacteria | 2792 |
| 597 | Ga0209129_1016572 | 3300025258 | Bacteria | 1474 |
| 598 | Ga0209129_1017663 | 3300025258 | Bacteria | 1393 |
| 599 | Ga0209129_1035134 | 3300025258 | Bacteria | 817 |
| 600 | Ga0209565_1000039 | 3300025263 | Bacteria | 278026 |
| 601 | Ga0209565_1000080 | 3300025263 | Bacteria | 156999 |
| 602 | Ga0209565_1000583 | 3300025263 | Bacteria | 24687 |
| 603 | Ga0209565_1000645 | 3300025263 | Bacteria | 22597 |
| 604 | Ga0209565_1000876 | 3300025263 | Bacteria | 16569 |
| 605 | Ga0209673_1000088 | 3300025273 | Bacteria | 204629 |
| 606 | Ga0209673_1000284 | 3300025273 | Bacteria | 94932 |
| 607 | Ga0209673_1001443 | 3300025273 | Bacteria | 22597 |
| 608 | Ga0209673_1002254 | 3300025273 | Bacteria | 13894 |
| 609 | Ga0209130_1000040 | 3300025284 | Bacteria | 262926 |
| 610 | Ga0209130_1000346 | 3300025284 | Bacteria | 53329 |
| 611 | Ga0209130_1000757 | 3300025284 | Bacteria | 28010 |
| 612 | Ga0209130_1001429 | 3300025284 | Bacteria | 15870 |
| 613 | Ga0209675_1000030 | 3300025291 | Bacteria | 278026 |
| 614 | Ga0209675_1000133 | 3300025291 | Bacteria | 101207 |
| 615 | Ga0209675_1000471 | 3300025291 | Bacteria | 30899 |
| 616 | Ga0209675_1000695 | 3300025291 | Bacteria | 23368 |
| 617 | Ga0209675_1001131 | 3300025291 | Bacteria | 16273 |
| 618 | Ga0209675_1004254 | 3300025291 | Bacteria | 6449 |
| 619 | Ga0209675_1020620 | 3300025291 | Bacteria | 1780 |
| 620 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 621 | Ga0209676_1000073 | 3300025292 | Bacteria | 305947 |
| 622 | Ga0209676_1000142 | 3300025292 | Bacteria | 175752 |
| 623 | Ga0209676_1000317 | 3300025292 | Bacteria | 94105 |
| 624 | Ga0209676_1000383 | 3300025292 | Bacteria | 81259 |
| 625 | Ga0209676_1013166 | 3300025292 | Bacteria | 3196 |
| 626 | Ga0209676_1042675 | 3300025292 | Bacteria | 1257 |
| 627 | Ga0209025_1000088 | 3300025294 | Bacteria | 255087 |
| 628 | Ga0209025_1000104 | 3300025294 | Bacteria | 226895 |
| 629 | Ga0209025_1001526 | 3300025294 | Bacteria | 29626 |
| 630 | Ga0209025_1002084 | 3300025294 | Bacteria | 22602 |
| 631 | Ga0209025_1004730 | 3300025294 | Bacteria | 11596 |
| 632 | Ga0209025_1006776 | 3300025294 | Bacteria | 8785 |
| 633 | Ga0209025_1011727 | 3300025294 | Bacteria | 5724 |
| 634 | Ga0209025_1013516 | 3300025294 | Bacteria | 5123 |
| 635 | Ga0209025_1040081 | 3300025294 | Bacteria | 2032 |
| 636 | Ga0209025_1095901 | 3300025294 | Bacteria | 954 |
| 637 | Ga0209025_1095980 | 3300025294 | Bacteria | 954 |
| 638 | Ga0209564_1000313 | 3300025295 | Bacteria | 95224 |
| 639 | Ga0209564_1000823 | 3300025295 | Bacteria | 42196 |
| 640 | Ga0209564_1001505 | 3300025295 | Bacteria | 23368 |
| 641 | Ga0209564_1002447 | 3300025295 | Bacteria | 14665 |
| 642 | Ga0209564_1005212 | 3300025295 | Bacteria | 7521 |
| 643 | Ga0209758_1000510 | 3300025297 | Bacteria | 62591 |
| 644 | Ga0209758_1000679 | 3300025297 | Bacteria | 50729 |
| 645 | Ga0209758_1003918 | 3300025297 | Bacteria | 12990 |
| 646 | Ga0209758_1005216 | 3300025297 | Bacteria | 10191 |
| 647 | Ga0209758_1050082 | 3300025297 | Bacteria | 1468 |
| 648 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 649 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 650 | Ga0209050_1000786 | 3300025298 | Bacteria | 45131 |
| 651 | Ga0209050_1000952 | 3300025298 | Bacteria | 37637 |
| 652 | Ga0209050_1001577 | 3300025298 | Bacteria | 23647 |
| 653 | Ga0209050_1005629 | 3300025298 | Bacteria | 7769 |
| 654 | Ga0209050_1015985 | 3300025298 | Bacteria | 3103 |
| 655 | Ga0209050_1034091 | 3300025298 | Bacteria | 1531 |
| 656 | Ga0209256_1000096 | 3300025299 | Bacteria | 204629 |
| 657 | Ga0209256_1000151 | 3300025299 | Bacteria | 145299 |
| 658 | Ga0209256_1000256 | 3300025299 | Bacteria | 94699 |
| 659 | Ga0209256_1040804 | 3300025299 | Bacteria | 1183 |
| 660 | Ga0209256_1056004 | 3300025299 | Bacteria | 934 |
| 661 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 662 | Ga0207426_1000188 | 3300025302 | Bacteria | 153510 |
| 663 | Ga0207426_1000315 | 3300025302 | Bacteria | 94699 |
| 664 | Ga0207426_1001354 | 3300025302 | Bacteria | 20775 |
| 665 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 666 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 667 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 668 | Ga0209051_1000161 | 3300025303 | Bacteria | 125704 |
| 669 | Ga0209051_1000259 | 3300025303 | Bacteria | 88311 |
| 670 | Ga0209051_1000416 | 3300025303 | Bacteria | 58872 |
| 671 | Ga0209051_1084184 | 3300025303 | Bacteria | 906 |
| 672 | Ga0209051_1136246 | 3300025303 | Bacteria | 598 |
| 673 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 674 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 675 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 676 | Ga0209257_1002902 | 3300025304 | Bacteria | 15869 |
| 677 | Ga0209257_1004513 | 3300025304 | Bacteria | 10710 |
| 678 | Ga0209257_1022591 | 3300025304 | Bacteria | 2238 |
| 679 | Ga0207697_10046109 | 3300025315 | Bacteria | 1794 |
| 680 | Ga0207697_10070620 | 3300025315 | Bacteria | 1463 |
| 681 | Ga0207656_10020678 | 3300025321 | Bacteria | 2619 |
| 682 | Ga0207656_10027516 | 3300025321 | Bacteria | 2326 |
| 683 | Ga0207656_10103921 | 3300025321 | Bacteria | 1305 |
| 684 | Ga0207656_10234090 | 3300025321 | Bacteria | 896 |
| 685 | Ga0207656_10328922 | 3300025321 | Bacteria | 760 |
| 686 | Ga0207655_1015947 | 3300025728 | Bacteria | 4141 |
| 687 | Ga0207682_10032758 | 3300025893 | Bacteria | 2089 |
| 688 | Ga0207682_10044699 | 3300025893 | Bacteria | 1816 |
| 689 | Ga0207682_10247434 | 3300025893 | Bacteria | 829 |
| 690 | Ga0207642_10006015 | 3300025899 | Bacteria | 4005 |
| 691 | Ga0207642_10024373 | 3300025899 | Bacteria | 2432 |
| 692 | Ga0207688_10078411 | 3300025901 | Bacteria | 1883 |
| 693 | Ga0207688_10188104 | 3300025901 | Bacteria | 1234 |
| 694 | Ga0207688_10652489 | 3300025901 | Bacteria | 664 |
| 695 | Ga0207680_10028766 | 3300025903 | Bacteria | 3113 |
| 696 | Ga0207680_10191237 | 3300025903 | Bacteria | 1389 |
| 697 | Ga0207647_10357268 | 3300025904 | Bacteria | 827 |
| 698 | Ga0207645_10004614 | 3300025907 | Bacteria | 10153 |
| 699 | Ga0207645_10041857 | 3300025907 | Bacteria | 2931 |
| 700 | Ga0207645_10309051 | 3300025907 | Bacteria | 1053 |
| 701 | Ga0207643_10009830 | 3300025908 | Bacteria | 5138 |
| 702 | Ga0207643_10166620 | 3300025908 | Bacteria | 1328 |
| 703 | Ga0207643_10252977 | 3300025908 | Bacteria | 1086 |
| 704 | Ga0207705_10164082 | 3300025909 | Bacteria | 1670 |
| 705 | Ga0207684_10119778 | 3300025910 | Bacteria | 2256 |
| 706 | Ga0207654_10402338 | 3300025911 | Bacteria | 952 |
| 707 | Ga0207695_10130175 | 3300025913 | Bacteria | 2474 |
| 708 | Ga0207695_10145157 | 3300025913 | Bacteria | 2318 |
| 709 | Ga0207671_10075823 | 3300025914 | Bacteria | 2516 |
| 710 | Ga0207671_10219270 | 3300025914 | Bacteria | 1490 |
| 711 | Ga0207671_10494572 | 3300025914 | Bacteria | 975 |
| 712 | Ga0207660_10026081 | 3300025917 | Bacteria | 3976 |
| 713 | Ga0207662_10013391 | 3300025918 | Bacteria | 4587 |
| 714 | Ga0207662_10089116 | 3300025918 | Bacteria | 1895 |
| 715 | Ga0207657_10038426 | 3300025919 | Bacteria | 4261 |
| 716 | Ga0207657_10082664 | 3300025919 | Bacteria | 2696 |
| 717 | Ga0207657_10308033 | 3300025919 | Bacteria | 1254 |
| 718 | Ga0207657_10320421 | 3300025919 | Bacteria | 1226 |
| 719 | Ga0207649_10314732 | 3300025920 | Bacteria | 1148 |
| 720 | Ga0207649_10762319 | 3300025920 | Bacteria | 753 |
| 721 | Ga0207649_10792593 | 3300025920 | Bacteria | 739 |
| 722 | Ga0207652_10073735 | 3300025921 | Bacteria | 2970 |
| 723 | Ga0207646_10015873 | 3300025922 | Bacteria | 7087 |
| 724 | Ga0207681_10000826 | 3300025923 | Bacteria | 20436 |
| 725 | Ga0207681_10008765 | 3300025923 | Bacteria | 6178 |
| 726 | Ga0207681_10114005 | 3300025923 | Bacteria | 1971 |
| 727 | Ga0207681_10243304 | 3300025923 | Bacteria | 1401 |
| 728 | Ga0207694_10041437 | 3300025924 | Bacteria | 3548 |
| 729 | Ga0207694_10111689 | 3300025924 | Bacteria | 2175 |
| 730 | Ga0207694_10164283 | 3300025924 | Bacteria | 1795 |
| 731 | Ga0207694_10603891 | 3300025924 | Bacteria | 923 |
| 732 | Ga0207650_10120072 | 3300025925 | Bacteria | 2045 |
| 733 | Ga0207650_10204515 | 3300025925 | Bacteria | 1583 |
| 734 | Ga0207650_10224507 | 3300025925 | Bacteria | 1513 |
| 735 | Ga0207650_10315573 | 3300025925 | Bacteria | 1279 |
| 736 | Ga0207650_10512274 | 3300025925 | Bacteria | 1003 |
| 737 | Ga0207650_10576954 | 3300025925 | Bacteria | 944 |
| 738 | Ga0207659_10001869 | 3300025926 | Bacteria | 12468 |
| 739 | Ga0207659_10029827 | 3300025926 | Bacteria | 3721 |
| 740 | Ga0207659_10839328 | 3300025926 | Bacteria | 790 |
| 741 | Ga0207659_11273276 | 3300025926 | Bacteria | 631 |
| 742 | Ga0207687_10013703 | 3300025927 | Bacteria | 5293 |
| 743 | Ga0207687_10056676 | 3300025927 | Bacteria | 2749 |
| 744 | Ga0207687_10211834 | 3300025927 | Bacteria | 1521 |
| 745 | Ga0207687_10421403 | 3300025927 | Bacteria | 1102 |
| 746 | Ga0207644_10000223 | 3300025931 | Bacteria | 39200 |
| 747 | Ga0207644_10008993 | 3300025931 | Bacteria | 6545 |
| 748 | Ga0207644_10065196 | 3300025931 | Bacteria | 2648 |
| 749 | Ga0207644_10070563 | 3300025931 | Bacteria | 2554 |
| 750 | Ga0207644_10347830 | 3300025931 | Bacteria | 1203 |
| 751 | Ga0207644_10382331 | 3300025931 | Bacteria | 1148 |
| 752 | Ga0207644_10672504 | 3300025931 | Bacteria | 862 |
| 753 | Ga0207690_10032585 | 3300025932 | Bacteria | 3345 |
| 754 | Ga0207690_10456255 | 3300025932 | Bacteria | 1028 |
| 755 | Ga0207690_10664135 | 3300025932 | Bacteria | 855 |
| 756 | Ga0207706_10000736 | 3300025933 | Bacteria | 34115 |
| 757 | Ga0207706_10012885 | 3300025933 | Bacteria | 7611 |
| 758 | Ga0207706_10172590 | 3300025933 | Bacteria | 1900 |
| 759 | Ga0207706_10379576 | 3300025933 | Bacteria | 1227 |
| 760 | Ga0207706_10573407 | 3300025933 | Bacteria | 970 |
| 761 | Ga0207706_10720062 | 3300025933 | Bacteria | 852 |
| 762 | Ga0207706_10830020 | 3300025933 | Bacteria | 784 |
| 763 | Ga0207706_10850399 | 3300025933 | Bacteria | 773 |
| 764 | Ga0207686_10030421 | 3300025934 | Bacteria | 3196 |
| 765 | Ga0207686_10088915 | 3300025934 | Bacteria | 2034 |
| 766 | Ga0207686_10476777 | 3300025934 | Bacteria | 964 |
| 767 | Ga0207709_10000771 | 3300025935 | Bacteria | 25177 |
| 768 | Ga0207709_10001444 | 3300025935 | Bacteria | 16592 |
| 769 | Ga0207709_10011940 | 3300025935 | Bacteria | 4789 |
| 770 | Ga0207709_10012398 | 3300025935 | Bacteria | 4698 |
| 771 | Ga0207709_10039692 | 3300025935 | Bacteria | 2813 |
| 772 | Ga0207709_10076505 | 3300025935 | Bacteria | 2143 |
| 773 | Ga0207709_10157185 | 3300025935 | Bacteria | 1582 |
| 774 | Ga0207709_10616933 | 3300025935 | Bacteria | 860 |
| 775 | Ga0207709_10650558 | 3300025935 | Bacteria | 839 |
| 776 | Ga0207669_10002159 | 3300025937 | Bacteria | 8340 |
| 777 | Ga0207669_10636871 | 3300025937 | Bacteria | 870 |
| 778 | Ga0207669_11385823 | 3300025937 | Bacteria | 598 |
| 779 | Ga0207704_10002371 | 3300025938 | Bacteria | 8463 |
| 780 | Ga0207704_10205529 | 3300025938 | Bacteria | 1445 |
| 781 | Ga0207704_10221663 | 3300025938 | Bacteria | 1400 |
| 782 | Ga0207704_10262680 | 3300025938 | Bacteria | 1303 |
| 783 | Ga0207704_10376209 | 3300025938 | Bacteria | 1113 |
| 784 | Ga0207704_10404880 | 3300025938 | Bacteria | 1078 |
| 785 | Ga0207665_10140128 | 3300025939 | Bacteria | 1724 |
| 786 | Ga0207691_10002576 | 3300025940 | Bacteria | 17721 |
| 787 | Ga0207691_10023739 | 3300025940 | Bacteria | 5773 |
| 788 | Ga0207691_10075275 | 3300025940 | Bacteria | 3044 |
| 789 | Ga0207691_10081432 | 3300025940 | Bacteria | 2910 |
| 790 | Ga0207691_10087282 | 3300025940 | Bacteria | 2799 |
| 791 | Ga0207691_10153924 | 3300025940 | Bacteria | 2020 |
| 792 | Ga0207691_10337776 | 3300025940 | Bacteria | 1290 |
| 793 | Ga0207691_10363434 | 3300025940 | Bacteria | 1237 |
| 794 | Ga0207711_10002181 | 3300025941 | Bacteria | 17610 |
| 795 | Ga0207711_10008423 | 3300025941 | Bacteria | 8624 |
| 796 | Ga0207711_10093737 | 3300025941 | Bacteria | 2645 |
| 797 | Ga0207711_10205036 | 3300025941 | Bacteria | 1800 |
| 798 | Ga0207711_10501111 | 3300025941 | Bacteria | 1132 |
| 799 | Ga0207711_10666528 | 3300025941 | Bacteria | 970 |
| 800 | Ga0207689_10000259 | 3300025942 | Bacteria | 47474 |
| 801 | Ga0207689_10006174 | 3300025942 | Bacteria | 10604 |
| 802 | Ga0207689_10018504 | 3300025942 | Bacteria | 5877 |
| 803 | Ga0207689_10120756 | 3300025942 | Bacteria | 2156 |
| 804 | Ga0207689_10180386 | 3300025942 | Bacteria | 1741 |
| 805 | Ga0207689_10202186 | 3300025942 | Bacteria | 1640 |
| 806 | Ga0207689_10202319 | 3300025942 | Bacteria | 1639 |
| 807 | Ga0207689_10269083 | 3300025942 | Bacteria | 1411 |
| 808 | Ga0207689_10644972 | 3300025942 | Bacteria | 892 |
| 809 | Ga0207689_10983709 | 3300025942 | Bacteria | 712 |
| 810 | Ga0207661_10025802 | 3300025944 | Bacteria | 4471 |
| 811 | Ga0207661_10151431 | 3300025944 | Bacteria | 2005 |
| 812 | Ga0207679_10044865 | 3300025945 | Bacteria | 3193 |
| 813 | Ga0207679_10134308 | 3300025945 | Bacteria | 1990 |
| 814 | Ga0207679_10212816 | 3300025945 | Bacteria | 1622 |
| 815 | Ga0207679_10548238 | 3300025945 | Bacteria | 1037 |
| 816 | Ga0207679_11094158 | 3300025945 | Bacteria | 731 |
| 817 | Ga0207667_10110625 | 3300025949 | Bacteria | 2834 |
| 818 | Ga0207651_10005547 | 3300025960 | Bacteria | 6494 |
| 819 | Ga0207651_10100796 | 3300025960 | Bacteria | 2141 |
| 820 | Ga0207651_10128082 | 3300025960 | Bacteria | 1938 |
| 821 | Ga0207651_10140033 | 3300025960 | Bacteria | 1867 |
| 822 | Ga0207651_10184316 | 3300025960 | Bacteria | 1659 |
| 823 | Ga0207651_10317868 | 3300025960 | Bacteria | 1300 |
| 824 | Ga0207651_10330439 | 3300025960 | Bacteria | 1277 |
| 825 | Ga0207651_10656942 | 3300025960 | Bacteria | 921 |
| 826 | Ga0207651_11063547 | 3300025960 | Bacteria | 724 |
| 827 | Ga0207712_10013171 | 3300025961 | Bacteria | 5301 |
| 828 | Ga0207712_10375071 | 3300025961 | Bacteria | 1189 |
| 829 | Ga0207712_10391396 | 3300025961 | Bacteria | 1166 |
| 830 | Ga0207668_10030116 | 3300025972 | Bacteria | 3563 |
| 831 | Ga0207668_10524630 | 3300025972 | Bacteria | 1022 |
| 832 | Ga0207640_10072192 | 3300025981 | Bacteria | 2327 |
| 833 | Ga0207640_11067399 | 3300025981 | Bacteria | 713 |
| 834 | Ga0207658_10002825 | 3300025986 | Bacteria | 12451 |
| 835 | Ga0207658_10005834 | 3300025986 | Bacteria | 8423 |
| 836 | Ga0207658_10013147 | 3300025986 | Bacteria | 5654 |
| 837 | Ga0207658_10411655 | 3300025986 | Bacteria | 1190 |
| 838 | Ga0207658_10742933 | 3300025986 | Bacteria | 888 |
| 839 | Ga0207658_10804600 | 3300025986 | Bacteria | 853 |
| 840 | Ga0207658_11137489 | 3300025986 | Bacteria | 713 |
| 841 | Ga0207658_11537809 | 3300025986 | Bacteria | 608 |
| 842 | Ga0207677_10001179 | 3300026023 | Bacteria | 14211 |
| 843 | Ga0207677_10001436 | 3300026023 | Bacteria | 12666 |
| 844 | Ga0207677_10015394 | 3300026023 | Bacteria | 4498 |
| 845 | Ga0207677_10040367 | 3300026023 | Bacteria | 3076 |
| 846 | Ga0207677_10117791 | 3300026023 | Bacteria | 1991 |
| 847 | Ga0207677_10260398 | 3300026023 | Bacteria | 1414 |
| 848 | Ga0207677_10426178 | 3300026023 | Bacteria | 1131 |
| 849 | Ga0207703_10000408 | 3300026035 | Bacteria | 45772 |
| 850 | Ga0207703_10018563 | 3300026035 | Bacteria | 5430 |
| 851 | Ga0207703_10036310 | 3300026035 | Bacteria | 3922 |
| 852 | Ga0207703_10037004 | 3300026035 | Bacteria | 3887 |
| 853 | Ga0207703_11561808 | 3300026035 | Bacteria | 635 |
| 854 | Ga0207639_10043276 | 3300026041 | Bacteria | 3380 |
| 855 | Ga0207639_10278290 | 3300026041 | Bacteria | 1471 |
| 856 | Ga0207639_10811434 | 3300026041 | Bacteria | 872 |
| 857 | Ga0207639_11560680 | 3300026041 | Bacteria | 619 |
| 858 | Ga0207678_10005998 | 3300026067 | Bacteria | 10813 |
| 859 | Ga0207678_10049813 | 3300026067 | Bacteria | 3620 |
| 860 | Ga0207678_10171827 | 3300026067 | Bacteria | 1850 |
| 861 | Ga0207678_10641644 | 3300026067 | Bacteria | 932 |
| 862 | Ga0207702_10037491 | 3300026078 | Bacteria | 4058 |
| 863 | Ga0207702_10248514 | 3300026078 | Bacteria | 1669 |
| 864 | Ga0207702_10979134 | 3300026078 | Bacteria | 839 |
| 865 | Ga0207702_11659806 | 3300026078 | Bacteria | 632 |
| 866 | Ga0207641_10002065 | 3300026088 | Bacteria | 19074 |
| 867 | Ga0207641_10004421 | 3300026088 | Bacteria | 12179 |
| 868 | Ga0207641_10037985 | 3300026088 | Bacteria | 4024 |
| 869 | Ga0207641_10135068 | 3300026088 | Bacteria | 2220 |
| 870 | Ga0207641_10136517 | 3300026088 | Bacteria | 2208 |
| 871 | Ga0207641_10188888 | 3300026088 | Bacteria | 1892 |
| 872 | Ga0207648_10000686 | 3300026089 | Bacteria | 37954 |
| 873 | Ga0207648_10012681 | 3300026089 | Bacteria | 7879 |
| 874 | Ga0207648_10017873 | 3300026089 | Bacteria | 6435 |
| 875 | Ga0207648_10019036 | 3300026089 | Bacteria | 6200 |
| 876 | Ga0207648_10044650 | 3300026089 | Bacteria | 3888 |
| 877 | Ga0207648_10292659 | 3300026089 | Bacteria | 1458 |
| 878 | Ga0207648_10322549 | 3300026089 | Bacteria | 1388 |
| 879 | Ga0207648_10400077 | 3300026089 | Bacteria | 1244 |
| 880 | Ga0207648_10516637 | 3300026089 | Bacteria | 1094 |
| 881 | Ga0207648_10522031 | 3300026089 | Bacteria | 1088 |
| 882 | Ga0207648_11580882 | 3300026089 | Bacteria | 616 |
| 883 | Ga0207676_10000269 | 3300026095 | Bacteria | 45280 |
| 884 | Ga0207676_10054658 | 3300026095 | Bacteria | 3130 |
| 885 | Ga0207676_10065398 | 3300026095 | Bacteria | 2895 |
| 886 | Ga0207676_10161348 | 3300026095 | Bacteria | 1942 |
| 887 | Ga0207676_11046571 | 3300026095 | Bacteria | 805 |
| 888 | Ga0207676_11577421 | 3300026095 | Bacteria | 654 |
| 889 | Ga0207674_10016515 | 3300026116 | Bacteria | 8077 |
| 890 | Ga0207674_10029563 | 3300026116 | Bacteria | 5769 |
| 891 | Ga0207674_10038674 | 3300026116 | Bacteria | 4948 |
| 892 | Ga0207674_10139045 | 3300026116 | Bacteria | 2389 |
| 893 | Ga0207674_10411475 | 3300026116 | Bacteria | 1307 |
| 894 | Ga0207674_10604400 | 3300026116 | Bacteria | 1059 |
| 895 | Ga0207674_10921920 | 3300026116 | Bacteria | 842 |
| 896 | Ga0207674_11470051 | 3300026116 | Bacteria | 651 |
| 897 | Ga0207675_100000307 | 3300026118 | Bacteria | 46857 |
| 898 | Ga0207675_100001416 | 3300026118 | Bacteria | 24021 |
| 899 | Ga0207675_100076361 | 3300026118 | Bacteria | 3137 |
| 900 | Ga0207675_100466401 | 3300026118 | Bacteria | 1253 |
| 901 | Ga0207683_10001051 | 3300026121 | Bacteria | 25171 |
| 902 | Ga0207683_10066755 | 3300026121 | Bacteria | 3173 |
| 903 | Ga0207683_10237209 | 3300026121 | Bacteria | 1663 |
| 904 | Ga0207683_10385382 | 3300026121 | Bacteria | 1289 |
| 905 | Ga0207683_10416789 | 3300026121 | Bacteria | 1237 |
| 906 | Ga0207683_10564333 | 3300026121 | Bacteria | 1053 |
| 907 | Ga0207683_10569559 | 3300026121 | Bacteria | 1048 |
| 908 | Ga0207683_11007022 | 3300026121 | Bacteria | 773 |
| 909 | Ga0207683_11075958 | 3300026121 | Bacteria | 746 |
| 910 | Ga0207698_10037962 | 3300026142 | Bacteria | 3553 |
| 911 | Ga0207698_10090847 | 3300026142 | Bacteria | 2498 |
| 912 | Ga0207698_10104934 | 3300026142 | Bacteria | 2353 |
| 913 | Ga0207698_10109147 | 3300026142 | Bacteria | 2315 |
| 914 | Ga0207698_10196658 | 3300026142 | Bacteria | 1802 |
| 915 | Ga0207698_10210647 | 3300026142 | Bacteria | 1748 |
| 916 | Ga0207698_10337349 | 3300026142 | Bacteria | 1418 |
| 917 | Ga0207698_10402939 | 3300026142 | Bacteria | 1308 |
| 918 | Ga0207698_10411559 | 3300026142 | Bacteria | 1295 |
| 919 | Ga0207698_10421196 | 3300026142 | Bacteria | 1281 |
| 920 | Ga0207698_10425227 | 3300026142 | Bacteria | 1276 |
| 921 | Ga0207698_10549355 | 3300026142 | Bacteria | 1132 |
| 922 | Ga0207698_10899207 | 3300026142 | Bacteria | 892 |
| 923 | Ga0207698_11212884 | 3300026142 | Bacteria | 769 |
| 924 | Ga0207698_11341165 | 3300026142 | Bacteria | 730 |
| 925 | Ga0209996_1001867 | 3300027395 | Bacteria | 2584 |
| 926 | Ga0209968_1000702 | 3300027526 | Bacteria | 5159 |
| 927 | Ga0209282_1011860 | 3300027666 | Bacteria | 5539 |
| 928 | Ga0209966_1000040 | 3300027695 | Bacteria | 54404 |
| 929 | Ga0209998_10021105 | 3300027717 | Bacteria | 1397 |
| 930 | Ga0209813_10023158 | 3300027866 | Bacteria | 1764 |
| 931 | Ga0209813_10222054 | 3300027866 | Bacteria | 708 |
| 932 | Ga0209974_10006173 | 3300027876 | Bacteria | 4198 |
| 933 | Ga0207428_10578269 | 3300027907 | Bacteria | 811 |
| 934 | Ga0268266_10010170 | 3300028379 | Bacteria | 8244 |
| 935 | Ga0268266_10061450 | 3300028379 | Bacteria | 3240 |
| 936 | Ga0268266_10317098 | 3300028379 | Bacteria | 1458 |
| 937 | Ga0268266_10455050 | 3300028379 | Bacteria | 1217 |
| 938 | Ga0268266_10817657 | 3300028379 | Bacteria | 900 |
| 939 | Ga0268265_10087552 | 3300028380 | Bacteria | 2478 |
| 940 | Ga0268265_10179219 | 3300028380 | Bacteria | 1819 |
| 941 | Ga0268265_10260150 | 3300028380 | Bacteria | 1542 |
| 942 | Ga0268265_10260891 | 3300028380 | Bacteria | 1540 |
| 943 | Ga0268265_10268500 | 3300028380 | Bacteria | 1520 |
| 944 | Ga0268265_11578579 | 3300028380 | Bacteria | 661 |
| 945 | Ga0268264_10004973 | 3300028381 | Bacteria | 11260 |
| 946 | Ga0268264_10019709 | 3300028381 | Bacteria | 5510 |
| 947 | Ga0268264_10077625 | 3300028381 | Bacteria | 2830 |
| 948 | Ga0268264_10180300 | 3300028381 | Bacteria | 1917 |
| 949 | Ga0268264_10269302 | 3300028381 | Bacteria | 1591 |
| 950 | Ga0268264_10275052 | 3300028381 | Bacteria | 1575 |
| 951 | Ga0268264_10825647 | 3300028381 | Bacteria | 927 |
| 952 | Ga0307517_10000160 | 3300028786 | Bacteria | 108370 |
| 953 | Ga0307517_10000395 | 3300028786 | Bacteria | 74663 |
| 954 | Ga0307517_10074719 | 3300028786 | Bacteria | 2985 |
| 955 | Ga0307517_10179818 | 3300028786 | Bacteria | 1368 |
| 956 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 957 | Ga0307515_10000160 | 3300028794 | Bacteria | 164789 |
| 958 | Ga0307515_10000332 | 3300028794 | Bacteria | 116126 |
| 959 | Ga0307515_10000893 | 3300028794 | Bacteria | 68669 |
| 960 | Ga0307515_10001283 | 3300028794 | Bacteria | 57022 |
| 961 | Ga0307515_10007639 | 3300028794 | Bacteria | 21327 |
| 962 | Ga0307515_10012223 | 3300028794 | Bacteria | 16171 |
| 963 | Ga0307515_10022830 | 3300028794 | Bacteria | 11008 |
| 964 | Ga0307515_10033807 | 3300028794 | Bacteria | 8403 |
| 965 | Ga0307515_10060601 | 3300028794 | Bacteria | 5392 |
| 966 | Ga0307515_10080735 | 3300028794 | Bacteria | 4235 |
| 967 | Ga0307515_10147322 | 3300028794 | Bacteria | 2485 |
| 968 | Ga0307515_10179656 | 3300028794 | Bacteria | 2072 |
| 969 | Ga0307515_10206740 | 3300028794 | Bacteria | 1820 |
| 970 | Ga0307515_10223497 | 3300028794 | Bacteria | 1694 |
| 971 | Ga0307515_10281623 | 3300028794 | Bacteria | 1369 |
| 972 | Ga0307515_10364123 | 3300028794 | Bacteria | 1085 |
| 973 | Ga0307515_10635715 | 3300028794 | Bacteria | 679 |
| 974 | Ga0307511_10013142 | 3300030521 | Bacteria | 8095 |
| 975 | Ga0307512_10041345 | 3300030522 | Bacteria | 3833 |
| 976 | Ga0307512_10102024 | 3300030522 | Bacteria | 1938 |
| 977 | Ga0307512_10139063 | 3300030522 | Bacteria | 1492 |
| 978 | Ga0307512_10289617 | 3300030522 | Bacteria | 774 |
| 979 | Ga0316177_1091352 | 3300030731 | Bacteria | 2470 |
| 980 | Ga0316176_1071075 | 3300030732 | Bacteria | 1595 |
| 981 | Ga0314311_1059274 | 3300030733 | Bacteria | 9245 |
| 982 | Ga0316179_1119471 | 3300030734 | Bacteria | 2059 |
| 983 | Ga0316178_1094522 | 3300030735 | Bacteria | 3317 |
| 984 | Ga0316180_1037515 | 3300030736 | Bacteria | 1162 |
| 985 | Ga0316183_1042467 | 3300030742 | Bacteria | 3746 |
| 986 | Ga0316181_1174890 | 3300030744 | Bacteria | 3015 |
| 987 | Ga0316182_1176401 | 3300030745 | Bacteria | 2996 |
| 988 | Ga0316182_1440727 | 3300030745 | Bacteria | 2006 |
| 989 | Ga0265327_10002595 | 3300031251 | Bacteria | 18697 |
| 990 | Ga0307513_10003528 | 3300031456 | Bacteria | 21162 |
| 991 | Ga0307513_10020560 | 3300031456 | Bacteria | 7826 |
| 992 | Ga0307513_10037147 | 3300031456 | Bacteria | 5423 |
| 993 | Ga0307513_10097939 | 3300031456 | Bacteria | 2966 |
| 994 | Ga0307513_10215434 | 3300031456 | Bacteria | 1747 |
| 995 | Ga0307513_11091140 | 3300031456 | Bacteria | 510 |
| 996 | Ga0307509_10000212 | 3300031507 | Bacteria | 92922 |
| 997 | Ga0307509_10000317 | 3300031507 | Bacteria | 79032 |
| 998 | Ga0307509_10001515 | 3300031507 | Bacteria | 39177 |
| 999 | Ga0307509_10002052 | 3300031507 | Bacteria | 33147 |
| 1000 | Ga0307509_10057914 | 3300031507 | Bacteria | 4105 |
| 1001 | Ga0307509_10117990 | 3300031507 | Bacteria | 2638 |
| 1002 | Ga0307509_10161551 | 3300031507 | Bacteria | 2136 |
| 1003 | Ga0307509_10250752 | 3300031507 | Bacteria | 1554 |
| 1004 | Ga0307509_10478928 | 3300031507 | Bacteria | 933 |
| 1005 | Ga0307509_10529824 | 3300031507 | Bacteria | 858 |
| 1006 | Ga0307408_100026572 | 3300031548 | Bacteria | 3979 |
| 1007 | Ga0307408_100073052 | 3300031548 | Bacteria | 2540 |
| 1008 | Ga0307408_100113754 | 3300031548 | Bacteria | 2083 |
| 1009 | Ga0307408_100199041 | 3300031548 | Bacteria | 1620 |
| 1010 | Ga0307408_100225286 | 3300031548 | Bacteria | 1532 |
| 1011 | Ga0307408_100323704 | 3300031548 | Bacteria | 1299 |
| 1012 | Ga0307408_100912915 | 3300031548 | Bacteria | 804 |
| 1013 | Ga0307508_10000097 | 3300031616 | Bacteria | 103662 |
| 1014 | Ga0307508_10000332 | 3300031616 | Bacteria | 57039 |
| 1015 | Ga0307508_10001697 | 3300031616 | Bacteria | 24440 |
| 1016 | Ga0307508_10005499 | 3300031616 | Bacteria | 12042 |
| 1017 | Ga0307508_10006375 | 3300031616 | Bacteria | 11096 |
| 1018 | Ga0307508_10118737 | 3300031616 | Bacteria | 2246 |
| 1019 | Ga0307508_10191308 | 3300031616 | Bacteria | 1647 |
| 1020 | Ga0307508_10394920 | 3300031616 | Bacteria | 974 |
| 1021 | Ga0307514_10000795 | 3300031649 | Bacteria | 52015 |
| 1022 | Ga0307514_10003838 | 3300031649 | Bacteria | 14140 |
| 1023 | Ga0307514_10005414 | 3300031649 | Bacteria | 11411 |
| 1024 | Ga0307514_10026427 | 3300031649 | Bacteria | 4694 |
| 1025 | Ga0307514_10066783 | 3300031649 | Bacteria | 2718 |
| 1026 | Ga0307514_10176693 | 3300031649 | Bacteria | 1384 |
| 1027 | Ga0307516_10006132 | 3300031730 | Bacteria | 14171 |
| 1028 | Ga0307516_10126756 | 3300031730 | Bacteria | 2337 |
| 1029 | Ga0307516_10166406 | 3300031730 | Bacteria | 1949 |
| 1030 | Ga0307516_10269308 | 3300031730 | Bacteria | 1390 |
| 1031 | Ga0307516_10307928 | 3300031730 | Bacteria | 1258 |
| 1032 | Ga0307516_10513847 | 3300031730 | Bacteria | 852 |
| 1033 | Ga0307405_10008706 | 3300031731 | Bacteria | 5157 |
| 1034 | Ga0307405_10044351 | 3300031731 | Bacteria | 2719 |
| 1035 | Ga0307405_10199037 | 3300031731 | Bacteria | 1453 |
| 1036 | Ga0307405_10510250 | 3300031731 | Bacteria | 965 |
| 1037 | Ga0307405_10542540 | 3300031731 | Bacteria | 939 |
| 1038 | Ga0307405_10948442 | 3300031731 | Bacteria | 731 |
| 1039 | Ga0307405_11726206 | 3300031731 | Bacteria | 555 |
| 1040 | Ga0307413_10709507 | 3300031824 | Bacteria | 836 |
| 1041 | Ga0307413_10984130 | 3300031824 | Bacteria | 722 |
| 1042 | Ga0307410_10450209 | 3300031852 | Bacteria | 1050 |
| 1043 | Ga0307410_10678872 | 3300031852 | Bacteria | 866 |
| 1044 | Ga0307406_10067497 | 3300031901 | Bacteria | 2332 |
| 1045 | Ga0307406_10083841 | 3300031901 | Bacteria | 2126 |
| 1046 | Ga0307406_10717461 | 3300031901 | Bacteria | 836 |
| 1047 | Ga0307406_11592248 | 3300031901 | Bacteria | 577 |
| 1048 | Ga0307412_10017936 | 3300031911 | Bacteria | 4245 |
| 1049 | Ga0307412_10032642 | 3300031911 | Bacteria | 3302 |
| 1050 | Ga0307412_10096348 | 3300031911 | Bacteria | 2082 |
| 1051 | Ga0307412_10203425 | 3300031911 | Bacteria | 1505 |
| 1052 | Ga0307412_10309707 | 3300031911 | Bacteria | 1251 |
| 1053 | Ga0307412_10625997 | 3300031911 | Bacteria | 915 |
| 1054 | Ga0307412_11142263 | 3300031911 | Bacteria | 695 |
| 1055 | Ga0307409_100005809 | 3300031995 | Bacteria | 7159 |
| 1056 | Ga0307409_101227328 | 3300031995 | Bacteria | 774 |
| 1057 | Ga0307416_100001574 | 3300032002 | Bacteria | 12514 |
| 1058 | Ga0307416_100216574 | 3300032002 | Bacteria | 1832 |
| 1059 | Ga0307416_100360975 | 3300032002 | Bacteria | 1475 |
| 1060 | Ga0307416_100420709 | 3300032002 | Bacteria | 1380 |
| 1061 | Ga0307416_100891181 | 3300032002 | Bacteria | 989 |
| 1062 | Ga0307414_10142492 | 3300032004 | Bacteria | 1878 |
| 1063 | Ga0307414_10173251 | 3300032004 | Bacteria | 1727 |
| 1064 | Ga0307414_11522563 | 3300032004 | Bacteria | 623 |
| 1065 | Ga0307411_10013253 | 3300032005 | Bacteria | 4540 |
| 1066 | Ga0307411_10132222 | 3300032005 | Bacteria | 1826 |
| 1067 | Ga0307411_10780284 | 3300032005 | Bacteria | 840 |
| 1068 | Ga0307415_100007021 | 3300032126 | Bacteria | 6125 |
| 1069 | Ga0307507_10269557 | 3300033179 | Bacteria | 1077 |
| 1070 | Ga0307507_10369216 | 3300033179 | Bacteria | 833 |
| 1071 | Ga0307510_10129347 | 3300033180 | Bacteria | 2204 |
| 1072 | Ga0307510_10262467 | 3300033180 | Bacteria | 1208 |
| 1073 | Ga0307510_10395991 | 3300033180 | Bacteria | 824 |
| 1074 | Ga0307510_10538721 | 3300033180 | Bacteria | 613 |
| 1075 | Ga0373930_0047804 | 3300034816 | Bacteria | 927 |
| 1076 | Ga0373948_0053027 | 3300034817 | Bacteria | 875 |
| 1077 | Ga0373938_0083037 | 3300034957 | Bacteria | 783 |
| 1078 | Ga0373926_0317095 | 3300035083 | Bacteria | 610 |
| 1079 | Ga0373929_0004656 | 3300035085 | Bacteria | 2460 |
| 1080 | Ga0373940_0078320 | 3300035088 | Bacteria | 973 |
| 1081 | Ga0373944_0026045 | 3300035089 | Bacteria | 1725 |
| 1082 | Ga0373923_0056861 | 3300035111 | Bacteria | 1653 |
| 1083 | Ga0373923_0151710 | 3300035111 | Bacteria | 1053 |
| 1084 | Ga0373932_0020198 | 3300035112 | Bacteria | 1744 |
| 1085 | Ga0373932_0059406 | 3300035112 | Bacteria | 1158 |
| 1086 | Ga0373936_0001484 | 3300035113 | Bacteria | 8523 |
| 1087 | Ga0373936_0270213 | 3300035113 | Bacteria | 763 |
| 1088 | Ga0373941_0021775 | 3300035115 | Bacteria | 1813 |
| 1089 | Ga0373956_0089353 | 3300035119 | Bacteria | 1420 |
| 1090 | Ga0373943_0008038 | 3300035170 | Bacteria | 4732 |
| 1091 | Ga0373943_0082489 | 3300035170 | Bacteria | 1651 |
| 1092 | Ga0373946_0124206 | 3300035171 | Bacteria | 1181 |
| 1093 | Ga0373962_0098964 | 3300035242 | Bacteria | 907 |
| 1094 | Ga0373924_0001472 | 3300035410 | Bacteria | 7658 |
| 1095 | Ga0373931_0010336 | 3300035691 | Bacteria | 4485 |
| 1096 | Ga0373935_0166599 | 3300035692 | Bacteria | 1505 |
| 1097 | Ga0373935_0418713 | 3300035692 | Bacteria | 964 |
| 1098 | Ga0373935_0585758 | 3300035692 | Bacteria | 815 |
| 1099 | Ga0373927_0032371 | 3300035695 | Bacteria | 3406 |
| 1100 | Ga0373947_0162803 | 3300035725 | Bacteria | 1444 |
| 1101 | Ga0373947_0732890 | 3300035725 | Bacteria | 674 |
| 1102 | Ga0373937_0171129 | 3300036401 | Bacteria | 2038 |
| 1103 | Ga0373937_0539793 | 3300036401 | Bacteria | 1108 |
| 1104 | Ga0373925_0125496 | 3300037068 | Bacteria | 1996 |
| 1105 | Ga0395899_0000970 | 3300037312 | Bacteria | 26551 |
| 1106 | Ga0395899_0001451 | 3300037312 | Bacteria | 20221 |
| 1107 | Ga0395899_0003277 | 3300037312 | Bacteria | 12837 |
| 1108 | Ga0395899_0115511 | 3300037312 | Bacteria | 1926 |
| 1109 | Ga0395900_0000091 | 3300037418 | Bacteria | 167089 |
| 1110 | Ga0395900_0000602 | 3300037418 | Bacteria | 49161 |
| 1111 | Ga0395900_0006947 | 3300037418 | Bacteria | 11742 |
| 1112 | Ga0395900_0012073 | 3300037418 | Bacteria | 8826 |
| 1113 | Ga0395900_0109955 | 3300037418 | Bacteria | 2831 |
| 1114 | Ga0395900_0313416 | 3300037418 | Bacteria | 1551 |
| 1115 | Ga0395898_0008585 | 3300037466 | Bacteria | 10782 |
| 1116 | Ga0395898_0304421 | 3300037466 | Bacteria | 1520 |
| 1117 | Ga0395898_0310389 | 3300037466 | Bacteria | 1504 |
| 1118 | Ga0395898_0708158 | 3300037466 | Bacteria | 949 |
| 1119 | Ga0395905_0000269 | 3300037471 | Bacteria | 77631 |
| 1120 | Ga0395905_0003396 | 3300037471 | Bacteria | 17047 |
| 1121 | Ga0395905_0008793 | 3300037471 | Bacteria | 9926 |
| 1122 | Ga0395905_0011217 | 3300037471 | Bacteria | 8664 |
| 1123 | Ga0395905_0018561 | 3300037471 | Bacteria | 6600 |
| 1124 | Ga0395905_0115052 | 3300037471 | Bacteria | 2527 |
| 1125 | Ga0395905_0136166 | 3300037471 | Bacteria | 2310 |
| 1126 | Ga0395905_0137658 | 3300037471 | Bacteria | 2297 |
| 1127 | Ga0395905_0237491 | 3300037471 | Bacteria | 1703 |
| 1128 | Ga0395905_0243446 | 3300037471 | Bacteria | 1680 |
| 1129 | Ga0395905_0603517 | 3300037471 | Bacteria | 999 |
| 1130 | Ga0395901_0010721 | 3300038443 | Bacteria | 9292 |
| 1131 | Ga0395901_0085465 | 3300038443 | Bacteria | 3298 |
| 1132 | Ga0395901_0137392 | 3300038443 | Bacteria | 2568 |
| 1133 | Ga0395901_0646484 | 3300038443 | Bacteria | 1061 |
| 1134 | Ga0395901_1085880 | 3300038443 | Bacteria | 771 |
| 1135 | Ga0436365_1128978 | 3300039437 | Bacteria | 2310 |
| 1136 | Ga0436363_1660049 | 3300039450 | Bacteria | 3141 |
| 1137 | Ga0439436_0052251 | 3300041404 | Bacteria | 1153 |
| 1138 | Ga0439439_0039272 | 3300041406 | Bacteria | 1223 |
| 1139 | Ga0439439_0047623 | 3300041406 | Bacteria | 1120 |
| 1140 | Ga0439439_0109082 | 3300041406 | Bacteria | 766 |
| 1141 | Ga0439447_025014 | 3300041407 | Bacteria | 1541 |
| 1142 | Ga0439465_0248345 | 3300041413 | Bacteria | 658 |
| 1143 | Ga0451791_0516807 | 3300041451 | Bacteria | 696 |
| 1144 | Ga0451791_1822013 | 3300041451 | Bacteria | 598 |
| 1145 | Ga0451793_0849783 | 3300041452 | Bacteria | 678 |
| 1146 | Ga0451797_0036350 | 3300041453 | Bacteria | 1330 |
| 1147 | Ga0451795_1156050 | 3300041456 | Bacteria | 964 |
| 1148 | Ga0451798_0365603 | 3300041458 | Bacteria | 1186 |
| 1149 | Ga0451798_0783119 | 3300041458 | Bacteria | 665 |
| 1150 | Ga0451798_1050572 | 3300041458 | Bacteria | 596 |
| 1151 | Ga0451798_1073454 | 3300041458 | Bacteria | 536 |
| 1152 | Ga0451800_0507924 | 3300041459 | Bacteria | 1457 |
| 1153 | Ga0451800_1125983 | 3300041459 | Bacteria | 544 |
| 1154 | Ga0451807_0531094 | 3300041486 | Bacteria | 1124 |
| 1155 | Ga0451807_0955082 | 3300041486 | Bacteria | 553 |
| 1156 | Ga0451833_1039235 | 3300041491 | Bacteria | 709 |
| 1157 | Ga0451839_0995859 | 3300041496 | Bacteria | 703 |
| 1158 | Ga0451845_0395844 | 3300041501 | Bacteria | 626 |
| 1159 | Ga0451847_0890968 | 3300041503 | Bacteria | 561 |
| 1160 | Ga0451849_0455082 | 3300041505 | Bacteria | 1100 |
| 1161 | Ga0451849_0763045 | 3300041505 | Bacteria | 597 |
| 1162 | Ga0451855_0676908 | 3300041511 | Bacteria | 544 |
| 1163 | Ga0451853_0929926 | 3300041512 | Bacteria | 1910 |
| 1164 | Ga0451853_2031670 | 3300041512 | Bacteria | 1033 |
| 1165 | Ga0451853_2256767 | 3300041512 | Bacteria | 663 |
| 1166 | Ga0451853_2771872 | 3300041512 | Bacteria | 1332 |
| 1167 | Ga0439433_0013375 | 3300041999 | Bacteria | 1802 |
| 1168 | Ga0439433_0019350 | 3300041999 | Bacteria | 1517 |
| 1169 | Ga0439442_009722 | 3300042002 | Bacteria | 1945 |
| 1170 | Ga0439445_0055849 | 3300042004 | Bacteria | 1073 |
| 1171 | Ga0439432_075318 | 3300042006 | Bacteria | 1025 |
| 1172 | Ga0439432_200791 | 3300042006 | Bacteria | 578 |
| 1173 | Ga0439449_0001455 | 3300042007 | Bacteria | 9260 |
| 1174 | Ga0439449_0012086 | 3300042007 | Bacteria | 3245 |
| 1175 | Ga0439452_031211 | 3300042010 | Bacteria | 1308 |
| 1176 | Ga0439455_0003947 | 3300042012 | Bacteria | 2893 |
| 1177 | Ga0439457_067024 | 3300042014 | Bacteria | 816 |
| 1178 | Ga0439462_0007888 | 3300042015 | Bacteria | 2673 |
| 1179 | Ga0439462_0010211 | 3300042015 | Bacteria | 2378 |
| 1180 | Ga0450921_001983 | 3300042123 | Bacteria | 1313 |
| 1181 | Ga0450923_003206 | 3300042125 | Bacteria | 2442 |
| 1182 | Ga0450923_020511 | 3300042125 | Bacteria | 1281 |
| 1183 | Ga0450923_035316 | 3300042125 | Bacteria | 1034 |
| 1184 | Ga0450897_008249 | 3300042128 | Bacteria | 965 |
| 1185 | Ga0450896_007410 | 3300042133 | Bacteria | 1514 |
| 1186 | Ga0450898_005481 | 3300042134 | Bacteria | 1919 |
| 1187 | Ga0450898_020412 | 3300042134 | Bacteria | 1161 |
| 1188 | Ga0450905_056568 | 3300042142 | Bacteria | 648 |
| 1189 | Ga0450910_025753 | 3300042147 | Bacteria | 906 |
| 1190 | Ga0439446_0011968 | 3300042156 | Bacteria | 2365 |
| 1191 | Ga0439446_0194101 | 3300042156 | Bacteria | 683 |
| 1192 | Ga0439458_0006040 | 3300042157 | Bacteria | 2707 |
| 1193 | Ga0450908_011589 | 3300042184 | Bacteria | 1612 |
| 1194 | Ga0450908_030358 | 3300042184 | Bacteria | 939 |
| 1195 | Ga0450909_037887 | 3300042185 | Bacteria | 739 |
| 1196 | Ga0439434_0104381 | 3300042435 | Bacteria | 915 |
| 1197 | Ga0439434_0115615 | 3300042435 | Bacteria | 872 |
| 1198 | Ga0450893_0005187 | 3300042532 | Bacteria | 2085 |
| 1199 | Ga0450893_0019015 | 3300042532 | Bacteria | 1173 |
| 1200 | Ga0451577_0012109 | 3300042876 | Bacteria | 8113 |
| 1201 | Ga0451577_0694118 | 3300042876 | Bacteria | 922 |
| 1202 | Ga0466969_0194702 | 3300044656 | Bacteria | 925 |
| 1203 | Ga0466972_0026237 | 3300044658 | Bacteria | 2887 |
| 1204 | Ga0466965_0124831 | 3300044683 | Bacteria | 1331 |
| 1205 | Ga0466961_0965815 | 3300044693 | Bacteria | 507 |
| 1206 | Ga0466963_0387885 | 3300044694 | Bacteria | 985 |
| 1207 | Ga0466964_0070136 | 3300044706 | Bacteria | 1480 |
| 1208 | Ga0453684_0009557 | 3300044712 | Bacteria | 16927 |
| 1209 | Ga0453684_0067062 | 3300044712 | Bacteria | 4566 |
| 1210 | Ga0466968_0578281 | 3300044735 | Bacteria | 565 |
| 1211 | Ga0466960_0187524 | 3300044901 | Bacteria | 1124 |
| 1212 | Ga0451576_0035144 | 3300045051 | Bacteria | 5319 |
| 1213 | Ga0451576_0804264 | 3300045051 | Bacteria | 987 |
| 1214 | Ga0451576_0993627 | 3300045051 | Bacteria | 880 |
| 1215 | Ga0466958_0525569 | 3300045836 | Bacteria | 768 |
| 1216 | Ga0495627_049188 | 3300046453 | Bacteria | 1273 |
| 1217 | Ga0495627_143442 | 3300046453 | Bacteria | 668 |
| 1218 | Ga0495592_0000175 | 3300046454 | Bacteria | 56416 |
| 1219 | Ga0495592_0003711 | 3300046454 | Bacteria | 11010 |
| 1220 | Ga0495603_0337394 | 3300046455 | Bacteria | 865 |
| 1221 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 1222 | Ga0495590_0014398 | 3300046457 | Bacteria | 2886 |
| 1223 | Ga0495590_0015858 | 3300046457 | Bacteria | 2726 |
| 1224 | Ga0495590_0151583 | 3300046457 | Bacteria | 840 |
| 1225 | Ga0495638_0002754 | 3300046460 | Bacteria | 14123 |
| 1226 | Ga0495638_0005353 | 3300046460 | Bacteria | 9568 |
| 1227 | Ga0495638_0086048 | 3300046460 | Bacteria | 1900 |
| 1228 | Ga0495638_0105756 | 3300046460 | Bacteria | 1677 |
| 1229 | Ga0495638_0421708 | 3300046460 | Bacteria | 688 |
| 1230 | Ga0495641_0300235 | 3300046461 | Bacteria | 724 |
| 1231 | Ga0495653_0000009 | 3300046463 | Bacteria | 304207 |
| 1232 | Ga0495653_0316734 | 3300046463 | Bacteria | 1012 |
| 1233 | Ga0495653_0406350 | 3300046463 | Bacteria | 864 |
| 1234 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 1235 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 1236 | Ga0495650_0000213 | 3300046471 | Bacteria | 123910 |
| 1237 | Ga0495650_0009697 | 3300046471 | Bacteria | 5456 |
| 1238 | Ga0495650_0030124 | 3300046471 | Bacteria | 2462 |
| 1239 | Ga0495580_0355786 | 3300046472 | Bacteria | 991 |
| 1240 | Ga0495580_0685529 | 3300046472 | Bacteria | 672 |
| 1241 | Ga0495605_0000040 | 3300046474 | Bacteria | 193955 |
| 1242 | Ga0495605_0024096 | 3300046474 | Bacteria | 3189 |
| 1243 | Ga0495605_0049002 | 3300046474 | Bacteria | 2065 |
| 1244 | Ga0495605_0284035 | 3300046474 | Bacteria | 703 |
| 1245 | Ga0495605_0386324 | 3300046474 | Bacteria | 583 |
| 1246 | Ga0495639_0021593 | 3300046475 | Bacteria | 2819 |
| 1247 | Ga0495639_0127151 | 3300046475 | Bacteria | 1218 |
| 1248 | Ga0495639_0457425 | 3300046475 | Bacteria | 649 |
| 1249 | Ga0495639_0629862 | 3300046475 | Bacteria | 552 |
| 1250 | Ga0495662_0401925 | 3300046476 | Bacteria | 673 |
| 1251 | Ga0495584_0015103 | 3300046491 | Bacteria | 3935 |
| 1252 | Ga0495584_0047944 | 3300046491 | Bacteria | 2155 |
| 1253 | Ga0495584_0084559 | 3300046491 | Bacteria | 1598 |
| 1254 | Ga0495584_0269858 | 3300046491 | Bacteria | 865 |
| 1255 | Ga0495585_0000587 | 3300046492 | Bacteria | 34126 |
| 1256 | Ga0495585_0005376 | 3300046492 | Bacteria | 8082 |
| 1257 | Ga0495585_0292387 | 3300046492 | Bacteria | 803 |
| 1258 | Ga0495596_0000029 | 3300046500 | Bacteria | 103615 |
| 1259 | Ga0495596_0000177 | 3300046500 | Bacteria | 44496 |
| 1260 | Ga0495596_0000309 | 3300046500 | Bacteria | 32084 |
| 1261 | Ga0495596_0002217 | 3300046500 | Bacteria | 10590 |
| 1262 | Ga0495596_0002850 | 3300046500 | Bacteria | 9022 |
| 1263 | Ga0495596_0003951 | 3300046500 | Bacteria | 7334 |
| 1264 | Ga0495596_0006338 | 3300046500 | Bacteria | 5459 |
| 1265 | Ga0495596_0032721 | 3300046500 | Bacteria | 2072 |
| 1266 | Ga0495596_0046851 | 3300046500 | Bacteria | 1697 |
| 1267 | Ga0495607_0000867 | 3300046501 | Bacteria | 28348 |
| 1268 | Ga0495607_0003055 | 3300046501 | Bacteria | 13021 |
| 1269 | Ga0495607_0035858 | 3300046501 | Bacteria | 2995 |
| 1270 | Ga0495607_0035916 | 3300046501 | Bacteria | 2992 |
| 1271 | Ga0495607_0058891 | 3300046501 | Bacteria | 2193 |
| 1272 | Ga0495607_0060055 | 3300046501 | Bacteria | 2165 |
| 1273 | Ga0495607_0095182 | 3300046501 | Bacteria | 1605 |
| 1274 | Ga0495583_0000127 | 3300046506 | Bacteria | 127780 |
| 1275 | Ga0495583_0002687 | 3300046506 | Bacteria | 14789 |
| 1276 | Ga0495583_0003009 | 3300046506 | Bacteria | 13477 |
| 1277 | Ga0495583_0009275 | 3300046506 | Bacteria | 5895 |
| 1278 | Ga0495583_0016689 | 3300046506 | Bacteria | 3935 |
| 1279 | Ga0495583_0018534 | 3300046506 | Bacteria | 3661 |
| 1280 | Ga0495583_0108944 | 3300046506 | Bacteria | 1175 |
| 1281 | Ga0495583_0259338 | 3300046506 | Bacteria | 696 |
| 1282 | Ga0495606_0019807 | 3300046507 | Bacteria | 4985 |
| 1283 | Ga0495606_0163844 | 3300046507 | Bacteria | 1295 |
| 1284 | Ga0495606_0316167 | 3300046507 | Bacteria | 841 |
| 1285 | Ga0495610_0000008 | 3300046512 | Bacteria | 622732 |
| 1286 | Ga0495610_0001018 | 3300046512 | Bacteria | 25838 |
| 1287 | Ga0495610_0081480 | 3300046512 | Bacteria | 1485 |
| 1288 | Ga0495610_0119289 | 3300046512 | Bacteria | 1158 |
| 1289 | Ga0495616_0000034 | 3300046513 | Bacteria | 129394 |
| 1290 | Ga0495616_0000071 | 3300046513 | Bacteria | 89053 |
| 1291 | Ga0495616_0000294 | 3300046513 | Bacteria | 40512 |
| 1292 | Ga0495616_0002129 | 3300046513 | Bacteria | 13266 |
| 1293 | Ga0495616_0004940 | 3300046513 | Bacteria | 8327 |
| 1294 | Ga0495616_0008342 | 3300046513 | Bacteria | 6143 |
| 1295 | Ga0495616_0014033 | 3300046513 | Bacteria | 4501 |
| 1296 | Ga0495616_0132029 | 3300046513 | Bacteria | 1143 |
| 1297 | Ga0495616_0221478 | 3300046513 | Bacteria | 823 |
| 1298 | Ga0495620_0031646 | 3300046515 | Bacteria | 2422 |
| 1299 | Ga0495620_0061356 | 3300046515 | Bacteria | 1564 |
| 1300 | Ga0495620_0072090 | 3300046515 | Bacteria | 1411 |
| 1301 | Ga0495620_0224872 | 3300046515 | Bacteria | 718 |
| 1302 | Ga0495628_0377451 | 3300046516 | Bacteria | 1039 |
| 1303 | Ga0495630_0225575 | 3300046517 | Bacteria | 1431 |
| 1304 | Ga0495630_0288158 | 3300046517 | Bacteria | 1255 |
| 1305 | Ga0495631_0000042 | 3300046518 | Bacteria | 78766 |
| 1306 | Ga0495631_0000408 | 3300046518 | Bacteria | 29643 |
| 1307 | Ga0495631_0001648 | 3300046518 | Bacteria | 13280 |
| 1308 | Ga0495631_0037703 | 3300046518 | Bacteria | 2152 |
| 1309 | Ga0495631_0042931 | 3300046518 | Bacteria | 1996 |
| 1310 | Ga0495631_0321971 | 3300046518 | Bacteria | 658 |
| 1311 | Ga0495632_0000033 | 3300046519 | Bacteria | 164240 |
| 1312 | Ga0495632_0000086 | 3300046519 | Bacteria | 95327 |
| 1313 | Ga0495632_0000321 | 3300046519 | Bacteria | 46253 |
| 1314 | Ga0495632_0001237 | 3300046519 | Bacteria | 21665 |
| 1315 | Ga0495632_0005196 | 3300046519 | Bacteria | 8683 |
| 1316 | Ga0495632_0008164 | 3300046519 | Bacteria | 6468 |
| 1317 | Ga0495632_0028978 | 3300046519 | Bacteria | 2886 |
| 1318 | Ga0495632_0112266 | 3300046519 | Bacteria | 1279 |
| 1319 | Ga0495632_0204880 | 3300046519 | Bacteria | 897 |
| 1320 | Ga0495637_0003831 | 3300046520 | Bacteria | 7897 |
| 1321 | Ga0495637_0005223 | 3300046520 | Bacteria | 6648 |
| 1322 | Ga0495637_0018995 | 3300046520 | Bacteria | 3183 |
| 1323 | Ga0495637_0020863 | 3300046520 | Bacteria | 3007 |
| 1324 | Ga0495637_0052143 | 3300046520 | Bacteria | 1709 |
| 1325 | Ga0495637_0052357 | 3300046520 | Bacteria | 1704 |
| 1326 | Ga0495637_0068682 | 3300046520 | Bacteria | 1435 |
| 1327 | Ga0495637_0097785 | 3300046520 | Bacteria | 1151 |
| 1328 | Ga0495637_0193181 | 3300046520 | Bacteria | 750 |
| 1329 | Ga0495643_0000044 | 3300046522 | Bacteria | 226211 |
| 1330 | Ga0495643_0000096 | 3300046522 | Bacteria | 146041 |
| 1331 | Ga0495643_0000398 | 3300046522 | Bacteria | 57089 |
| 1332 | Ga0495643_0000760 | 3300046522 | Bacteria | 36247 |
| 1333 | Ga0495643_0001857 | 3300046522 | Bacteria | 17930 |
| 1334 | Ga0495643_0024026 | 3300046522 | Bacteria | 3460 |
| 1335 | Ga0495643_0035116 | 3300046522 | Bacteria | 2761 |
| 1336 | Ga0495643_0048354 | 3300046522 | Bacteria | 2299 |
| 1337 | Ga0495643_0063146 | 3300046522 | Bacteria | 1959 |
| 1338 | Ga0495643_0068006 | 3300046522 | Bacteria | 1875 |
| 1339 | Ga0495643_0084857 | 3300046522 | Bacteria | 1643 |
| 1340 | Ga0495643_0197664 | 3300046522 | Bacteria | 967 |
| 1341 | Ga0495643_0274842 | 3300046522 | Bacteria | 777 |
| 1342 | Ga0495644_0000030 | 3300046523 | Bacteria | 66319 |
| 1343 | Ga0495644_0033198 | 3300046523 | Bacteria | 1950 |
| 1344 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 1345 | Ga0495648_0000505 | 3300046524 | Bacteria | 41982 |
| 1346 | Ga0495648_0001508 | 3300046524 | Bacteria | 22794 |
| 1347 | Ga0495648_0011019 | 3300046524 | Bacteria | 6850 |
| 1348 | Ga0495648_0016203 | 3300046524 | Bacteria | 5377 |
| 1349 | Ga0495648_0020401 | 3300046524 | Bacteria | 4623 |
| 1350 | Ga0495648_0024378 | 3300046524 | Bacteria | 4122 |
| 1351 | Ga0495648_0036767 | 3300046524 | Bacteria | 3153 |
| 1352 | Ga0495648_0041837 | 3300046524 | Bacteria | 2889 |
| 1353 | Ga0495648_0054396 | 3300046524 | Bacteria | 2418 |
| 1354 | Ga0495648_0115262 | 3300046524 | Bacteria | 1454 |
| 1355 | Ga0495648_0292683 | 3300046524 | Bacteria | 766 |
| 1356 | Ga0495642_0000246 | 3300046528 | Bacteria | 30547 |
| 1357 | Ga0495642_0000273 | 3300046528 | Bacteria | 29188 |
| 1358 | Ga0495642_0000401 | 3300046528 | Bacteria | 23277 |
| 1359 | Ga0495642_0003450 | 3300046528 | Bacteria | 6228 |
| 1360 | Ga0495642_0054844 | 3300046528 | Bacteria | 1644 |
| 1361 | Ga0495642_0063629 | 3300046528 | Bacteria | 1533 |
| 1362 | Ga0495642_0099496 | 3300046528 | Bacteria | 1237 |
| 1363 | Ga0495642_0218528 | 3300046528 | Bacteria | 832 |
| 1364 | Ga0495654_0000058 | 3300046530 | Bacteria | 139884 |
| 1365 | Ga0495654_0001164 | 3300046530 | Bacteria | 18772 |
| 1366 | Ga0495654_0002363 | 3300046530 | Bacteria | 12189 |
| 1367 | Ga0495654_0008964 | 3300046530 | Bacteria | 5495 |
| 1368 | Ga0495654_0020402 | 3300046530 | Bacteria | 3454 |
| 1369 | Ga0495654_0045998 | 3300046530 | Bacteria | 2151 |
| 1370 | Ga0495654_0054787 | 3300046530 | Bacteria | 1933 |
| 1371 | Ga0495654_0058094 | 3300046530 | Bacteria | 1867 |
| 1372 | Ga0495654_0174153 | 3300046530 | Bacteria | 936 |
| 1373 | Ga0495654_0205785 | 3300046530 | Bacteria | 839 |
| 1374 | Ga0495586_0509190 | 3300046535 | Bacteria | 695 |
| 1375 | Ga0495587_0200705 | 3300046536 | Bacteria | 1128 |
| 1376 | Ga0495587_0292480 | 3300046536 | Bacteria | 912 |
| 1377 | Ga0495598_0069329 | 3300046537 | Bacteria | 1107 |
| 1378 | Ga0495609_0000044 | 3300046538 | Bacteria | 161642 |
| 1379 | Ga0495609_0000628 | 3300046538 | Bacteria | 27456 |
| 1380 | Ga0495609_0000913 | 3300046538 | Bacteria | 21398 |
| 1381 | Ga0495609_0000919 | 3300046538 | Bacteria | 21337 |
| 1382 | Ga0495609_0002371 | 3300046538 | Bacteria | 11615 |
| 1383 | Ga0495609_0002960 | 3300046538 | Bacteria | 10046 |
| 1384 | Ga0495609_0005079 | 3300046538 | Bacteria | 7015 |
| 1385 | Ga0495609_0034221 | 3300046538 | Bacteria | 2304 |
| 1386 | Ga0495609_0094690 | 3300046538 | Bacteria | 1297 |
| 1387 | Ga0495609_0199349 | 3300046538 | Bacteria | 837 |
| 1388 | Ga0495621_0041382 | 3300046539 | Bacteria | 1618 |
| 1389 | Ga0495621_0098758 | 3300046539 | Bacteria | 1109 |
| 1390 | Ga0495621_0099677 | 3300046539 | Bacteria | 1104 |
| 1391 | Ga0495621_0100499 | 3300046539 | Bacteria | 1100 |
| 1392 | Ga0495597_0000115 | 3300046542 | Bacteria | 72325 |
| 1393 | Ga0495597_0000996 | 3300046542 | Bacteria | 21725 |
| 1394 | Ga0495597_0001025 | 3300046542 | Bacteria | 21374 |
| 1395 | Ga0495597_0003730 | 3300046542 | Bacteria | 8697 |
| 1396 | Ga0495597_0030025 | 3300046542 | Bacteria | 2479 |
| 1397 | Ga0495597_0041564 | 3300046542 | Bacteria | 2053 |
| 1398 | Ga0495597_0084653 | 3300046542 | Bacteria | 1352 |
| 1399 | Ga0495597_0100640 | 3300046542 | Bacteria | 1219 |
| 1400 | Ga0495597_0157684 | 3300046542 | Bacteria | 928 |
| 1401 | Ga0495645_0181194 | 3300046543 | Bacteria | 1443 |
| 1402 | Ga0495622_0051350 | 3300046557 | Bacteria | 1913 |
| 1403 | Ga0495622_0063469 | 3300046557 | Bacteria | 1709 |
| 1404 | Ga0495633_0000521 | 3300046558 | Bacteria | 38447 |
| 1405 | Ga0495633_0003990 | 3300046558 | Bacteria | 9560 |
| 1406 | Ga0495633_0019390 | 3300046558 | Bacteria | 3441 |
| 1407 | Ga0495633_0044952 | 3300046558 | Bacteria | 2092 |
| 1408 | Ga0495633_0073496 | 3300046558 | Bacteria | 1594 |
| 1409 | Ga0495633_0111838 | 3300046558 | Bacteria | 1266 |
| 1410 | Ga0495633_0243430 | 3300046558 | Bacteria | 821 |
| 1411 | Ga0495633_0249677 | 3300046558 | Bacteria | 810 |
| 1412 | Ga0495633_0310676 | 3300046558 | Bacteria | 716 |
| 1413 | Ga0495667_0081116 | 3300046559 | Bacteria | 2109 |
| 1414 | Ga0495656_0001972 | 3300046615 | Bacteria | 6773 |
| 1415 | Ga0495656_0006352 | 3300046615 | Bacteria | 4144 |
| 1416 | Ga0495668_0000045 | 3300046616 | Bacteria | 225145 |
| 1417 | Ga0495668_0000193 | 3300046616 | Bacteria | 89740 |
| 1418 | Ga0495668_0000669 | 3300046616 | Bacteria | 41269 |
| 1419 | Ga0495668_0013890 | 3300046616 | Bacteria | 4736 |
| 1420 | Ga0495668_0051691 | 3300046616 | Bacteria | 2275 |
| 1421 | Ga0495668_0123854 | 3300046616 | Bacteria | 1414 |
| 1422 | Ga0495668_0133597 | 3300046616 | Bacteria | 1358 |
| 1423 | Ga0495668_0255204 | 3300046616 | Bacteria | 960 |
| 1424 | Ga0495668_0312677 | 3300046616 | Bacteria | 861 |
| 1425 | Ga0495668_0373975 | 3300046616 | Bacteria | 782 |
| 1426 | Ga0495668_0375524 | 3300046616 | Bacteria | 781 |
| 1427 | Ga0495634_0293425 | 3300046642 | Bacteria | 985 |
| 1428 | Ga0495634_0438806 | 3300046642 | Bacteria | 772 |
| 1429 | Ga0495611_0000439 | 3300046648 | Bacteria | 25620 |
| 1430 | Ga0495611_0179729 | 3300046648 | Bacteria | 989 |
| 1431 | Ga0495611_0192884 | 3300046648 | Bacteria | 951 |
| 1432 | Ga0495625_0000065 | 3300046660 | Bacteria | 173230 |
| 1433 | Ga0495625_0000224 | 3300046660 | Bacteria | 89521 |
| 1434 | Ga0495625_0001600 | 3300046660 | Bacteria | 26768 |
| 1435 | Ga0495625_0004383 | 3300046660 | Bacteria | 13387 |
| 1436 | Ga0495625_0010559 | 3300046660 | Bacteria | 7627 |
| 1437 | Ga0495625_0010801 | 3300046660 | Bacteria | 7516 |
| 1438 | Ga0495625_0021731 | 3300046660 | Bacteria | 4933 |
| 1439 | Ga0495625_0027912 | 3300046660 | Bacteria | 4239 |
| 1440 | Ga0495625_0054514 | 3300046660 | Bacteria | 2855 |
| 1441 | Ga0495625_0080161 | 3300046660 | Bacteria | 2274 |
| 1442 | Ga0495625_0083807 | 3300046660 | Bacteria | 2215 |
| 1443 | Ga0495625_0114980 | 3300046660 | Bacteria | 1836 |
| 1444 | Ga0495625_0147503 | 3300046660 | Bacteria | 1583 |
| 1445 | Ga0495625_0227577 | 3300046660 | Bacteria | 1219 |
| 1446 | Ga0495625_0385197 | 3300046660 | Bacteria | 879 |
| 1447 | Ga0495625_0451389 | 3300046660 | Bacteria | 794 |
| 1448 | Ga0495625_0592313 | 3300046660 | Bacteria | 667 |
| 1449 | Ga0495635_0418108 | 3300046663 | Bacteria | 889 |
| 1450 | Ga0495659_0000041 | 3300046664 | Bacteria | 59124 |
| 1451 | Ga0495659_0002529 | 3300046664 | Bacteria | 5904 |
| 1452 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 1453 | Ga0495661_0000170 | 3300046665 | Bacteria | 77754 |
| 1454 | Ga0495661_0000325 | 3300046665 | Bacteria | 52324 |
| 1455 | Ga0495661_0000843 | 3300046665 | Bacteria | 28565 |
| 1456 | Ga0495661_0001206 | 3300046665 | Bacteria | 22434 |
| 1457 | Ga0495661_0002108 | 3300046665 | Bacteria | 15613 |
| 1458 | Ga0495661_0005969 | 3300046665 | Bacteria | 8595 |
| 1459 | Ga0495661_0024188 | 3300046665 | Bacteria | 3932 |
| 1460 | Ga0495661_0040999 | 3300046665 | Bacteria | 2867 |
| 1461 | Ga0495661_0049889 | 3300046665 | Bacteria | 2536 |
| 1462 | Ga0495661_0062830 | 3300046665 | Bacteria | 2198 |
| 1463 | Ga0495661_0126875 | 3300046665 | Bacteria | 1403 |
| 1464 | Ga0495661_0166230 | 3300046665 | Bacteria | 1180 |
| 1465 | Ga0495661_0217644 | 3300046665 | Bacteria | 991 |
| 1466 | Ga0495661_0478153 | 3300046665 | Bacteria | 596 |
| 1467 | Ga0495588_0020475 | 3300046674 | Bacteria | 3252 |
| 1468 | Ga0495588_0026306 | 3300046674 | Bacteria | 2904 |
| 1469 | Ga0495588_0191695 | 3300046674 | Bacteria | 1080 |
| 1470 | Ga0495588_0218584 | 3300046674 | Bacteria | 1006 |
| 1471 | Ga0495657_0274252 | 3300046675 | Bacteria | 1011 |
| 1472 | Ga0495646_0005993 | 3300046680 | Bacteria | 7705 |
| 1473 | Ga0495646_0284957 | 3300046680 | Bacteria | 877 |
| 1474 | Ga0495647_0116960 | 3300046681 | Bacteria | 1118 |
| 1475 | Ga0495647_0122974 | 3300046681 | Bacteria | 1093 |
| 1476 | Ga0495647_0150415 | 3300046681 | Bacteria | 998 |
| 1477 | Ga0495647_0157311 | 3300046681 | Bacteria | 977 |
| 1478 | Ga0495658_0010460 | 3300046683 | Bacteria | 4642 |
| 1479 | Ga0495658_0037225 | 3300046683 | Bacteria | 2688 |
| 1480 | Ga0495658_0068835 | 3300046683 | Bacteria | 2050 |
| 1481 | Ga0495658_0180529 | 3300046683 | Bacteria | 1309 |
| 1482 | Ga0495658_0327932 | 3300046683 | Bacteria | 971 |
| 1483 | Ga0495658_0525918 | 3300046683 | Bacteria | 757 |
| 1484 | Ga0495669_0000091 | 3300046684 | Bacteria | 59795 |
| 1485 | Ga0495669_0015836 | 3300046684 | Bacteria | 3228 |
| 1486 | Ga0495669_0029860 | 3300046684 | Bacteria | 2392 |
| 1487 | Ga0495669_0256211 | 3300046684 | Bacteria | 840 |
| 1488 | Ga0495613_0387219 | 3300046689 | Bacteria | 955 |
| 1489 | Ga0495670_0024393 | 3300046691 | Bacteria | 2989 |
| 1490 | Ga0495670_0030552 | 3300046691 | Bacteria | 2676 |
| 1491 | Ga0495670_0038070 | 3300046691 | Bacteria | 2397 |
| 1492 | Ga0495670_0257154 | 3300046691 | Bacteria | 932 |
| 1493 | Ga0495670_0492896 | 3300046691 | Bacteria | 665 |
| 1494 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 1495 | Ga0495671_0000131 | 3300046692 | Bacteria | 67432 |
| 1496 | Ga0495671_0000198 | 3300046692 | Bacteria | 52877 |
| 1497 | Ga0495671_0001101 | 3300046692 | Bacteria | 18664 |
| 1498 | Ga0495671_0062030 | 3300046692 | Bacteria | 1843 |
| 1499 | Ga0495671_0241127 | 3300046692 | Bacteria | 873 |
| 1500 | Ga0495671_0334160 | 3300046692 | Bacteria | 727 |
| 1501 | Ga0495649_0000303 | 3300046694 | Bacteria | 43094 |
| 1502 | Ga0495649_0001551 | 3300046694 | Bacteria | 17244 |
| 1503 | Ga0495649_0007850 | 3300046694 | Bacteria | 6459 |
| 1504 | Ga0495649_0076699 | 3300046694 | Bacteria | 1789 |
| 1505 | Ga0495649_0077226 | 3300046694 | Bacteria | 1783 |
| 1506 | Ga0495649_0152523 | 3300046694 | Bacteria | 1213 |
| 1507 | Ga0495649_0287073 | 3300046694 | Bacteria | 840 |
| 1508 | Ga0495649_0497529 | 3300046694 | Bacteria | 606 |
| 1509 | Ga0495589_0000035 | 3300046794 | Bacteria | 161642 |
| 1510 | Ga0495589_0000219 | 3300046794 | Bacteria | 48510 |
| 1511 | Ga0495589_0004514 | 3300046794 | Bacteria | 7395 |
| 1512 | Ga0495589_0014524 | 3300046794 | Bacteria | 4053 |
| 1513 | Ga0495589_0086051 | 3300046794 | Bacteria | 1527 |
| 1514 | Ga0495589_0145767 | 3300046794 | Bacteria | 1132 |
| 1515 | Ga0495589_0157520 | 3300046794 | Bacteria | 1082 |
| 1516 | Ga0495589_0294625 | 3300046794 | Bacteria | 753 |
| 1517 | Ga0495600_0177981 | 3300046809 | Bacteria | 1371 |
| 1518 | Ga0495600_0459836 | 3300046809 | Bacteria | 786 |
| 1519 | Ga0495660_0002312 | 3300046810 | Bacteria | 12220 |
| 1520 | Ga0495660_0004863 | 3300046810 | Bacteria | 8088 |
| 1521 | Ga0495660_0012822 | 3300046810 | Bacteria | 4861 |
| 1522 | Ga0495660_0018326 | 3300046810 | Bacteria | 4024 |
| 1523 | Ga0495660_0027191 | 3300046810 | Bacteria | 3237 |
| 1524 | Ga0495660_0027838 | 3300046810 | Bacteria | 3195 |
| 1525 | Ga0495660_0030060 | 3300046810 | Bacteria | 3062 |
| 1526 | Ga0495660_0092147 | 3300046810 | Bacteria | 1573 |
| 1527 | Ga0495660_0128877 | 3300046810 | Bacteria | 1271 |
| 1528 | Ga0495660_0134626 | 3300046810 | Bacteria | 1236 |
| 1529 | Ga0495660_0141449 | 3300046810 | Bacteria | 1197 |
| 1530 | Ga0495604_0413231 | 3300047317 | Bacteria | 887 |
| 1531 | Ga0495636_0000537 | 3300047318 | Bacteria | 13950 |
| 1532 | Ga0495636_0005816 | 3300047318 | Bacteria | 4835 |
| 1533 | Ga0495636_0037481 | 3300047318 | Bacteria | 2002 |
| 1534 | Ga0495672_0000031 | 3300047320 | Bacteria | 298258 |
| 1535 | Ga0495672_0000685 | 3300047320 | Bacteria | 37744 |
| 1536 | Ga0495672_0001603 | 3300047320 | Bacteria | 22074 |
| 1537 | Ga0495672_0005983 | 3300047320 | Bacteria | 9528 |
| 1538 | Ga0495672_0021488 | 3300047320 | Bacteria | 4209 |
| 1539 | Ga0495676_0000398 | 3300047321 | Bacteria | 35184 |
| 1540 | Ga0495676_0030096 | 3300047321 | Bacteria | 4614 |
| 1541 | Ga0495676_0069402 | 3300047321 | Bacteria | 2719 |
| 1542 | Ga0495680_0509407 | 3300047322 | Bacteria | 816 |
| 1543 | Ga0495683_0003254 | 3300047323 | Bacteria | 9489 |
| 1544 | Ga0495683_0072619 | 3300047323 | Bacteria | 1688 |
| 1545 | Ga0495683_0116569 | 3300047323 | Bacteria | 1271 |
| 1546 | Ga0495683_0432777 | 3300047323 | Bacteria | 542 |
| 1547 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 1548 | Ga0495687_000066 | 3300047443 | Bacteria | 161642 |
| 1549 | Ga0495687_001099 | 3300047443 | Bacteria | 26415 |
| 1550 | Ga0495687_001273 | 3300047443 | Bacteria | 23729 |
| 1551 | Ga0495687_001453 | 3300047443 | Bacteria | 21748 |
| 1552 | Ga0495687_002257 | 3300047443 | Bacteria | 15813 |
| 1553 | Ga0495687_002986 | 3300047443 | Bacteria | 12800 |
| 1554 | Ga0495687_004333 | 3300047443 | Bacteria | 9656 |
| 1555 | Ga0495687_012673 | 3300047443 | Bacteria | 4444 |
| 1556 | Ga0495687_013163 | 3300047443 | Bacteria | 4330 |
| 1557 | Ga0495687_018635 | 3300047443 | Bacteria | 3427 |
| 1558 | Ga0495687_031321 | 3300047443 | Bacteria | 2440 |
| 1559 | Ga0495677_0000013 | 3300047445 | Bacteria | 138372 |
| 1560 | Ga0495677_0000512 | 3300047445 | Bacteria | 16307 |
| 1561 | Ga0495677_0000550 | 3300047445 | Bacteria | 15532 |
| 1562 | Ga0495677_0002369 | 3300047445 | Bacteria | 7408 |
| 1563 | Ga0495677_0050369 | 3300047445 | Bacteria | 1532 |
| 1564 | Ga0495677_0088148 | 3300047445 | Bacteria | 1168 |
| 1565 | Ga0495677_0148178 | 3300047445 | Bacteria | 903 |
| 1566 | Ga0495677_0202949 | 3300047445 | Bacteria | 771 |
| 1567 | Ga0495677_0302893 | 3300047445 | Bacteria | 629 |
| 1568 | Ga0495679_000296 | 3300047446 | Bacteria | 40360 |
| 1569 | Ga0495679_002037 | 3300047446 | Bacteria | 10678 |
| 1570 | Ga0495679_010136 | 3300047446 | Bacteria | 3719 |
| 1571 | Ga0495679_020858 | 3300047446 | Bacteria | 2275 |
| 1572 | Ga0495679_045256 | 3300047446 | Bacteria | 1345 |
| 1573 | Ga0495685_000307 | 3300047447 | Bacteria | 16005 |
| 1574 | Ga0495685_040375 | 3300047447 | Bacteria | 1596 |
| 1575 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 1576 | Ga0495673_0000926 | 3300047469 | Bacteria | 26610 |
| 1577 | Ga0495681_0000016 | 3300047470 | Bacteria | 181322 |
| 1578 | Ga0495681_0022987 | 3300047470 | Bacteria | 3324 |
| 1579 | Ga0495681_0104177 | 3300047470 | Bacteria | 1237 |
| 1580 | Ga0495686_0000054 | 3300047472 | Bacteria | 259400 |
| 1581 | Ga0495686_0000464 | 3300047472 | Bacteria | 60897 |
| 1582 | Ga0495686_0001324 | 3300047472 | Bacteria | 27731 |
| 1583 | Ga0495686_0269510 | 3300047472 | Bacteria | 950 |
| 1584 | Ga0495686_0459673 | 3300047472 | Bacteria | 675 |
| 1585 | Ga0495593_0000083 | 3300047673 | Bacteria | 41204 |
| 1586 | Ga0495593_0017089 | 3300047673 | Bacteria | 4083 |
| 1587 | Ga0495602_0232178 | 3300048088 | Bacteria | 1385 |
| 1588 | Ga0495614_0004378 | 3300048089 | Bacteria | 6367 |
| 1589 | Ga0495614_0010642 | 3300048089 | Bacteria | 4053 |
| 1590 | Ga0495615_0002597 | 3300048090 | Bacteria | 2915 |
| 1591 | Ga0495626_0000011 | 3300048091 | Bacteria | 260928 |
| 1592 | Ga0495626_0000071 | 3300048091 | Bacteria | 136767 |
| 1593 | Ga0495626_0003695 | 3300048091 | Bacteria | 9685 |
| 1594 | Ga0495626_0005258 | 3300048091 | Bacteria | 7651 |
| 1595 | Ga0495626_0008223 | 3300048091 | Bacteria | 5745 |
| 1596 | Ga0495626_0020612 | 3300048091 | Bacteria | 3282 |
| 1597 | Ga0495626_0029974 | 3300048091 | Bacteria | 2626 |
| 1598 | Ga0495626_0031597 | 3300048091 | Bacteria | 2547 |
| 1599 | Ga0495626_0058708 | 3300048091 | Bacteria | 1757 |
| 1600 | Ga0495626_0059441 | 3300048091 | Bacteria | 1744 |
| 1601 | Ga0495626_0065283 | 3300048091 | Bacteria | 1647 |
| 1602 | Ga0495626_0066936 | 3300048091 | Bacteria | 1623 |
| 1603 | Ga0495626_0086231 | 3300048091 | Bacteria | 1387 |
| 1604 | Ga0495626_0090886 | 3300048091 | Bacteria | 1342 |
| 1605 | Ga0495626_0127985 | 3300048091 | Bacteria | 1086 |
| 1606 | Ga0495626_0127989 | 3300048091 | Bacteria | 1086 |
| 1607 | Ga0495626_0399090 | 3300048091 | Bacteria | 532 |
| 1608 | Ga0496100_0002053 | 3300048903 | Bacteria | 10102 |
| 1609 | Ga0496100_0007896 | 3300048903 | Bacteria | 5909 |
| 1610 | Ga0496100_0456306 | 3300048903 | Bacteria | 980 |
| 1611 | Ga0496101_0056761 | 3300048904 | Bacteria | 2831 |
| 1612 | Ga0496101_0067612 | 3300048904 | Bacteria | 2609 |
| 1613 | Ga0496101_0485113 | 3300048904 | Bacteria | 976 |
| 1614 | Ga0496102_0003799 | 3300048905 | Bacteria | 12766 |
| 1615 | Ga0496102_0047264 | 3300048905 | Bacteria | 3910 |
| 1616 | Ga0496102_0191157 | 3300048905 | Bacteria | 1929 |
| 1617 | Ga0496102_0509070 | 3300048905 | Bacteria | 1126 |
| 1618 | Ga0496103_0246927 | 3300048906 | Bacteria | 1148 |
| 1619 | Ga0496104_0004101 | 3300048907 | Bacteria | 12642 |
| 1620 | Ga0496104_0058001 | 3300048907 | Bacteria | 3664 |
| 1621 | Ga0496104_0330733 | 3300048907 | Bacteria | 1437 |
| 1622 | Ga0496104_0657970 | 3300048907 | Bacteria | 956 |
| 1623 | Ga0496105_0043048 | 3300048908 | Bacteria | 3724 |
| 1624 | Ga0496105_0592230 | 3300048908 | Bacteria | 861 |
| 1625 | Ga0496105_0626676 | 3300048908 | Bacteria | 832 |
| 1626 | Ga0496106_0012220 | 3300048909 | Bacteria | 6336 |
| 1627 | Ga0496106_0055120 | 3300048909 | Bacteria | 3004 |
| 1628 | Ga0496107_0130976 | 3300048910 | Bacteria | 1851 |
| 1629 | Ga0496107_0372999 | 3300048910 | Bacteria | 1061 |
| 1630 | Ga0496108_0067782 | 3300048911 | Bacteria | 3010 |
| 1631 | Ga0496108_0254884 | 3300048911 | Bacteria | 1526 |
| 1632 | Ga0496108_0525511 | 3300048911 | Bacteria | 1033 |
| 1633 | Ga0496109_0034590 | 3300048912 | Bacteria | 4553 |
| 1634 | Ga0496109_0069873 | 3300048912 | Bacteria | 3222 |
| 1635 | Ga0496109_1231936 | 3300048912 | Bacteria | 685 |
| 1636 | Ga0496110_0094088 | 3300048913 | Bacteria | 2683 |
| 1637 | Ga0496110_0128599 | 3300048913 | Bacteria | 2286 |
| 1638 | Ga0496110_0158310 | 3300048913 | Bacteria | 2052 |
| 1639 | Ga0496110_0353796 | 3300048913 | Bacteria | 1338 |
| 1640 | Ga0496111_0062777 | 3300048914 | Bacteria | 2694 |
| 1641 | Ga0496111_0252643 | 3300048914 | Bacteria | 1308 |
| 1642 | Ga0496111_0669728 | 3300048914 | Bacteria | 756 |
| 1643 | Ga0496112_0277695 | 3300048915 | Bacteria | 1623 |
| 1644 | Ga0496113_0010989 | 3300048916 | Bacteria | 6016 |
| 1645 | Ga0496113_0122050 | 3300048916 | Bacteria | 2038 |
| 1646 | Ga0496113_0990754 | 3300048916 | Bacteria | 662 |
| 1647 | Ga0496114_0218590 | 3300048917 | Bacteria | 1672 |
| 1648 | Ga0496114_0314115 | 3300048917 | Bacteria | 1384 |
| 1649 | Ga0496114_0341868 | 3300048917 | Bacteria | 1323 |
| 1650 | Ga0496114_0601822 | 3300048917 | Bacteria | 969 |
| 1651 | Ga0496115_0259830 | 3300048918 | Bacteria | 1428 |
| 1652 | Ga0496116_0163029 | 3300048919 | Bacteria | 1220 |
| 1653 | Ga0496116_0166712 | 3300048919 | Bacteria | 1200 |
| 1654 | Ga0496116_0266748 | 3300048919 | Bacteria | 840 |
| 1655 | Ga0496117_0013508 | 3300048920 | Bacteria | 7119 |
| 1656 | Ga0496117_0019516 | 3300048920 | Bacteria | 5563 |
| 1657 | Ga0496117_0052144 | 3300048920 | Bacteria | 2884 |
| 1658 | Ga0496118_0009116 | 3300048921 | Bacteria | 10097 |
| 1659 | Ga0496118_0053625 | 3300048921 | Bacteria | 3062 |
| 1660 | Ga0496121_0045456 | 3300048924 | Bacteria | 3772 |
| 1661 | Ga0496121_0089403 | 3300048924 | Bacteria | 2411 |
| 1662 | Ga0496121_0188861 | 3300048924 | Bacteria | 1479 |
| 1663 | Ga0496122_0000552 | 3300048925 | Bacteria | 77275 |
| 1664 | Ga0496122_0127986 | 3300048925 | Bacteria | 1621 |
| 1665 | Ga0496123_0001585 | 3300048926 | Bacteria | 30921 |
| 1666 | Ga0496123_0025017 | 3300048926 | Bacteria | 4515 |
| 1667 | Ga0496123_0052955 | 3300048926 | Bacteria | 2687 |
| 1668 | Ga0496123_0143032 | 3300048926 | Bacteria | 1304 |
| 1669 | Ga0496124_0089671 | 3300048927 | Bacteria | 2510 |
| 1670 | Ga0496124_0142076 | 3300048927 | Bacteria | 1893 |
| 1671 | Ga0496124_0166873 | 3300048927 | Bacteria | 1710 |
| 1672 | Ga0496124_0189507 | 3300048927 | Bacteria | 1575 |
| 1673 | Ga0496125_0001368 | 3300048928 | Bacteria | 35878 |
| 1674 | Ga0496125_0009166 | 3300048928 | Bacteria | 10227 |
| 1675 | Ga0496125_0034798 | 3300048928 | Bacteria | 4432 |
| 1676 | Ga0496125_0056434 | 3300048928 | Bacteria | 3189 |
| 1677 | Ga0496125_0190126 | 3300048928 | Bacteria | 1356 |
| 1678 | Ga0496125_0256365 | 3300048928 | Bacteria | 1099 |
| 1679 | Ga0496125_0471999 | 3300048928 | Bacteria | 713 |
| 1680 | Ga0496126_0126980 | 3300048929 | Bacteria | 2207 |
| 1681 | Ga0496126_0496667 | 3300048929 | Bacteria | 976 |
| 1682 | Ga0496126_0547004 | 3300048929 | Bacteria | 919 |
| 1683 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 1684 | Ga0495678_000035 | 3300049459 | Bacteria | 200957 |
| 1685 | Ga0495678_003416 | 3300049459 | Bacteria | 9852 |
| 1686 | Ga0495678_014610 | 3300049459 | Bacteria | 3646 |
| 1687 | Ga0495678_033503 | 3300049459 | Bacteria | 2119 |
| 1688 | Ga0495678_094668 | 3300049459 | Bacteria | 1045 |
| 1689 | Ga0495678_112271 | 3300049459 | Bacteria | 927 |
| 1690 | Ga0495682_0001939 | 3300049460 | Bacteria | 10279 |
| 1691 | Ga0495682_0002609 | 3300049460 | Bacteria | 8457 |
| 1692 | Ga0495682_0007946 | 3300049460 | Bacteria | 4194 |
| 1693 | Ga0495682_0068522 | 3300049460 | Bacteria | 1278 |
| 1694 | Ga0501298_011896 | 3300049521 | Bacteria | 1519 |
| 1695 | Ga0501300_018393 | 3300049523 | Bacteria | 1021 |
| 1696 | Ga0501303_004894 | 3300049526 | Bacteria | 1122 |
| 1697 | Ga0501032_0057759 | 3300049569 | Bacteria | 2606 |
| 1698 | Ga0501034_0735138 | 3300049571 | Bacteria | 883 |
| 1699 | Ga0501043_0010569 | 3300049579 | Bacteria | 7226 |
| 1700 | Ga0501043_0365601 | 3300049579 | Bacteria | 1094 |
| 1701 | Ga0501043_0623108 | 3300049579 | Bacteria | 795 |
| 1702 | Ga0501046_0012537 | 3300049580 | Bacteria | 7209 |
| 1703 | Ga0501047_0015658 | 3300049581 | Bacteria | 7226 |
| 1704 | Ga0501048_0068146 | 3300049582 | Bacteria | 2514 |
| 1705 | Ga0501206_015062 | 3300049653 | Bacteria | 1068 |
| 1706 | Ga0501222_011032 | 3300049662 | Bacteria | 1192 |
| 1707 | Ga0501240_015693 | 3300049673 | Bacteria | 1080 |
| 1708 | Ga0501249_001955 | 3300049679 | Bacteria | 4189 |
| 1709 | Ga0501225_0009720 | 3300049705 | Bacteria | 2735 |
| 1710 | Ga0501079_0898240 | 3300049741 | Bacteria | 698 |
| 1711 | Ga0501262_000333 | 3300049759 | Bacteria | 5698 |
| 1712 | Ga0501264_008911 | 3300049761 | Bacteria | 951 |
| 1713 | Ga0501265_002430 | 3300049762 | Bacteria | 2113 |
| 1714 | Ga0501269_051107 | 3300049766 | Bacteria | 569 |
| 1715 | nmdc:mga03683_100415_c1 | 3300050489 | Bacteria | 1271 |
| 1716 | nmdc:mga03683_11059_c1 | 3300050489 | Bacteria | 3253 |
| 1717 | nmdc:mga03683_121243_c1 | 3300050489 | Bacteria | 1163 |
| 1718 | nmdc:mga03683_176849_c1 | 3300050489 | Bacteria | 972 |
| 1719 | nmdc:mga03683_191079_c1 | 3300050489 | Bacteria | 937 |
| 1720 | nmdc:mga03683_2207_c1 | 3300050489 | Bacteria | 6010 |
| 1721 | nmdc:mga03683_231868_c1 | 3300050489 | Bacteria | 854 |
| 1722 | nmdc:mga03683_312174_c1 | 3300050489 | Bacteria | 739 |
| 1723 | nmdc:mga03683_351698_c1 | 3300050489 | Bacteria | 698 |
| 1724 | nmdc:mga03683_4604_c1 | 3300050489 | Bacteria | 4588 |
| 1725 | nmdc:mga03683_505229_c1 | 3300050489 | Bacteria | 586 |
| 1726 | nmdc:mga03683_52226_c1 | 3300050489 | Bacteria | 1708 |
| 1727 | nmdc:mga03683_558913_c1 | 3300050489 | Bacteria | 557 |
| 1728 | nmdc:mga03683_7947_c2 | 3300050489 | Bacteria | 2071 |
| 1729 | nmdc:mga03n38_132691_c1 | 3300050490 | Bacteria | 1236 |
| 1730 | nmdc:mga03n38_395696_c1 | 3300050490 | Bacteria | 760 |
| 1731 | nmdc:mga03n38_73274_c1 | 3300050490 | Bacteria | 1590 |
| 1732 | nmdc:mga00v17_28836_c1 | 3300050491 | Bacteria | 3254 |
| 1733 | nmdc:mga00v17_309415_c1 | 3300050491 | Bacteria | 1026 |
| 1734 | nmdc:mga00v17_779504_c1 | 3300050491 | Bacteria | 610 |
| 1735 | nmdc:mga0k408_12545_c1 | 3300050493 | Bacteria | 4635 |
| 1736 | nmdc:mga0k408_136604_c1 | 3300050493 | Bacteria | 1457 |
| 1737 | nmdc:mga0k408_143867_c1 | 3300050493 | Bacteria | 1419 |
| 1738 | nmdc:mga0k408_172153_c1 | 3300050493 | Bacteria | 1291 |
| 1739 | nmdc:mga0k408_18003_c1 | 3300050493 | Bacteria | 3938 |
| 1740 | nmdc:mga0k408_1832_c1 | 3300050493 | Bacteria | 11407 |
| 1741 | nmdc:mga0k408_2173_c2 | 3300050493 | Bacteria | 6893 |
| 1742 | nmdc:mga0k408_23489_c1 | 3300050493 | Bacteria | 3479 |
| 1743 | nmdc:mga0k408_2403_c1 | 3300050493 | Bacteria | 9962 |
| 1744 | nmdc:mga0k408_25142_c1 | 3300050493 | Bacteria | 3371 |
| 1745 | nmdc:mga0k408_3264_c1 | 3300050493 | Bacteria | 8581 |
| 1746 | nmdc:mga0k408_366874_c1 | 3300050493 | Bacteria | 858 |
| 1747 | nmdc:mga0k408_374987_c1 | 3300050493 | Bacteria | 848 |
| 1748 | nmdc:mga0k408_38001_c1 | 3300050493 | Bacteria | 2764 |
| 1749 | nmdc:mga0k408_394745_c1 | 3300050493 | Bacteria | 824 |
| 1750 | nmdc:mga0k408_41756_c1 | 3300050493 | Bacteria | 2641 |
| 1751 | nmdc:mga0k408_483053_c1 | 3300050493 | Bacteria | 735 |
| 1752 | nmdc:mga0k408_519125_c1 | 3300050493 | Bacteria | 705 |
| 1753 | nmdc:mga0k408_6625_c1 | 3300050493 | Bacteria | 6174 |
| 1754 | nmdc:mga0k408_69454_c1 | 3300050493 | Bacteria | 2056 |
| 1755 | nmdc:mga0k408_79993_c1 | 3300050493 | Bacteria | 1913 |
| 1756 | nmdc:mga0k408_83142_c1 | 3300050493 | Bacteria | 1877 |
| 1757 | nmdc:mga0k408_83423_c1 | 3300050493 | Bacteria | 1873 |
| 1758 | nmdc:mga0k408_95654_c1 | 3300050493 | Bacteria | 1748 |
| 1759 | nmdc:mga06z11_15676_c1 | 3300050494 | Bacteria | 3389 |
| 1760 | nmdc:mga06z11_251659_c1 | 3300050494 | Bacteria | 1040 |
| 1761 | nmdc:mga06z11_291793_c1 | 3300050494 | Bacteria | 968 |
| 1762 | nmdc:mga06z11_297640_c1 | 3300050494 | Bacteria | 959 |
| 1763 | nmdc:mga06z11_431473_c1 | 3300050494 | Bacteria | 795 |
| 1764 | nmdc:mga06z11_5404_c1 | 3300050494 | Bacteria | 5120 |
| 1765 | nmdc:mga04h51_104660_c1 | 3300050495 | Bacteria | 1036 |
| 1766 | nmdc:mga04h51_257970_c1 | 3300050495 | Bacteria | 700 |
| 1767 | nmdc:mga07m45_10967_c1 | 3300050496 | Bacteria | 4749 |
| 1768 | nmdc:mga07m45_117139_c1 | 3300050496 | Bacteria | 1537 |
| 1769 | nmdc:mga07m45_13780_c1 | 3300050496 | Bacteria | 4294 |
| 1770 | nmdc:mga07m45_142433_c1 | 3300050496 | Bacteria | 1388 |
| 1771 | nmdc:mga07m45_173713_c1 | 3300050496 | Bacteria | 1253 |
| 1772 | nmdc:mga07m45_23347_c2 | 3300050496 | Bacteria | 2879 |
| 1773 | nmdc:mga07m45_257119_c1 | 3300050496 | Bacteria | 1016 |
| 1774 | nmdc:mga07m45_43309_c1 | 3300050496 | Bacteria | 2524 |
| 1775 | nmdc:mga07m45_48119_c1 | 3300050496 | Bacteria | 2398 |
| 1776 | nmdc:mga07m45_6011_c1 | 3300050496 | Bacteria | 6108 |
| 1777 | nmdc:mga07m45_62617_c1 | 3300050496 | Bacteria | 2109 |
| 1778 | nmdc:mga07m45_70336_c1 | 3300050496 | Bacteria | 1991 |
| 1779 | nmdc:mga07m45_88815_c1 | 3300050496 | Bacteria | 1769 |
| 1780 | nmdc:mga0qj67_725633_c1 | 3300050509 | Bacteria | 789 |
| 1781 | nmdc:mga0rr50_902513_c1 | 3300050513 | Bacteria | 753 |
| 1782 | nmdc:mga0sz30_276124_c1 | 3300050516 | Bacteria | 749 |
| 1783 | nmdc:mga0sz30_294999_c1 | 3300050516 | Bacteria | 723 |
| 1784 | Ga0495601_0069985 | 3300053077 | Bacteria | 2239 |
| 1785 | Ga0500610_0000055 | 3300053079 | Bacteria | 36032 |
| 1786 | Ga0500610_0000454 | 3300053079 | Bacteria | 12629 |
| 1787 | Ga0500610_0000509 | 3300053079 | Bacteria | 11979 |
| 1788 | Ga0495655_0078673 | 3300053083 | Bacteria | 938 |
| 1789 | Ga0495595_0056914 | 3300053084 | Bacteria | 1823 |
| 1790 | Ga0495595_0140001 | 3300053084 | Bacteria | 1187 |
| 1791 | Ga0495619_0694758 | 3300053085 | Bacteria | 692 |
| 1792 | Ga0500578_0078098 | 3300053086 | Bacteria | 2107 |
| 1793 | Ga0500578_0168990 | 3300053086 | Bacteria | 1353 |
| 1794 | Ga0500643_011260 | 3300053087 | Bacteria | 3272 |
| 1795 | Ga0500644_0008080 | 3300053088 | Bacteria | 2766 |
| 1796 | Ga0500644_0014654 | 3300053088 | Bacteria | 2218 |
| 1797 | Ga0500644_0018208 | 3300053088 | Bacteria | 2053 |
| 1798 | Ga0500646_0132370 | 3300053090 | Bacteria | 812 |
| 1799 | Ga0500647_0050303 | 3300053091 | Bacteria | 2004 |
| 1800 | Ga0500647_0249347 | 3300053091 | Bacteria | 781 |
| 1801 | Ga0500583_0125474 | 3300053092 | Bacteria | 1271 |
| 1802 | Ga0500583_0318735 | 3300053092 | Bacteria | 758 |
| 1803 | Ga0500583_0334033 | 3300053092 | Bacteria | 737 |
| 1804 | Ga0500651_0000015 | 3300053093 | Bacteria | 161416 |
| 1805 | Ga0500651_0000242 | 3300053093 | Bacteria | 33458 |
| 1806 | Ga0500651_0179287 | 3300053093 | Bacteria | 1259 |
| 1807 | Ga0500566_0030268 | 3300053094 | Bacteria | 3157 |
| 1808 | Ga0500566_0129441 | 3300053094 | Bacteria | 1352 |
| 1809 | Ga0500566_0362801 | 3300053094 | Bacteria | 660 |
| 1810 | Ga0500641_0211130 | 3300053096 | Bacteria | 826 |
| 1811 | Ga0500650_0128252 | 3300053098 | Bacteria | 1180 |
| 1812 | Ga0500650_0260854 | 3300053098 | Bacteria | 775 |
| 1813 | Ga0500560_096383 | 3300053107 | Bacteria | 990 |
| 1814 | Ga0500562_010558 | 3300053108 | Bacteria | 2342 |
| 1815 | Ga0500569_087057 | 3300053109 | Bacteria | 1007 |
| 1816 | Ga0500571_000017 | 3300053110 | Bacteria | 64361 |
| 1817 | Ga0500571_000074 | 3300053110 | Bacteria | 31440 |
| 1818 | Ga0500572_107590 | 3300053111 | Bacteria | 895 |
| 1819 | Ga0500572_210357 | 3300053111 | Bacteria | 637 |
| 1820 | Ga0500572_245004 | 3300053111 | Bacteria | 584 |
| 1821 | Ga0500591_050154 | 3300053115 | Bacteria | 1959 |
| 1822 | Ga0500592_006166 | 3300053116 | Bacteria | 1908 |
| 1823 | Ga0500593_000097 | 3300053117 | Bacteria | 32867 |
| 1824 | Ga0500593_000242 | 3300053117 | Bacteria | 22487 |
| 1825 | Ga0500593_003350 | 3300053117 | Bacteria | 6035 |
| 1826 | Ga0500594_0002529 | 3300053118 | Bacteria | 3977 |
| 1827 | Ga0500594_0021001 | 3300053118 | Bacteria | 1633 |
| 1828 | Ga0500607_000025 | 3300053121 | Bacteria | 95473 |
| 1829 | Ga0500607_000049 | 3300053121 | Bacteria | 80941 |
| 1830 | Ga0500607_019928 | 3300053121 | Bacteria | 3791 |
| 1831 | Ga0500607_135680 | 3300053121 | Bacteria | 1166 |
| 1832 | Ga0500608_012479 | 3300053122 | Bacteria | 3727 |
| 1833 | Ga0500614_156419 | 3300053123 | Bacteria | 689 |
| 1834 | Ga0500618_000173 | 3300053125 | Bacteria | 53346 |
| 1835 | Ga0500618_015894 | 3300053125 | Bacteria | 1893 |
| 1836 | Ga0500618_052678 | 3300053125 | Bacteria | 920 |
| 1837 | Ga0500618_058291 | 3300053125 | Bacteria | 869 |
| 1838 | Ga0500626_009438 | 3300053128 | Bacteria | 4058 |
| 1839 | Ga0500655_000065 | 3300053133 | Bacteria | 28630 |
| 1840 | Ga0500655_002857 | 3300053133 | Bacteria | 3137 |
| 1841 | Ga0500658_0000028 | 3300053134 | Bacteria | 105688 |
| 1842 | Ga0500658_0000054 | 3300053134 | Bacteria | 60941 |
| 1843 | Ga0500658_0003025 | 3300053134 | Bacteria | 6449 |
| 1844 | Ga0500658_0042452 | 3300053134 | Bacteria | 1827 |
| 1845 | Ga0500559_0001694 | 3300053136 | Bacteria | 12147 |
| 1846 | Ga0500559_0004268 | 3300053136 | Bacteria | 6837 |
| 1847 | Ga0500559_0006743 | 3300053136 | Bacteria | 5159 |
| 1848 | Ga0500559_0015080 | 3300053136 | Bacteria | 3266 |
| 1849 | Ga0500559_0025318 | 3300053136 | Bacteria | 2525 |
| 1850 | Ga0500559_0093712 | 3300053136 | Bacteria | 1377 |
| 1851 | Ga0500559_0226043 | 3300053136 | Bacteria | 882 |
| 1852 | Ga0500564_001050 | 3300053138 | Bacteria | 9107 |
| 1853 | Ga0500564_066263 | 3300053138 | Bacteria | 1633 |
| 1854 | Ga0500564_118137 | 3300053138 | Bacteria | 1158 |
| 1855 | Ga0500568_0001518 | 3300053139 | Bacteria | 14786 |
| 1856 | Ga0500568_0068042 | 3300053139 | Bacteria | 1367 |
| 1857 | Ga0500573_0005327 | 3300053140 | Bacteria | 6885 |
| 1858 | Ga0500574_000051 | 3300053141 | Bacteria | 13789 |
| 1859 | Ga0500574_000431 | 3300053141 | Bacteria | 5303 |
| 1860 | Ga0500586_000727 | 3300053145 | Bacteria | 6760 |
| 1861 | Ga0500586_025988 | 3300053145 | Bacteria | 1892 |
| 1862 | Ga0500616_0025694 | 3300053153 | Bacteria | 3265 |
| 1863 | Ga0500616_0041391 | 3300053153 | Bacteria | 2473 |
| 1864 | Ga0500616_0050793 | 3300053153 | Bacteria | 2188 |
| 1865 | Ga0500616_0332006 | 3300053153 | Bacteria | 623 |
| 1866 | Ga0500619_088620 | 3300053154 | Bacteria | 1044 |
| 1867 | Ga0500622_0001109 | 3300053156 | Bacteria | 22452 |
| 1868 | Ga0500622_0008524 | 3300053156 | Bacteria | 5727 |
| 1869 | Ga0500622_0137997 | 3300053156 | Bacteria | 1166 |
| 1870 | Ga0500627_0000171 | 3300053158 | Bacteria | 19148 |
| 1871 | Ga0500630_073077 | 3300053159 | Bacteria | 1618 |
| 1872 | Ga0500633_0087958 | 3300053160 | Bacteria | 1132 |
| 1873 | Ga0500634_0004247 | 3300053161 | Bacteria | 6586 |
| 1874 | Ga0500634_0004851 | 3300053161 | Bacteria | 6297 |
| 1875 | Ga0500634_0063922 | 3300053161 | Bacteria | 1945 |
| 1876 | Ga0500634_0113662 | 3300053161 | Bacteria | 1331 |
| 1877 | Ga0500638_000284 | 3300053162 | Bacteria | 11309 |
| 1878 | Ga0500638_012459 | 3300053162 | Bacteria | 3811 |
| 1879 | Ga0500639_008998 | 3300053163 | Bacteria | 5208 |
| 1880 | Ga0500636_0005829 | 3300053177 | Bacteria | 7053 |
| 1881 | Ga0500636_0221671 | 3300053177 | Bacteria | 985 |
| 1882 | Ga0500567_125390 | 3300053723 | Bacteria | 1016 |
| 1883 | Ga0500565_025083 | 3300053734 | Bacteria | 747 |
| 1884 | Ga0500587_002697 | 3300053739 | Bacteria | 2515 |
| 1885 | Ga0500587_009667 | 3300053739 | Bacteria | 1229 |
| 1886 | Ga0500661_003998 | 3300055283 | Bacteria | 2759 |
| 1887 | 2511242546 | 2511231002 | Bacteria | 5042903 |
| 1888 | 2513228680 | 2513020051 | Bacteria | 6053213 |
| 1889 | 2548498599 | 2547132374 | Bacteria | 5530232 |
| 1890 | 2553004589 | 2551306416 | Bacteria | 6152985 |
| 1891 | 2587758680 | 2585428062 | Bacteria | 6842168 |
| 1892 | 2599620622 | 2599185214 | Bacteria | 8209958 |
| 1893 | 2599673921 | 2599185226 | Bacteria | 8233575 |
| 1894 | 2599678762 | 2599185227 | Bacteria | 8246414 |
| 1895 | 2599690133 | 2599185229 | Bacteria | 8216126 |
| 1896 | 2643864789 | 2643221570 | Bacteria | 5103772 |
| 1897 | 2644159027 | 2643221628 | Bacteria | 5745828 |
| 1898 | 2644244933 | 2643221644 | Bacteria | 6865017 |
| 1899 | 2644257493 | 2643221646 | Bacteria | 6433402 |
| 1900 | 2644293980 | 2643221652 | Bacteria | 5140275 |
| 1901 | 2644302577 | 2643221654 | Bacteria | 5273570 |
| 1902 | 2644400379 | 2643221672 | Bacteria | 6322190 |
| 1903 | 2644468252 | 2643221683 | Bacteria | 5749203 |
| 1904 | 2644649334 | 2643221717 | Bacteria | 5676132 |
| 1905 | 2738717815 | 2738541277 | Bacteria | 7458140 |
| 1906 | 2738723725 | 2738541277 | Bacteria | 7458140 |
| 1907 | 2738739727 | 2738541280 | Bacteria | 6630198 |
| 1908 | 2738830461 | 2738541297 | Bacteria | 6549566 |
| 1909 | 2738879436 | 2738541307 | Bacteria | 8606193 |
| 1910 | 2739154257 | 2738541357 | Bacteria | 6549408 |
| 1911 | 2739196210 | 2738543003 | Bacteria | 6549560 |
| 1912 | 2739249426 | 2738543013 | Bacteria | 5618633 |
| 1913 | 2739278501 | 2738543019 | Bacteria | 7459457 |
| 1914 | 2739284456 | 2738543019 | Bacteria | 7459457 |
| 1915 | 2739322653 | 2738543026 | Bacteria | 6549408 |
| 1916 | 2739340894 | 2738543029 | Bacteria | 6549249 |
| 1917 | 2819601198 | 2818991446 | Bacteria | 7757362 |
| 1918 | 2831271487 | 2831265667 | Bacteria | 7184833 |
| 1919 | 2838055386 | 2838054893 | Bacteria | 7451788 |
| 1920 | 2842679996 | 2842677519 | Bacteria | 5615038 |
| 1921 | 2842735283 | 2842733646 | Bacteria | 5716726 |
| 1922 | 2842749961 | 2842747753 | Bacteria | 5578255 |
| 1923 | 2885201115 | 2885198086 | Bacteria | 7212419 |
| 1924 | 2885214101 | 2885211737 | Bacteria | 7212420 |
| 1925 | 2899927455 | 2899924645 | Bacteria | 7487985 |
| 1926 | 2904453290 | 2904449895 | Bacteria | 6927402 |
| 1927 | 2904459284 | 2904456579 | Bacteria | 6819253 |
| 1928 | 2904532422 | 2904530477 | Bacteria | 5876334 |
| 1929 | 2904548342 | 2904541872 | Bacteria | 8915136 |
| 1930 | 2919466116 | 2919462493 | Bacteria | 5817112 |
| 1931 | 2919708845 | 2919704043 | Bacteria | 5560311 |
| 1932 | 2923515417 | 2923510766 | Bacteria | 5926163 |
| 1933 | 2928042633 | 2928037797 | Bacteria | 7273642 |
| 1934 | 2928048940 | 2928044640 | Bacteria | 7271509 |
| 1935 | 2928051490 | 2928051484 | Bacteria | 7773759 |
| 1936 | 2928068702 | 2928064002 | Bacteria | 7419480 |
| 1937 | 2928073330 | 2928070936 | Bacteria | 8062541 |
| 1938 | 2928084432 | 2928084124 | Bacteria | 7159212 |
| 1939 | 2928117795 | 2928115317 | Bacteria | 6477646 |
| 1940 | 2929163332 | 2929160207 | Bacteria | 9075316 |
| 1941 | 2929523212 | 2929520902 | Bacteria | 6765052 |
| 1942 | 2939634006 | 2939631187 | Bacteria | 6118131 |
| 1943 | 2945912018 | 2945909444 | Bacteria | 7065066 |
| 1944 | 2945947977 | 2945945610 | Bacteria | 5951079 |
| 1945 | 2945972083 | 2945972063 | Bacteria | 6086495 |
| 1946 | 2945985711 | 2945984333 | Bacteria | 7358892 |
| 1947 | 2954772223 | 2954767861 | Bacteria | 5535784 |
| 1948 | 2990712005 | 2990710928 | Bacteria | 5002431 |
| 1949 | 639787670 | 639633007 | Bacteria | 4376040 |
| 1950 | Ga0501067_0457017 | |||
| 1951 | JGI24740J21852_10014352 | |||
| 1952 | JGI24739J22299_10005780 | |||
| 1953 | JGI25155J39150_1000062 | |||
| 1954 | JGI25156J39149_1000012 | |||
| 1955 | JGI25154J39366_1000029 | |||
| 1956 | JGI25154J39366_1000278 | |||
| 1957 | JGI25158J39367_1004986 | |||
| 1958 | JGI25157J39369_1000014 | |||
| 1959 | JGI25152J39213_1001366 | |||
| 1960 | JGI25152J39213_1006035 | |||
| 1961 | JGI25150J39212_1000869 | |||
| 1962 | JGI25150J39212_1014431 | |||
| 1963 | JGI25159J45721_1000054 | |||
| 1964 | JGI25159J45721_1005152 | |||
| 1965 | JGI25151J46595_10000507 | |||
| 1966 | JGI25151J46595_10002599 | |||
| 1967 | JGI25151J46595_10002870 | |||
| 1968 | JGI25151J46595_10004424 | |||
| 1969 | JGI25151J46595_10006031 | |||
| 1970 | JGI25151J46595_10006574 | |||
| 1971 | JGI25153J46596_10002045 | |||
| 1972 | rootL2_10020233 | |||
| 1973 | rootL2_10167114 | |||
| 1974 | rootH1_10030289 | |||
| 1975 | JGI25160J50197_1000088 | |||
| 1976 | JGI25160J50197_1000119 | |||
| 1977 | JGI25160J50197_1001065 | |||
| 1978 | JGI25160J50197_1005159 | |||
| 1979 | JGI25160J50197_1037137 | |||
| 1980 | JGI25161J50226_1000056 | |||
| 1981 | JGI25161J50226_1003182 | |||
| 1982 | Ga0055532_1013650 | |||
| 1983 | Ga0055525_1000001 | |||
| 1984 | Ga0055535_1000286 | |||
| 1985 | Ga0055535_1001184 | |||
| 1986 | Ga0055542_1000080 | |||
| 1987 | Ga0055542_1001176 | |||
| 1988 | Ga0055526_1006187 | |||
| 1989 | Ga0055526_1011254 | |||
| 1990 | Ga0055526_1024874 | |||
| 1991 | Ga0055526_1024934 | |||
| 1992 | Ga0055537_1000024 | |||
| 1993 | Ga0055537_1000047 | |||
| 1994 | Ga0055537_1001263 | |||
| 1995 | Ga0055537_1006648 | |||
| 1996 | Ga0055537_1007290 | |||
| 1997 | Ga0055524_1000039 | |||
| 1998 | Ga0055524_1008821 | |||
| 1999 | Ga0055524_1009148 | |||
| 2000 | Ga0055536_1002675 | |||
| 2001 | Ga0055536_1009284 | |||
| 2002 | Ga0055536_1009897 | |||
| 2003 | Ga0055536_1028754 | |||
| 2004 | Ga0055534_1000032 | |||
| 2005 | Ga0055534_1000141 | |||
| 2006 | Ga0055534_1001229 | |||
| 2007 | Ga0055534_1002784 | |||
| 2008 | Ga0055534_1038206 | |||
| 2009 | Ga0055528_1002122 | |||
| 2010 | Ga0055528_1002521 | |||
| 2011 | Ga0055528_1002981 | |||
| 2012 | Ga0055528_1009497 | |||
| 2013 | Ga0055530_10000532 | |||
| 2014 | Ga0055530_10002093 | |||
| 2015 | Ga0055530_10004782 | |||
| 2016 | Ga0055530_10022158 | |||
| 2017 | Ga0055530_10024142 | |||
| 2018 | Ga0055530_10053041 | |||
| 2019 | Ga0055540_1000047 | |||
| 2020 | Ga0055540_1000365 | |||
| 2021 | Ga0055540_1000440 | |||
| 2022 | Ga0055540_1002293 | |||
| 2023 | Ga0055540_1008010 | |||
| 2024 | Ga0055531_10000454 | |||
| 2025 | Ga0055531_10011051 | |||
| 2026 | Ga0055531_10012021 | |||
| 2027 | Ga0055531_10012911 | |||
| 2028 | Ga0055531_10057654 | |||
| 2029 | Ga0055543_1000904 | |||
| 2030 | Ga0055543_1001077 | |||
| 2031 | Ga0055543_1001260 | |||
| 2032 | Ga0065165_1003589 | |||
| 2033 | Ga0065165_1005321 | |||
| 2034 | Ga0065165_1023989 | |||
| 2035 | Ga0065165_1024242 | |||
| 2036 | Ga0065165_1081429 | |||
| 2037 | Ga0065714_10066369 | |||
| 2038 | Ga0065715_10244020 | |||
| 2039 | Ga0065707_10087747 | |||
| 2040 | Ga0070658_10125538 | |||
| 2041 | Ga0070658_10176893 | |||
| 2042 | Ga0070676_10004494 | |||
| 2043 | Ga0070676_10032895 | |||
| 2044 | Ga0070676_10203602 | |||
| 2045 | Ga0070676_10285396 | |||
| 2046 | Ga0070683_100131089 | |||
| 2047 | Ga0070683_100154993 | |||
| 2048 | Ga0070690_100037460 | |||
| 2049 | Ga0070690_100165870 | |||
| 2050 | Ga0070690_101040912 | |||
| 2051 | Ga0070670_100031372 | |||
| 2052 | Ga0070670_100097851 | |||
| 2053 | Ga0070670_100398756 | |||
| 2054 | Ga0070670_100427560 | |||
| 2055 | Ga0070670_100483723 | |||
| 2056 | Ga0070670_100773935 | |||
| 2057 | Ga0070670_101137033 | |||
| 2058 | Ga0070677_10020521 | |||
| 2059 | Ga0070677_10096467 | |||
| 2060 | Ga0070677_10284039 | |||
| 2061 | Ga0070677_10352729 | |||
| 2062 | Ga0068869_100000109 | |||
| 2063 | Ga0068869_100011409 | |||
| 2064 | Ga0068869_100061469 | |||
| 2065 | Ga0068869_100118296 | |||
| 2066 | Ga0068869_100322628 | |||
| 2067 | Ga0068869_100600166 | |||
| 2068 | Ga0068869_101125485 | |||
| 2069 | Ga0070666_10006231 | |||
| 2070 | Ga0070666_10009271 | |||
| 2071 | Ga0070666_10146619 | |||
| 2072 | Ga0070666_10772301 | |||
| 2073 | Ga0070680_100063118 | |||
| 2074 | Ga0070682_100473027 | |||
| 2075 | Ga0068868_100000928 | |||
| 2076 | Ga0068868_100002606 | |||
| 2077 | Ga0068868_100009104 | |||
| 2078 | Ga0068868_100043506 | |||
| 2079 | Ga0068868_100068559 | |||
| 2080 | Ga0068868_100094776 | |||
| 2081 | Ga0068868_100327397 | |||
| 2082 | Ga0068868_100618047 | |||
| 2083 | Ga0068868_101543346 | |||
| 2084 | Ga0070660_100102495 | |||
| 2085 | Ga0070660_100113595 | |||
| 2086 | Ga0070660_101555058 | |||
| 2087 | Ga0070687_100121070 | |||
| 2088 | Ga0070661_100071384 | |||
| 2089 | Ga0070661_100098854 | |||
| 2090 | Ga0070661_100098982 | |||
| 2091 | Ga0070661_100760848 | |||
| 2092 | Ga0070692_10314546 | |||
| 2093 | Ga0070692_10769411 | |||
| 2094 | Ga0070668_100005748 | |||
| 2095 | Ga0070668_100493696 | |||
| 2096 | Ga0070668_100612524 | |||
| 2097 | Ga0070669_100003867 | |||
| 2098 | Ga0070669_100032291 | |||
| 2099 | Ga0070669_100096210 | |||
| 2100 | Ga0070669_100206889 | |||
| 2101 | Ga0070669_100516365 | |||
| 2102 | Ga0070669_101115792 | |||
| 2103 | Ga0070675_100000772 | |||
| 2104 | Ga0070675_100018873 | |||
| 2105 | Ga0070675_100038290 | |||
| 2106 | Ga0070675_100145426 | |||
| 2107 | Ga0070675_100224640 | |||
| 2108 | Ga0070675_100348796 | |||
| 2109 | Ga0070675_100485372 | |||
| 2110 | Ga0070671_100006491 | |||
| 2111 | Ga0070671_100011811 | |||
| 2112 | Ga0070671_100030752 | |||
| 2113 | Ga0070671_100127377 | |||
| 2114 | Ga0070671_100249854 | |||
| 2115 | Ga0070671_100411541 | |||
| 2116 | Ga0070671_100422072 | |||
| 2117 | Ga0070674_100014173 | |||
| 2118 | Ga0070674_100146038 | |||
| 2119 | Ga0070673_100007669 | |||
| 2120 | Ga0070673_100077501 | |||
| 2121 | Ga0070673_100086947 | |||
| 2122 | Ga0070673_100129628 | |||
| 2123 | Ga0070673_100229881 | |||
| 2124 | Ga0070673_100316352 | |||
| 2125 | Ga0070673_100434024 | |||
| 2126 | Ga0070673_100496870 | |||
| 2127 | Ga0070673_100653681 | |||
| 2128 | Ga0070673_100825658 | |||
| 2129 | Ga0070673_100853490 | |||
| 2130 | Ga0070673_100926170 | |||
| 2131 | Ga0070673_101190219 | |||
| 2132 | Ga0070688_100026856 | |||
| 2133 | Ga0070659_100015164 | |||
| 2134 | Ga0070659_100114676 | |||
| 2135 | Ga0070659_100198344 | |||
| 2136 | Ga0070659_101053265 | |||
| 2137 | Ga0070667_100005806 | |||
| 2138 | Ga0070667_100007096 | |||
| 2139 | Ga0070667_100064974 | |||
| 2140 | Ga0070667_100125372 | |||
| 2141 | Ga0070667_100188883 | |||
| 2142 | Ga0070667_100484550 | |||
| 2143 | Ga0070667_100999049 | |||
| 2144 | Ga0070667_101222092 | |||
| 2145 | Ga0070701_10383946 | |||
| 2146 | Ga0070708_100135616 | |||
| 2147 | Ga0070663_100003925 | |||
| 2148 | Ga0070663_100313932 | |||
| 2149 | Ga0070663_100371878 | |||
| 2150 | Ga0070678_100004609 | |||
| 2151 | Ga0070678_100035270 | |||
| 2152 | Ga0070678_100420817 | |||
| 2153 | Ga0070678_101010441 | |||
| 2154 | Ga0070662_100000552 | |||
| 2155 | Ga0070662_100003920 | |||
| 2156 | Ga0070662_100032880 | |||
| 2157 | Ga0070662_100160037 | |||
| 2158 | Ga0070662_100452663 | |||
| 2159 | Ga0070662_100587568 | |||
| 2160 | Ga0068867_100000186 | |||
| 2161 | Ga0068867_100005611 | |||
| 2162 | Ga0068867_100033298 | |||
| 2163 | Ga0068867_100064019 | |||
| 2164 | Ga0068867_100259388 | |||
| 2165 | Ga0068867_100279964 | |||
| 2166 | Ga0068867_100316881 | |||
| 2167 | Ga0068867_100459729 | |||
| 2168 | Ga0068867_100633974 | |||
| 2169 | Ga0068867_100832172 | |||
| 2170 | Ga0068867_100867902 | |||
| 2171 | Ga0068867_100928701 | |||
| 2172 | Ga0068867_101856499 | |||
| 2173 | Ga0070685_10147935 | |||
| 2174 | Ga0070706_100017115 | |||
| 2175 | Ga0070706_100960143 | |||
| 2176 | Ga0070706_101871002 | |||
| 2177 | Ga0070707_100064439 | |||
| 2178 | Ga0070707_100154296 | |||
| 2179 | Ga0070699_100116427 | |||
| 2180 | Ga0070679_100003825 | |||
| 2181 | Ga0070684_100023555 | |||
| 2182 | Ga0070684_100248441 | |||
| 2183 | Ga0068853_100011884 | |||
| 2184 | Ga0068853_100059570 | |||
| 2185 | Ga0068853_100189341 | |||
| 2186 | Ga0068853_100437457 | |||
| 2187 | Ga0068853_100898155 | |||
| 2188 | Ga0068853_101606701 | |||
| 2189 | Ga0070672_100010739 | |||
| 2190 | Ga0070672_100016252 | |||
| 2191 | Ga0070672_100027229 | |||
| 2192 | Ga0070672_100055551 | |||
| 2193 | Ga0070672_100164157 | |||
| 2194 | Ga0070672_100228801 | |||
| 2195 | Ga0070672_100245988 | |||
| 2196 | Ga0070672_100369800 | |||
| 2197 | Ga0070672_100389330 | |||
| 2198 | Ga0070672_100739793 | |||
| 2199 | Ga0070672_101241462 | |||
| 2200 | Ga0070693_100763512 | |||
| 2201 | Ga0070665_100043405 | |||
| 2202 | Ga0070665_100144705 | |||
| 2203 | Ga0070665_100278353 | |||
| 2204 | Ga0070665_100509410 | |||
| 2205 | Ga0070665_100668795 | |||
| 2206 | Ga0068855_100015116 | |||
| 2207 | Ga0068855_100047998 | |||
| 2208 | Ga0068855_100173929 | |||
| 2209 | Ga0070664_100006998 | |||
| 2210 | Ga0070664_100116860 | |||
| 2211 | Ga0070664_100211556 | |||
| 2212 | Ga0070664_100219576 | |||
| 2213 | Ga0070664_100325032 | |||
| 2214 | Ga0070664_100769040 | |||
| 2215 | Ga0070664_101313837 | |||
| 2216 | Ga0068857_100053902 | |||
| 2217 | Ga0068857_100134323 | |||
| 2218 | Ga0068857_100162697 | |||
| 2219 | Ga0068857_100298227 | |||
| 2220 | Ga0068857_101269641 | |||
| 2221 | Ga0068854_100048398 | |||
| 2222 | Ga0068854_100084591 | |||
| 2223 | Ga0068854_100120987 | |||
| 2224 | Ga0068854_100694332 | |||
| 2225 | Ga0068854_100841142 | |||
| 2226 | Ga0068854_100935849 | |||
| 2227 | Ga0068856_100069854 | |||
| 2228 | Ga0068856_100139123 | |||
| 2229 | Ga0068856_100226628 | |||
| 2230 | Ga0068856_101093590 | |||
| 2231 | Ga0070702_100026507 | |||
| 2232 | Ga0068852_100012691 | |||
| 2233 | Ga0068852_100014348 | |||
| 2234 | Ga0068852_100018466 | |||
| 2235 | Ga0068852_100097562 | |||
| 2236 | Ga0068852_100227802 | |||
| 2237 | Ga0068852_100250838 | |||
| 2238 | Ga0068852_100274059 | |||
| 2239 | Ga0068852_100517269 | |||
| 2240 | Ga0068852_100913899 | |||
| 2241 | Ga0068852_100919057 | |||
| 2242 | Ga0068859_100141793 | |||
| 2243 | Ga0068859_100260379 | |||
| 2244 | Ga0068859_100306399 | |||
| 2245 | Ga0068859_100870067 | |||
| 2246 | Ga0068864_100000270 | |||
| 2247 | Ga0068864_100010659 | |||
| 2248 | Ga0068864_100053816 | |||
| 2249 | Ga0068864_100065725 | |||
| 2250 | Ga0068864_100207736 | |||
| 2251 | Ga0068864_100837819 | |||
| 2252 | Ga0068866_10001571 | |||
| 2253 | Ga0068866_10148194 | |||
| 2254 | Ga0068866_10554989 | |||
| 2255 | Ga0068861_100000126 | |||
| 2256 | Ga0068861_100006858 | |||
| 2257 | Ga0068861_100802485 | |||
| 2258 | Ga0068851_10012812 | |||
| 2259 | Ga0068851_10019913 | |||
| 2260 | Ga0068851_10072851 | |||
| 2261 | Ga0068851_10090524 | |||
| 2262 | Ga0068851_10325795 | |||
| 2263 | Ga0068870_10115031 | |||
| 2264 | Ga0068870_10212735 | |||
| 2265 | Ga0068863_100000679 | |||
| 2266 | Ga0068863_100022577 | |||
| 2267 | Ga0068863_100136576 | |||
| 2268 | Ga0068863_100227727 | |||
| 2269 | Ga0068863_100259471 | |||
| 2270 | Ga0068863_100366894 | |||
| 2271 | Ga0068863_101408982 | |||
| 2272 | Ga0068858_100000225 | |||
| 2273 | Ga0068858_100006184 | |||
| 2274 | Ga0068858_100011807 | |||
| 2275 | Ga0068860_100010530 | |||
| 2276 | Ga0068860_100025113 | |||
| 2277 | Ga0068860_100071695 | |||
| 2278 | Ga0068860_100224709 | |||
| 2279 | Ga0068860_100372691 | |||
| 2280 | Ga0068860_100678258 | |||
| 2281 | Ga0068862_100091077 | |||
| 2282 | Ga0068862_100215452 | |||
| 2283 | Ga0068862_100274253 | |||
| 2284 | Ga0068862_100921771 | |||
| 2285 | Ga0070717_11108428 | |||
| 2286 | Ga0075365_10040246 | |||
| 2287 | Ga0075368_10019359 | |||
| 2288 | Ga0075363_100002613 | |||
| 2289 | Ga0075363_100098285 | |||
| 2290 | Ga0075363_100100513 | |||
| 2291 | Ga0075363_100173312 | |||
| 2292 | Ga0075363_100282609 | |||
| 2293 | Ga0075363_100397393 | |||
| 2294 | Ga0075364_10154827 | |||
| 2295 | Ga0075432_10028831 | |||
| 2296 | Ga0075432_10186761 | |||
| 2297 | Ga0070716_100528969 | |||
| 2298 | Ga0075362_10006845 | |||
| 2299 | Ga0075362_10012721 | |||
| 2300 | Ga0075362_10027255 | |||
| 2301 | Ga0075362_10027795 | |||
| 2302 | Ga0075362_10036217 | |||
| 2303 | Ga0075362_10075832 | |||
| 2304 | Ga0075362_10078719 | |||
| 2305 | Ga0075362_10101318 | |||
| 2306 | Ga0075362_10265553 | |||
| 2307 | Ga0075362_10268680 | |||
| 2308 | Ga0075362_10462436 | |||
| 2309 | Ga0075362_10620995 | |||
| 2310 | Ga0075367_10003489 | |||
| 2311 | Ga0075367_10023278 | |||
| 2312 | Ga0075367_10065241 | |||
| 2313 | Ga0075367_10086899 | |||
| 2314 | Ga0075367_10485085 | |||
| 2315 | Ga0075369_10028290 | |||
| 2316 | Ga0075369_10053864 | |||
| 2317 | Ga0075369_10127102 | |||
| 2318 | Ga0075366_10000903 | |||
| 2319 | Ga0075366_10004367 | |||
| 2320 | Ga0075366_10005063 | |||
| 2321 | Ga0075366_10005254 | |||
| 2322 | Ga0075366_10020888 | |||
| 2323 | Ga0075366_10024928 | |||
| 2324 | Ga0075366_10063986 | |||
| 2325 | Ga0075366_10076436 | |||
| 2326 | Ga0075366_10088553 | |||
| 2327 | Ga0075366_10089581 | |||
| 2328 | Ga0075366_10103288 | |||
| 2329 | Ga0075366_10108492 | |||
| 2330 | Ga0075366_10177989 | |||
| 2331 | Ga0075366_10205769 | |||
| 2332 | Ga0075366_10209479 | |||
| 2333 | Ga0075366_10233960 | |||
| 2334 | Ga0075366_10310856 | |||
| 2335 | Ga0075366_10341979 | |||
| 2336 | Ga0075366_10408676 | |||
| 2337 | Ga0075366_10553356 | |||
| 2338 | Ga0075366_10562262 | |||
| 2339 | Ga0075366_10938001 | |||
| 2340 | Ga0075366_10968446 | |||
| 2341 | Ga0097621_100060271 | |||
| 2342 | Ga0097621_100178814 | |||
| 2343 | Ga0097621_100226196 | |||
| 2344 | Ga0097621_100321941 | |||
| 2345 | Ga0097621_100417698 | |||
| 2346 | Ga0097621_100423384 | |||
| 2347 | Ga0075370_10001385 | |||
| 2348 | Ga0075370_10003497 | |||
| 2349 | Ga0075370_10006662 | |||
| 2350 | Ga0075370_10008356 | |||
| 2351 | Ga0075370_10009388 | |||
| 2352 | Ga0075370_10011977 | |||
| 2353 | Ga0075370_10021716 | |||
| 2354 | Ga0075370_10041399 | |||
| 2355 | Ga0075370_10072521 | |||
| 2356 | Ga0075370_10079534 | |||
| 2357 | Ga0075370_10159946 | |||
| 2358 | Ga0075370_10169808 | |||
| 2359 | Ga0075370_10221285 | |||
| 2360 | Ga0075370_10264415 | |||
| 2361 | Ga0075370_10393622 | |||
| 2362 | Ga0075370_10518841 | |||
| 2363 | Ga0068871_100026429 | |||
| 2364 | Ga0068871_100044440 | |||
| 2365 | Ga0068871_100060141 | |||
| 2366 | Ga0068871_100186123 | |||
| 2367 | Ga0068871_100412930 | |||
| 2368 | Ga0068871_100705121 | |||
| 2369 | Ga0068871_100816192 | |||
| 2370 | Ga0075430_100464806 | |||
| 2371 | Ga0075430_100742798 | |||
| 2372 | Ga0075434_100258587 | |||
| 2373 | Ga0068865_100031632 | |||
| 2374 | Ga0068865_100242195 | |||
| 2375 | Ga0068865_100360419 | |||
| 2376 | Ga0068865_100717727 | |||
| 2377 | Ga0097620_100141795 | |||
| 2378 | Ga0097620_100260380 | |||
| 2379 | Ga0097620_100306401 | |||
| 2380 | Ga0097620_100870165 | |||
| 2381 | Ga0075435_100684643 | |||
| 2382 | Ga0105244_10002369 | |||
| 2383 | Ga0105244_10080538 | |||
| 2384 | Ga0105240_10044244 | |||
| 2385 | Ga0105240_10376389 | |||
| 2386 | Ga0105240_11666270 | |||
| 2387 | Ga0111539_10496588 | |||
| 2388 | Ga0111539_11076507 | |||
| 2389 | Ga0105245_10011498 | |||
| 2390 | Ga0105245_10044575 | |||
| 2391 | Ga0105245_10429981 | |||
| 2392 | Ga0105245_10478639 | |||
| 2393 | Ga0105245_10578857 | |||
| 2394 | Ga0105245_10587549 | |||
| 2395 | Ga0105245_11031379 | |||
| 2396 | Ga0105247_10783640 | |||
| 2397 | Ga0105243_10002142 | |||
| 2398 | Ga0105243_10002791 | |||
| 2399 | Ga0105243_10006295 | |||
| 2400 | Ga0105243_10066462 | |||
| 2401 | Ga0105243_10195426 | |||
| 2402 | Ga0105243_10211999 | |||
| 2403 | Ga0105243_10307811 | |||
| 2404 | Ga0105243_10529961 | |||
| 2405 | Ga0105243_10626920 | |||
| 2406 | Ga0105243_10824709 | |||
| 2407 | Ga0105243_11023162 | |||
| 2408 | Ga0105241_10207015 | |||
| 2409 | Ga0105241_10680647 | |||
| 2410 | Ga0105241_11448252 | |||
| 2411 | Ga0105242_10179763 | |||
| 2412 | Ga0105242_10785592 | |||
| 2413 | Ga0105242_10798183 | |||
| 2414 | Ga0105242_11464865 | |||
| 2415 | Ga0105248_10020776 | |||
| 2416 | Ga0105248_10069162 | |||
| 2417 | Ga0105248_10103800 | |||
| 2418 | Ga0105248_10140104 | |||
| 2419 | Ga0105248_10223348 | |||
| 2420 | Ga0105248_10381645 | |||
| 2421 | Ga0105248_11065491 | |||
| 2422 | Ga0105248_11365687 | |||
| 2423 | Ga0105237_10038448 | |||
| 2424 | Ga0105237_10210367 | |||
| 2425 | Ga0105237_10211438 | |||
| 2426 | Ga0105237_10584019 | |||
| 2427 | Ga0105237_11719452 | |||
| 2428 | Ga0105238_10007445 | |||
| 2429 | Ga0105238_10237419 | |||
| 2430 | Ga0105238_10554246 | |||
| 2431 | Ga0105238_10765782 | |||
| 2432 | Ga0105238_12092877 | |||
| 2433 | Ga0105249_10020223 | |||
| 2434 | Ga0105249_10255488 | |||
| 2435 | Ga0105249_10511243 | |||
| 2436 | Ga0105239_10008553 | |||
| 2437 | Ga0105239_10014688 | |||
| 2438 | Ga0105239_10178863 | |||
| 2439 | Ga0105239_11428694 | |||
| 2440 | Ga0105239_11885533 | |||
| 2441 | Ga0105246_10116212 | |||
| 2442 | Ga0105246_10261339 | |||
| 2443 | Ga0105246_11072474 | |||
| 2444 | Ga0105246_11128730 | |||
| 2445 | Ga0157347_1007959 | |||
| 2446 | Ga0157373_10000764 | |||
| 2447 | Ga0157373_10073883 | |||
| 2448 | Ga0157373_10289715 | |||
| 2449 | Ga0157371_10102848 | |||
| 2450 | Ga0157371_10524539 | |||
| 2451 | Ga0157371_10891869 | |||
| 2452 | Ga0157370_10005548 | |||
| 2453 | Ga0157370_10925268 | |||
| 2454 | Ga0157374_10149927 | |||
| 2455 | Ga0157374_10576304 | |||
| 2456 | Ga0157374_11938732 | |||
| 2457 | Ga0157378_10204597 | |||
| 2458 | Ga0157378_10702504 | |||
| 2459 | Ga0163162_10010080 | |||
| 2460 | Ga0163162_10077396 | |||
| 2461 | Ga0163162_10093880 | |||
| 2462 | Ga0163162_10203206 | |||
| 2463 | Ga0163162_10242856 | |||
| 2464 | Ga0163162_10909509 | |||
| 2465 | Ga0157372_10024604 | |||
| 2466 | Ga0157372_10276250 | |||
| 2467 | Ga0157375_10010897 | |||
| 2468 | Ga0157375_10014628 | |||
| 2469 | Ga0157375_10051979 | |||
| 2470 | Ga0157375_10159166 | |||
| 2471 | Ga0157375_10277498 | |||
| 2472 | Ga0157375_10364097 | |||
| 2473 | Ga0157375_10404100 | |||
| 2474 | Ga0157375_10524196 | |||
| 2475 | Ga0157375_10626044 | |||
| 2476 | Ga0157375_10688444 | |||
| 2477 | Ga0163163_10004422 | |||
| 2478 | Ga0163163_10961423 | |||
| 2479 | Ga0157380_10001564 | |||
| 2480 | Ga0157380_10016118 | |||
| 2481 | Ga0157380_10343089 | |||
| 2482 | Ga0157380_11397059 | |||
| 2483 | Ga0182008_10000794 | |||
| 2484 | Ga0182008_10043908 | |||
| 2485 | Ga0182008_10053057 | |||
| 2486 | Ga0157377_10000464 | |||
| 2487 | Ga0157377_10074914 | |||
| 2488 | Ga0157377_10124000 | |||
| 2489 | Ga0157379_10005033 | |||
| 2490 | Ga0157379_10012124 | |||
| 2491 | Ga0157379_10040104 | |||
| 2492 | Ga0157379_10304460 | |||
| 2493 | Ga0157376_10001974 | |||
| 2494 | Ga0157376_10012956 | |||
| 2495 | Ga0157376_10787806 | |||
| 2496 | Ga0157376_11260089 | |||
| 2497 | Ga0157376_11488441 | |||
| 2498 | Ga0157376_11808905 | |||
| 2499 | Ga0182006_1000690 | |||
| 2500 | Ga0182007_10004716 | |||
| 2501 | Ga0182007_10006853 | |||
| 2502 | Ga0182007_10394058 | |||
| 2503 | Ga0182005_1027614 | |||
| 2504 | Ga0182005_1082344 | |||
| 2505 | Ga0183362_10002 | |||
| 2506 | Ga0163161_10000161 | |||
| 2507 | Ga0163161_10016112 | |||
| 2508 | Ga0163161_10039405 | |||
| 2509 | Ga0163161_10067154 | |||
| 2510 | Ga0163161_10071647 | |||
| 2511 | Ga0163161_10341235 | |||
| 2512 | Ga0163161_10352220 | |||
| 2513 | Ga0163161_10851943 | |||
| 2514 | Ga0213874_10130485 | |||
| 2515 | Ga0213876_10101220 | |||
| 2516 | Ga0209435_100002 | |||
| 2517 | Ga0209436_103397 | |||
| 2518 | Ga0209436_106002 | |||
| 2519 | Ga0209672_100711 | |||
| 2520 | Ga0209672_101238 | |||
| 2521 | Ga0209147_100450 | |||
| 2522 | Ga0209147_103013 | |||
| 2523 | Ga0209563_100007 | |||
| 2524 | Ga0209258_100093 | |||
| 2525 | Ga0209258_100519 | |||
| 2526 | Ga0207425_1001011 | |||
| 2527 | Ga0207425_1001306 | |||
| 2528 | Ga0207425_1004714 | |||
| 2529 | Ga0207425_1022335 | |||
| 2530 | Ga0207425_1023670 | |||
| 2531 | Ga0207425_1038846 | |||
| 2532 | Ga0207425_1053424 | |||
| 2533 | Ga0209646_1000001 | |||
| 2534 | Ga0209646_1000023 | |||
| 2535 | Ga0209026_1000040 | |||
| 2536 | Ga0209026_1013794 | |||
| 2537 | Ga0209677_109163 | |||
| 2538 | Ga0209148_1000007 | |||
| 2539 | Ga0209148_1000067 | |||
| 2540 | Ga0209148_1000440 | |||
| 2541 | Ga0209759_1000001 | |||
| 2542 | Ga0209129_1000024 | |||
| 2543 | Ga0209129_1001645 | |||
| 2544 | Ga0209129_1008680 | |||
| 2545 | Ga0209129_1016572 | |||
| 2546 | Ga0209129_1017663 | |||
| 2547 | Ga0209129_1035134 | |||
| 2548 | Ga0209565_1000039 | |||
| 2549 | Ga0209565_1000080 | |||
| 2550 | Ga0209565_1000583 | |||
| 2551 | Ga0209565_1000645 | |||
| 2552 | Ga0209565_1000876 | |||
| 2553 | Ga0209673_1000088 | |||
| 2554 | Ga0209673_1000284 | |||
| 2555 | Ga0209673_1001443 | |||
| 2556 | Ga0209673_1002254 | |||
| 2557 | Ga0209130_1000040 | |||
| 2558 | Ga0209130_1000346 | |||
| 2559 | Ga0209130_1000757 | |||
| 2560 | Ga0209130_1001429 | |||
| 2561 | Ga0209675_1000030 | |||
| 2562 | Ga0209675_1000133 | |||
| 2563 | Ga0209675_1000471 | |||
| 2564 | Ga0209675_1000695 | |||
| 2565 | Ga0209675_1001131 | |||
| 2566 | Ga0209675_1004254 | |||
| 2567 | Ga0209675_1020620 | |||
| 2568 | Ga0209676_1000028 | |||
| 2569 | Ga0209676_1000073 | |||
| 2570 | Ga0209676_1000142 | |||
| 2571 | Ga0209676_1000317 | |||
| 2572 | Ga0209676_1000383 | |||
| 2573 | Ga0209676_1013166 | |||
| 2574 | Ga0209676_1042675 | |||
| 2575 | Ga0209025_1000088 | |||
| 2576 | Ga0209025_1000104 | |||
| 2577 | Ga0209025_1001526 | |||
| 2578 | Ga0209025_1002084 | |||
| 2579 | Ga0209025_1004730 | |||
| 2580 | Ga0209025_1006776 | |||
| 2581 | Ga0209025_1011727 | |||
| 2582 | Ga0209025_1013516 | |||
| 2583 | Ga0209025_1040081 | |||
| 2584 | Ga0209025_1095901 | |||
| 2585 | Ga0209025_1095980 | |||
| 2586 | Ga0209564_1000313 | |||
| 2587 | Ga0209564_1000823 | |||
| 2588 | Ga0209564_1001505 | |||
| 2589 | Ga0209564_1002447 | |||
| 2590 | Ga0209564_1005212 | |||
| 2591 | Ga0209758_1000510 | |||
| 2592 | Ga0209758_1000679 | |||
| 2593 | Ga0209758_1003918 | |||
| 2594 | Ga0209758_1005216 | |||
| 2595 | Ga0209758_1050082 | |||
| 2596 | Ga0209050_1000008 | |||
| 2597 | Ga0209050_1000072 | |||
| 2598 | Ga0209050_1000786 | |||
| 2599 | Ga0209050_1000952 | |||
| 2600 | Ga0209050_1001577 | |||
| 2601 | Ga0209050_1005629 | |||
| 2602 | Ga0209050_1015985 | |||
| 2603 | Ga0209050_1034091 | |||
| 2604 | Ga0209256_1000096 | |||
| 2605 | Ga0209256_1000151 | |||
| 2606 | Ga0209256_1000256 | |||
| 2607 | Ga0209256_1040804 | |||
| 2608 | Ga0209256_1056004 | |||
| 2609 | Ga0207426_1000049 | |||
| 2610 | Ga0207426_1000188 | |||
| 2611 | Ga0207426_1000315 | |||
| 2612 | Ga0207426_1001354 | |||
| 2613 | Ga0209051_1000005 | |||
| 2614 | Ga0209051_1000015 | |||
| 2615 | Ga0209051_1000056 | |||
| 2616 | Ga0209051_1000161 | |||
| 2617 | Ga0209051_1000259 | |||
| 2618 | Ga0209051_1000416 | |||
| 2619 | Ga0209051_1084184 | |||
| 2620 | Ga0209051_1136246 | |||
| 2621 | Ga0209257_1000031 | |||
| 2622 | Ga0209257_1000037 | |||
| 2623 | Ga0209257_1000116 | |||
| 2624 | Ga0209257_1002902 | |||
| 2625 | Ga0209257_1004513 | |||
| 2626 | Ga0209257_1022591 | |||
| 2627 | Ga0207697_10046109 | |||
| 2628 | Ga0207697_10070620 | |||
| 2629 | Ga0207656_10020678 | |||
| 2630 | Ga0207656_10027516 | |||
| 2631 | Ga0207656_10103921 | |||
| 2632 | Ga0207656_10234090 | |||
| 2633 | Ga0207656_10328922 | |||
| 2634 | Ga0207655_1015947 | |||
| 2635 | Ga0207682_10032758 | |||
| 2636 | Ga0207682_10044699 | |||
| 2637 | Ga0207682_10247434 | |||
| 2638 | Ga0207642_10006015 | |||
| 2639 | Ga0207642_10024373 | |||
| 2640 | Ga0207688_10078411 | |||
| 2641 | Ga0207688_10188104 | |||
| 2642 | Ga0207688_10652489 | |||
| 2643 | Ga0207680_10028766 | |||
| 2644 | Ga0207680_10191237 | |||
| 2645 | Ga0207647_10357268 | |||
| 2646 | Ga0207645_10004614 | |||
| 2647 | Ga0207645_10041857 | |||
| 2648 | Ga0207645_10309051 | |||
| 2649 | Ga0207643_10009830 | |||
| 2650 | Ga0207643_10166620 | |||
| 2651 | Ga0207643_10252977 | |||
| 2652 | Ga0207705_10164082 | |||
| 2653 | Ga0207684_10119778 | |||
| 2654 | Ga0207654_10402338 | |||
| 2655 | Ga0207695_10130175 | |||
| 2656 | Ga0207695_10145157 | |||
| 2657 | Ga0207671_10075823 | |||
| 2658 | Ga0207671_10219270 | |||
| 2659 | Ga0207671_10494572 | |||
| 2660 | Ga0207660_10026081 | |||
| 2661 | Ga0207662_10013391 | |||
| 2662 | Ga0207662_10089116 | |||
| 2663 | Ga0207657_10038426 | |||
| 2664 | Ga0207657_10082664 | |||
| 2665 | Ga0207657_10308033 | |||
| 2666 | Ga0207657_10320421 | |||
| 2667 | Ga0207649_10314732 | |||
| 2668 | Ga0207649_10762319 | |||
| 2669 | Ga0207649_10792593 | |||
| 2670 | Ga0207652_10073735 | |||
| 2671 | Ga0207646_10015873 | |||
| 2672 | Ga0207681_10000826 | |||
| 2673 | Ga0207681_10008765 | |||
| 2674 | Ga0207681_10114005 | |||
| 2675 | Ga0207681_10243304 | |||
| 2676 | Ga0207694_10041437 | |||
| 2677 | Ga0207694_10111689 | |||
| 2678 | Ga0207694_10164283 | |||
| 2679 | Ga0207694_10603891 | |||
| 2680 | Ga0207650_10120072 | |||
| 2681 | Ga0207650_10204515 | |||
| 2682 | Ga0207650_10224507 | |||
| 2683 | Ga0207650_10315573 | |||
| 2684 | Ga0207650_10512274 | |||
| 2685 | Ga0207650_10576954 | |||
| 2686 | Ga0207659_10001869 | |||
| 2687 | Ga0207659_10029827 | |||
| 2688 | Ga0207659_10839328 | |||
| 2689 | Ga0207659_11273276 | |||
| 2690 | Ga0207687_10013703 | |||
| 2691 | Ga0207687_10056676 | |||
| 2692 | Ga0207687_10211834 | |||
| 2693 | Ga0207687_10421403 | |||
| 2694 | Ga0207644_10000223 | |||
| 2695 | Ga0207644_10008993 | |||
| 2696 | Ga0207644_10065196 | |||
| 2697 | Ga0207644_10070563 | |||
| 2698 | Ga0207644_10347830 | |||
| 2699 | Ga0207644_10382331 | |||
| 2700 | Ga0207644_10672504 | |||
| 2701 | Ga0207690_10032585 | |||
| 2702 | Ga0207690_10456255 | |||
| 2703 | Ga0207690_10664135 | |||
| 2704 | Ga0207706_10000736 | |||
| 2705 | Ga0207706_10012885 | |||
| 2706 | Ga0207706_10172590 | |||
| 2707 | Ga0207706_10379576 | |||
| 2708 | Ga0207706_10573407 | |||
| 2709 | Ga0207706_10720062 | |||
| 2710 | Ga0207706_10830020 | |||
| 2711 | Ga0207706_10850399 | |||
| 2712 | Ga0207686_10030421 | |||
| 2713 | Ga0207686_10088915 | |||
| 2714 | Ga0207686_10476777 | |||
| 2715 | Ga0207709_10000771 | |||
| 2716 | Ga0207709_10001444 | |||
| 2717 | Ga0207709_10011940 | |||
| 2718 | Ga0207709_10012398 | |||
| 2719 | Ga0207709_10039692 | |||
| 2720 | Ga0207709_10076505 | |||
| 2721 | Ga0207709_10157185 | |||
| 2722 | Ga0207709_10616933 | |||
| 2723 | Ga0207709_10650558 | |||
| 2724 | Ga0207669_10002159 | |||
| 2725 | Ga0207669_10636871 | |||
| 2726 | Ga0207669_11385823 | |||
| 2727 | Ga0207704_10002371 | |||
| 2728 | Ga0207704_10205529 | |||
| 2729 | Ga0207704_10221663 | |||
| 2730 | Ga0207704_10262680 | |||
| 2731 | Ga0207704_10376209 | |||
| 2732 | Ga0207704_10404880 | |||
| 2733 | Ga0207665_10140128 | |||
| 2734 | Ga0207691_10002576 | |||
| 2735 | Ga0207691_10023739 | |||
| 2736 | Ga0207691_10075275 | |||
| 2737 | Ga0207691_10081432 | |||
| 2738 | Ga0207691_10087282 | |||
| 2739 | Ga0207691_10153924 | |||
| 2740 | Ga0207691_10337776 | |||
| 2741 | Ga0207691_10363434 | |||
| 2742 | Ga0207711_10002181 | |||
| 2743 | Ga0207711_10008423 | |||
| 2744 | Ga0207711_10093737 | |||
| 2745 | Ga0207711_10205036 | |||
| 2746 | Ga0207711_10501111 | |||
| 2747 | Ga0207711_10666528 | |||
| 2748 | Ga0207689_10000259 | |||
| 2749 | Ga0207689_10006174 | |||
| 2750 | Ga0207689_10018504 | |||
| 2751 | Ga0207689_10120756 | |||
| 2752 | Ga0207689_10180386 | |||
| 2753 | Ga0207689_10202186 | |||
| 2754 | Ga0207689_10202319 | |||
| 2755 | Ga0207689_10269083 | |||
| 2756 | Ga0207689_10644972 | |||
| 2757 | Ga0207689_10983709 | |||
| 2758 | Ga0207661_10025802 | |||
| 2759 | Ga0207661_10151431 | |||
| 2760 | Ga0207679_10044865 | |||
| 2761 | Ga0207679_10134308 | |||
| 2762 | Ga0207679_10212816 | |||
| 2763 | Ga0207679_10548238 | |||
| 2764 | Ga0207679_11094158 | |||
| 2765 | Ga0207667_10110625 | |||
| 2766 | Ga0207651_10005547 | |||
| 2767 | Ga0207651_10100796 | |||
| 2768 | Ga0207651_10128082 | |||
| 2769 | Ga0207651_10140033 | |||
| 2770 | Ga0207651_10184316 | |||
| 2771 | Ga0207651_10317868 | |||
| 2772 | Ga0207651_10330439 | |||
| 2773 | Ga0207651_10656942 | |||
| 2774 | Ga0207651_11063547 | |||
| 2775 | Ga0207712_10013171 | |||
| 2776 | Ga0207712_10375071 | |||
| 2777 | Ga0207712_10391396 | |||
| 2778 | Ga0207668_10030116 | |||
| 2779 | Ga0207668_10524630 | |||
| 2780 | Ga0207640_10072192 | |||
| 2781 | Ga0207640_11067399 | |||
| 2782 | Ga0207658_10002825 | |||
| 2783 | Ga0207658_10005834 | |||
| 2784 | Ga0207658_10013147 | |||
| 2785 | Ga0207658_10411655 | |||
| 2786 | Ga0207658_10742933 | |||
| 2787 | Ga0207658_10804600 | |||
| 2788 | Ga0207658_11137489 | |||
| 2789 | Ga0207658_11537809 | |||
| 2790 | Ga0207677_10001179 | |||
| 2791 | Ga0207677_10001436 | |||
| 2792 | Ga0207677_10015394 | |||
| 2793 | Ga0207677_10040367 | |||
| 2794 | Ga0207677_10117791 | |||
| 2795 | Ga0207677_10260398 | |||
| 2796 | Ga0207677_10426178 | |||
| 2797 | Ga0207703_10000408 | |||
| 2798 | Ga0207703_10018563 | |||
| 2799 | Ga0207703_10036310 | |||
| 2800 | Ga0207703_10037004 | |||
| 2801 | Ga0207703_11561808 | |||
| 2802 | Ga0207639_10043276 | |||
| 2803 | Ga0207639_10278290 | |||
| 2804 | Ga0207639_10811434 | |||
| 2805 | Ga0207639_11560680 | |||
| 2806 | Ga0207678_10005998 | |||
| 2807 | Ga0207678_10049813 | |||
| 2808 | Ga0207678_10171827 | |||
| 2809 | Ga0207678_10641644 | |||
| 2810 | Ga0207702_10037491 | |||
| 2811 | Ga0207702_10248514 | |||
| 2812 | Ga0207702_10979134 | |||
| 2813 | Ga0207702_11659806 | |||
| 2814 | Ga0207641_10002065 | |||
| 2815 | Ga0207641_10004421 | |||
| 2816 | Ga0207641_10037985 | |||
| 2817 | Ga0207641_10135068 | |||
| 2818 | Ga0207641_10136517 | |||
| 2819 | Ga0207641_10188888 | |||
| 2820 | Ga0207648_10000686 | |||
| 2821 | Ga0207648_10012681 | |||
| 2822 | Ga0207648_10017873 | |||
| 2823 | Ga0207648_10019036 | |||
| 2824 | Ga0207648_10044650 | |||
| 2825 | Ga0207648_10292659 | |||
| 2826 | Ga0207648_10322549 | |||
| 2827 | Ga0207648_10400077 | |||
| 2828 | Ga0207648_10516637 | |||
| 2829 | Ga0207648_10522031 | |||
| 2830 | Ga0207648_11580882 | |||
| 2831 | Ga0207676_10000269 | |||
| 2832 | Ga0207676_10054658 | |||
| 2833 | Ga0207676_10065398 | |||
| 2834 | Ga0207676_10161348 | |||
| 2835 | Ga0207676_11046571 | |||
| 2836 | Ga0207676_11577421 | |||
| 2837 | Ga0207674_10016515 | |||
| 2838 | Ga0207674_10029563 | |||
| 2839 | Ga0207674_10038674 | |||
| 2840 | Ga0207674_10139045 | |||
| 2841 | Ga0207674_10411475 | |||
| 2842 | Ga0207674_10604400 | |||
| 2843 | Ga0207674_10921920 | |||
| 2844 | Ga0207674_11470051 | |||
| 2845 | Ga0207675_100000307 | |||
| 2846 | Ga0207675_100001416 | |||
| 2847 | Ga0207675_100076361 | |||
| 2848 | Ga0207675_100466401 | |||
| 2849 | Ga0207683_10001051 | |||
| 2850 | Ga0207683_10066755 | |||
| 2851 | Ga0207683_10237209 | |||
| 2852 | Ga0207683_10385382 | |||
| 2853 | Ga0207683_10416789 | |||
| 2854 | Ga0207683_10564333 | |||
| 2855 | Ga0207683_10569559 | |||
| 2856 | Ga0207683_11007022 | |||
| 2857 | Ga0207683_11075958 | |||
| 2858 | Ga0207698_10037962 | |||
| 2859 | Ga0207698_10090847 | |||
| 2860 | Ga0207698_10104934 | |||
| 2861 | Ga0207698_10109147 | |||
| 2862 | Ga0207698_10196658 | |||
| 2863 | Ga0207698_10210647 | |||
| 2864 | Ga0207698_10337349 | |||
| 2865 | Ga0207698_10402939 | |||
| 2866 | Ga0207698_10411559 | |||
| 2867 | Ga0207698_10421196 | |||
| 2868 | Ga0207698_10425227 | |||
| 2869 | Ga0207698_10549355 | |||
| 2870 | Ga0207698_10899207 | |||
| 2871 | Ga0207698_11212884 | |||
| 2872 | Ga0207698_11341165 | |||
| 2873 | Ga0209996_1001867 | |||
| 2874 | Ga0209968_1000702 | |||
| 2875 | Ga0209282_1011860 | |||
| 2876 | Ga0209966_1000040 | |||
| 2877 | Ga0209998_10021105 | |||
| 2878 | Ga0209813_10023158 | |||
| 2879 | Ga0209813_10222054 | |||
| 2880 | Ga0209974_10006173 | |||
| 2881 | Ga0207428_10578269 | |||
| 2882 | Ga0268266_10010170 | |||
| 2883 | Ga0268266_10061450 | |||
| 2884 | Ga0268266_10317098 | |||
| 2885 | Ga0268266_10455050 | |||
| 2886 | Ga0268266_10817657 | |||
| 2887 | Ga0268265_10087552 | |||
| 2888 | Ga0268265_10179219 | |||
| 2889 | Ga0268265_10260150 | |||
| 2890 | Ga0268265_10260891 | |||
| 2891 | Ga0268265_10268500 | |||
| 2892 | Ga0268265_11578579 | |||
| 2893 | Ga0268264_10004973 | |||
| 2894 | Ga0268264_10019709 | |||
| 2895 | Ga0268264_10077625 | |||
| 2896 | Ga0268264_10180300 | |||
| 2897 | Ga0268264_10269302 | |||
| 2898 | Ga0268264_10275052 | |||
| 2899 | Ga0268264_10825647 | |||
| 2900 | Ga0307517_10000160 | |||
| 2901 | Ga0307517_10000395 | |||
| 2902 | Ga0307517_10074719 | |||
| 2903 | Ga0307517_10179818 | |||
| 2904 | Ga0307515_10000006 | |||
| 2905 | Ga0307515_10000160 | |||
| 2906 | Ga0307515_10000332 | |||
| 2907 | Ga0307515_10000893 | |||
| 2908 | Ga0307515_10001283 | |||
| 2909 | Ga0307515_10007639 | |||
| 2910 | Ga0307515_10012223 | |||
| 2911 | Ga0307515_10022830 | |||
| 2912 | Ga0307515_10033807 | |||
| 2913 | Ga0307515_10060601 | |||
| 2914 | Ga0307515_10080735 | |||
| 2915 | Ga0307515_10147322 | |||
| 2916 | Ga0307515_10179656 | |||
| 2917 | Ga0307515_10206740 | |||
| 2918 | Ga0307515_10223497 | |||
| 2919 | Ga0307515_10281623 | |||
| 2920 | Ga0307515_10364123 | |||
| 2921 | Ga0307515_10635715 | |||
| 2922 | Ga0307511_10013142 | |||
| 2923 | Ga0307512_10041345 | |||
| 2924 | Ga0307512_10102024 | |||
| 2925 | Ga0307512_10139063 | |||
| 2926 | Ga0307512_10289617 | |||
| 2927 | Ga0316177_1091352 | |||
| 2928 | Ga0316176_1071075 | |||
| 2929 | Ga0314311_1059274 | |||
| 2930 | Ga0316179_1119471 | |||
| 2931 | Ga0316178_1094522 | |||
| 2932 | Ga0316180_1037515 | |||
| 2933 | Ga0316183_1042467 | |||
| 2934 | Ga0316181_1174890 | |||
| 2935 | Ga0316182_1176401 | |||
| 2936 | Ga0316182_1440727 | |||
| 2937 | Ga0265327_10002595 | |||
| 2938 | Ga0307513_10003528 | |||
| 2939 | Ga0307513_10020560 | |||
| 2940 | Ga0307513_10037147 | |||
| 2941 | Ga0307513_10097939 | |||
| 2942 | Ga0307513_10215434 | |||
| 2943 | Ga0307513_11091140 | |||
| 2944 | Ga0307509_10000212 | |||
| 2945 | Ga0307509_10000317 | |||
| 2946 | Ga0307509_10001515 | |||
| 2947 | Ga0307509_10002052 | |||
| 2948 | Ga0307509_10057914 | |||
| 2949 | Ga0307509_10117990 | |||
| 2950 | Ga0307509_10161551 | |||
| 2951 | Ga0307509_10250752 | |||
| 2952 | Ga0307509_10478928 | |||
| 2953 | Ga0307509_10529824 | |||
| 2954 | Ga0307408_100026572 | |||
| 2955 | Ga0307408_100073052 | |||
| 2956 | Ga0307408_100113754 | |||
| 2957 | Ga0307408_100199041 | |||
| 2958 | Ga0307408_100225286 | |||
| 2959 | Ga0307408_100323704 | |||
| 2960 | Ga0307408_100912915 | |||
| 2961 | Ga0307508_10000097 | |||
| 2962 | Ga0307508_10000332 | |||
| 2963 | Ga0307508_10001697 | |||
| 2964 | Ga0307508_10005499 | |||
| 2965 | Ga0307508_10006375 | |||
| 2966 | Ga0307508_10118737 | |||
| 2967 | Ga0307508_10191308 | |||
| 2968 | Ga0307508_10394920 | |||
| 2969 | Ga0307514_10000795 | |||
| 2970 | Ga0307514_10003838 | |||
| 2971 | Ga0307514_10005414 | |||
| 2972 | Ga0307514_10026427 | |||
| 2973 | Ga0307514_10066783 | |||
| 2974 | Ga0307514_10176693 | |||
| 2975 | Ga0307516_10006132 | |||
| 2976 | Ga0307516_10126756 | |||
| 2977 | Ga0307516_10166406 | |||
| 2978 | Ga0307516_10269308 | |||
| 2979 | Ga0307516_10307928 | |||
| 2980 | Ga0307516_10513847 | |||
| 2981 | Ga0307405_10008706 | |||
| 2982 | Ga0307405_10044351 | |||
| 2983 | Ga0307405_10199037 | |||
| 2984 | Ga0307405_10510250 | |||
| 2985 | Ga0307405_10542540 | |||
| 2986 | Ga0307405_10948442 | |||
| 2987 | Ga0307405_11726206 | |||
| 2988 | Ga0307413_10709507 | |||
| 2989 | Ga0307413_10984130 | |||
| 2990 | Ga0307410_10450209 | |||
| 2991 | Ga0307410_10678872 | |||
| 2992 | Ga0307406_10067497 | |||
| 2993 | Ga0307406_10083841 | |||
| 2994 | Ga0307406_10717461 | |||
| 2995 | Ga0307406_11592248 | |||
| 2996 | Ga0307412_10017936 | |||
| 2997 | Ga0307412_10032642 | |||
| 2998 | Ga0307412_10096348 | |||
| 2999 | Ga0307412_10203425 | |||
| 3000 | Ga0307412_10309707 | |||
| 3001 | Ga0307412_10625997 | |||
| 3002 | Ga0307412_11142263 | |||
| 3003 | Ga0307409_100005809 | |||
| 3004 | Ga0307409_101227328 | |||
| 3005 | Ga0307416_100001574 | |||
| 3006 | Ga0307416_100216574 | |||
| 3007 | Ga0307416_100360975 | |||
| 3008 | Ga0307416_100420709 | |||
| 3009 | Ga0307416_100891181 | |||
| 3010 | Ga0307414_10142492 | |||
| 3011 | Ga0307414_10173251 | |||
| 3012 | Ga0307414_11522563 | |||
| 3013 | Ga0307411_10013253 | |||
| 3014 | Ga0307411_10132222 | |||
| 3015 | Ga0307411_10780284 | |||
| 3016 | Ga0307415_100007021 | |||
| 3017 | Ga0307507_10269557 | |||
| 3018 | Ga0307507_10369216 | |||
| 3019 | Ga0307510_10129347 | |||
| 3020 | Ga0307510_10262467 | |||
| 3021 | Ga0307510_10395991 | |||
| 3022 | Ga0307510_10538721 | |||
| 3023 | Ga0373930_0047804 | |||
| 3024 | Ga0373948_0053027 | |||
| 3025 | Ga0373938_0083037 | |||
| 3026 | Ga0373926_0317095 | |||
| 3027 | Ga0373929_0004656 | |||
| 3028 | Ga0373940_0078320 | |||
| 3029 | Ga0373944_0026045 | |||
| 3030 | Ga0373923_0056861 | |||
| 3031 | Ga0373923_0151710 | |||
| 3032 | Ga0373932_0020198 | |||
| 3033 | Ga0373932_0059406 | |||
| 3034 | Ga0373936_0001484 | |||
| 3035 | Ga0373936_0270213 | |||
| 3036 | Ga0373941_0021775 | |||
| 3037 | Ga0373956_0089353 | |||
| 3038 | Ga0373943_0008038 | |||
| 3039 | Ga0373943_0082489 | |||
| 3040 | Ga0373946_0124206 | |||
| 3041 | Ga0373962_0098964 | |||
| 3042 | Ga0373924_0001472 | |||
| 3043 | Ga0373931_0010336 | |||
| 3044 | Ga0373935_0166599 | |||
| 3045 | Ga0373935_0418713 | |||
| 3046 | Ga0373935_0585758 | |||
| 3047 | Ga0373927_0032371 | |||
| 3048 | Ga0373947_0162803 | |||
| 3049 | Ga0373947_0732890 | |||
| 3050 | Ga0373937_0171129 | |||
| 3051 | Ga0373937_0539793 | |||
| 3052 | Ga0373925_0125496 | |||
| 3053 | Ga0395899_0000970 | |||
| 3054 | Ga0395899_0001451 | |||
| 3055 | Ga0395899_0003277 | |||
| 3056 | Ga0395899_0115511 | |||
| 3057 | Ga0395900_0000091 | |||
| 3058 | Ga0395900_0000602 | |||
| 3059 | Ga0395900_0006947 | |||
| 3060 | Ga0395900_0012073 | |||
| 3061 | Ga0395900_0109955 | |||
| 3062 | Ga0395900_0313416 | |||
| 3063 | Ga0395898_0008585 | |||
| 3064 | Ga0395898_0304421 | |||
| 3065 | Ga0395898_0310389 | |||
| 3066 | Ga0395898_0708158 | |||
| 3067 | Ga0395905_0000269 | |||
| 3068 | Ga0395905_0003396 | |||
| 3069 | Ga0395905_0008793 | |||
| 3070 | Ga0395905_0011217 | |||
| 3071 | Ga0395905_0018561 | |||
| 3072 | Ga0395905_0115052 | |||
| 3073 | Ga0395905_0136166 | |||
| 3074 | Ga0395905_0137658 | |||
| 3075 | Ga0395905_0237491 | |||
| 3076 | Ga0395905_0243446 | |||
| 3077 | Ga0395905_0603517 | |||
| 3078 | Ga0395901_0010721 | |||
| 3079 | Ga0395901_0085465 | |||
| 3080 | Ga0395901_0137392 | |||
| 3081 | Ga0395901_0646484 | |||
| 3082 | Ga0395901_1085880 | |||
| 3083 | Ga0436365_1128978 | |||
| 3084 | Ga0436363_1660049 | |||
| 3085 | Ga0439436_0052251 | |||
| 3086 | Ga0439439_0039272 | |||
| 3087 | Ga0439439_0047623 | |||
| 3088 | Ga0439439_0109082 | |||
| 3089 | Ga0439447_025014 | |||
| 3090 | Ga0439465_0248345 | |||
| 3091 | Ga0451791_0516807 | |||
| 3092 | Ga0451791_1822013 | |||
| 3093 | Ga0451793_0849783 | |||
| 3094 | Ga0451797_0036350 | |||
| 3095 | Ga0451795_1156050 | |||
| 3096 | Ga0451798_0365603 | |||
| 3097 | Ga0451798_0783119 | |||
| 3098 | Ga0451798_1050572 | |||
| 3099 | Ga0451798_1073454 | |||
| 3100 | Ga0451800_0507924 | |||
| 3101 | Ga0451800_1125983 | |||
| 3102 | Ga0451807_0531094 | |||
| 3103 | Ga0451807_0955082 | |||
| 3104 | Ga0451833_1039235 | |||
| 3105 | Ga0451839_0995859 | |||
| 3106 | Ga0451845_0395844 | |||
| 3107 | Ga0451847_0890968 | |||
| 3108 | Ga0451849_0455082 | |||
| 3109 | Ga0451849_0763045 | |||
| 3110 | Ga0451855_0676908 | |||
| 3111 | Ga0451853_0929926 | |||
| 3112 | Ga0451853_2031670 | |||
| 3113 | Ga0451853_2256767 | |||
| 3114 | Ga0451853_2771872 | |||
| 3115 | Ga0439433_0013375 | |||
| 3116 | Ga0439433_0019350 | |||
| 3117 | Ga0439442_009722 | |||
| 3118 | Ga0439445_0055849 | |||
| 3119 | Ga0439432_075318 | |||
| 3120 | Ga0439432_200791 | |||
| 3121 | Ga0439449_0001455 | |||
| 3122 | Ga0439449_0012086 | |||
| 3123 | Ga0439452_031211 | |||
| 3124 | Ga0439455_0003947 | |||
| 3125 | Ga0439457_067024 | |||
| 3126 | Ga0439462_0007888 | |||
| 3127 | Ga0439462_0010211 | |||
| 3128 | Ga0450921_001983 | |||
| 3129 | Ga0450923_003206 | |||
| 3130 | Ga0450923_020511 | |||
| 3131 | Ga0450923_035316 | |||
| 3132 | Ga0450897_008249 | |||
| 3133 | Ga0450896_007410 | |||
| 3134 | Ga0450898_005481 | |||
| 3135 | Ga0450898_020412 | |||
| 3136 | Ga0450905_056568 | |||
| 3137 | Ga0450910_025753 | |||
| 3138 | Ga0439446_0011968 | |||
| 3139 | Ga0439446_0194101 | |||
| 3140 | Ga0439458_0006040 | |||
| 3141 | Ga0450908_011589 | |||
| 3142 | Ga0450908_030358 | |||
| 3143 | Ga0450909_037887 | |||
| 3144 | Ga0439434_0104381 | |||
| 3145 | Ga0439434_0115615 | |||
| 3146 | Ga0450893_0005187 | |||
| 3147 | Ga0450893_0019015 | |||
| 3148 | Ga0451577_0012109 | |||
| 3149 | Ga0451577_0694118 | |||
| 3150 | Ga0466969_0194702 | |||
| 3151 | Ga0466972_0026237 | |||
| 3152 | Ga0466965_0124831 | |||
| 3153 | Ga0466961_0965815 | |||
| 3154 | Ga0466963_0387885 | |||
| 3155 | Ga0466964_0070136 | |||
| 3156 | Ga0453684_0009557 | |||
| 3157 | Ga0453684_0067062 | |||
| 3158 | Ga0466968_0578281 | |||
| 3159 | Ga0466960_0187524 | |||
| 3160 | Ga0451576_0035144 | |||
| 3161 | Ga0451576_0804264 | |||
| 3162 | Ga0451576_0993627 | |||
| 3163 | Ga0466958_0525569 | |||
| 3164 | Ga0495627_049188 | |||
| 3165 | Ga0495627_143442 | |||
| 3166 | Ga0495592_0000175 | |||
| 3167 | Ga0495592_0003711 | |||
| 3168 | Ga0495603_0337394 | |||
| 3169 | Ga0495590_0000001 | |||
| 3170 | Ga0495590_0014398 | |||
| 3171 | Ga0495590_0015858 | |||
| 3172 | Ga0495590_0151583 | |||
| 3173 | Ga0495638_0002754 | |||
| 3174 | Ga0495638_0005353 | |||
| 3175 | Ga0495638_0086048 | |||
| 3176 | Ga0495638_0105756 | |||
| 3177 | Ga0495638_0421708 | |||
| 3178 | Ga0495641_0300235 | |||
| 3179 | Ga0495653_0000009 | |||
| 3180 | Ga0495653_0316734 | |||
| 3181 | Ga0495653_0406350 | |||
| 3182 | Ga0495650_0000001 | |||
| 3183 | Ga0495650_0000051 | |||
| 3184 | Ga0495650_0000213 | |||
| 3185 | Ga0495650_0009697 | |||
| 3186 | Ga0495650_0030124 | |||
| 3187 | Ga0495580_0355786 | |||
| 3188 | Ga0495580_0685529 | |||
| 3189 | Ga0495605_0000040 | |||
| 3190 | Ga0495605_0024096 | |||
| 3191 | Ga0495605_0049002 | |||
| 3192 | Ga0495605_0284035 | |||
| 3193 | Ga0495605_0386324 | |||
| 3194 | Ga0495639_0021593 | |||
| 3195 | Ga0495639_0127151 | |||
| 3196 | Ga0495639_0457425 | |||
| 3197 | Ga0495639_0629862 | |||
| 3198 | Ga0495662_0401925 | |||
| 3199 | Ga0495584_0015103 | |||
| 3200 | Ga0495584_0047944 | |||
| 3201 | Ga0495584_0084559 | |||
| 3202 | Ga0495584_0269858 | |||
| 3203 | Ga0495585_0000587 | |||
| 3204 | Ga0495585_0005376 | |||
| 3205 | Ga0495585_0292387 | |||
| 3206 | Ga0495596_0000029 | |||
| 3207 | Ga0495596_0000177 | |||
| 3208 | Ga0495596_0000309 | |||
| 3209 | Ga0495596_0002217 | |||
| 3210 | Ga0495596_0002850 | |||
| 3211 | Ga0495596_0003951 | |||
| 3212 | Ga0495596_0006338 | |||
| 3213 | Ga0495596_0032721 | |||
| 3214 | Ga0495596_0046851 | |||
| 3215 | Ga0495607_0000867 | |||
| 3216 | Ga0495607_0003055 | |||
| 3217 | Ga0495607_0035858 | |||
| 3218 | Ga0495607_0035916 | |||
| 3219 | Ga0495607_0058891 | |||
| 3220 | Ga0495607_0060055 | |||
| 3221 | Ga0495607_0095182 | |||
| 3222 | Ga0495583_0000127 | |||
| 3223 | Ga0495583_0002687 | |||
| 3224 | Ga0495583_0003009 | |||
| 3225 | Ga0495583_0009275 | |||
| 3226 | Ga0495583_0016689 | |||
| 3227 | Ga0495583_0018534 | |||
| 3228 | Ga0495583_0108944 | |||
| 3229 | Ga0495583_0259338 | |||
| 3230 | Ga0495606_0019807 | |||
| 3231 | Ga0495606_0163844 | |||
| 3232 | Ga0495606_0316167 | |||
| 3233 | Ga0495610_0000008 | |||
| 3234 | Ga0495610_0001018 | |||
| 3235 | Ga0495610_0081480 | |||
| 3236 | Ga0495610_0119289 | |||
| 3237 | Ga0495616_0000034 | |||
| 3238 | Ga0495616_0000071 | |||
| 3239 | Ga0495616_0000294 | |||
| 3240 | Ga0495616_0002129 | |||
| 3241 | Ga0495616_0004940 | |||
| 3242 | Ga0495616_0008342 | |||
| 3243 | Ga0495616_0014033 | |||
| 3244 | Ga0495616_0132029 | |||
| 3245 | Ga0495616_0221478 | |||
| 3246 | Ga0495620_0031646 | |||
| 3247 | Ga0495620_0061356 | |||
| 3248 | Ga0495620_0072090 | |||
| 3249 | Ga0495620_0224872 | |||
| 3250 | Ga0495628_0377451 | |||
| 3251 | Ga0495630_0225575 | |||
| 3252 | Ga0495630_0288158 | |||
| 3253 | Ga0495631_0000042 | |||
| 3254 | Ga0495631_0000408 | |||
| 3255 | Ga0495631_0001648 | |||
| 3256 | Ga0495631_0037703 | |||
| 3257 | Ga0495631_0042931 | |||
| 3258 | Ga0495631_0321971 | |||
| 3259 | Ga0495632_0000033 | |||
| 3260 | Ga0495632_0000086 | |||
| 3261 | Ga0495632_0000321 | |||
| 3262 | Ga0495632_0001237 | |||
| 3263 | Ga0495632_0005196 | |||
| 3264 | Ga0495632_0008164 | |||
| 3265 | Ga0495632_0028978 | |||
| 3266 | Ga0495632_0112266 | |||
| 3267 | Ga0495632_0204880 | |||
| 3268 | Ga0495637_0003831 | |||
| 3269 | Ga0495637_0005223 | |||
| 3270 | Ga0495637_0018995 | |||
| 3271 | Ga0495637_0020863 | |||
| 3272 | Ga0495637_0052143 | |||
| 3273 | Ga0495637_0052357 | |||
| 3274 | Ga0495637_0068682 | |||
| 3275 | Ga0495637_0097785 | |||
| 3276 | Ga0495637_0193181 | |||
| 3277 | Ga0495643_0000044 | |||
| 3278 | Ga0495643_0000096 | |||
| 3279 | Ga0495643_0000398 | |||
| 3280 | Ga0495643_0000760 | |||
| 3281 | Ga0495643_0001857 | |||
| 3282 | Ga0495643_0024026 | |||
| 3283 | Ga0495643_0035116 | |||
| 3284 | Ga0495643_0048354 | |||
| 3285 | Ga0495643_0063146 | |||
| 3286 | Ga0495643_0068006 | |||
| 3287 | Ga0495643_0084857 | |||
| 3288 | Ga0495643_0197664 | |||
| 3289 | Ga0495643_0274842 | |||
| 3290 | Ga0495644_0000030 | |||
| 3291 | Ga0495644_0033198 | |||
| 3292 | Ga0495648_0000001 | |||
| 3293 | Ga0495648_0000505 | |||
| 3294 | Ga0495648_0001508 | |||
| 3295 | Ga0495648_0011019 | |||
| 3296 | Ga0495648_0016203 | |||
| 3297 | Ga0495648_0020401 | |||
| 3298 | Ga0495648_0024378 | |||
| 3299 | Ga0495648_0036767 | |||
| 3300 | Ga0495648_0041837 | |||
| 3301 | Ga0495648_0054396 | |||
| 3302 | Ga0495648_0115262 | |||
| 3303 | Ga0495648_0292683 | |||
| 3304 | Ga0495642_0000246 | |||
| 3305 | Ga0495642_0000273 | |||
| 3306 | Ga0495642_0000401 | |||
| 3307 | Ga0495642_0003450 | |||
| 3308 | Ga0495642_0054844 | |||
| 3309 | Ga0495642_0063629 | |||
| 3310 | Ga0495642_0099496 | |||
| 3311 | Ga0495642_0218528 | |||
| 3312 | Ga0495654_0000058 | |||
| 3313 | Ga0495654_0001164 | |||
| 3314 | Ga0495654_0002363 | |||
| 3315 | Ga0495654_0008964 | |||
| 3316 | Ga0495654_0020402 | |||
| 3317 | Ga0495654_0045998 | |||
| 3318 | Ga0495654_0054787 | |||
| 3319 | Ga0495654_0058094 | |||
| 3320 | Ga0495654_0174153 | |||
| 3321 | Ga0495654_0205785 | |||
| 3322 | Ga0495586_0509190 | |||
| 3323 | Ga0495587_0200705 | |||
| 3324 | Ga0495587_0292480 | |||
| 3325 | Ga0495598_0069329 | |||
| 3326 | Ga0495609_0000044 | |||
| 3327 | Ga0495609_0000628 | |||
| 3328 | Ga0495609_0000913 | |||
| 3329 | Ga0495609_0000919 | |||
| 3330 | Ga0495609_0002371 | |||
| 3331 | Ga0495609_0002960 | |||
| 3332 | Ga0495609_0005079 | |||
| 3333 | Ga0495609_0034221 | |||
| 3334 | Ga0495609_0094690 | |||
| 3335 | Ga0495609_0199349 | |||
| 3336 | Ga0495621_0041382 | |||
| 3337 | Ga0495621_0098758 | |||
| 3338 | Ga0495621_0099677 | |||
| 3339 | Ga0495621_0100499 | |||
| 3340 | Ga0495597_0000115 | |||
| 3341 | Ga0495597_0000996 | |||
| 3342 | Ga0495597_0001025 | |||
| 3343 | Ga0495597_0003730 | |||
| 3344 | Ga0495597_0030025 | |||
| 3345 | Ga0495597_0041564 | |||
| 3346 | Ga0495597_0084653 | |||
| 3347 | Ga0495597_0100640 | |||
| 3348 | Ga0495597_0157684 | |||
| 3349 | Ga0495645_0181194 | |||
| 3350 | Ga0495622_0051350 | |||
| 3351 | Ga0495622_0063469 | |||
| 3352 | Ga0495633_0000521 | |||
| 3353 | Ga0495633_0003990 | |||
| 3354 | Ga0495633_0019390 | |||
| 3355 | Ga0495633_0044952 | |||
| 3356 | Ga0495633_0073496 | |||
| 3357 | Ga0495633_0111838 | |||
| 3358 | Ga0495633_0243430 | |||
| 3359 | Ga0495633_0249677 | |||
| 3360 | Ga0495633_0310676 | |||
| 3361 | Ga0495667_0081116 | |||
| 3362 | Ga0495656_0001972 | |||
| 3363 | Ga0495656_0006352 | |||
| 3364 | Ga0495668_0000045 | |||
| 3365 | Ga0495668_0000193 | |||
| 3366 | Ga0495668_0000669 | |||
| 3367 | Ga0495668_0013890 | |||
| 3368 | Ga0495668_0051691 | |||
| 3369 | Ga0495668_0123854 | |||
| 3370 | Ga0495668_0133597 | |||
| 3371 | Ga0495668_0255204 | |||
| 3372 | Ga0495668_0312677 | |||
| 3373 | Ga0495668_0373975 | |||
| 3374 | Ga0495668_0375524 | |||
| 3375 | Ga0495634_0293425 | |||
| 3376 | Ga0495634_0438806 | |||
| 3377 | Ga0495611_0000439 | |||
| 3378 | Ga0495611_0179729 | |||
| 3379 | Ga0495611_0192884 | |||
| 3380 | Ga0495625_0000065 | |||
| 3381 | Ga0495625_0000224 | |||
| 3382 | Ga0495625_0001600 | |||
| 3383 | Ga0495625_0004383 | |||
| 3384 | Ga0495625_0010559 | |||
| 3385 | Ga0495625_0010801 | |||
| 3386 | Ga0495625_0021731 | |||
| 3387 | Ga0495625_0027912 | |||
| 3388 | Ga0495625_0054514 | |||
| 3389 | Ga0495625_0080161 | |||
| 3390 | Ga0495625_0083807 | |||
| 3391 | Ga0495625_0114980 | |||
| 3392 | Ga0495625_0147503 | |||
| 3393 | Ga0495625_0227577 | |||
| 3394 | Ga0495625_0385197 | |||
| 3395 | Ga0495625_0451389 | |||
| 3396 | Ga0495625_0592313 | |||
| 3397 | Ga0495635_0418108 | |||
| 3398 | Ga0495659_0000041 | |||
| 3399 | Ga0495659_0002529 | |||
| 3400 | Ga0495661_0000049 | |||
| 3401 | Ga0495661_0000170 | |||
| 3402 | Ga0495661_0000325 | |||
| 3403 | Ga0495661_0000843 | |||
| 3404 | Ga0495661_0001206 | |||
| 3405 | Ga0495661_0002108 | |||
| 3406 | Ga0495661_0005969 | |||
| 3407 | Ga0495661_0024188 | |||
| 3408 | Ga0495661_0040999 | |||
| 3409 | Ga0495661_0049889 | |||
| 3410 | Ga0495661_0062830 | |||
| 3411 | Ga0495661_0126875 | |||
| 3412 | Ga0495661_0166230 | |||
| 3413 | Ga0495661_0217644 | |||
| 3414 | Ga0495661_0478153 | |||
| 3415 | Ga0495588_0020475 | |||
| 3416 | Ga0495588_0026306 | |||
| 3417 | Ga0495588_0191695 | |||
| 3418 | Ga0495588_0218584 | |||
| 3419 | Ga0495657_0274252 | |||
| 3420 | Ga0495646_0005993 | |||
| 3421 | Ga0495646_0284957 | |||
| 3422 | Ga0495647_0116960 | |||
| 3423 | Ga0495647_0122974 | |||
| 3424 | Ga0495647_0150415 | |||
| 3425 | Ga0495647_0157311 | |||
| 3426 | Ga0495658_0010460 | |||
| 3427 | Ga0495658_0037225 | |||
| 3428 | Ga0495658_0068835 | |||
| 3429 | Ga0495658_0180529 | |||
| 3430 | Ga0495658_0327932 | |||
| 3431 | Ga0495658_0525918 | |||
| 3432 | Ga0495669_0000091 | |||
| 3433 | Ga0495669_0015836 | |||
| 3434 | Ga0495669_0029860 | |||
| 3435 | Ga0495669_0256211 | |||
| 3436 | Ga0495613_0387219 | |||
| 3437 | Ga0495670_0024393 | |||
| 3438 | Ga0495670_0030552 | |||
| 3439 | Ga0495670_0038070 | |||
| 3440 | Ga0495670_0257154 | |||
| 3441 | Ga0495670_0492896 | |||
| 3442 | Ga0495671_0000002 | |||
| 3443 | Ga0495671_0000131 | |||
| 3444 | Ga0495671_0000198 | |||
| 3445 | Ga0495671_0001101 | |||
| 3446 | Ga0495671_0062030 | |||
| 3447 | Ga0495671_0241127 | |||
| 3448 | Ga0495671_0334160 | |||
| 3449 | Ga0495649_0000303 | |||
| 3450 | Ga0495649_0001551 | |||
| 3451 | Ga0495649_0007850 | |||
| 3452 | Ga0495649_0076699 | |||
| 3453 | Ga0495649_0077226 | |||
| 3454 | Ga0495649_0152523 | |||
| 3455 | Ga0495649_0287073 | |||
| 3456 | Ga0495649_0497529 | |||
| 3457 | Ga0495589_0000035 | |||
| 3458 | Ga0495589_0000219 | |||
| 3459 | Ga0495589_0004514 | |||
| 3460 | Ga0495589_0014524 | |||
| 3461 | Ga0495589_0086051 | |||
| 3462 | Ga0495589_0145767 | |||
| 3463 | Ga0495589_0157520 | |||
| 3464 | Ga0495589_0294625 | |||
| 3465 | Ga0495600_0177981 | |||
| 3466 | Ga0495600_0459836 | |||
| 3467 | Ga0495660_0002312 | |||
| 3468 | Ga0495660_0004863 | |||
| 3469 | Ga0495660_0012822 | |||
| 3470 | Ga0495660_0018326 | |||
| 3471 | Ga0495660_0027191 | |||
| 3472 | Ga0495660_0027838 | |||
| 3473 | Ga0495660_0030060 | |||
| 3474 | Ga0495660_0092147 | |||
| 3475 | Ga0495660_0128877 | |||
| 3476 | Ga0495660_0134626 | |||
| 3477 | Ga0495660_0141449 | |||
| 3478 | Ga0495604_0413231 | |||
| 3479 | Ga0495636_0000537 | |||
| 3480 | Ga0495636_0005816 | |||
| 3481 | Ga0495636_0037481 | |||
| 3482 | Ga0495672_0000031 | |||
| 3483 | Ga0495672_0000685 | |||
| 3484 | Ga0495672_0001603 | |||
| 3485 | Ga0495672_0005983 | |||
| 3486 | Ga0495672_0021488 | |||
| 3487 | Ga0495676_0000398 | |||
| 3488 | Ga0495676_0030096 | |||
| 3489 | Ga0495676_0069402 | |||
| 3490 | Ga0495680_0509407 | |||
| 3491 | Ga0495683_0003254 | |||
| 3492 | Ga0495683_0072619 | |||
| 3493 | Ga0495683_0116569 | |||
| 3494 | Ga0495683_0432777 | |||
| 3495 | Ga0495687_000002 | |||
| 3496 | Ga0495687_000066 | |||
| 3497 | Ga0495687_001099 | |||
| 3498 | Ga0495687_001273 | |||
| 3499 | Ga0495687_001453 | |||
| 3500 | Ga0495687_002257 | |||
| 3501 | Ga0495687_002986 | |||
| 3502 | Ga0495687_004333 | |||
| 3503 | Ga0495687_012673 | |||
| 3504 | Ga0495687_013163 | |||
| 3505 | Ga0495687_018635 | |||
| 3506 | Ga0495687_031321 | |||
| 3507 | Ga0495677_0000013 | |||
| 3508 | Ga0495677_0000512 | |||
| 3509 | Ga0495677_0000550 | |||
| 3510 | Ga0495677_0002369 | |||
| 3511 | Ga0495677_0050369 | |||
| 3512 | Ga0495677_0088148 | |||
| 3513 | Ga0495677_0148178 | |||
| 3514 | Ga0495677_0202949 | |||
| 3515 | Ga0495677_0302893 | |||
| 3516 | Ga0495679_000296 | |||
| 3517 | Ga0495679_002037 | |||
| 3518 | Ga0495679_010136 | |||
| 3519 | Ga0495679_020858 | |||
| 3520 | Ga0495679_045256 | |||
| 3521 | Ga0495685_000307 | |||
| 3522 | Ga0495685_040375 | |||
| 3523 | Ga0495673_0000061 | |||
| 3524 | Ga0495673_0000926 | |||
| 3525 | Ga0495681_0000016 | |||
| 3526 | Ga0495681_0022987 | |||
| 3527 | Ga0495681_0104177 | |||
| 3528 | Ga0495686_0000054 | |||
| 3529 | Ga0495686_0000464 | |||
| 3530 | Ga0495686_0001324 | |||
| 3531 | Ga0495686_0269510 | |||
| 3532 | Ga0495686_0459673 | |||
| 3533 | Ga0495593_0000083 | |||
| 3534 | Ga0495593_0017089 | |||
| 3535 | Ga0495602_0232178 | |||
| 3536 | Ga0495614_0004378 | |||
| 3537 | Ga0495614_0010642 | |||
| 3538 | Ga0495615_0002597 | |||
| 3539 | Ga0495626_0000011 | |||
| 3540 | Ga0495626_0000071 | |||
| 3541 | Ga0495626_0003695 | |||
| 3542 | Ga0495626_0005258 | |||
| 3543 | Ga0495626_0008223 | |||
| 3544 | Ga0495626_0020612 | |||
| 3545 | Ga0495626_0029974 | |||
| 3546 | Ga0495626_0031597 | |||
| 3547 | Ga0495626_0058708 | |||
| 3548 | Ga0495626_0059441 | |||
| 3549 | Ga0495626_0065283 | |||
| 3550 | Ga0495626_0066936 | |||
| 3551 | Ga0495626_0086231 | |||
| 3552 | Ga0495626_0090886 | |||
| 3553 | Ga0495626_0127985 | |||
| 3554 | Ga0495626_0127989 | |||
| 3555 | Ga0495626_0399090 | |||
| 3556 | Ga0496100_0002053 | |||
| 3557 | Ga0496100_0007896 | |||
| 3558 | Ga0496100_0456306 | |||
| 3559 | Ga0496101_0056761 | |||
| 3560 | Ga0496101_0067612 | |||
| 3561 | Ga0496101_0485113 | |||
| 3562 | Ga0496102_0003799 | |||
| 3563 | Ga0496102_0047264 | |||
| 3564 | Ga0496102_0191157 | |||
| 3565 | Ga0496102_0509070 | |||
| 3566 | Ga0496103_0246927 | |||
| 3567 | Ga0496104_0004101 | |||
| 3568 | Ga0496104_0058001 | |||
| 3569 | Ga0496104_0330733 | |||
| 3570 | Ga0496104_0657970 | |||
| 3571 | Ga0496105_0043048 | |||
| 3572 | Ga0496105_0592230 | |||
| 3573 | Ga0496105_0626676 | |||
| 3574 | Ga0496106_0012220 | |||
| 3575 | Ga0496106_0055120 | |||
| 3576 | Ga0496107_0130976 | |||
| 3577 | Ga0496107_0372999 | |||
| 3578 | Ga0496108_0067782 | |||
| 3579 | Ga0496108_0254884 | |||
| 3580 | Ga0496108_0525511 | |||
| 3581 | Ga0496109_0034590 | |||
| 3582 | Ga0496109_0069873 | |||
| 3583 | Ga0496109_1231936 | |||
| 3584 | Ga0496110_0094088 | |||
| 3585 | Ga0496110_0128599 | |||
| 3586 | Ga0496110_0158310 | |||
| 3587 | Ga0496110_0353796 | |||
| 3588 | Ga0496111_0062777 | |||
| 3589 | Ga0496111_0252643 | |||
| 3590 | Ga0496111_0669728 | |||
| 3591 | Ga0496112_0277695 | |||
| 3592 | Ga0496113_0010989 | |||
| 3593 | Ga0496113_0122050 | |||
| 3594 | Ga0496113_0990754 | |||
| 3595 | Ga0496114_0218590 | |||
| 3596 | Ga0496114_0314115 | |||
| 3597 | Ga0496114_0341868 | |||
| 3598 | Ga0496114_0601822 | |||
| 3599 | Ga0496115_0259830 | |||
| 3600 | Ga0496116_0163029 | |||
| 3601 | Ga0496116_0166712 | |||
| 3602 | Ga0496116_0266748 | |||
| 3603 | Ga0496117_0013508 | |||
| 3604 | Ga0496117_0019516 | |||
| 3605 | Ga0496117_0052144 | |||
| 3606 | Ga0496118_0009116 | |||
| 3607 | Ga0496118_0053625 | |||
| 3608 | Ga0496121_0045456 | |||
| 3609 | Ga0496121_0089403 | |||
| 3610 | Ga0496121_0188861 | |||
| 3611 | Ga0496122_0000552 | |||
| 3612 | Ga0496122_0127986 | |||
| 3613 | Ga0496123_0001585 | |||
| 3614 | Ga0496123_0025017 | |||
| 3615 | Ga0496123_0052955 | |||
| 3616 | Ga0496123_0143032 | |||
| 3617 | Ga0496124_0089671 | |||
| 3618 | Ga0496124_0142076 | |||
| 3619 | Ga0496124_0166873 | |||
| 3620 | Ga0496124_0189507 | |||
| 3621 | Ga0496125_0001368 | |||
| 3622 | Ga0496125_0009166 | |||
| 3623 | Ga0496125_0034798 | |||
| 3624 | Ga0496125_0056434 | |||
| 3625 | Ga0496125_0190126 | |||
| 3626 | Ga0496125_0256365 | |||
| 3627 | Ga0496125_0471999 | |||
| 3628 | Ga0496126_0126980 | |||
| 3629 | Ga0496126_0496667 | |||
| 3630 | Ga0496126_0547004 | |||
| 3631 | Ga0495678_000009 | |||
| 3632 | Ga0495678_000035 | |||
| 3633 | Ga0495678_003416 | |||
| 3634 | Ga0495678_014610 | |||
| 3635 | Ga0495678_033503 | |||
| 3636 | Ga0495678_094668 | |||
| 3637 | Ga0495678_112271 | |||
| 3638 | Ga0495682_0001939 | |||
| 3639 | Ga0495682_0002609 | |||
| 3640 | Ga0495682_0007946 | |||
| 3641 | Ga0495682_0068522 | |||
| 3642 | Ga0501298_011896 | |||
| 3643 | Ga0501300_018393 | |||
| 3644 | Ga0501303_004894 | |||
| 3645 | Ga0501032_0057759 | |||
| 3646 | Ga0501034_0735138 | |||
| 3647 | Ga0501043_0010569 | |||
| 3648 | Ga0501043_0365601 | |||
| 3649 | Ga0501043_0623108 | |||
| 3650 | Ga0501046_0012537 | |||
| 3651 | Ga0501047_0015658 | |||
| 3652 | Ga0501048_0068146 | |||
| 3653 | Ga0501206_015062 | |||
| 3654 | Ga0501222_011032 | |||
| 3655 | Ga0501240_015693 | |||
| 3656 | Ga0501249_001955 | |||
| 3657 | Ga0501225_0009720 | |||
| 3658 | Ga0501079_0898240 | |||
| 3659 | Ga0501262_000333 | |||
| 3660 | Ga0501264_008911 | |||
| 3661 | Ga0501265_002430 | |||
| 3662 | Ga0501269_051107 | |||
| 3663 | nmdc:mga03683_100415_c1 | |||
| 3664 | nmdc:mga03683_11059_c1 | |||
| 3665 | nmdc:mga03683_121243_c1 | |||
| 3666 | nmdc:mga03683_176849_c1 | |||
| 3667 | nmdc:mga03683_191079_c1 | |||
| 3668 | nmdc:mga03683_2207_c1 | |||
| 3669 | nmdc:mga03683_231868_c1 | |||
| 3670 | nmdc:mga03683_312174_c1 | |||
| 3671 | nmdc:mga03683_351698_c1 | |||
| 3672 | nmdc:mga03683_4604_c1 | |||
| 3673 | nmdc:mga03683_505229_c1 | |||
| 3674 | nmdc:mga03683_52226_c1 | |||
| 3675 | nmdc:mga03683_558913_c1 | |||
| 3676 | nmdc:mga03683_7947_c2 | |||
| 3677 | nmdc:mga03n38_132691_c1 | |||
| 3678 | nmdc:mga03n38_395696_c1 | |||
| 3679 | nmdc:mga03n38_73274_c1 | |||
| 3680 | nmdc:mga00v17_28836_c1 | |||
| 3681 | nmdc:mga00v17_309415_c1 | |||
| 3682 | nmdc:mga00v17_779504_c1 | |||
| 3683 | nmdc:mga0k408_12545_c1 | |||
| 3684 | nmdc:mga0k408_136604_c1 | |||
| 3685 | nmdc:mga0k408_143867_c1 | |||
| 3686 | nmdc:mga0k408_172153_c1 | |||
| 3687 | nmdc:mga0k408_18003_c1 | |||
| 3688 | nmdc:mga0k408_1832_c1 | |||
| 3689 | nmdc:mga0k408_2173_c2 | |||
| 3690 | nmdc:mga0k408_23489_c1 | |||
| 3691 | nmdc:mga0k408_2403_c1 | |||
| 3692 | nmdc:mga0k408_25142_c1 | |||
| 3693 | nmdc:mga0k408_3264_c1 | |||
| 3694 | nmdc:mga0k408_366874_c1 | |||
| 3695 | nmdc:mga0k408_374987_c1 | |||
| 3696 | nmdc:mga0k408_38001_c1 | |||
| 3697 | nmdc:mga0k408_394745_c1 | |||
| 3698 | nmdc:mga0k408_41756_c1 | |||
| 3699 | nmdc:mga0k408_483053_c1 | |||
| 3700 | nmdc:mga0k408_519125_c1 | |||
| 3701 | nmdc:mga0k408_6625_c1 | |||
| 3702 | nmdc:mga0k408_69454_c1 | |||
| 3703 | nmdc:mga0k408_79993_c1 | |||
| 3704 | nmdc:mga0k408_83142_c1 | |||
| 3705 | nmdc:mga0k408_83423_c1 | |||
| 3706 | nmdc:mga0k408_95654_c1 | |||
| 3707 | nmdc:mga06z11_15676_c1 | |||
| 3708 | nmdc:mga06z11_251659_c1 | |||
| 3709 | nmdc:mga06z11_291793_c1 | |||
| 3710 | nmdc:mga06z11_297640_c1 | |||
| 3711 | nmdc:mga06z11_431473_c1 | |||
| 3712 | nmdc:mga06z11_5404_c1 | |||
| 3713 | nmdc:mga04h51_104660_c1 | |||
| 3714 | nmdc:mga04h51_257970_c1 | |||
| 3715 | nmdc:mga07m45_10967_c1 | |||
| 3716 | nmdc:mga07m45_117139_c1 | |||
| 3717 | nmdc:mga07m45_13780_c1 | |||
| 3718 | nmdc:mga07m45_142433_c1 | |||
| 3719 | nmdc:mga07m45_173713_c1 | |||
| 3720 | nmdc:mga07m45_23347_c2 | |||
| 3721 | nmdc:mga07m45_257119_c1 | |||
| 3722 | nmdc:mga07m45_43309_c1 | |||
| 3723 | nmdc:mga07m45_48119_c1 | |||
| 3724 | nmdc:mga07m45_6011_c1 | |||
| 3725 | nmdc:mga07m45_62617_c1 | |||
| 3726 | nmdc:mga07m45_70336_c1 | |||
| 3727 | nmdc:mga07m45_88815_c1 | |||
| 3728 | nmdc:mga0qj67_725633_c1 | |||
| 3729 | nmdc:mga0rr50_902513_c1 | |||
| 3730 | nmdc:mga0sz30_276124_c1 | |||
| 3731 | nmdc:mga0sz30_294999_c1 | |||
| 3732 | Ga0495601_0069985 | |||
| 3733 | Ga0500610_0000055 | |||
| 3734 | Ga0500610_0000454 | |||
| 3735 | Ga0500610_0000509 | |||
| 3736 | Ga0495655_0078673 | |||
| 3737 | Ga0495595_0056914 | |||
| 3738 | Ga0495595_0140001 | |||
| 3739 | Ga0495619_0694758 | |||
| 3740 | Ga0500578_0078098 | |||
| 3741 | Ga0500578_0168990 | |||
| 3742 | Ga0500643_011260 | |||
| 3743 | Ga0500644_0008080 | |||
| 3744 | Ga0500644_0014654 | |||
| 3745 | Ga0500644_0018208 | |||
| 3746 | Ga0500646_0132370 | |||
| 3747 | Ga0500647_0050303 | |||
| 3748 | Ga0500647_0249347 | |||
| 3749 | Ga0500583_0125474 | |||
| 3750 | Ga0500583_0318735 | |||
| 3751 | Ga0500583_0334033 | |||
| 3752 | Ga0500651_0000015 | |||
| 3753 | Ga0500651_0000242 | |||
| 3754 | Ga0500651_0179287 | |||
| 3755 | Ga0500566_0030268 | |||
| 3756 | Ga0500566_0129441 | |||
| 3757 | Ga0500566_0362801 | |||
| 3758 | Ga0500641_0211130 | |||
| 3759 | Ga0500650_0128252 | |||
| 3760 | Ga0500650_0260854 | |||
| 3761 | Ga0500560_096383 | |||
| 3762 | Ga0500562_010558 | |||
| 3763 | Ga0500569_087057 | |||
| 3764 | Ga0500571_000017 | |||
| 3765 | Ga0500571_000074 | |||
| 3766 | Ga0500572_107590 | |||
| 3767 | Ga0500572_210357 | |||
| 3768 | Ga0500572_245004 | |||
| 3769 | Ga0500591_050154 | |||
| 3770 | Ga0500592_006166 | |||
| 3771 | Ga0500593_000097 | |||
| 3772 | Ga0500593_000242 | |||
| 3773 | Ga0500593_003350 | |||
| 3774 | Ga0500594_0002529 | |||
| 3775 | Ga0500594_0021001 | |||
| 3776 | Ga0500607_000025 | |||
| 3777 | Ga0500607_000049 | |||
| 3778 | Ga0500607_019928 | |||
| 3779 | Ga0500607_135680 | |||
| 3780 | Ga0500608_012479 | |||
| 3781 | Ga0500614_156419 | |||
| 3782 | Ga0500618_000173 | |||
| 3783 | Ga0500618_015894 | |||
| 3784 | Ga0500618_052678 | |||
| 3785 | Ga0500618_058291 | |||
| 3786 | Ga0500626_009438 | |||
| 3787 | Ga0500655_000065 | |||
| 3788 | Ga0500655_002857 | |||
| 3789 | Ga0500658_0000028 | |||
| 3790 | Ga0500658_0000054 | |||
| 3791 | Ga0500658_0003025 | |||
| 3792 | Ga0500658_0042452 | |||
| 3793 | Ga0500559_0001694 | |||
| 3794 | Ga0500559_0004268 | |||
| 3795 | Ga0500559_0006743 | |||
| 3796 | Ga0500559_0015080 | |||
| 3797 | Ga0500559_0025318 | |||
| 3798 | Ga0500559_0093712 | |||
| 3799 | Ga0500559_0226043 | |||
| 3800 | Ga0500564_001050 | |||
| 3801 | Ga0500564_066263 | |||
| 3802 | Ga0500564_118137 | |||
| 3803 | Ga0500568_0001518 | |||
| 3804 | Ga0500568_0068042 | |||
| 3805 | Ga0500573_0005327 | |||
| 3806 | Ga0500574_000051 | |||
| 3807 | Ga0500574_000431 | |||
| 3808 | Ga0500586_000727 | |||
| 3809 | Ga0500586_025988 | |||
| 3810 | Ga0500616_0025694 | |||
| 3811 | Ga0500616_0041391 | |||
| 3812 | Ga0500616_0050793 | |||
| 3813 | Ga0500616_0332006 | |||
| 3814 | Ga0500619_088620 | |||
| 3815 | Ga0500622_0001109 | |||
| 3816 | Ga0500622_0008524 | |||
| 3817 | Ga0500622_0137997 | |||
| 3818 | Ga0500627_0000171 | |||
| 3819 | Ga0500630_073077 | |||
| 3820 | Ga0500633_0087958 | |||
| 3821 | Ga0500634_0004247 | |||
| 3822 | Ga0500634_0004851 | |||
| 3823 | Ga0500634_0063922 | |||
| 3824 | Ga0500634_0113662 | |||
| 3825 | Ga0500638_000284 | |||
| 3826 | Ga0500638_012459 | |||
| 3827 | Ga0500639_008998 | |||
| 3828 | Ga0500636_0005829 | |||
| 3829 | Ga0500636_0221671 | |||
| 3830 | Ga0500567_125390 | |||
| 3831 | Ga0500565_025083 | |||
| 3832 | Ga0500587_002697 | |||
| 3833 | Ga0500587_009667 | |||
| 3834 | Ga0500661_003998 | |||
| 3835 | 2511242546 | |||
| 3836 | 2513228680 | |||
| 3837 | 2548498599 | |||
| 3838 | 2553004589 | |||
| 3839 | 2587758680 | |||
| 3840 | 2599620622 | |||
| 3841 | 2599673921 | |||
| 3842 | 2599678762 | |||
| 3843 | 2599690133 | |||
| 3844 | 2643864789 | |||
| 3845 | 2644159027 | |||
| 3846 | 2644244933 | |||
| 3847 | 2644257493 | |||
| 3848 | 2644293980 | |||
| 3849 | 2644302577 | |||
| 3850 | 2644400379 | |||
| 3851 | 2644468252 | |||
| 3852 | 2644649334 | |||
| 3853 | 2738717815 | |||
| 3854 | 2738723725 | |||
| 3855 | 2738739727 | |||
| 3856 | 2738830461 | |||
| 3857 | 2738879436 | |||
| 3858 | 2739154257 | |||
| 3859 | 2739196210 | |||
| 3860 | 2739249426 | |||
| 3861 | 2739278501 | |||
| 3862 | 2739284456 | |||
| 3863 | 2739322653 | |||
| 3864 | 2739340894 | |||
| 3865 | 2819601198 | |||
| 3866 | 2831271487 | |||
| 3867 | 2838055386 | |||
| 3868 | 2842679996 | |||
| 3869 | 2842735283 | |||
| 3870 | 2842749961 | |||
| 3871 | 2885201115 | |||
| 3872 | 2885214101 | |||
| 3873 | 2899927455 | |||
| 3874 | 2904453290 | |||
| 3875 | 2904459284 | |||
| 3876 | 2904532422 | |||
| 3877 | 2904548342 | |||
| 3878 | 2919466116 | |||
| 3879 | 2919708845 | |||
| 3880 | 2923515417 | |||
| 3881 | 2928042633 | |||
| 3882 | 2928048940 | |||
| 3883 | 2928051490 | |||
| 3884 | 2928068702 | |||
| 3885 | 2928073330 | |||
| 3886 | 2928084432 | |||
| 3887 | 2928117795 | |||
| 3888 | 2929163332 | |||
| 3889 | 2929523212 | |||
| 3890 | 2939634006 | |||
| 3891 | 2945912018 | |||
| 3892 | 2945947977 | |||
| 3893 | 2945972083 | |||
| 3894 | 2945985711 | |||
| 3895 | 2954772223 | |||
| 3896 | 2990712005 | |||
| 3897 | 639787670 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2chc-assembly1.cif.gz_C | structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis | 0.9167 | 2 | 144 |
| 7c8z-assembly2.cif.gz_H | crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) | 0.9136 | 1 | 156 |
| 7c8z-assembly2.cif.gz_H | crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) | 0.9081 | 1 | 156 |
| 7vju-assembly1.cif.gz_F | crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 | 0.9074 | 7 | 156 |
| 7q05-assembly1.cif.gz_C | crystal structure of tpado in complex with tpa | 0.9061 | 6 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ebyA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8855 | 9 | 156 | 3.10.450.50 |
| 3ef8B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8544 | 15 | 143 | 3.10.450.50 |
| af_P71754_77_184_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8494 | 60 | 141 | 3.10.450.50 |
| 2b1xB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8422 | 1 | 148 | 3.10.450.50 |
| 2rfrA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8414 | 4 | 147 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A356HL20-F1-model_v4 | Salicylate hydroxylase | 0.955 | 1 | 150 |
|
| AF-B8ESU3-F1-model_v4 | Aromatic-ring-hydroxylating dioxygenase beta subunit | 0.9542 | 1 | 148 |
GO:0051213
|
| AF-A0A1Y0BBZ9-F1-model_v4 | B172 | 0.9513 | 1 | 148 |
GO:0016491
|
| AF-A0A537TZC4-F1-model_v4 | Ring-hydroxylating dioxygenase subunit beta | 0.9421 | 6 | 135 |
GO:0051213
|
| AF-A0A6N8XPX4-F1-model_v4 | Aromatic-ring-hydroxylating dioxygenase subunit beta | 0.9398 | 1 | 148 |
GO:0051213
|