F496129

General Info

Members Datasets Scaffolds Average Seq Length
1948 602 3897 160

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0457017|Ga0501067_0457017_64_627
Length 187
Sequence LDDPHARIRSLPPEGAPGGFGRPSTTGVGANIHFEDWLALTQLYADYASAVDSGNWDLWPEFFTDDCVYRLVPRENHERGFPLATLSFTSKGMLKDRVYGIKDTLFHDPYYQRHVVGAPVLRKVEAGRFECEANYAVFRTKLSEATVVFNVGRYLDVVVRTPAGLKFAERHCIYDSEMIPNSIIYPI

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
245 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
246 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
247 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
248 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
249 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
250 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
251 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
252 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
253 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
254 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
261 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
262 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
263 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
275 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
276 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
277 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
278 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
281 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
287 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
304 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
305 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
308 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
309 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
310 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
311 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
312 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
313 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
314 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
315 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
316 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
317 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
318 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
319 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
320 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
321 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
322 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
323 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
324 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
325 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
326 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
327 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
328 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
329 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
330 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
331 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
332 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
333 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
334 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
335 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
336 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
337 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
338 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
339 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
340 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
341 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
342 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
343 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
344 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
345 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
346 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
347 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
348 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
349 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
350 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
351 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
352 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
357 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
358 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
359 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
360 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
361 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
362 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
363 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
364 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
365 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
366 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
367 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
368 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
369 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
370 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
371 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
372 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
373 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
374 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
375 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
376 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
377 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
378 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
379 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
380 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
381 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
382 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
383 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
384 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
387 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
388 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
389 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
390 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
391 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
392 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
395 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
396 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
397 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
398 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
399 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
400 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
401 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
402 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
403 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
404 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
405 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
418 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
419 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
420 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
425 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
426 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
427 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
428 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
429 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
430 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
431 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
432 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
433 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
434 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
439 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
440 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
441 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
442 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
443 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
444 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
445 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
446 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
447 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
448 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
449 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
461 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
462 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
463 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
464 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
465 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
472 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
473 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
474 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
475 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
476 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
477 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
478 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
479 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
480 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
481 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
482 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
483 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
486 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
487 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
488 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
489 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
490 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
491 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
492 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
493 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
494 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
495 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
496 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
497 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
498 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
499 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
500 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
501 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
502 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
505 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
506 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
507 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
508 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
509 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
512 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
513 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
514 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
515 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
516 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
517 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
518 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
519 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
520 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
521 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
522 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
523 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
524 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
525 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
526 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
527 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
528 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
529 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
530 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
531 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
532 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
533 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
534 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
535 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
536 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
539 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
540 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
541 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
542 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
543 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
544 2547132374 Acidovorax radicis N35 Isolate Unclassified
545 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
546 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
547 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
548 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
549 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
550 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
551 2643221570 Acidovorax sp. Root568 Isolate Unclassified
552 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
553 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
554 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
555 2643221652 Acidovorax sp. Root402 Isolate Unclassified
556 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
557 2643221672 Variovorax sp. Root434 Isolate Unclassified
558 2643221683 Variovorax sp. Root473 Isolate Unclassified
559 2643221717 Acidovorax sp. Root267 Isolate Unclassified
560 2738541277 Variovorax sp. GV051 Isolate Unclassified
561 2738541280 Massilia sp. GV090 Isolate Unclassified
562 2738541297 Duganella sp. GV083 Isolate Unclassified
563 2738541307 Variovorax sp. GV008 Isolate Unclassified
564 2738541357 Duganella sp. GV053 Isolate Unclassified
565 2738543003 Duganella sp. GV066 Isolate Unclassified
566 2738543013 Variovorax sp. BT01 Isolate Unclassified
567 2738543019 Variovorax sp. GV040 Isolate Unclassified
568 2738543026 Duganella sp. GV089 Isolate Unclassified
569 2738543029 Duganella sp. GV039 Isolate Unclassified
570 2818991446 Variovorax sp. 1180 Isolate Unclassified
571 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
572 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
573 2842677519 Variovorax sp. R-72495 Isolate Unclassified
574 2842733646 Variovorax sp. R-72446 Isolate Unclassified
575 2842747753 Variovorax sp. R-72060 Isolate Unclassified
576 2885198086 Variovorax sp. 679 Isolate Unclassified
577 2885211737 Variovorax sp. 553 Isolate Unclassified
578 2899924645 Variovorax sp. 369 Isolate Unclassified
579 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
580 2904456579 Variovorax sp. 2002 Isolate Unclassified
581 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
582 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
583 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
584 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
585 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
586 2928037797 Variovorax sp. 1126 Isolate Unclassified
587 2928044640 Variovorax sp. 1128 Isolate Unclassified
588 2928051484 Variovorax sp. 1133 Isolate Unclassified
589 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
590 2928070936 Variovorax gossypii 1167 Isolate Unclassified
591 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
592 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
593 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
594 2929520902 Variovorax beijingensis 502 Isolate Unclassified
595 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
596 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
597 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
598 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
599 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
600 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
601 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
602 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.41
Nodule 0.1
Rhizoplane 3.08
Rhizosphere 66.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0457017 3300049583 Bacteria 713
2 JGI24740J21852_10014352 3300001979 Bacteria 2924
3 JGI24739J22299_10005780 3300001989 Bacteria 4687
4 JGI25155J39150_1000062 3300002704 Bacteria 70719
5 JGI25156J39149_1000012 3300002705 Bacteria 194393
6 JGI25154J39366_1000029 3300002738 Bacteria 194393
7 JGI25154J39366_1000278 3300002738 Bacteria 31200
8 JGI25158J39367_1004986 3300002739 Bacteria 1962
9 JGI25157J39369_1000014 3300002741 Bacteria 194393
10 JGI25152J39213_1001366 3300002773 Bacteria 10658
11 JGI25152J39213_1006035 3300002773 Bacteria 3387
12 JGI25150J39212_1000869 3300002774 Bacteria 10019
13 JGI25150J39212_1014431 3300002774 Bacteria 1342
14 JGI25159J45721_1000054 3300002987 Bacteria 56576
15 JGI25159J45721_1005152 3300002987 Bacteria 4144
16 JGI25151J46595_10000507 3300003187 Bacteria 36540
17 JGI25151J46595_10002599 3300003187 Bacteria 10658
18 JGI25151J46595_10002870 3300003187 Bacteria 9904
19 JGI25151J46595_10004424 3300003187 Bacteria 7439
20 JGI25151J46595_10006031 3300003187 Bacteria 6171
21 JGI25151J46595_10006574 3300003187 Bacteria 5823
22 JGI25153J46596_10002045 3300003215 Bacteria 11890
23 rootL2_10020233 3300003322 Bacteria 2342
24 rootL2_10167114 3300003322 Bacteria 1191
25 rootH1_10030289 3300003316 Bacteria 4911
26 rootH1_10030289 3300003323 Bacteria 1135
27 JGI25160J50197_1000088 3300003354 Bacteria 93050
28 JGI25160J50197_1000119 3300003354 Bacteria 71366
29 JGI25160J50197_1001065 3300003354 Bacteria 14091
30 JGI25160J50197_1005159 3300003354 Bacteria 5484
31 JGI25160J50197_1037137 3300003354 Bacteria 1171
32 JGI25161J50226_1000056 3300003374 Bacteria 103097
33 JGI25161J50226_1003182 3300003374 Bacteria 3871
34 Ga0055532_1013650 3300003758 Bacteria 923
35 Ga0055525_1000001 3300003759 Bacteria 1016948
36 Ga0055535_1000286 3300003761 Bacteria 53400
37 Ga0055535_1001184 3300003761 Bacteria 15063
38 Ga0055542_1000080 3300003762 Bacteria 129634
39 Ga0055542_1001176 3300003762 Bacteria 15063
40 Ga0055526_1006187 3300003771 Bacteria 6585
41 Ga0055526_1011254 3300003771 Bacteria 4054
42 Ga0055526_1024874 3300003771 Bacteria 1941
43 Ga0055526_1024934 3300003771 Bacteria 1936
44 Ga0055537_1000024 3300003773 Bacteria 111410
45 Ga0055537_1000047 3300003773 Bacteria 88000
46 Ga0055537_1001263 3300003773 Bacteria 10568
47 Ga0055537_1006648 3300003773 Bacteria 2901
48 Ga0055537_1007290 3300003773 Bacteria 2682
49 Ga0055524_1000039 3300003775 Bacteria 159897
50 Ga0055524_1008821 3300003775 Bacteria 4155
51 Ga0055524_1009148 3300003775 Bacteria 4054
52 Ga0055536_1002675 3300003781 Bacteria 9889
53 Ga0055536_1009284 3300003781 Bacteria 4091
54 Ga0055536_1009897 3300003781 Bacteria 3871
55 Ga0055536_1028754 3300003781 Bacteria 1509
56 Ga0055534_1000032 3300003784 Bacteria 118890
57 Ga0055534_1000141 3300003784 Bacteria 53818
58 Ga0055534_1001229 3300003784 Bacteria 10658
59 Ga0055534_1002784 3300003784 Bacteria 5844
60 Ga0055534_1038206 3300003784 Bacteria 715
61 Ga0055528_1002122 3300003790 Bacteria 10944
62 Ga0055528_1002521 3300003790 Bacteria 9752
63 Ga0055528_1002981 3300003790 Bacteria 8769
64 Ga0055528_1009497 3300003790 Bacteria 4054
65 Ga0055530_10000532 3300003791 Bacteria 33030
66 Ga0055530_10002093 3300003791 Bacteria 13335
67 Ga0055530_10004782 3300003791 Bacteria 6802
68 Ga0055530_10022158 3300003791 Bacteria 1855
69 Ga0055530_10024142 3300003791 Bacteria 1731
70 Ga0055530_10053041 3300003791 Bacteria 933
71 Ga0055540_1000047 3300003792 Bacteria 146914
72 Ga0055540_1000365 3300003792 Bacteria 38078
73 Ga0055540_1000440 3300003792 Bacteria 32622
74 Ga0055540_1002293 3300003792 Bacteria 10309
75 Ga0055540_1008010 3300003792 Bacteria 3871
76 Ga0055531_10000454 3300003794 Bacteria 38078
77 Ga0055531_10011051 3300003794 Bacteria 4407
78 Ga0055531_10012021 3300003794 Bacteria 4111
79 Ga0055531_10012911 3300003794 Bacteria 3891
80 Ga0055531_10057654 3300003794 Bacteria 972
81 Ga0055543_1000904 3300004625 Bacteria 13924
82 Ga0055543_1001077 3300004625 Bacteria 11969
83 Ga0055543_1001260 3300004625 Bacteria 10446
84 Ga0065165_1003589 3300005262 Bacteria 10696
85 Ga0065165_1005321 3300005262 Bacteria 7314
86 Ga0065165_1023989 3300005262 Bacteria 2058
87 Ga0065165_1024242 3300005262 Bacteria 2041
88 Ga0065165_1081429 3300005262 Bacteria 840
89 Ga0065714_10066369 3300005288 Bacteria 6992
90 Ga0065715_10244020 3300005293 Bacteria 1189
91 Ga0065707_10087747 3300005295 Bacteria 4904
92 Ga0070658_10125538 3300005327 Bacteria 2135
93 Ga0070658_10176893 3300005327 Bacteria 1795
94 Ga0070676_10004494 3300005328 Bacteria 7341
95 Ga0070676_10032895 3300005328 Bacteria 2973
96 Ga0070676_10203602 3300005328 Bacteria 1299
97 Ga0070676_10285396 3300005328 Bacteria 1114
98 Ga0070683_100131089 3300005329 Bacteria 2372
99 Ga0070683_100154993 3300005329 Bacteria 2172
100 Ga0070690_100037460 3300005330 Bacteria 3056
101 Ga0070690_100165870 3300005330 Bacteria 1517
102 Ga0070690_101040912 3300005330 Bacteria 647
103 Ga0070670_100031372 3300005331 Bacteria 4576
104 Ga0070670_100097851 3300005331 Bacteria 2524
105 Ga0070670_100398756 3300005331 Bacteria 1214
106 Ga0070670_100427560 3300005331 Bacteria 1171
107 Ga0070670_100483723 3300005331 Bacteria 1099
108 Ga0070670_100773935 3300005331 Bacteria 866
109 Ga0070670_101137033 3300005331 Bacteria 713
110 Ga0070677_10020521 3300005333 Bacteria 2408
111 Ga0070677_10096467 3300005333 Bacteria 1295
112 Ga0070677_10284039 3300005333 Bacteria 835
113 Ga0070677_10352729 3300005333 Bacteria 763
114 Ga0068869_100000109 3300005334 Bacteria 39248
115 Ga0068869_100011409 3300005334 Bacteria 5827
116 Ga0068869_100061469 3300005334 Bacteria 2755
117 Ga0068869_100118296 3300005334 Bacteria 2023
118 Ga0068869_100322628 3300005334 Bacteria 1253
119 Ga0068869_100600166 3300005334 Bacteria 930
120 Ga0068869_101125485 3300005334 Bacteria 688
121 Ga0070666_10006231 3300005335 Bacteria 7339
122 Ga0070666_10009271 3300005335 Bacteria 6133
123 Ga0070666_10146619 3300005335 Bacteria 1645
124 Ga0070666_10772301 3300005335 Bacteria 707
125 Ga0070680_100063118 3300005336 Bacteria 3034
126 Ga0070682_100473027 3300005337 Bacteria 965
127 Ga0068868_100000928 3300005338 Bacteria 19961
128 Ga0068868_100002606 3300005338 Bacteria 12501
129 Ga0068868_100009104 3300005338 Bacteria 7128
130 Ga0068868_100043506 3300005338 Bacteria 3508
131 Ga0068868_100068559 3300005338 Bacteria 2825
132 Ga0068868_100094776 3300005338 Bacteria 2408
133 Ga0068868_100327397 3300005338 Bacteria 1307
134 Ga0068868_100618047 3300005338 Bacteria 962
135 Ga0068868_101543346 3300005338 Bacteria 623
136 Ga0070660_100102495 3300005339 Bacteria 2269
137 Ga0070660_100113595 3300005339 Bacteria 2157
138 Ga0070660_101555058 3300005339 Bacteria 563
139 Ga0070687_100121070 3300005343 Bacteria 1497
140 Ga0070661_100071384 3300005344 Bacteria 2555
141 Ga0070661_100098854 3300005344 Bacteria 2167
142 Ga0070661_100098982 3300005344 Bacteria 2166
143 Ga0070661_100760848 3300005344 Bacteria 793
144 Ga0070692_10314546 3300005345 Bacteria 961
145 Ga0070692_10769411 3300005345 Bacteria 655
146 Ga0070668_100005748 3300005347 Bacteria 9200
147 Ga0070668_100493696 3300005347 Bacteria 1059
148 Ga0070668_100612524 3300005347 Bacteria 954
149 Ga0070669_100003867 3300005353 Bacteria 10823
150 Ga0070669_100032291 3300005353 Bacteria 3782
151 Ga0070669_100096210 3300005353 Bacteria 2228
152 Ga0070669_100206889 3300005353 Bacteria 1546
153 Ga0070669_100516365 3300005353 Bacteria 992
154 Ga0070669_101115792 3300005353 Bacteria 679
155 Ga0070675_100000772 3300005354 Bacteria 22339
156 Ga0070675_100018873 3300005354 Bacteria 5491
157 Ga0070675_100038290 3300005354 Bacteria 3907
158 Ga0070675_100145426 3300005354 Bacteria 2029
159 Ga0070675_100224640 3300005354 Bacteria 1636
160 Ga0070675_100348796 3300005354 Bacteria 1312
161 Ga0070675_100485372 3300005354 Bacteria 1112
162 Ga0070671_100006491 3300005355 Bacteria 9355
163 Ga0070671_100011811 3300005355 Bacteria 7026
164 Ga0070671_100030752 3300005355 Bacteria 4431
165 Ga0070671_100127377 3300005355 Bacteria 2144
166 Ga0070671_100249854 3300005355 Bacteria 1506
167 Ga0070671_100411541 3300005355 Bacteria 1157
168 Ga0070671_100422072 3300005355 Bacteria 1142
169 Ga0070674_100014173 3300005356 Bacteria 4949
170 Ga0070674_100146038 3300005356 Bacteria 1780
171 Ga0070673_100007669 3300005364 Bacteria 7138
172 Ga0070673_100077501 3300005364 Bacteria 2686
173 Ga0070673_100086947 3300005364 Bacteria 2547
174 Ga0070673_100129628 3300005364 Bacteria 2114
175 Ga0070673_100229881 3300005364 Bacteria 1609
176 Ga0070673_100316352 3300005364 Bacteria 1378
177 Ga0070673_100434024 3300005364 Bacteria 1179
178 Ga0070673_100496870 3300005364 Bacteria 1103
179 Ga0070673_100653681 3300005364 Bacteria 962
180 Ga0070673_100825658 3300005364 Bacteria 857
181 Ga0070673_100853490 3300005364 Bacteria 843
182 Ga0070673_100926170 3300005364 Bacteria 809
183 Ga0070673_101190219 3300005364 Bacteria 714
184 Ga0070688_100026856 3300005365 Bacteria 3425
185 Ga0070659_100015164 3300005366 Bacteria 5765
186 Ga0070659_100114676 3300005366 Bacteria 2177
187 Ga0070659_100198344 3300005366 Bacteria 1651
188 Ga0070659_101053265 3300005366 Bacteria 716
189 Ga0070667_100005806 3300005367 Bacteria 10301
190 Ga0070667_100007096 3300005367 Bacteria 9313
191 Ga0070667_100064974 3300005367 Bacteria 3097
192 Ga0070667_100125372 3300005367 Bacteria 2237
193 Ga0070667_100188883 3300005367 Bacteria 1824
194 Ga0070667_100484550 3300005367 Bacteria 1132
195 Ga0070667_100999049 3300005367 Bacteria 781
196 Ga0070667_101222092 3300005367 Bacteria 703
197 Ga0070701_10383946 3300005438 Bacteria 886
198 Ga0070708_100135616 3300005445 Bacteria 2280
199 Ga0070663_100003925 3300005455 Bacteria 8673
200 Ga0070663_100313932 3300005455 Bacteria 1258
201 Ga0070663_100371878 3300005455 Bacteria 1162
202 Ga0070678_100004609 3300005456 Bacteria 7833
203 Ga0070678_100035270 3300005456 Bacteria 3491
204 Ga0070678_100420817 3300005456 Bacteria 1164
205 Ga0070678_101010441 3300005456 Bacteria 765
206 Ga0070662_100000552 3300005457 Bacteria 22694
207 Ga0070662_100003920 3300005457 Bacteria 9330
208 Ga0070662_100032880 3300005457 Bacteria 3649
209 Ga0070662_100160037 3300005457 Bacteria 1760
210 Ga0070662_100452663 3300005457 Bacteria 1066
211 Ga0070662_100587568 3300005457 Bacteria 936
212 Ga0068867_100000186 3300005459 Bacteria 41001
213 Ga0068867_100005611 3300005459 Bacteria 8890
214 Ga0068867_100033298 3300005459 Bacteria 3731
215 Ga0068867_100064019 3300005459 Bacteria 2733
216 Ga0068867_100259388 3300005459 Bacteria 1416
217 Ga0068867_100279964 3300005459 Bacteria 1367
218 Ga0068867_100316881 3300005459 Bacteria 1291
219 Ga0068867_100459729 3300005459 Bacteria 1086
220 Ga0068867_100633974 3300005459 Bacteria 936
221 Ga0068867_100832172 3300005459 Bacteria 826
222 Ga0068867_100867902 3300005459 Bacteria 810
223 Ga0068867_100928701 3300005459 Bacteria 785
224 Ga0068867_101856499 3300005459 Bacteria 567
225 Ga0070685_10147935 3300005466 Bacteria 1486
226 Ga0070706_100017115 3300005467 Bacteria 6699
227 Ga0070706_100960143 3300005467 Bacteria 789
228 Ga0070706_101871002 3300005467 Bacteria 545
229 Ga0070707_100064439 3300005468 Bacteria 3519
230 Ga0070707_100154296 3300005468 Bacteria 2237
231 Ga0070699_100116427 3300005518 Bacteria 2349
232 Ga0070679_100003825 3300005530 Bacteria 13821
233 Ga0070684_100023555 3300005535 Bacteria 5153
234 Ga0070684_100248441 3300005535 Bacteria 1626
235 Ga0068853_100011884 3300005539 Bacteria 7080
236 Ga0068853_100059570 3300005539 Bacteria 3299
237 Ga0068853_100189341 3300005539 Bacteria 1869
238 Ga0068853_100437457 3300005539 Bacteria 1229
239 Ga0068853_100898155 3300005539 Bacteria 851
240 Ga0068853_101606701 3300005539 Bacteria 630
241 Ga0070672_100010739 3300005543 Bacteria 6363
242 Ga0070672_100016252 3300005543 Bacteria 5324
243 Ga0070672_100027229 3300005543 Bacteria 4262
244 Ga0070672_100055551 3300005543 Bacteria 3102
245 Ga0070672_100164157 3300005543 Bacteria 1844
246 Ga0070672_100228801 3300005543 Bacteria 1562
247 Ga0070672_100245988 3300005543 Bacteria 1505
248 Ga0070672_100369800 3300005543 Bacteria 1225
249 Ga0070672_100389330 3300005543 Bacteria 1193
250 Ga0070672_100739793 3300005543 Bacteria 863
251 Ga0070672_101241462 3300005543 Bacteria 664
252 Ga0070693_100763512 3300005547 Bacteria 713
253 Ga0070665_100043405 3300005548 Bacteria 4519
254 Ga0070665_100144705 3300005548 Bacteria 2380
255 Ga0070665_100278353 3300005548 Bacteria 1675
256 Ga0070665_100509410 3300005548 Bacteria 1215
257 Ga0070665_100668795 3300005548 Bacteria 1051
258 Ga0068855_100015116 3300005563 Bacteria 9294
259 Ga0068855_100047998 3300005563 Bacteria 5041
260 Ga0068855_100173929 3300005563 Bacteria 2437
261 Ga0070664_100006998 3300005564 Bacteria 9096
262 Ga0070664_100116860 3300005564 Bacteria 2332
263 Ga0070664_100211556 3300005564 Bacteria 1733
264 Ga0070664_100219576 3300005564 Bacteria 1700
265 Ga0070664_100325032 3300005564 Bacteria 1394
266 Ga0070664_100769040 3300005564 Bacteria 899
267 Ga0070664_101313837 3300005564 Bacteria 683
268 Ga0068857_100053902 3300005577 Bacteria 3567
269 Ga0068857_100134323 3300005577 Bacteria 2233
270 Ga0068857_100162697 3300005577 Bacteria 2025
271 Ga0068857_100298227 3300005577 Bacteria 1485
272 Ga0068857_101269641 3300005577 Bacteria 714
273 Ga0068854_100048398 3300005578 Bacteria 3033
274 Ga0068854_100084591 3300005578 Bacteria 2348
275 Ga0068854_100120987 3300005578 Bacteria 1987
276 Ga0068854_100694332 3300005578 Bacteria 878
277 Ga0068854_100841142 3300005578 Bacteria 803
278 Ga0068854_100935849 3300005578 Bacteria 763
279 Ga0068856_100069854 3300005614 Bacteria 3473
280 Ga0068856_100139123 3300005614 Bacteria 2434
281 Ga0068856_100226628 3300005614 Bacteria 1884
282 Ga0068856_101093590 3300005614 Bacteria 815
283 Ga0070702_100026507 3300005615 Bacteria 3115
284 Ga0068852_100012691 3300005616 Bacteria 6410
285 Ga0068852_100014348 3300005616 Bacteria 6095
286 Ga0068852_100018466 3300005616 Bacteria 5495
287 Ga0068852_100097562 3300005616 Bacteria 2644
288 Ga0068852_100227802 3300005616 Bacteria 1775
289 Ga0068852_100250838 3300005616 Bacteria 1696
290 Ga0068852_100274059 3300005616 Bacteria 1624
291 Ga0068852_100517269 3300005616 Bacteria 1190
292 Ga0068852_100913899 3300005616 Bacteria 895
293 Ga0068852_100919057 3300005616 Bacteria 892
294 Ga0068859_100141793 3300005617 Bacteria 2477
295 Ga0068859_100260379 3300005617 Bacteria 1826
296 Ga0068859_100306399 3300005617 Bacteria 1682
297 Ga0068859_100870067 3300005617 Bacteria 987
298 Ga0068864_100000270 3300005618 Bacteria 46170
299 Ga0068864_100010659 3300005618 Bacteria 7598
300 Ga0068864_100053816 3300005618 Bacteria 3473
301 Ga0068864_100065725 3300005618 Bacteria 3146
302 Ga0068864_100207736 3300005618 Bacteria 1801
303 Ga0068864_100837819 3300005618 Bacteria 905
304 Ga0068866_10001571 3300005718 Bacteria 9705
305 Ga0068866_10148194 3300005718 Bacteria 1356
306 Ga0068866_10554989 3300005718 Bacteria 769
307 Ga0068861_100000126 3300005719 Bacteria 39277
308 Ga0068861_100006858 3300005719 Bacteria 7777
309 Ga0068861_100802485 3300005719 Bacteria 883
310 Ga0068851_10012812 3300005834 Bacteria 3960
311 Ga0068851_10019913 3300005834 Bacteria 3244
312 Ga0068851_10072851 3300005834 Bacteria 1781
313 Ga0068851_10090524 3300005834 Bacteria 1610
314 Ga0068851_10325795 3300005834 Bacteria 889
315 Ga0068870_10115031 3300005840 Bacteria 1541
316 Ga0068870_10212735 3300005840 Bacteria 1179
317 Ga0068863_100000679 3300005841 Bacteria 34412
318 Ga0068863_100022577 3300005841 Bacteria 6009
319 Ga0068863_100136576 3300005841 Bacteria 2343
320 Ga0068863_100227727 3300005841 Bacteria 1797
321 Ga0068863_100259471 3300005841 Bacteria 1680
322 Ga0068863_100366894 3300005841 Bacteria 1404
323 Ga0068863_101408982 3300005841 Bacteria 705
324 Ga0068858_100000225 3300005842 Bacteria 61439
325 Ga0068858_100006184 3300005842 Bacteria 11677
326 Ga0068858_100011807 3300005842 Bacteria 8238
327 Ga0068860_100010530 3300005843 Bacteria 9137
328 Ga0068860_100025113 3300005843 Bacteria 5750
329 Ga0068860_100071695 3300005843 Bacteria 3291
330 Ga0068860_100224709 3300005843 Bacteria 1823
331 Ga0068860_100372691 3300005843 Bacteria 1408
332 Ga0068860_100678258 3300005843 Bacteria 1039
333 Ga0068862_100091077 3300005844 Bacteria 2655
334 Ga0068862_100215452 3300005844 Bacteria 1737
335 Ga0068862_100274253 3300005844 Bacteria 1544
336 Ga0068862_100921771 3300005844 Bacteria 860
337 Ga0070717_11108428 3300006028 Bacteria 721
338 Ga0075365_10040246 3300006038 Bacteria 3047
339 Ga0075368_10019359 3300006042 Bacteria 2569
340 Ga0075363_100002613 3300006048 Bacteria 7422
341 Ga0075363_100098285 3300006048 Bacteria 1618
342 Ga0075363_100100513 3300006048 Bacteria 1600
343 Ga0075363_100173312 3300006048 Bacteria 1225
344 Ga0075363_100282609 3300006048 Bacteria 960
345 Ga0075363_100397393 3300006048 Bacteria 810
346 Ga0075364_10154827 3300006051 Bacteria 1546
347 Ga0075432_10028831 3300006058 Bacteria 1916
348 Ga0075432_10186761 3300006058 Bacteria 814
349 Ga0070716_100528969 3300006173 Bacteria 875
350 Ga0075362_10006845 3300006177 Bacteria 4270
351 Ga0075362_10012721 3300006177 Bacteria 3349
352 Ga0075362_10027255 3300006177 Bacteria 2445
353 Ga0075362_10027795 3300006177 Bacteria 2424
354 Ga0075362_10036217 3300006177 Bacteria 2157
355 Ga0075362_10075832 3300006177 Bacteria 1543
356 Ga0075362_10078719 3300006177 Bacteria 1517
357 Ga0075362_10101318 3300006177 Bacteria 1347
358 Ga0075362_10265553 3300006177 Bacteria 846
359 Ga0075362_10268680 3300006177 Bacteria 842
360 Ga0075362_10462436 3300006177 Bacteria 645
361 Ga0075362_10620995 3300006177 Bacteria 560
362 Ga0075367_10003489 3300006178 Bacteria 7504
363 Ga0075367_10023278 3300006178 Bacteria 3483
364 Ga0075367_10065241 3300006178 Bacteria 2180
365 Ga0075367_10086899 3300006178 Bacteria 1898
366 Ga0075367_10485085 3300006178 Bacteria 784
367 Ga0075369_10028290 3300006186 Bacteria 2349
368 Ga0075369_10053864 3300006186 Bacteria 1746
369 Ga0075369_10127102 3300006186 Bacteria 1156
370 Ga0075366_10000903 3300006195 Bacteria 14366
371 Ga0075366_10004367 3300006195 Bacteria 7582
372 Ga0075366_10005063 3300006195 Bacteria 7126
373 Ga0075366_10005254 3300006195 Bacteria 7012
374 Ga0075366_10020888 3300006195 Bacteria 3803
375 Ga0075366_10024928 3300006195 Bacteria 3490
376 Ga0075366_10063986 3300006195 Bacteria 2187
377 Ga0075366_10076436 3300006195 Bacteria 1998
378 Ga0075366_10088553 3300006195 Bacteria 1854
379 Ga0075366_10089581 3300006195 Bacteria 1843
380 Ga0075366_10103288 3300006195 Bacteria 1711
381 Ga0075366_10108492 3300006195 Bacteria 1669
382 Ga0075366_10177989 3300006195 Bacteria 1291
383 Ga0075366_10205769 3300006195 Bacteria 1197
384 Ga0075366_10209479 3300006195 Bacteria 1186
385 Ga0075366_10233960 3300006195 Bacteria 1120
386 Ga0075366_10310856 3300006195 Bacteria 965
387 Ga0075366_10341979 3300006195 Bacteria 918
388 Ga0075366_10408676 3300006195 Bacteria 836
389 Ga0075366_10553356 3300006195 Bacteria 712
390 Ga0075366_10562262 3300006195 Bacteria 706
391 Ga0075366_10938001 3300006195 Bacteria 539
392 Ga0075366_10968446 3300006195 Bacteria 530
393 Ga0097621_100060271 3300006237 Bacteria 3110
394 Ga0097621_100178814 3300006237 Bacteria 1832
395 Ga0097621_100226196 3300006237 Bacteria 1632
396 Ga0097621_100321941 3300006237 Bacteria 1370
397 Ga0097621_100417698 3300006237 Bacteria 1203
398 Ga0097621_100423384 3300006237 Bacteria 1195
399 Ga0075370_10001385 3300006353 Bacteria 10451
400 Ga0075370_10003497 3300006353 Bacteria 7487
401 Ga0075370_10006662 3300006353 Bacteria 5826
402 Ga0075370_10008356 3300006353 Bacteria 5324
403 Ga0075370_10009388 3300006353 Bacteria 5076
404 Ga0075370_10011977 3300006353 Bacteria 4570
405 Ga0075370_10021716 3300006353 Bacteria 3517
406 Ga0075370_10041399 3300006353 Bacteria 2601
407 Ga0075370_10072521 3300006353 Bacteria 1971
408 Ga0075370_10079534 3300006353 Bacteria 1883
409 Ga0075370_10159946 3300006353 Bacteria 1321
410 Ga0075370_10169808 3300006353 Bacteria 1282
411 Ga0075370_10221285 3300006353 Bacteria 1119
412 Ga0075370_10264415 3300006353 Bacteria 1021
413 Ga0075370_10393622 3300006353 Bacteria 831
414 Ga0075370_10518841 3300006353 Bacteria 720
415 Ga0068871_100026429 3300006358 Bacteria 4529
416 Ga0068871_100044440 3300006358 Bacteria 3573
417 Ga0068871_100060141 3300006358 Bacteria 3098
418 Ga0068871_100186123 3300006358 Bacteria 1787
419 Ga0068871_100412930 3300006358 Bacteria 1204
420 Ga0068871_100705121 3300006358 Bacteria 925
421 Ga0068871_100816192 3300006358 Bacteria 860
422 Ga0075430_100464806 3300006846 Bacteria 1044
423 Ga0075430_100742798 3300006846 Bacteria 809
424 Ga0075434_100258587 3300006871 Bacteria 1760
425 Ga0068865_100031632 3300006881 Bacteria 3529
426 Ga0068865_100242195 3300006881 Bacteria 1420
427 Ga0068865_100360419 3300006881 Bacteria 1180
428 Ga0068865_100717727 3300006881 Bacteria 856
429 Ga0097620_100141795 3300006931 Bacteria 2477
430 Ga0097620_100260380 3300006931 Bacteria 1826
431 Ga0097620_100306401 3300006931 Bacteria 1682
432 Ga0097620_100870165 3300006931 Bacteria 987
433 Ga0075435_100684643 3300007076 Bacteria 891
434 Ga0105244_10002369 3300009036 Bacteria 14300
435 Ga0105244_10080538 3300009036 Bacteria 1613
436 Ga0105240_10044244 3300009093 Bacteria 5660
437 Ga0105240_10376389 3300009093 Bacteria 1604
438 Ga0105240_11666270 3300009093 Bacteria 666
439 Ga0111539_10496588 3300009094 Bacteria 1421
440 Ga0111539_11076507 3300009094 Bacteria 934
441 Ga0105245_10011498 3300009098 Bacteria 7709
442 Ga0105245_10044575 3300009098 Bacteria 3959
443 Ga0105245_10429981 3300009098 Bacteria 1325
444 Ga0105245_10478639 3300009098 Bacteria 1258
445 Ga0105245_10578857 3300009098 Bacteria 1147
446 Ga0105245_10587549 3300009098 Bacteria 1139
447 Ga0105245_11031379 3300009098 Bacteria 868
448 Ga0105247_10783640 3300009101 Bacteria 726
449 Ga0105243_10002142 3300009148 Bacteria 16689
450 Ga0105243_10002791 3300009148 Bacteria 14509
451 Ga0105243_10006295 3300009148 Bacteria 9173
452 Ga0105243_10066462 3300009148 Bacteria 2899
453 Ga0105243_10195426 3300009148 Bacteria 1770
454 Ga0105243_10211999 3300009148 Bacteria 1706
455 Ga0105243_10307811 3300009148 Bacteria 1438
456 Ga0105243_10529961 3300009148 Bacteria 1122
457 Ga0105243_10626920 3300009148 Bacteria 1039
458 Ga0105243_10824709 3300009148 Bacteria 916
459 Ga0105243_11023162 3300009148 Bacteria 830
460 Ga0105241_10207015 3300009174 Bacteria 1642
461 Ga0105241_10680647 3300009174 Bacteria 937
462 Ga0105241_11448252 3300009174 Bacteria 659
463 Ga0105242_10179763 3300009176 Bacteria 1866
464 Ga0105242_10785592 3300009176 Bacteria 941
465 Ga0105242_10798183 3300009176 Bacteria 934
466 Ga0105242_11464865 3300009176 Bacteria 712
467 Ga0105248_10020776 3300009177 Bacteria 7274
468 Ga0105248_10069162 3300009177 Bacteria 3964
469 Ga0105248_10103800 3300009177 Bacteria 3204
470 Ga0105248_10140104 3300009177 Bacteria 2728
471 Ga0105248_10223348 3300009177 Bacteria 2120
472 Ga0105248_10381645 3300009177 Bacteria 1587
473 Ga0105248_11065491 3300009177 Bacteria 913
474 Ga0105248_11365687 3300009177 Bacteria 802
475 Ga0105237_10038448 3300009545 Bacteria 4831
476 Ga0105237_10210367 3300009545 Bacteria 1945
477 Ga0105237_10211438 3300009545 Bacteria 1940
478 Ga0105237_10584019 3300009545 Bacteria 1124
479 Ga0105237_11719452 3300009545 Bacteria 635
480 Ga0105238_10007445 3300009551 Bacteria 10968
481 Ga0105238_10237419 3300009551 Bacteria 1800
482 Ga0105238_10554246 3300009551 Bacteria 1154
483 Ga0105238_10765782 3300009551 Bacteria 980
484 Ga0105238_12092877 3300009551 Bacteria 600
485 Ga0105249_10020223 3300009553 Bacteria 5950
486 Ga0105249_10255488 3300009553 Bacteria 1739
487 Ga0105249_10511243 3300009553 Bacteria 1247
488 Ga0105239_10008553 3300010375 Bacteria 11619
489 Ga0105239_10014688 3300010375 Bacteria 8684
490 Ga0105239_10178863 3300010375 Bacteria 2373
491 Ga0105239_11428694 3300010375 Bacteria 799
492 Ga0105239_11885533 3300010375 Bacteria 693
493 Ga0105246_10116212 3300011119 Bacteria 1974
494 Ga0105246_10261339 3300011119 Bacteria 1379
495 Ga0105246_11072474 3300011119 Bacteria 734
496 Ga0105246_11128730 3300011119 Bacteria 717
497 Ga0157347_1007959 3300012502 Bacteria 1069
498 Ga0157373_10000764 3300013100 Bacteria 24891
499 Ga0157373_10073883 3300013100 Bacteria 2406
500 Ga0157373_10289715 3300013100 Bacteria 1161
501 Ga0157371_10102848 3300013102 Bacteria 2027
502 Ga0157371_10524539 3300013102 Bacteria 876
503 Ga0157371_10891869 3300013102 Bacteria 674
504 Ga0157370_10005548 3300013104 Bacteria 14147
505 Ga0157370_10925268 3300013104 Bacteria 791
506 Ga0157374_10149927 3300013296 Bacteria 2267
507 Ga0157374_10576304 3300013296 Bacteria 1134
508 Ga0157374_11938732 3300013296 Bacteria 615
509 Ga0157378_10204597 3300013297 Bacteria 1869
510 Ga0157378_10702504 3300013297 Bacteria 1031
511 Ga0163162_10010080 3300013306 Bacteria 9185
512 Ga0163162_10077396 3300013306 Bacteria 3390
513 Ga0163162_10093880 3300013306 Bacteria 3086
514 Ga0163162_10203206 3300013306 Bacteria 2110
515 Ga0163162_10242856 3300013306 Bacteria 1932
516 Ga0163162_10909509 3300013306 Bacteria 993
517 Ga0157372_10024604 3300013307 Bacteria 6544
518 Ga0157372_10276250 3300013307 Bacteria 1953
519 Ga0157375_10010897 3300013308 Bacteria 8016
520 Ga0157375_10014628 3300013308 Bacteria 7009
521 Ga0157375_10051979 3300013308 Bacteria 4027
522 Ga0157375_10159166 3300013308 Bacteria 2399
523 Ga0157375_10277498 3300013308 Bacteria 1839
524 Ga0157375_10364097 3300013308 Bacteria 1612
525 Ga0157375_10404100 3300013308 Bacteria 1532
526 Ga0157375_10524196 3300013308 Bacteria 1348
527 Ga0157375_10626044 3300013308 Bacteria 1234
528 Ga0157375_10688444 3300013308 Bacteria 1176
529 Ga0163163_10004422 3300014325 Bacteria 11982
530 Ga0163163_10961423 3300014325 Bacteria 917
531 Ga0157380_10001564 3300014326 Bacteria 15067
532 Ga0157380_10016118 3300014326 Bacteria 5505
533 Ga0157380_10343089 3300014326 Bacteria 1394
534 Ga0157380_11397059 3300014326 Bacteria 750
535 Ga0182008_10000794 3300014497 Bacteria 22137
536 Ga0182008_10043908 3300014497 Bacteria 2224
537 Ga0182008_10053057 3300014497 Bacteria 2008
538 Ga0157377_10000464 3300014745 Bacteria 17471
539 Ga0157377_10074914 3300014745 Bacteria 1965
540 Ga0157377_10124000 3300014745 Bacteria 1569
541 Ga0157379_10005033 3300014968 Bacteria 11338
542 Ga0157379_10012124 3300014968 Bacteria 7527
543 Ga0157379_10040104 3300014968 Bacteria 4178
544 Ga0157379_10304460 3300014968 Bacteria 1453
545 Ga0157376_10001974 3300014969 Bacteria 13725
546 Ga0157376_10012956 3300014969 Bacteria 6209
547 Ga0157376_10787806 3300014969 Bacteria 962
548 Ga0157376_11260089 3300014969 Bacteria 769
549 Ga0157376_11488441 3300014969 Bacteria 710
550 Ga0157376_11808905 3300014969 Bacteria 647
551 Ga0182006_1000690 3300015261 Bacteria 23537
552 Ga0182007_10004716 3300015262 Bacteria 6133
553 Ga0182007_10006853 3300015262 Bacteria 4845
554 Ga0182007_10394058 3300015262 Bacteria 527
555 Ga0182005_1027614 3300015265 Bacteria 1547
556 Ga0182005_1082344 3300015265 Bacteria 889
557 Ga0183362_10002 3300015683 Bacteria 1432711
558 Ga0163161_10000161 3300017792 Bacteria 61815
559 Ga0163161_10016112 3300017792 Bacteria 5218
560 Ga0163161_10039405 3300017792 Bacteria 3392
561 Ga0163161_10067154 3300017792 Bacteria 2619
562 Ga0163161_10071647 3300017792 Bacteria 2536
563 Ga0163161_10341235 3300017792 Bacteria 1188
564 Ga0163161_10352220 3300017792 Bacteria 1171
565 Ga0163161_10851943 3300017792 Bacteria 769
566 Ga0213874_10130485 3300021377 Bacteria 862
567 Ga0213876_10101220 3300021384 Bacteria 1528
568 Ga0209435_100002 3300025206 Bacteria 794178
569 Ga0209436_103397 3300025208 Bacteria 4252
570 Ga0209436_106002 3300025208 Bacteria 2713
571 Ga0209672_100711 3300025228 Bacteria 16556
572 Ga0209672_101238 3300025228 Bacteria 10251
573 Ga0209147_100450 3300025229 Bacteria 25862
574 Ga0209147_103013 3300025229 Bacteria 3586
575 Ga0209563_100007 3300025230 Bacteria 1579402
576 Ga0209258_100093 3300025242 Bacteria 223559
577 Ga0209258_100519 3300025242 Bacteria 37071
578 Ga0207425_1001011 3300025245 Bacteria 13170
579 Ga0207425_1001306 3300025245 Bacteria 10745
580 Ga0207425_1004714 3300025245 Bacteria 4025
581 Ga0207425_1022335 3300025245 Bacteria 1334
582 Ga0207425_1023670 3300025245 Bacteria 1283
583 Ga0207425_1038846 3300025245 Bacteria 913
584 Ga0207425_1053424 3300025245 Bacteria 731
585 Ga0209646_1000001 3300025246 Bacteria 3092932
586 Ga0209646_1000023 3300025246 Bacteria 441100
587 Ga0209026_1000040 3300025250 Bacteria 277470
588 Ga0209026_1013794 3300025250 Bacteria 1365
589 Ga0209677_109163 3300025253 Bacteria 1812
590 Ga0209148_1000007 3300025254 Bacteria 1592273
591 Ga0209148_1000067 3300025254 Bacteria 338678
592 Ga0209148_1000440 3300025254 Bacteria 45707
593 Ga0209759_1000001 3300025256 Bacteria 2799452
594 Ga0209129_1000024 3300025258 Bacteria 417268
595 Ga0209129_1001645 3300025258 Bacteria 12118
596 Ga0209129_1008680 3300025258 Bacteria 2792
597 Ga0209129_1016572 3300025258 Bacteria 1474
598 Ga0209129_1017663 3300025258 Bacteria 1393
599 Ga0209129_1035134 3300025258 Bacteria 817
600 Ga0209565_1000039 3300025263 Bacteria 278026
601 Ga0209565_1000080 3300025263 Bacteria 156999
602 Ga0209565_1000583 3300025263 Bacteria 24687
603 Ga0209565_1000645 3300025263 Bacteria 22597
604 Ga0209565_1000876 3300025263 Bacteria 16569
605 Ga0209673_1000088 3300025273 Bacteria 204629
606 Ga0209673_1000284 3300025273 Bacteria 94932
607 Ga0209673_1001443 3300025273 Bacteria 22597
608 Ga0209673_1002254 3300025273 Bacteria 13894
609 Ga0209130_1000040 3300025284 Bacteria 262926
610 Ga0209130_1000346 3300025284 Bacteria 53329
611 Ga0209130_1000757 3300025284 Bacteria 28010
612 Ga0209130_1001429 3300025284 Bacteria 15870
613 Ga0209675_1000030 3300025291 Bacteria 278026
614 Ga0209675_1000133 3300025291 Bacteria 101207
615 Ga0209675_1000471 3300025291 Bacteria 30899
616 Ga0209675_1000695 3300025291 Bacteria 23368
617 Ga0209675_1001131 3300025291 Bacteria 16273
618 Ga0209675_1004254 3300025291 Bacteria 6449
619 Ga0209675_1020620 3300025291 Bacteria 1780
620 Ga0209676_1000028 3300025292 Bacteria 559745
621 Ga0209676_1000073 3300025292 Bacteria 305947
622 Ga0209676_1000142 3300025292 Bacteria 175752
623 Ga0209676_1000317 3300025292 Bacteria 94105
624 Ga0209676_1000383 3300025292 Bacteria 81259
625 Ga0209676_1013166 3300025292 Bacteria 3196
626 Ga0209676_1042675 3300025292 Bacteria 1257
627 Ga0209025_1000088 3300025294 Bacteria 255087
628 Ga0209025_1000104 3300025294 Bacteria 226895
629 Ga0209025_1001526 3300025294 Bacteria 29626
630 Ga0209025_1002084 3300025294 Bacteria 22602
631 Ga0209025_1004730 3300025294 Bacteria 11596
632 Ga0209025_1006776 3300025294 Bacteria 8785
633 Ga0209025_1011727 3300025294 Bacteria 5724
634 Ga0209025_1013516 3300025294 Bacteria 5123
635 Ga0209025_1040081 3300025294 Bacteria 2032
636 Ga0209025_1095901 3300025294 Bacteria 954
637 Ga0209025_1095980 3300025294 Bacteria 954
638 Ga0209564_1000313 3300025295 Bacteria 95224
639 Ga0209564_1000823 3300025295 Bacteria 42196
640 Ga0209564_1001505 3300025295 Bacteria 23368
641 Ga0209564_1002447 3300025295 Bacteria 14665
642 Ga0209564_1005212 3300025295 Bacteria 7521
643 Ga0209758_1000510 3300025297 Bacteria 62591
644 Ga0209758_1000679 3300025297 Bacteria 50729
645 Ga0209758_1003918 3300025297 Bacteria 12990
646 Ga0209758_1005216 3300025297 Bacteria 10191
647 Ga0209758_1050082 3300025297 Bacteria 1468
648 Ga0209050_1000008 3300025298 Bacteria 1144179
649 Ga0209050_1000072 3300025298 Bacteria 293619
650 Ga0209050_1000786 3300025298 Bacteria 45131
651 Ga0209050_1000952 3300025298 Bacteria 37637
652 Ga0209050_1001577 3300025298 Bacteria 23647
653 Ga0209050_1005629 3300025298 Bacteria 7769
654 Ga0209050_1015985 3300025298 Bacteria 3103
655 Ga0209050_1034091 3300025298 Bacteria 1531
656 Ga0209256_1000096 3300025299 Bacteria 204629
657 Ga0209256_1000151 3300025299 Bacteria 145299
658 Ga0209256_1000256 3300025299 Bacteria 94699
659 Ga0209256_1040804 3300025299 Bacteria 1183
660 Ga0209256_1056004 3300025299 Bacteria 934
661 Ga0207426_1000049 3300025302 Bacteria 401954
662 Ga0207426_1000188 3300025302 Bacteria 153510
663 Ga0207426_1000315 3300025302 Bacteria 94699
664 Ga0207426_1001354 3300025302 Bacteria 20775
665 Ga0209051_1000005 3300025303 Bacteria 1142353
666 Ga0209051_1000015 3300025303 Bacteria 546798
667 Ga0209051_1000056 3300025303 Bacteria 271616
668 Ga0209051_1000161 3300025303 Bacteria 125704
669 Ga0209051_1000259 3300025303 Bacteria 88311
670 Ga0209051_1000416 3300025303 Bacteria 58872
671 Ga0209051_1084184 3300025303 Bacteria 906
672 Ga0209051_1136246 3300025303 Bacteria 598
673 Ga0209257_1000031 3300025304 Bacteria 688770
674 Ga0209257_1000037 3300025304 Bacteria 612915
675 Ga0209257_1000116 3300025304 Bacteria 228733
676 Ga0209257_1002902 3300025304 Bacteria 15869
677 Ga0209257_1004513 3300025304 Bacteria 10710
678 Ga0209257_1022591 3300025304 Bacteria 2238
679 Ga0207697_10046109 3300025315 Bacteria 1794
680 Ga0207697_10070620 3300025315 Bacteria 1463
681 Ga0207656_10020678 3300025321 Bacteria 2619
682 Ga0207656_10027516 3300025321 Bacteria 2326
683 Ga0207656_10103921 3300025321 Bacteria 1305
684 Ga0207656_10234090 3300025321 Bacteria 896
685 Ga0207656_10328922 3300025321 Bacteria 760
686 Ga0207655_1015947 3300025728 Bacteria 4141
687 Ga0207682_10032758 3300025893 Bacteria 2089
688 Ga0207682_10044699 3300025893 Bacteria 1816
689 Ga0207682_10247434 3300025893 Bacteria 829
690 Ga0207642_10006015 3300025899 Bacteria 4005
691 Ga0207642_10024373 3300025899 Bacteria 2432
692 Ga0207688_10078411 3300025901 Bacteria 1883
693 Ga0207688_10188104 3300025901 Bacteria 1234
694 Ga0207688_10652489 3300025901 Bacteria 664
695 Ga0207680_10028766 3300025903 Bacteria 3113
696 Ga0207680_10191237 3300025903 Bacteria 1389
697 Ga0207647_10357268 3300025904 Bacteria 827
698 Ga0207645_10004614 3300025907 Bacteria 10153
699 Ga0207645_10041857 3300025907 Bacteria 2931
700 Ga0207645_10309051 3300025907 Bacteria 1053
701 Ga0207643_10009830 3300025908 Bacteria 5138
702 Ga0207643_10166620 3300025908 Bacteria 1328
703 Ga0207643_10252977 3300025908 Bacteria 1086
704 Ga0207705_10164082 3300025909 Bacteria 1670
705 Ga0207684_10119778 3300025910 Bacteria 2256
706 Ga0207654_10402338 3300025911 Bacteria 952
707 Ga0207695_10130175 3300025913 Bacteria 2474
708 Ga0207695_10145157 3300025913 Bacteria 2318
709 Ga0207671_10075823 3300025914 Bacteria 2516
710 Ga0207671_10219270 3300025914 Bacteria 1490
711 Ga0207671_10494572 3300025914 Bacteria 975
712 Ga0207660_10026081 3300025917 Bacteria 3976
713 Ga0207662_10013391 3300025918 Bacteria 4587
714 Ga0207662_10089116 3300025918 Bacteria 1895
715 Ga0207657_10038426 3300025919 Bacteria 4261
716 Ga0207657_10082664 3300025919 Bacteria 2696
717 Ga0207657_10308033 3300025919 Bacteria 1254
718 Ga0207657_10320421 3300025919 Bacteria 1226
719 Ga0207649_10314732 3300025920 Bacteria 1148
720 Ga0207649_10762319 3300025920 Bacteria 753
721 Ga0207649_10792593 3300025920 Bacteria 739
722 Ga0207652_10073735 3300025921 Bacteria 2970
723 Ga0207646_10015873 3300025922 Bacteria 7087
724 Ga0207681_10000826 3300025923 Bacteria 20436
725 Ga0207681_10008765 3300025923 Bacteria 6178
726 Ga0207681_10114005 3300025923 Bacteria 1971
727 Ga0207681_10243304 3300025923 Bacteria 1401
728 Ga0207694_10041437 3300025924 Bacteria 3548
729 Ga0207694_10111689 3300025924 Bacteria 2175
730 Ga0207694_10164283 3300025924 Bacteria 1795
731 Ga0207694_10603891 3300025924 Bacteria 923
732 Ga0207650_10120072 3300025925 Bacteria 2045
733 Ga0207650_10204515 3300025925 Bacteria 1583
734 Ga0207650_10224507 3300025925 Bacteria 1513
735 Ga0207650_10315573 3300025925 Bacteria 1279
736 Ga0207650_10512274 3300025925 Bacteria 1003
737 Ga0207650_10576954 3300025925 Bacteria 944
738 Ga0207659_10001869 3300025926 Bacteria 12468
739 Ga0207659_10029827 3300025926 Bacteria 3721
740 Ga0207659_10839328 3300025926 Bacteria 790
741 Ga0207659_11273276 3300025926 Bacteria 631
742 Ga0207687_10013703 3300025927 Bacteria 5293
743 Ga0207687_10056676 3300025927 Bacteria 2749
744 Ga0207687_10211834 3300025927 Bacteria 1521
745 Ga0207687_10421403 3300025927 Bacteria 1102
746 Ga0207644_10000223 3300025931 Bacteria 39200
747 Ga0207644_10008993 3300025931 Bacteria 6545
748 Ga0207644_10065196 3300025931 Bacteria 2648
749 Ga0207644_10070563 3300025931 Bacteria 2554
750 Ga0207644_10347830 3300025931 Bacteria 1203
751 Ga0207644_10382331 3300025931 Bacteria 1148
752 Ga0207644_10672504 3300025931 Bacteria 862
753 Ga0207690_10032585 3300025932 Bacteria 3345
754 Ga0207690_10456255 3300025932 Bacteria 1028
755 Ga0207690_10664135 3300025932 Bacteria 855
756 Ga0207706_10000736 3300025933 Bacteria 34115
757 Ga0207706_10012885 3300025933 Bacteria 7611
758 Ga0207706_10172590 3300025933 Bacteria 1900
759 Ga0207706_10379576 3300025933 Bacteria 1227
760 Ga0207706_10573407 3300025933 Bacteria 970
761 Ga0207706_10720062 3300025933 Bacteria 852
762 Ga0207706_10830020 3300025933 Bacteria 784
763 Ga0207706_10850399 3300025933 Bacteria 773
764 Ga0207686_10030421 3300025934 Bacteria 3196
765 Ga0207686_10088915 3300025934 Bacteria 2034
766 Ga0207686_10476777 3300025934 Bacteria 964
767 Ga0207709_10000771 3300025935 Bacteria 25177
768 Ga0207709_10001444 3300025935 Bacteria 16592
769 Ga0207709_10011940 3300025935 Bacteria 4789
770 Ga0207709_10012398 3300025935 Bacteria 4698
771 Ga0207709_10039692 3300025935 Bacteria 2813
772 Ga0207709_10076505 3300025935 Bacteria 2143
773 Ga0207709_10157185 3300025935 Bacteria 1582
774 Ga0207709_10616933 3300025935 Bacteria 860
775 Ga0207709_10650558 3300025935 Bacteria 839
776 Ga0207669_10002159 3300025937 Bacteria 8340
777 Ga0207669_10636871 3300025937 Bacteria 870
778 Ga0207669_11385823 3300025937 Bacteria 598
779 Ga0207704_10002371 3300025938 Bacteria 8463
780 Ga0207704_10205529 3300025938 Bacteria 1445
781 Ga0207704_10221663 3300025938 Bacteria 1400
782 Ga0207704_10262680 3300025938 Bacteria 1303
783 Ga0207704_10376209 3300025938 Bacteria 1113
784 Ga0207704_10404880 3300025938 Bacteria 1078
785 Ga0207665_10140128 3300025939 Bacteria 1724
786 Ga0207691_10002576 3300025940 Bacteria 17721
787 Ga0207691_10023739 3300025940 Bacteria 5773
788 Ga0207691_10075275 3300025940 Bacteria 3044
789 Ga0207691_10081432 3300025940 Bacteria 2910
790 Ga0207691_10087282 3300025940 Bacteria 2799
791 Ga0207691_10153924 3300025940 Bacteria 2020
792 Ga0207691_10337776 3300025940 Bacteria 1290
793 Ga0207691_10363434 3300025940 Bacteria 1237
794 Ga0207711_10002181 3300025941 Bacteria 17610
795 Ga0207711_10008423 3300025941 Bacteria 8624
796 Ga0207711_10093737 3300025941 Bacteria 2645
797 Ga0207711_10205036 3300025941 Bacteria 1800
798 Ga0207711_10501111 3300025941 Bacteria 1132
799 Ga0207711_10666528 3300025941 Bacteria 970
800 Ga0207689_10000259 3300025942 Bacteria 47474
801 Ga0207689_10006174 3300025942 Bacteria 10604
802 Ga0207689_10018504 3300025942 Bacteria 5877
803 Ga0207689_10120756 3300025942 Bacteria 2156
804 Ga0207689_10180386 3300025942 Bacteria 1741
805 Ga0207689_10202186 3300025942 Bacteria 1640
806 Ga0207689_10202319 3300025942 Bacteria 1639
807 Ga0207689_10269083 3300025942 Bacteria 1411
808 Ga0207689_10644972 3300025942 Bacteria 892
809 Ga0207689_10983709 3300025942 Bacteria 712
810 Ga0207661_10025802 3300025944 Bacteria 4471
811 Ga0207661_10151431 3300025944 Bacteria 2005
812 Ga0207679_10044865 3300025945 Bacteria 3193
813 Ga0207679_10134308 3300025945 Bacteria 1990
814 Ga0207679_10212816 3300025945 Bacteria 1622
815 Ga0207679_10548238 3300025945 Bacteria 1037
816 Ga0207679_11094158 3300025945 Bacteria 731
817 Ga0207667_10110625 3300025949 Bacteria 2834
818 Ga0207651_10005547 3300025960 Bacteria 6494
819 Ga0207651_10100796 3300025960 Bacteria 2141
820 Ga0207651_10128082 3300025960 Bacteria 1938
821 Ga0207651_10140033 3300025960 Bacteria 1867
822 Ga0207651_10184316 3300025960 Bacteria 1659
823 Ga0207651_10317868 3300025960 Bacteria 1300
824 Ga0207651_10330439 3300025960 Bacteria 1277
825 Ga0207651_10656942 3300025960 Bacteria 921
826 Ga0207651_11063547 3300025960 Bacteria 724
827 Ga0207712_10013171 3300025961 Bacteria 5301
828 Ga0207712_10375071 3300025961 Bacteria 1189
829 Ga0207712_10391396 3300025961 Bacteria 1166
830 Ga0207668_10030116 3300025972 Bacteria 3563
831 Ga0207668_10524630 3300025972 Bacteria 1022
832 Ga0207640_10072192 3300025981 Bacteria 2327
833 Ga0207640_11067399 3300025981 Bacteria 713
834 Ga0207658_10002825 3300025986 Bacteria 12451
835 Ga0207658_10005834 3300025986 Bacteria 8423
836 Ga0207658_10013147 3300025986 Bacteria 5654
837 Ga0207658_10411655 3300025986 Bacteria 1190
838 Ga0207658_10742933 3300025986 Bacteria 888
839 Ga0207658_10804600 3300025986 Bacteria 853
840 Ga0207658_11137489 3300025986 Bacteria 713
841 Ga0207658_11537809 3300025986 Bacteria 608
842 Ga0207677_10001179 3300026023 Bacteria 14211
843 Ga0207677_10001436 3300026023 Bacteria 12666
844 Ga0207677_10015394 3300026023 Bacteria 4498
845 Ga0207677_10040367 3300026023 Bacteria 3076
846 Ga0207677_10117791 3300026023 Bacteria 1991
847 Ga0207677_10260398 3300026023 Bacteria 1414
848 Ga0207677_10426178 3300026023 Bacteria 1131
849 Ga0207703_10000408 3300026035 Bacteria 45772
850 Ga0207703_10018563 3300026035 Bacteria 5430
851 Ga0207703_10036310 3300026035 Bacteria 3922
852 Ga0207703_10037004 3300026035 Bacteria 3887
853 Ga0207703_11561808 3300026035 Bacteria 635
854 Ga0207639_10043276 3300026041 Bacteria 3380
855 Ga0207639_10278290 3300026041 Bacteria 1471
856 Ga0207639_10811434 3300026041 Bacteria 872
857 Ga0207639_11560680 3300026041 Bacteria 619
858 Ga0207678_10005998 3300026067 Bacteria 10813
859 Ga0207678_10049813 3300026067 Bacteria 3620
860 Ga0207678_10171827 3300026067 Bacteria 1850
861 Ga0207678_10641644 3300026067 Bacteria 932
862 Ga0207702_10037491 3300026078 Bacteria 4058
863 Ga0207702_10248514 3300026078 Bacteria 1669
864 Ga0207702_10979134 3300026078 Bacteria 839
865 Ga0207702_11659806 3300026078 Bacteria 632
866 Ga0207641_10002065 3300026088 Bacteria 19074
867 Ga0207641_10004421 3300026088 Bacteria 12179
868 Ga0207641_10037985 3300026088 Bacteria 4024
869 Ga0207641_10135068 3300026088 Bacteria 2220
870 Ga0207641_10136517 3300026088 Bacteria 2208
871 Ga0207641_10188888 3300026088 Bacteria 1892
872 Ga0207648_10000686 3300026089 Bacteria 37954
873 Ga0207648_10012681 3300026089 Bacteria 7879
874 Ga0207648_10017873 3300026089 Bacteria 6435
875 Ga0207648_10019036 3300026089 Bacteria 6200
876 Ga0207648_10044650 3300026089 Bacteria 3888
877 Ga0207648_10292659 3300026089 Bacteria 1458
878 Ga0207648_10322549 3300026089 Bacteria 1388
879 Ga0207648_10400077 3300026089 Bacteria 1244
880 Ga0207648_10516637 3300026089 Bacteria 1094
881 Ga0207648_10522031 3300026089 Bacteria 1088
882 Ga0207648_11580882 3300026089 Bacteria 616
883 Ga0207676_10000269 3300026095 Bacteria 45280
884 Ga0207676_10054658 3300026095 Bacteria 3130
885 Ga0207676_10065398 3300026095 Bacteria 2895
886 Ga0207676_10161348 3300026095 Bacteria 1942
887 Ga0207676_11046571 3300026095 Bacteria 805
888 Ga0207676_11577421 3300026095 Bacteria 654
889 Ga0207674_10016515 3300026116 Bacteria 8077
890 Ga0207674_10029563 3300026116 Bacteria 5769
891 Ga0207674_10038674 3300026116 Bacteria 4948
892 Ga0207674_10139045 3300026116 Bacteria 2389
893 Ga0207674_10411475 3300026116 Bacteria 1307
894 Ga0207674_10604400 3300026116 Bacteria 1059
895 Ga0207674_10921920 3300026116 Bacteria 842
896 Ga0207674_11470051 3300026116 Bacteria 651
897 Ga0207675_100000307 3300026118 Bacteria 46857
898 Ga0207675_100001416 3300026118 Bacteria 24021
899 Ga0207675_100076361 3300026118 Bacteria 3137
900 Ga0207675_100466401 3300026118 Bacteria 1253
901 Ga0207683_10001051 3300026121 Bacteria 25171
902 Ga0207683_10066755 3300026121 Bacteria 3173
903 Ga0207683_10237209 3300026121 Bacteria 1663
904 Ga0207683_10385382 3300026121 Bacteria 1289
905 Ga0207683_10416789 3300026121 Bacteria 1237
906 Ga0207683_10564333 3300026121 Bacteria 1053
907 Ga0207683_10569559 3300026121 Bacteria 1048
908 Ga0207683_11007022 3300026121 Bacteria 773
909 Ga0207683_11075958 3300026121 Bacteria 746
910 Ga0207698_10037962 3300026142 Bacteria 3553
911 Ga0207698_10090847 3300026142 Bacteria 2498
912 Ga0207698_10104934 3300026142 Bacteria 2353
913 Ga0207698_10109147 3300026142 Bacteria 2315
914 Ga0207698_10196658 3300026142 Bacteria 1802
915 Ga0207698_10210647 3300026142 Bacteria 1748
916 Ga0207698_10337349 3300026142 Bacteria 1418
917 Ga0207698_10402939 3300026142 Bacteria 1308
918 Ga0207698_10411559 3300026142 Bacteria 1295
919 Ga0207698_10421196 3300026142 Bacteria 1281
920 Ga0207698_10425227 3300026142 Bacteria 1276
921 Ga0207698_10549355 3300026142 Bacteria 1132
922 Ga0207698_10899207 3300026142 Bacteria 892
923 Ga0207698_11212884 3300026142 Bacteria 769
924 Ga0207698_11341165 3300026142 Bacteria 730
925 Ga0209996_1001867 3300027395 Bacteria 2584
926 Ga0209968_1000702 3300027526 Bacteria 5159
927 Ga0209282_1011860 3300027666 Bacteria 5539
928 Ga0209966_1000040 3300027695 Bacteria 54404
929 Ga0209998_10021105 3300027717 Bacteria 1397
930 Ga0209813_10023158 3300027866 Bacteria 1764
931 Ga0209813_10222054 3300027866 Bacteria 708
932 Ga0209974_10006173 3300027876 Bacteria 4198
933 Ga0207428_10578269 3300027907 Bacteria 811
934 Ga0268266_10010170 3300028379 Bacteria 8244
935 Ga0268266_10061450 3300028379 Bacteria 3240
936 Ga0268266_10317098 3300028379 Bacteria 1458
937 Ga0268266_10455050 3300028379 Bacteria 1217
938 Ga0268266_10817657 3300028379 Bacteria 900
939 Ga0268265_10087552 3300028380 Bacteria 2478
940 Ga0268265_10179219 3300028380 Bacteria 1819
941 Ga0268265_10260150 3300028380 Bacteria 1542
942 Ga0268265_10260891 3300028380 Bacteria 1540
943 Ga0268265_10268500 3300028380 Bacteria 1520
944 Ga0268265_11578579 3300028380 Bacteria 661
945 Ga0268264_10004973 3300028381 Bacteria 11260
946 Ga0268264_10019709 3300028381 Bacteria 5510
947 Ga0268264_10077625 3300028381 Bacteria 2830
948 Ga0268264_10180300 3300028381 Bacteria 1917
949 Ga0268264_10269302 3300028381 Bacteria 1591
950 Ga0268264_10275052 3300028381 Bacteria 1575
951 Ga0268264_10825647 3300028381 Bacteria 927
952 Ga0307517_10000160 3300028786 Bacteria 108370
953 Ga0307517_10000395 3300028786 Bacteria 74663
954 Ga0307517_10074719 3300028786 Bacteria 2985
955 Ga0307517_10179818 3300028786 Bacteria 1368
956 Ga0307515_10000006 3300028794 Bacteria 725810
957 Ga0307515_10000160 3300028794 Bacteria 164789
958 Ga0307515_10000332 3300028794 Bacteria 116126
959 Ga0307515_10000893 3300028794 Bacteria 68669
960 Ga0307515_10001283 3300028794 Bacteria 57022
961 Ga0307515_10007639 3300028794 Bacteria 21327
962 Ga0307515_10012223 3300028794 Bacteria 16171
963 Ga0307515_10022830 3300028794 Bacteria 11008
964 Ga0307515_10033807 3300028794 Bacteria 8403
965 Ga0307515_10060601 3300028794 Bacteria 5392
966 Ga0307515_10080735 3300028794 Bacteria 4235
967 Ga0307515_10147322 3300028794 Bacteria 2485
968 Ga0307515_10179656 3300028794 Bacteria 2072
969 Ga0307515_10206740 3300028794 Bacteria 1820
970 Ga0307515_10223497 3300028794 Bacteria 1694
971 Ga0307515_10281623 3300028794 Bacteria 1369
972 Ga0307515_10364123 3300028794 Bacteria 1085
973 Ga0307515_10635715 3300028794 Bacteria 679
974 Ga0307511_10013142 3300030521 Bacteria 8095
975 Ga0307512_10041345 3300030522 Bacteria 3833
976 Ga0307512_10102024 3300030522 Bacteria 1938
977 Ga0307512_10139063 3300030522 Bacteria 1492
978 Ga0307512_10289617 3300030522 Bacteria 774
979 Ga0316177_1091352 3300030731 Bacteria 2470
980 Ga0316176_1071075 3300030732 Bacteria 1595
981 Ga0314311_1059274 3300030733 Bacteria 9245
982 Ga0316179_1119471 3300030734 Bacteria 2059
983 Ga0316178_1094522 3300030735 Bacteria 3317
984 Ga0316180_1037515 3300030736 Bacteria 1162
985 Ga0316183_1042467 3300030742 Bacteria 3746
986 Ga0316181_1174890 3300030744 Bacteria 3015
987 Ga0316182_1176401 3300030745 Bacteria 2996
988 Ga0316182_1440727 3300030745 Bacteria 2006
989 Ga0265327_10002595 3300031251 Bacteria 18697
990 Ga0307513_10003528 3300031456 Bacteria 21162
991 Ga0307513_10020560 3300031456 Bacteria 7826
992 Ga0307513_10037147 3300031456 Bacteria 5423
993 Ga0307513_10097939 3300031456 Bacteria 2966
994 Ga0307513_10215434 3300031456 Bacteria 1747
995 Ga0307513_11091140 3300031456 Bacteria 510
996 Ga0307509_10000212 3300031507 Bacteria 92922
997 Ga0307509_10000317 3300031507 Bacteria 79032
998 Ga0307509_10001515 3300031507 Bacteria 39177
999 Ga0307509_10002052 3300031507 Bacteria 33147
1000 Ga0307509_10057914 3300031507 Bacteria 4105
1001 Ga0307509_10117990 3300031507 Bacteria 2638
1002 Ga0307509_10161551 3300031507 Bacteria 2136
1003 Ga0307509_10250752 3300031507 Bacteria 1554
1004 Ga0307509_10478928 3300031507 Bacteria 933
1005 Ga0307509_10529824 3300031507 Bacteria 858
1006 Ga0307408_100026572 3300031548 Bacteria 3979
1007 Ga0307408_100073052 3300031548 Bacteria 2540
1008 Ga0307408_100113754 3300031548 Bacteria 2083
1009 Ga0307408_100199041 3300031548 Bacteria 1620
1010 Ga0307408_100225286 3300031548 Bacteria 1532
1011 Ga0307408_100323704 3300031548 Bacteria 1299
1012 Ga0307408_100912915 3300031548 Bacteria 804
1013 Ga0307508_10000097 3300031616 Bacteria 103662
1014 Ga0307508_10000332 3300031616 Bacteria 57039
1015 Ga0307508_10001697 3300031616 Bacteria 24440
1016 Ga0307508_10005499 3300031616 Bacteria 12042
1017 Ga0307508_10006375 3300031616 Bacteria 11096
1018 Ga0307508_10118737 3300031616 Bacteria 2246
1019 Ga0307508_10191308 3300031616 Bacteria 1647
1020 Ga0307508_10394920 3300031616 Bacteria 974
1021 Ga0307514_10000795 3300031649 Bacteria 52015
1022 Ga0307514_10003838 3300031649 Bacteria 14140
1023 Ga0307514_10005414 3300031649 Bacteria 11411
1024 Ga0307514_10026427 3300031649 Bacteria 4694
1025 Ga0307514_10066783 3300031649 Bacteria 2718
1026 Ga0307514_10176693 3300031649 Bacteria 1384
1027 Ga0307516_10006132 3300031730 Bacteria 14171
1028 Ga0307516_10126756 3300031730 Bacteria 2337
1029 Ga0307516_10166406 3300031730 Bacteria 1949
1030 Ga0307516_10269308 3300031730 Bacteria 1390
1031 Ga0307516_10307928 3300031730 Bacteria 1258
1032 Ga0307516_10513847 3300031730 Bacteria 852
1033 Ga0307405_10008706 3300031731 Bacteria 5157
1034 Ga0307405_10044351 3300031731 Bacteria 2719
1035 Ga0307405_10199037 3300031731 Bacteria 1453
1036 Ga0307405_10510250 3300031731 Bacteria 965
1037 Ga0307405_10542540 3300031731 Bacteria 939
1038 Ga0307405_10948442 3300031731 Bacteria 731
1039 Ga0307405_11726206 3300031731 Bacteria 555
1040 Ga0307413_10709507 3300031824 Bacteria 836
1041 Ga0307413_10984130 3300031824 Bacteria 722
1042 Ga0307410_10450209 3300031852 Bacteria 1050
1043 Ga0307410_10678872 3300031852 Bacteria 866
1044 Ga0307406_10067497 3300031901 Bacteria 2332
1045 Ga0307406_10083841 3300031901 Bacteria 2126
1046 Ga0307406_10717461 3300031901 Bacteria 836
1047 Ga0307406_11592248 3300031901 Bacteria 577
1048 Ga0307412_10017936 3300031911 Bacteria 4245
1049 Ga0307412_10032642 3300031911 Bacteria 3302
1050 Ga0307412_10096348 3300031911 Bacteria 2082
1051 Ga0307412_10203425 3300031911 Bacteria 1505
1052 Ga0307412_10309707 3300031911 Bacteria 1251
1053 Ga0307412_10625997 3300031911 Bacteria 915
1054 Ga0307412_11142263 3300031911 Bacteria 695
1055 Ga0307409_100005809 3300031995 Bacteria 7159
1056 Ga0307409_101227328 3300031995 Bacteria 774
1057 Ga0307416_100001574 3300032002 Bacteria 12514
1058 Ga0307416_100216574 3300032002 Bacteria 1832
1059 Ga0307416_100360975 3300032002 Bacteria 1475
1060 Ga0307416_100420709 3300032002 Bacteria 1380
1061 Ga0307416_100891181 3300032002 Bacteria 989
1062 Ga0307414_10142492 3300032004 Bacteria 1878
1063 Ga0307414_10173251 3300032004 Bacteria 1727
1064 Ga0307414_11522563 3300032004 Bacteria 623
1065 Ga0307411_10013253 3300032005 Bacteria 4540
1066 Ga0307411_10132222 3300032005 Bacteria 1826
1067 Ga0307411_10780284 3300032005 Bacteria 840
1068 Ga0307415_100007021 3300032126 Bacteria 6125
1069 Ga0307507_10269557 3300033179 Bacteria 1077
1070 Ga0307507_10369216 3300033179 Bacteria 833
1071 Ga0307510_10129347 3300033180 Bacteria 2204
1072 Ga0307510_10262467 3300033180 Bacteria 1208
1073 Ga0307510_10395991 3300033180 Bacteria 824
1074 Ga0307510_10538721 3300033180 Bacteria 613
1075 Ga0373930_0047804 3300034816 Bacteria 927
1076 Ga0373948_0053027 3300034817 Bacteria 875
1077 Ga0373938_0083037 3300034957 Bacteria 783
1078 Ga0373926_0317095 3300035083 Bacteria 610
1079 Ga0373929_0004656 3300035085 Bacteria 2460
1080 Ga0373940_0078320 3300035088 Bacteria 973
1081 Ga0373944_0026045 3300035089 Bacteria 1725
1082 Ga0373923_0056861 3300035111 Bacteria 1653
1083 Ga0373923_0151710 3300035111 Bacteria 1053
1084 Ga0373932_0020198 3300035112 Bacteria 1744
1085 Ga0373932_0059406 3300035112 Bacteria 1158
1086 Ga0373936_0001484 3300035113 Bacteria 8523
1087 Ga0373936_0270213 3300035113 Bacteria 763
1088 Ga0373941_0021775 3300035115 Bacteria 1813
1089 Ga0373956_0089353 3300035119 Bacteria 1420
1090 Ga0373943_0008038 3300035170 Bacteria 4732
1091 Ga0373943_0082489 3300035170 Bacteria 1651
1092 Ga0373946_0124206 3300035171 Bacteria 1181
1093 Ga0373962_0098964 3300035242 Bacteria 907
1094 Ga0373924_0001472 3300035410 Bacteria 7658
1095 Ga0373931_0010336 3300035691 Bacteria 4485
1096 Ga0373935_0166599 3300035692 Bacteria 1505
1097 Ga0373935_0418713 3300035692 Bacteria 964
1098 Ga0373935_0585758 3300035692 Bacteria 815
1099 Ga0373927_0032371 3300035695 Bacteria 3406
1100 Ga0373947_0162803 3300035725 Bacteria 1444
1101 Ga0373947_0732890 3300035725 Bacteria 674
1102 Ga0373937_0171129 3300036401 Bacteria 2038
1103 Ga0373937_0539793 3300036401 Bacteria 1108
1104 Ga0373925_0125496 3300037068 Bacteria 1996
1105 Ga0395899_0000970 3300037312 Bacteria 26551
1106 Ga0395899_0001451 3300037312 Bacteria 20221
1107 Ga0395899_0003277 3300037312 Bacteria 12837
1108 Ga0395899_0115511 3300037312 Bacteria 1926
1109 Ga0395900_0000091 3300037418 Bacteria 167089
1110 Ga0395900_0000602 3300037418 Bacteria 49161
1111 Ga0395900_0006947 3300037418 Bacteria 11742
1112 Ga0395900_0012073 3300037418 Bacteria 8826
1113 Ga0395900_0109955 3300037418 Bacteria 2831
1114 Ga0395900_0313416 3300037418 Bacteria 1551
1115 Ga0395898_0008585 3300037466 Bacteria 10782
1116 Ga0395898_0304421 3300037466 Bacteria 1520
1117 Ga0395898_0310389 3300037466 Bacteria 1504
1118 Ga0395898_0708158 3300037466 Bacteria 949
1119 Ga0395905_0000269 3300037471 Bacteria 77631
1120 Ga0395905_0003396 3300037471 Bacteria 17047
1121 Ga0395905_0008793 3300037471 Bacteria 9926
1122 Ga0395905_0011217 3300037471 Bacteria 8664
1123 Ga0395905_0018561 3300037471 Bacteria 6600
1124 Ga0395905_0115052 3300037471 Bacteria 2527
1125 Ga0395905_0136166 3300037471 Bacteria 2310
1126 Ga0395905_0137658 3300037471 Bacteria 2297
1127 Ga0395905_0237491 3300037471 Bacteria 1703
1128 Ga0395905_0243446 3300037471 Bacteria 1680
1129 Ga0395905_0603517 3300037471 Bacteria 999
1130 Ga0395901_0010721 3300038443 Bacteria 9292
1131 Ga0395901_0085465 3300038443 Bacteria 3298
1132 Ga0395901_0137392 3300038443 Bacteria 2568
1133 Ga0395901_0646484 3300038443 Bacteria 1061
1134 Ga0395901_1085880 3300038443 Bacteria 771
1135 Ga0436365_1128978 3300039437 Bacteria 2310
1136 Ga0436363_1660049 3300039450 Bacteria 3141
1137 Ga0439436_0052251 3300041404 Bacteria 1153
1138 Ga0439439_0039272 3300041406 Bacteria 1223
1139 Ga0439439_0047623 3300041406 Bacteria 1120
1140 Ga0439439_0109082 3300041406 Bacteria 766
1141 Ga0439447_025014 3300041407 Bacteria 1541
1142 Ga0439465_0248345 3300041413 Bacteria 658
1143 Ga0451791_0516807 3300041451 Bacteria 696
1144 Ga0451791_1822013 3300041451 Bacteria 598
1145 Ga0451793_0849783 3300041452 Bacteria 678
1146 Ga0451797_0036350 3300041453 Bacteria 1330
1147 Ga0451795_1156050 3300041456 Bacteria 964
1148 Ga0451798_0365603 3300041458 Bacteria 1186
1149 Ga0451798_0783119 3300041458 Bacteria 665
1150 Ga0451798_1050572 3300041458 Bacteria 596
1151 Ga0451798_1073454 3300041458 Bacteria 536
1152 Ga0451800_0507924 3300041459 Bacteria 1457
1153 Ga0451800_1125983 3300041459 Bacteria 544
1154 Ga0451807_0531094 3300041486 Bacteria 1124
1155 Ga0451807_0955082 3300041486 Bacteria 553
1156 Ga0451833_1039235 3300041491 Bacteria 709
1157 Ga0451839_0995859 3300041496 Bacteria 703
1158 Ga0451845_0395844 3300041501 Bacteria 626
1159 Ga0451847_0890968 3300041503 Bacteria 561
1160 Ga0451849_0455082 3300041505 Bacteria 1100
1161 Ga0451849_0763045 3300041505 Bacteria 597
1162 Ga0451855_0676908 3300041511 Bacteria 544
1163 Ga0451853_0929926 3300041512 Bacteria 1910
1164 Ga0451853_2031670 3300041512 Bacteria 1033
1165 Ga0451853_2256767 3300041512 Bacteria 663
1166 Ga0451853_2771872 3300041512 Bacteria 1332
1167 Ga0439433_0013375 3300041999 Bacteria 1802
1168 Ga0439433_0019350 3300041999 Bacteria 1517
1169 Ga0439442_009722 3300042002 Bacteria 1945
1170 Ga0439445_0055849 3300042004 Bacteria 1073
1171 Ga0439432_075318 3300042006 Bacteria 1025
1172 Ga0439432_200791 3300042006 Bacteria 578
1173 Ga0439449_0001455 3300042007 Bacteria 9260
1174 Ga0439449_0012086 3300042007 Bacteria 3245
1175 Ga0439452_031211 3300042010 Bacteria 1308
1176 Ga0439455_0003947 3300042012 Bacteria 2893
1177 Ga0439457_067024 3300042014 Bacteria 816
1178 Ga0439462_0007888 3300042015 Bacteria 2673
1179 Ga0439462_0010211 3300042015 Bacteria 2378
1180 Ga0450921_001983 3300042123 Bacteria 1313
1181 Ga0450923_003206 3300042125 Bacteria 2442
1182 Ga0450923_020511 3300042125 Bacteria 1281
1183 Ga0450923_035316 3300042125 Bacteria 1034
1184 Ga0450897_008249 3300042128 Bacteria 965
1185 Ga0450896_007410 3300042133 Bacteria 1514
1186 Ga0450898_005481 3300042134 Bacteria 1919
1187 Ga0450898_020412 3300042134 Bacteria 1161
1188 Ga0450905_056568 3300042142 Bacteria 648
1189 Ga0450910_025753 3300042147 Bacteria 906
1190 Ga0439446_0011968 3300042156 Bacteria 2365
1191 Ga0439446_0194101 3300042156 Bacteria 683
1192 Ga0439458_0006040 3300042157 Bacteria 2707
1193 Ga0450908_011589 3300042184 Bacteria 1612
1194 Ga0450908_030358 3300042184 Bacteria 939
1195 Ga0450909_037887 3300042185 Bacteria 739
1196 Ga0439434_0104381 3300042435 Bacteria 915
1197 Ga0439434_0115615 3300042435 Bacteria 872
1198 Ga0450893_0005187 3300042532 Bacteria 2085
1199 Ga0450893_0019015 3300042532 Bacteria 1173
1200 Ga0451577_0012109 3300042876 Bacteria 8113
1201 Ga0451577_0694118 3300042876 Bacteria 922
1202 Ga0466969_0194702 3300044656 Bacteria 925
1203 Ga0466972_0026237 3300044658 Bacteria 2887
1204 Ga0466965_0124831 3300044683 Bacteria 1331
1205 Ga0466961_0965815 3300044693 Bacteria 507
1206 Ga0466963_0387885 3300044694 Bacteria 985
1207 Ga0466964_0070136 3300044706 Bacteria 1480
1208 Ga0453684_0009557 3300044712 Bacteria 16927
1209 Ga0453684_0067062 3300044712 Bacteria 4566
1210 Ga0466968_0578281 3300044735 Bacteria 565
1211 Ga0466960_0187524 3300044901 Bacteria 1124
1212 Ga0451576_0035144 3300045051 Bacteria 5319
1213 Ga0451576_0804264 3300045051 Bacteria 987
1214 Ga0451576_0993627 3300045051 Bacteria 880
1215 Ga0466958_0525569 3300045836 Bacteria 768
1216 Ga0495627_049188 3300046453 Bacteria 1273
1217 Ga0495627_143442 3300046453 Bacteria 668
1218 Ga0495592_0000175 3300046454 Bacteria 56416
1219 Ga0495592_0003711 3300046454 Bacteria 11010
1220 Ga0495603_0337394 3300046455 Bacteria 865
1221 Ga0495590_0000001 3300046457 Bacteria 762984
1222 Ga0495590_0014398 3300046457 Bacteria 2886
1223 Ga0495590_0015858 3300046457 Bacteria 2726
1224 Ga0495590_0151583 3300046457 Bacteria 840
1225 Ga0495638_0002754 3300046460 Bacteria 14123
1226 Ga0495638_0005353 3300046460 Bacteria 9568
1227 Ga0495638_0086048 3300046460 Bacteria 1900
1228 Ga0495638_0105756 3300046460 Bacteria 1677
1229 Ga0495638_0421708 3300046460 Bacteria 688
1230 Ga0495641_0300235 3300046461 Bacteria 724
1231 Ga0495653_0000009 3300046463 Bacteria 304207
1232 Ga0495653_0316734 3300046463 Bacteria 1012
1233 Ga0495653_0406350 3300046463 Bacteria 864
1234 Ga0495650_0000001 3300046471 Bacteria 1085492
1235 Ga0495650_0000051 3300046471 Bacteria 318297
1236 Ga0495650_0000213 3300046471 Bacteria 123910
1237 Ga0495650_0009697 3300046471 Bacteria 5456
1238 Ga0495650_0030124 3300046471 Bacteria 2462
1239 Ga0495580_0355786 3300046472 Bacteria 991
1240 Ga0495580_0685529 3300046472 Bacteria 672
1241 Ga0495605_0000040 3300046474 Bacteria 193955
1242 Ga0495605_0024096 3300046474 Bacteria 3189
1243 Ga0495605_0049002 3300046474 Bacteria 2065
1244 Ga0495605_0284035 3300046474 Bacteria 703
1245 Ga0495605_0386324 3300046474 Bacteria 583
1246 Ga0495639_0021593 3300046475 Bacteria 2819
1247 Ga0495639_0127151 3300046475 Bacteria 1218
1248 Ga0495639_0457425 3300046475 Bacteria 649
1249 Ga0495639_0629862 3300046475 Bacteria 552
1250 Ga0495662_0401925 3300046476 Bacteria 673
1251 Ga0495584_0015103 3300046491 Bacteria 3935
1252 Ga0495584_0047944 3300046491 Bacteria 2155
1253 Ga0495584_0084559 3300046491 Bacteria 1598
1254 Ga0495584_0269858 3300046491 Bacteria 865
1255 Ga0495585_0000587 3300046492 Bacteria 34126
1256 Ga0495585_0005376 3300046492 Bacteria 8082
1257 Ga0495585_0292387 3300046492 Bacteria 803
1258 Ga0495596_0000029 3300046500 Bacteria 103615
1259 Ga0495596_0000177 3300046500 Bacteria 44496
1260 Ga0495596_0000309 3300046500 Bacteria 32084
1261 Ga0495596_0002217 3300046500 Bacteria 10590
1262 Ga0495596_0002850 3300046500 Bacteria 9022
1263 Ga0495596_0003951 3300046500 Bacteria 7334
1264 Ga0495596_0006338 3300046500 Bacteria 5459
1265 Ga0495596_0032721 3300046500 Bacteria 2072
1266 Ga0495596_0046851 3300046500 Bacteria 1697
1267 Ga0495607_0000867 3300046501 Bacteria 28348
1268 Ga0495607_0003055 3300046501 Bacteria 13021
1269 Ga0495607_0035858 3300046501 Bacteria 2995
1270 Ga0495607_0035916 3300046501 Bacteria 2992
1271 Ga0495607_0058891 3300046501 Bacteria 2193
1272 Ga0495607_0060055 3300046501 Bacteria 2165
1273 Ga0495607_0095182 3300046501 Bacteria 1605
1274 Ga0495583_0000127 3300046506 Bacteria 127780
1275 Ga0495583_0002687 3300046506 Bacteria 14789
1276 Ga0495583_0003009 3300046506 Bacteria 13477
1277 Ga0495583_0009275 3300046506 Bacteria 5895
1278 Ga0495583_0016689 3300046506 Bacteria 3935
1279 Ga0495583_0018534 3300046506 Bacteria 3661
1280 Ga0495583_0108944 3300046506 Bacteria 1175
1281 Ga0495583_0259338 3300046506 Bacteria 696
1282 Ga0495606_0019807 3300046507 Bacteria 4985
1283 Ga0495606_0163844 3300046507 Bacteria 1295
1284 Ga0495606_0316167 3300046507 Bacteria 841
1285 Ga0495610_0000008 3300046512 Bacteria 622732
1286 Ga0495610_0001018 3300046512 Bacteria 25838
1287 Ga0495610_0081480 3300046512 Bacteria 1485
1288 Ga0495610_0119289 3300046512 Bacteria 1158
1289 Ga0495616_0000034 3300046513 Bacteria 129394
1290 Ga0495616_0000071 3300046513 Bacteria 89053
1291 Ga0495616_0000294 3300046513 Bacteria 40512
1292 Ga0495616_0002129 3300046513 Bacteria 13266
1293 Ga0495616_0004940 3300046513 Bacteria 8327
1294 Ga0495616_0008342 3300046513 Bacteria 6143
1295 Ga0495616_0014033 3300046513 Bacteria 4501
1296 Ga0495616_0132029 3300046513 Bacteria 1143
1297 Ga0495616_0221478 3300046513 Bacteria 823
1298 Ga0495620_0031646 3300046515 Bacteria 2422
1299 Ga0495620_0061356 3300046515 Bacteria 1564
1300 Ga0495620_0072090 3300046515 Bacteria 1411
1301 Ga0495620_0224872 3300046515 Bacteria 718
1302 Ga0495628_0377451 3300046516 Bacteria 1039
1303 Ga0495630_0225575 3300046517 Bacteria 1431
1304 Ga0495630_0288158 3300046517 Bacteria 1255
1305 Ga0495631_0000042 3300046518 Bacteria 78766
1306 Ga0495631_0000408 3300046518 Bacteria 29643
1307 Ga0495631_0001648 3300046518 Bacteria 13280
1308 Ga0495631_0037703 3300046518 Bacteria 2152
1309 Ga0495631_0042931 3300046518 Bacteria 1996
1310 Ga0495631_0321971 3300046518 Bacteria 658
1311 Ga0495632_0000033 3300046519 Bacteria 164240
1312 Ga0495632_0000086 3300046519 Bacteria 95327
1313 Ga0495632_0000321 3300046519 Bacteria 46253
1314 Ga0495632_0001237 3300046519 Bacteria 21665
1315 Ga0495632_0005196 3300046519 Bacteria 8683
1316 Ga0495632_0008164 3300046519 Bacteria 6468
1317 Ga0495632_0028978 3300046519 Bacteria 2886
1318 Ga0495632_0112266 3300046519 Bacteria 1279
1319 Ga0495632_0204880 3300046519 Bacteria 897
1320 Ga0495637_0003831 3300046520 Bacteria 7897
1321 Ga0495637_0005223 3300046520 Bacteria 6648
1322 Ga0495637_0018995 3300046520 Bacteria 3183
1323 Ga0495637_0020863 3300046520 Bacteria 3007
1324 Ga0495637_0052143 3300046520 Bacteria 1709
1325 Ga0495637_0052357 3300046520 Bacteria 1704
1326 Ga0495637_0068682 3300046520 Bacteria 1435
1327 Ga0495637_0097785 3300046520 Bacteria 1151
1328 Ga0495637_0193181 3300046520 Bacteria 750
1329 Ga0495643_0000044 3300046522 Bacteria 226211
1330 Ga0495643_0000096 3300046522 Bacteria 146041
1331 Ga0495643_0000398 3300046522 Bacteria 57089
1332 Ga0495643_0000760 3300046522 Bacteria 36247
1333 Ga0495643_0001857 3300046522 Bacteria 17930
1334 Ga0495643_0024026 3300046522 Bacteria 3460
1335 Ga0495643_0035116 3300046522 Bacteria 2761
1336 Ga0495643_0048354 3300046522 Bacteria 2299
1337 Ga0495643_0063146 3300046522 Bacteria 1959
1338 Ga0495643_0068006 3300046522 Bacteria 1875
1339 Ga0495643_0084857 3300046522 Bacteria 1643
1340 Ga0495643_0197664 3300046522 Bacteria 967
1341 Ga0495643_0274842 3300046522 Bacteria 777
1342 Ga0495644_0000030 3300046523 Bacteria 66319
1343 Ga0495644_0033198 3300046523 Bacteria 1950
1344 Ga0495648_0000001 3300046524 Bacteria 696872
1345 Ga0495648_0000505 3300046524 Bacteria 41982
1346 Ga0495648_0001508 3300046524 Bacteria 22794
1347 Ga0495648_0011019 3300046524 Bacteria 6850
1348 Ga0495648_0016203 3300046524 Bacteria 5377
1349 Ga0495648_0020401 3300046524 Bacteria 4623
1350 Ga0495648_0024378 3300046524 Bacteria 4122
1351 Ga0495648_0036767 3300046524 Bacteria 3153
1352 Ga0495648_0041837 3300046524 Bacteria 2889
1353 Ga0495648_0054396 3300046524 Bacteria 2418
1354 Ga0495648_0115262 3300046524 Bacteria 1454
1355 Ga0495648_0292683 3300046524 Bacteria 766
1356 Ga0495642_0000246 3300046528 Bacteria 30547
1357 Ga0495642_0000273 3300046528 Bacteria 29188
1358 Ga0495642_0000401 3300046528 Bacteria 23277
1359 Ga0495642_0003450 3300046528 Bacteria 6228
1360 Ga0495642_0054844 3300046528 Bacteria 1644
1361 Ga0495642_0063629 3300046528 Bacteria 1533
1362 Ga0495642_0099496 3300046528 Bacteria 1237
1363 Ga0495642_0218528 3300046528 Bacteria 832
1364 Ga0495654_0000058 3300046530 Bacteria 139884
1365 Ga0495654_0001164 3300046530 Bacteria 18772
1366 Ga0495654_0002363 3300046530 Bacteria 12189
1367 Ga0495654_0008964 3300046530 Bacteria 5495
1368 Ga0495654_0020402 3300046530 Bacteria 3454
1369 Ga0495654_0045998 3300046530 Bacteria 2151
1370 Ga0495654_0054787 3300046530 Bacteria 1933
1371 Ga0495654_0058094 3300046530 Bacteria 1867
1372 Ga0495654_0174153 3300046530 Bacteria 936
1373 Ga0495654_0205785 3300046530 Bacteria 839
1374 Ga0495586_0509190 3300046535 Bacteria 695
1375 Ga0495587_0200705 3300046536 Bacteria 1128
1376 Ga0495587_0292480 3300046536 Bacteria 912
1377 Ga0495598_0069329 3300046537 Bacteria 1107
1378 Ga0495609_0000044 3300046538 Bacteria 161642
1379 Ga0495609_0000628 3300046538 Bacteria 27456
1380 Ga0495609_0000913 3300046538 Bacteria 21398
1381 Ga0495609_0000919 3300046538 Bacteria 21337
1382 Ga0495609_0002371 3300046538 Bacteria 11615
1383 Ga0495609_0002960 3300046538 Bacteria 10046
1384 Ga0495609_0005079 3300046538 Bacteria 7015
1385 Ga0495609_0034221 3300046538 Bacteria 2304
1386 Ga0495609_0094690 3300046538 Bacteria 1297
1387 Ga0495609_0199349 3300046538 Bacteria 837
1388 Ga0495621_0041382 3300046539 Bacteria 1618
1389 Ga0495621_0098758 3300046539 Bacteria 1109
1390 Ga0495621_0099677 3300046539 Bacteria 1104
1391 Ga0495621_0100499 3300046539 Bacteria 1100
1392 Ga0495597_0000115 3300046542 Bacteria 72325
1393 Ga0495597_0000996 3300046542 Bacteria 21725
1394 Ga0495597_0001025 3300046542 Bacteria 21374
1395 Ga0495597_0003730 3300046542 Bacteria 8697
1396 Ga0495597_0030025 3300046542 Bacteria 2479
1397 Ga0495597_0041564 3300046542 Bacteria 2053
1398 Ga0495597_0084653 3300046542 Bacteria 1352
1399 Ga0495597_0100640 3300046542 Bacteria 1219
1400 Ga0495597_0157684 3300046542 Bacteria 928
1401 Ga0495645_0181194 3300046543 Bacteria 1443
1402 Ga0495622_0051350 3300046557 Bacteria 1913
1403 Ga0495622_0063469 3300046557 Bacteria 1709
1404 Ga0495633_0000521 3300046558 Bacteria 38447
1405 Ga0495633_0003990 3300046558 Bacteria 9560
1406 Ga0495633_0019390 3300046558 Bacteria 3441
1407 Ga0495633_0044952 3300046558 Bacteria 2092
1408 Ga0495633_0073496 3300046558 Bacteria 1594
1409 Ga0495633_0111838 3300046558 Bacteria 1266
1410 Ga0495633_0243430 3300046558 Bacteria 821
1411 Ga0495633_0249677 3300046558 Bacteria 810
1412 Ga0495633_0310676 3300046558 Bacteria 716
1413 Ga0495667_0081116 3300046559 Bacteria 2109
1414 Ga0495656_0001972 3300046615 Bacteria 6773
1415 Ga0495656_0006352 3300046615 Bacteria 4144
1416 Ga0495668_0000045 3300046616 Bacteria 225145
1417 Ga0495668_0000193 3300046616 Bacteria 89740
1418 Ga0495668_0000669 3300046616 Bacteria 41269
1419 Ga0495668_0013890 3300046616 Bacteria 4736
1420 Ga0495668_0051691 3300046616 Bacteria 2275
1421 Ga0495668_0123854 3300046616 Bacteria 1414
1422 Ga0495668_0133597 3300046616 Bacteria 1358
1423 Ga0495668_0255204 3300046616 Bacteria 960
1424 Ga0495668_0312677 3300046616 Bacteria 861
1425 Ga0495668_0373975 3300046616 Bacteria 782
1426 Ga0495668_0375524 3300046616 Bacteria 781
1427 Ga0495634_0293425 3300046642 Bacteria 985
1428 Ga0495634_0438806 3300046642 Bacteria 772
1429 Ga0495611_0000439 3300046648 Bacteria 25620
1430 Ga0495611_0179729 3300046648 Bacteria 989
1431 Ga0495611_0192884 3300046648 Bacteria 951
1432 Ga0495625_0000065 3300046660 Bacteria 173230
1433 Ga0495625_0000224 3300046660 Bacteria 89521
1434 Ga0495625_0001600 3300046660 Bacteria 26768
1435 Ga0495625_0004383 3300046660 Bacteria 13387
1436 Ga0495625_0010559 3300046660 Bacteria 7627
1437 Ga0495625_0010801 3300046660 Bacteria 7516
1438 Ga0495625_0021731 3300046660 Bacteria 4933
1439 Ga0495625_0027912 3300046660 Bacteria 4239
1440 Ga0495625_0054514 3300046660 Bacteria 2855
1441 Ga0495625_0080161 3300046660 Bacteria 2274
1442 Ga0495625_0083807 3300046660 Bacteria 2215
1443 Ga0495625_0114980 3300046660 Bacteria 1836
1444 Ga0495625_0147503 3300046660 Bacteria 1583
1445 Ga0495625_0227577 3300046660 Bacteria 1219
1446 Ga0495625_0385197 3300046660 Bacteria 879
1447 Ga0495625_0451389 3300046660 Bacteria 794
1448 Ga0495625_0592313 3300046660 Bacteria 667
1449 Ga0495635_0418108 3300046663 Bacteria 889
1450 Ga0495659_0000041 3300046664 Bacteria 59124
1451 Ga0495659_0002529 3300046664 Bacteria 5904
1452 Ga0495661_0000049 3300046665 Bacteria 144060
1453 Ga0495661_0000170 3300046665 Bacteria 77754
1454 Ga0495661_0000325 3300046665 Bacteria 52324
1455 Ga0495661_0000843 3300046665 Bacteria 28565
1456 Ga0495661_0001206 3300046665 Bacteria 22434
1457 Ga0495661_0002108 3300046665 Bacteria 15613
1458 Ga0495661_0005969 3300046665 Bacteria 8595
1459 Ga0495661_0024188 3300046665 Bacteria 3932
1460 Ga0495661_0040999 3300046665 Bacteria 2867
1461 Ga0495661_0049889 3300046665 Bacteria 2536
1462 Ga0495661_0062830 3300046665 Bacteria 2198
1463 Ga0495661_0126875 3300046665 Bacteria 1403
1464 Ga0495661_0166230 3300046665 Bacteria 1180
1465 Ga0495661_0217644 3300046665 Bacteria 991
1466 Ga0495661_0478153 3300046665 Bacteria 596
1467 Ga0495588_0020475 3300046674 Bacteria 3252
1468 Ga0495588_0026306 3300046674 Bacteria 2904
1469 Ga0495588_0191695 3300046674 Bacteria 1080
1470 Ga0495588_0218584 3300046674 Bacteria 1006
1471 Ga0495657_0274252 3300046675 Bacteria 1011
1472 Ga0495646_0005993 3300046680 Bacteria 7705
1473 Ga0495646_0284957 3300046680 Bacteria 877
1474 Ga0495647_0116960 3300046681 Bacteria 1118
1475 Ga0495647_0122974 3300046681 Bacteria 1093
1476 Ga0495647_0150415 3300046681 Bacteria 998
1477 Ga0495647_0157311 3300046681 Bacteria 977
1478 Ga0495658_0010460 3300046683 Bacteria 4642
1479 Ga0495658_0037225 3300046683 Bacteria 2688
1480 Ga0495658_0068835 3300046683 Bacteria 2050
1481 Ga0495658_0180529 3300046683 Bacteria 1309
1482 Ga0495658_0327932 3300046683 Bacteria 971
1483 Ga0495658_0525918 3300046683 Bacteria 757
1484 Ga0495669_0000091 3300046684 Bacteria 59795
1485 Ga0495669_0015836 3300046684 Bacteria 3228
1486 Ga0495669_0029860 3300046684 Bacteria 2392
1487 Ga0495669_0256211 3300046684 Bacteria 840
1488 Ga0495613_0387219 3300046689 Bacteria 955
1489 Ga0495670_0024393 3300046691 Bacteria 2989
1490 Ga0495670_0030552 3300046691 Bacteria 2676
1491 Ga0495670_0038070 3300046691 Bacteria 2397
1492 Ga0495670_0257154 3300046691 Bacteria 932
1493 Ga0495670_0492896 3300046691 Bacteria 665
1494 Ga0495671_0000002 3300046692 Bacteria 1136189
1495 Ga0495671_0000131 3300046692 Bacteria 67432
1496 Ga0495671_0000198 3300046692 Bacteria 52877
1497 Ga0495671_0001101 3300046692 Bacteria 18664
1498 Ga0495671_0062030 3300046692 Bacteria 1843
1499 Ga0495671_0241127 3300046692 Bacteria 873
1500 Ga0495671_0334160 3300046692 Bacteria 727
1501 Ga0495649_0000303 3300046694 Bacteria 43094
1502 Ga0495649_0001551 3300046694 Bacteria 17244
1503 Ga0495649_0007850 3300046694 Bacteria 6459
1504 Ga0495649_0076699 3300046694 Bacteria 1789
1505 Ga0495649_0077226 3300046694 Bacteria 1783
1506 Ga0495649_0152523 3300046694 Bacteria 1213
1507 Ga0495649_0287073 3300046694 Bacteria 840
1508 Ga0495649_0497529 3300046694 Bacteria 606
1509 Ga0495589_0000035 3300046794 Bacteria 161642
1510 Ga0495589_0000219 3300046794 Bacteria 48510
1511 Ga0495589_0004514 3300046794 Bacteria 7395
1512 Ga0495589_0014524 3300046794 Bacteria 4053
1513 Ga0495589_0086051 3300046794 Bacteria 1527
1514 Ga0495589_0145767 3300046794 Bacteria 1132
1515 Ga0495589_0157520 3300046794 Bacteria 1082
1516 Ga0495589_0294625 3300046794 Bacteria 753
1517 Ga0495600_0177981 3300046809 Bacteria 1371
1518 Ga0495600_0459836 3300046809 Bacteria 786
1519 Ga0495660_0002312 3300046810 Bacteria 12220
1520 Ga0495660_0004863 3300046810 Bacteria 8088
1521 Ga0495660_0012822 3300046810 Bacteria 4861
1522 Ga0495660_0018326 3300046810 Bacteria 4024
1523 Ga0495660_0027191 3300046810 Bacteria 3237
1524 Ga0495660_0027838 3300046810 Bacteria 3195
1525 Ga0495660_0030060 3300046810 Bacteria 3062
1526 Ga0495660_0092147 3300046810 Bacteria 1573
1527 Ga0495660_0128877 3300046810 Bacteria 1271
1528 Ga0495660_0134626 3300046810 Bacteria 1236
1529 Ga0495660_0141449 3300046810 Bacteria 1197
1530 Ga0495604_0413231 3300047317 Bacteria 887
1531 Ga0495636_0000537 3300047318 Bacteria 13950
1532 Ga0495636_0005816 3300047318 Bacteria 4835
1533 Ga0495636_0037481 3300047318 Bacteria 2002
1534 Ga0495672_0000031 3300047320 Bacteria 298258
1535 Ga0495672_0000685 3300047320 Bacteria 37744
1536 Ga0495672_0001603 3300047320 Bacteria 22074
1537 Ga0495672_0005983 3300047320 Bacteria 9528
1538 Ga0495672_0021488 3300047320 Bacteria 4209
1539 Ga0495676_0000398 3300047321 Bacteria 35184
1540 Ga0495676_0030096 3300047321 Bacteria 4614
1541 Ga0495676_0069402 3300047321 Bacteria 2719
1542 Ga0495680_0509407 3300047322 Bacteria 816
1543 Ga0495683_0003254 3300047323 Bacteria 9489
1544 Ga0495683_0072619 3300047323 Bacteria 1688
1545 Ga0495683_0116569 3300047323 Bacteria 1271
1546 Ga0495683_0432777 3300047323 Bacteria 542
1547 Ga0495687_000002 3300047443 Bacteria 1085770
1548 Ga0495687_000066 3300047443 Bacteria 161642
1549 Ga0495687_001099 3300047443 Bacteria 26415
1550 Ga0495687_001273 3300047443 Bacteria 23729
1551 Ga0495687_001453 3300047443 Bacteria 21748
1552 Ga0495687_002257 3300047443 Bacteria 15813
1553 Ga0495687_002986 3300047443 Bacteria 12800
1554 Ga0495687_004333 3300047443 Bacteria 9656
1555 Ga0495687_012673 3300047443 Bacteria 4444
1556 Ga0495687_013163 3300047443 Bacteria 4330
1557 Ga0495687_018635 3300047443 Bacteria 3427
1558 Ga0495687_031321 3300047443 Bacteria 2440
1559 Ga0495677_0000013 3300047445 Bacteria 138372
1560 Ga0495677_0000512 3300047445 Bacteria 16307
1561 Ga0495677_0000550 3300047445 Bacteria 15532
1562 Ga0495677_0002369 3300047445 Bacteria 7408
1563 Ga0495677_0050369 3300047445 Bacteria 1532
1564 Ga0495677_0088148 3300047445 Bacteria 1168
1565 Ga0495677_0148178 3300047445 Bacteria 903
1566 Ga0495677_0202949 3300047445 Bacteria 771
1567 Ga0495677_0302893 3300047445 Bacteria 629
1568 Ga0495679_000296 3300047446 Bacteria 40360
1569 Ga0495679_002037 3300047446 Bacteria 10678
1570 Ga0495679_010136 3300047446 Bacteria 3719
1571 Ga0495679_020858 3300047446 Bacteria 2275
1572 Ga0495679_045256 3300047446 Bacteria 1345
1573 Ga0495685_000307 3300047447 Bacteria 16005
1574 Ga0495685_040375 3300047447 Bacteria 1596
1575 Ga0495673_0000061 3300047469 Bacteria 230647
1576 Ga0495673_0000926 3300047469 Bacteria 26610
1577 Ga0495681_0000016 3300047470 Bacteria 181322
1578 Ga0495681_0022987 3300047470 Bacteria 3324
1579 Ga0495681_0104177 3300047470 Bacteria 1237
1580 Ga0495686_0000054 3300047472 Bacteria 259400
1581 Ga0495686_0000464 3300047472 Bacteria 60897
1582 Ga0495686_0001324 3300047472 Bacteria 27731
1583 Ga0495686_0269510 3300047472 Bacteria 950
1584 Ga0495686_0459673 3300047472 Bacteria 675
1585 Ga0495593_0000083 3300047673 Bacteria 41204
1586 Ga0495593_0017089 3300047673 Bacteria 4083
1587 Ga0495602_0232178 3300048088 Bacteria 1385
1588 Ga0495614_0004378 3300048089 Bacteria 6367
1589 Ga0495614_0010642 3300048089 Bacteria 4053
1590 Ga0495615_0002597 3300048090 Bacteria 2915
1591 Ga0495626_0000011 3300048091 Bacteria 260928
1592 Ga0495626_0000071 3300048091 Bacteria 136767
1593 Ga0495626_0003695 3300048091 Bacteria 9685
1594 Ga0495626_0005258 3300048091 Bacteria 7651
1595 Ga0495626_0008223 3300048091 Bacteria 5745
1596 Ga0495626_0020612 3300048091 Bacteria 3282
1597 Ga0495626_0029974 3300048091 Bacteria 2626
1598 Ga0495626_0031597 3300048091 Bacteria 2547
1599 Ga0495626_0058708 3300048091 Bacteria 1757
1600 Ga0495626_0059441 3300048091 Bacteria 1744
1601 Ga0495626_0065283 3300048091 Bacteria 1647
1602 Ga0495626_0066936 3300048091 Bacteria 1623
1603 Ga0495626_0086231 3300048091 Bacteria 1387
1604 Ga0495626_0090886 3300048091 Bacteria 1342
1605 Ga0495626_0127985 3300048091 Bacteria 1086
1606 Ga0495626_0127989 3300048091 Bacteria 1086
1607 Ga0495626_0399090 3300048091 Bacteria 532
1608 Ga0496100_0002053 3300048903 Bacteria 10102
1609 Ga0496100_0007896 3300048903 Bacteria 5909
1610 Ga0496100_0456306 3300048903 Bacteria 980
1611 Ga0496101_0056761 3300048904 Bacteria 2831
1612 Ga0496101_0067612 3300048904 Bacteria 2609
1613 Ga0496101_0485113 3300048904 Bacteria 976
1614 Ga0496102_0003799 3300048905 Bacteria 12766
1615 Ga0496102_0047264 3300048905 Bacteria 3910
1616 Ga0496102_0191157 3300048905 Bacteria 1929
1617 Ga0496102_0509070 3300048905 Bacteria 1126
1618 Ga0496103_0246927 3300048906 Bacteria 1148
1619 Ga0496104_0004101 3300048907 Bacteria 12642
1620 Ga0496104_0058001 3300048907 Bacteria 3664
1621 Ga0496104_0330733 3300048907 Bacteria 1437
1622 Ga0496104_0657970 3300048907 Bacteria 956
1623 Ga0496105_0043048 3300048908 Bacteria 3724
1624 Ga0496105_0592230 3300048908 Bacteria 861
1625 Ga0496105_0626676 3300048908 Bacteria 832
1626 Ga0496106_0012220 3300048909 Bacteria 6336
1627 Ga0496106_0055120 3300048909 Bacteria 3004
1628 Ga0496107_0130976 3300048910 Bacteria 1851
1629 Ga0496107_0372999 3300048910 Bacteria 1061
1630 Ga0496108_0067782 3300048911 Bacteria 3010
1631 Ga0496108_0254884 3300048911 Bacteria 1526
1632 Ga0496108_0525511 3300048911 Bacteria 1033
1633 Ga0496109_0034590 3300048912 Bacteria 4553
1634 Ga0496109_0069873 3300048912 Bacteria 3222
1635 Ga0496109_1231936 3300048912 Bacteria 685
1636 Ga0496110_0094088 3300048913 Bacteria 2683
1637 Ga0496110_0128599 3300048913 Bacteria 2286
1638 Ga0496110_0158310 3300048913 Bacteria 2052
1639 Ga0496110_0353796 3300048913 Bacteria 1338
1640 Ga0496111_0062777 3300048914 Bacteria 2694
1641 Ga0496111_0252643 3300048914 Bacteria 1308
1642 Ga0496111_0669728 3300048914 Bacteria 756
1643 Ga0496112_0277695 3300048915 Bacteria 1623
1644 Ga0496113_0010989 3300048916 Bacteria 6016
1645 Ga0496113_0122050 3300048916 Bacteria 2038
1646 Ga0496113_0990754 3300048916 Bacteria 662
1647 Ga0496114_0218590 3300048917 Bacteria 1672
1648 Ga0496114_0314115 3300048917 Bacteria 1384
1649 Ga0496114_0341868 3300048917 Bacteria 1323
1650 Ga0496114_0601822 3300048917 Bacteria 969
1651 Ga0496115_0259830 3300048918 Bacteria 1428
1652 Ga0496116_0163029 3300048919 Bacteria 1220
1653 Ga0496116_0166712 3300048919 Bacteria 1200
1654 Ga0496116_0266748 3300048919 Bacteria 840
1655 Ga0496117_0013508 3300048920 Bacteria 7119
1656 Ga0496117_0019516 3300048920 Bacteria 5563
1657 Ga0496117_0052144 3300048920 Bacteria 2884
1658 Ga0496118_0009116 3300048921 Bacteria 10097
1659 Ga0496118_0053625 3300048921 Bacteria 3062
1660 Ga0496121_0045456 3300048924 Bacteria 3772
1661 Ga0496121_0089403 3300048924 Bacteria 2411
1662 Ga0496121_0188861 3300048924 Bacteria 1479
1663 Ga0496122_0000552 3300048925 Bacteria 77275
1664 Ga0496122_0127986 3300048925 Bacteria 1621
1665 Ga0496123_0001585 3300048926 Bacteria 30921
1666 Ga0496123_0025017 3300048926 Bacteria 4515
1667 Ga0496123_0052955 3300048926 Bacteria 2687
1668 Ga0496123_0143032 3300048926 Bacteria 1304
1669 Ga0496124_0089671 3300048927 Bacteria 2510
1670 Ga0496124_0142076 3300048927 Bacteria 1893
1671 Ga0496124_0166873 3300048927 Bacteria 1710
1672 Ga0496124_0189507 3300048927 Bacteria 1575
1673 Ga0496125_0001368 3300048928 Bacteria 35878
1674 Ga0496125_0009166 3300048928 Bacteria 10227
1675 Ga0496125_0034798 3300048928 Bacteria 4432
1676 Ga0496125_0056434 3300048928 Bacteria 3189
1677 Ga0496125_0190126 3300048928 Bacteria 1356
1678 Ga0496125_0256365 3300048928 Bacteria 1099
1679 Ga0496125_0471999 3300048928 Bacteria 713
1680 Ga0496126_0126980 3300048929 Bacteria 2207
1681 Ga0496126_0496667 3300048929 Bacteria 976
1682 Ga0496126_0547004 3300048929 Bacteria 919
1683 Ga0495678_000009 3300049459 Bacteria 373806
1684 Ga0495678_000035 3300049459 Bacteria 200957
1685 Ga0495678_003416 3300049459 Bacteria 9852
1686 Ga0495678_014610 3300049459 Bacteria 3646
1687 Ga0495678_033503 3300049459 Bacteria 2119
1688 Ga0495678_094668 3300049459 Bacteria 1045
1689 Ga0495678_112271 3300049459 Bacteria 927
1690 Ga0495682_0001939 3300049460 Bacteria 10279
1691 Ga0495682_0002609 3300049460 Bacteria 8457
1692 Ga0495682_0007946 3300049460 Bacteria 4194
1693 Ga0495682_0068522 3300049460 Bacteria 1278
1694 Ga0501298_011896 3300049521 Bacteria 1519
1695 Ga0501300_018393 3300049523 Bacteria 1021
1696 Ga0501303_004894 3300049526 Bacteria 1122
1697 Ga0501032_0057759 3300049569 Bacteria 2606
1698 Ga0501034_0735138 3300049571 Bacteria 883
1699 Ga0501043_0010569 3300049579 Bacteria 7226
1700 Ga0501043_0365601 3300049579 Bacteria 1094
1701 Ga0501043_0623108 3300049579 Bacteria 795
1702 Ga0501046_0012537 3300049580 Bacteria 7209
1703 Ga0501047_0015658 3300049581 Bacteria 7226
1704 Ga0501048_0068146 3300049582 Bacteria 2514
1705 Ga0501206_015062 3300049653 Bacteria 1068
1706 Ga0501222_011032 3300049662 Bacteria 1192
1707 Ga0501240_015693 3300049673 Bacteria 1080
1708 Ga0501249_001955 3300049679 Bacteria 4189
1709 Ga0501225_0009720 3300049705 Bacteria 2735
1710 Ga0501079_0898240 3300049741 Bacteria 698
1711 Ga0501262_000333 3300049759 Bacteria 5698
1712 Ga0501264_008911 3300049761 Bacteria 951
1713 Ga0501265_002430 3300049762 Bacteria 2113
1714 Ga0501269_051107 3300049766 Bacteria 569
1715 nmdc:mga03683_100415_c1 3300050489 Bacteria 1271
1716 nmdc:mga03683_11059_c1 3300050489 Bacteria 3253
1717 nmdc:mga03683_121243_c1 3300050489 Bacteria 1163
1718 nmdc:mga03683_176849_c1 3300050489 Bacteria 972
1719 nmdc:mga03683_191079_c1 3300050489 Bacteria 937
1720 nmdc:mga03683_2207_c1 3300050489 Bacteria 6010
1721 nmdc:mga03683_231868_c1 3300050489 Bacteria 854
1722 nmdc:mga03683_312174_c1 3300050489 Bacteria 739
1723 nmdc:mga03683_351698_c1 3300050489 Bacteria 698
1724 nmdc:mga03683_4604_c1 3300050489 Bacteria 4588
1725 nmdc:mga03683_505229_c1 3300050489 Bacteria 586
1726 nmdc:mga03683_52226_c1 3300050489 Bacteria 1708
1727 nmdc:mga03683_558913_c1 3300050489 Bacteria 557
1728 nmdc:mga03683_7947_c2 3300050489 Bacteria 2071
1729 nmdc:mga03n38_132691_c1 3300050490 Bacteria 1236
1730 nmdc:mga03n38_395696_c1 3300050490 Bacteria 760
1731 nmdc:mga03n38_73274_c1 3300050490 Bacteria 1590
1732 nmdc:mga00v17_28836_c1 3300050491 Bacteria 3254
1733 nmdc:mga00v17_309415_c1 3300050491 Bacteria 1026
1734 nmdc:mga00v17_779504_c1 3300050491 Bacteria 610
1735 nmdc:mga0k408_12545_c1 3300050493 Bacteria 4635
1736 nmdc:mga0k408_136604_c1 3300050493 Bacteria 1457
1737 nmdc:mga0k408_143867_c1 3300050493 Bacteria 1419
1738 nmdc:mga0k408_172153_c1 3300050493 Bacteria 1291
1739 nmdc:mga0k408_18003_c1 3300050493 Bacteria 3938
1740 nmdc:mga0k408_1832_c1 3300050493 Bacteria 11407
1741 nmdc:mga0k408_2173_c2 3300050493 Bacteria 6893
1742 nmdc:mga0k408_23489_c1 3300050493 Bacteria 3479
1743 nmdc:mga0k408_2403_c1 3300050493 Bacteria 9962
1744 nmdc:mga0k408_25142_c1 3300050493 Bacteria 3371
1745 nmdc:mga0k408_3264_c1 3300050493 Bacteria 8581
1746 nmdc:mga0k408_366874_c1 3300050493 Bacteria 858
1747 nmdc:mga0k408_374987_c1 3300050493 Bacteria 848
1748 nmdc:mga0k408_38001_c1 3300050493 Bacteria 2764
1749 nmdc:mga0k408_394745_c1 3300050493 Bacteria 824
1750 nmdc:mga0k408_41756_c1 3300050493 Bacteria 2641
1751 nmdc:mga0k408_483053_c1 3300050493 Bacteria 735
1752 nmdc:mga0k408_519125_c1 3300050493 Bacteria 705
1753 nmdc:mga0k408_6625_c1 3300050493 Bacteria 6174
1754 nmdc:mga0k408_69454_c1 3300050493 Bacteria 2056
1755 nmdc:mga0k408_79993_c1 3300050493 Bacteria 1913
1756 nmdc:mga0k408_83142_c1 3300050493 Bacteria 1877
1757 nmdc:mga0k408_83423_c1 3300050493 Bacteria 1873
1758 nmdc:mga0k408_95654_c1 3300050493 Bacteria 1748
1759 nmdc:mga06z11_15676_c1 3300050494 Bacteria 3389
1760 nmdc:mga06z11_251659_c1 3300050494 Bacteria 1040
1761 nmdc:mga06z11_291793_c1 3300050494 Bacteria 968
1762 nmdc:mga06z11_297640_c1 3300050494 Bacteria 959
1763 nmdc:mga06z11_431473_c1 3300050494 Bacteria 795
1764 nmdc:mga06z11_5404_c1 3300050494 Bacteria 5120
1765 nmdc:mga04h51_104660_c1 3300050495 Bacteria 1036
1766 nmdc:mga04h51_257970_c1 3300050495 Bacteria 700
1767 nmdc:mga07m45_10967_c1 3300050496 Bacteria 4749
1768 nmdc:mga07m45_117139_c1 3300050496 Bacteria 1537
1769 nmdc:mga07m45_13780_c1 3300050496 Bacteria 4294
1770 nmdc:mga07m45_142433_c1 3300050496 Bacteria 1388
1771 nmdc:mga07m45_173713_c1 3300050496 Bacteria 1253
1772 nmdc:mga07m45_23347_c2 3300050496 Bacteria 2879
1773 nmdc:mga07m45_257119_c1 3300050496 Bacteria 1016
1774 nmdc:mga07m45_43309_c1 3300050496 Bacteria 2524
1775 nmdc:mga07m45_48119_c1 3300050496 Bacteria 2398
1776 nmdc:mga07m45_6011_c1 3300050496 Bacteria 6108
1777 nmdc:mga07m45_62617_c1 3300050496 Bacteria 2109
1778 nmdc:mga07m45_70336_c1 3300050496 Bacteria 1991
1779 nmdc:mga07m45_88815_c1 3300050496 Bacteria 1769
1780 nmdc:mga0qj67_725633_c1 3300050509 Bacteria 789
1781 nmdc:mga0rr50_902513_c1 3300050513 Bacteria 753
1782 nmdc:mga0sz30_276124_c1 3300050516 Bacteria 749
1783 nmdc:mga0sz30_294999_c1 3300050516 Bacteria 723
1784 Ga0495601_0069985 3300053077 Bacteria 2239
1785 Ga0500610_0000055 3300053079 Bacteria 36032
1786 Ga0500610_0000454 3300053079 Bacteria 12629
1787 Ga0500610_0000509 3300053079 Bacteria 11979
1788 Ga0495655_0078673 3300053083 Bacteria 938
1789 Ga0495595_0056914 3300053084 Bacteria 1823
1790 Ga0495595_0140001 3300053084 Bacteria 1187
1791 Ga0495619_0694758 3300053085 Bacteria 692
1792 Ga0500578_0078098 3300053086 Bacteria 2107
1793 Ga0500578_0168990 3300053086 Bacteria 1353
1794 Ga0500643_011260 3300053087 Bacteria 3272
1795 Ga0500644_0008080 3300053088 Bacteria 2766
1796 Ga0500644_0014654 3300053088 Bacteria 2218
1797 Ga0500644_0018208 3300053088 Bacteria 2053
1798 Ga0500646_0132370 3300053090 Bacteria 812
1799 Ga0500647_0050303 3300053091 Bacteria 2004
1800 Ga0500647_0249347 3300053091 Bacteria 781
1801 Ga0500583_0125474 3300053092 Bacteria 1271
1802 Ga0500583_0318735 3300053092 Bacteria 758
1803 Ga0500583_0334033 3300053092 Bacteria 737
1804 Ga0500651_0000015 3300053093 Bacteria 161416
1805 Ga0500651_0000242 3300053093 Bacteria 33458
1806 Ga0500651_0179287 3300053093 Bacteria 1259
1807 Ga0500566_0030268 3300053094 Bacteria 3157
1808 Ga0500566_0129441 3300053094 Bacteria 1352
1809 Ga0500566_0362801 3300053094 Bacteria 660
1810 Ga0500641_0211130 3300053096 Bacteria 826
1811 Ga0500650_0128252 3300053098 Bacteria 1180
1812 Ga0500650_0260854 3300053098 Bacteria 775
1813 Ga0500560_096383 3300053107 Bacteria 990
1814 Ga0500562_010558 3300053108 Bacteria 2342
1815 Ga0500569_087057 3300053109 Bacteria 1007
1816 Ga0500571_000017 3300053110 Bacteria 64361
1817 Ga0500571_000074 3300053110 Bacteria 31440
1818 Ga0500572_107590 3300053111 Bacteria 895
1819 Ga0500572_210357 3300053111 Bacteria 637
1820 Ga0500572_245004 3300053111 Bacteria 584
1821 Ga0500591_050154 3300053115 Bacteria 1959
1822 Ga0500592_006166 3300053116 Bacteria 1908
1823 Ga0500593_000097 3300053117 Bacteria 32867
1824 Ga0500593_000242 3300053117 Bacteria 22487
1825 Ga0500593_003350 3300053117 Bacteria 6035
1826 Ga0500594_0002529 3300053118 Bacteria 3977
1827 Ga0500594_0021001 3300053118 Bacteria 1633
1828 Ga0500607_000025 3300053121 Bacteria 95473
1829 Ga0500607_000049 3300053121 Bacteria 80941
1830 Ga0500607_019928 3300053121 Bacteria 3791
1831 Ga0500607_135680 3300053121 Bacteria 1166
1832 Ga0500608_012479 3300053122 Bacteria 3727
1833 Ga0500614_156419 3300053123 Bacteria 689
1834 Ga0500618_000173 3300053125 Bacteria 53346
1835 Ga0500618_015894 3300053125 Bacteria 1893
1836 Ga0500618_052678 3300053125 Bacteria 920
1837 Ga0500618_058291 3300053125 Bacteria 869
1838 Ga0500626_009438 3300053128 Bacteria 4058
1839 Ga0500655_000065 3300053133 Bacteria 28630
1840 Ga0500655_002857 3300053133 Bacteria 3137
1841 Ga0500658_0000028 3300053134 Bacteria 105688
1842 Ga0500658_0000054 3300053134 Bacteria 60941
1843 Ga0500658_0003025 3300053134 Bacteria 6449
1844 Ga0500658_0042452 3300053134 Bacteria 1827
1845 Ga0500559_0001694 3300053136 Bacteria 12147
1846 Ga0500559_0004268 3300053136 Bacteria 6837
1847 Ga0500559_0006743 3300053136 Bacteria 5159
1848 Ga0500559_0015080 3300053136 Bacteria 3266
1849 Ga0500559_0025318 3300053136 Bacteria 2525
1850 Ga0500559_0093712 3300053136 Bacteria 1377
1851 Ga0500559_0226043 3300053136 Bacteria 882
1852 Ga0500564_001050 3300053138 Bacteria 9107
1853 Ga0500564_066263 3300053138 Bacteria 1633
1854 Ga0500564_118137 3300053138 Bacteria 1158
1855 Ga0500568_0001518 3300053139 Bacteria 14786
1856 Ga0500568_0068042 3300053139 Bacteria 1367
1857 Ga0500573_0005327 3300053140 Bacteria 6885
1858 Ga0500574_000051 3300053141 Bacteria 13789
1859 Ga0500574_000431 3300053141 Bacteria 5303
1860 Ga0500586_000727 3300053145 Bacteria 6760
1861 Ga0500586_025988 3300053145 Bacteria 1892
1862 Ga0500616_0025694 3300053153 Bacteria 3265
1863 Ga0500616_0041391 3300053153 Bacteria 2473
1864 Ga0500616_0050793 3300053153 Bacteria 2188
1865 Ga0500616_0332006 3300053153 Bacteria 623
1866 Ga0500619_088620 3300053154 Bacteria 1044
1867 Ga0500622_0001109 3300053156 Bacteria 22452
1868 Ga0500622_0008524 3300053156 Bacteria 5727
1869 Ga0500622_0137997 3300053156 Bacteria 1166
1870 Ga0500627_0000171 3300053158 Bacteria 19148
1871 Ga0500630_073077 3300053159 Bacteria 1618
1872 Ga0500633_0087958 3300053160 Bacteria 1132
1873 Ga0500634_0004247 3300053161 Bacteria 6586
1874 Ga0500634_0004851 3300053161 Bacteria 6297
1875 Ga0500634_0063922 3300053161 Bacteria 1945
1876 Ga0500634_0113662 3300053161 Bacteria 1331
1877 Ga0500638_000284 3300053162 Bacteria 11309
1878 Ga0500638_012459 3300053162 Bacteria 3811
1879 Ga0500639_008998 3300053163 Bacteria 5208
1880 Ga0500636_0005829 3300053177 Bacteria 7053
1881 Ga0500636_0221671 3300053177 Bacteria 985
1882 Ga0500567_125390 3300053723 Bacteria 1016
1883 Ga0500565_025083 3300053734 Bacteria 747
1884 Ga0500587_002697 3300053739 Bacteria 2515
1885 Ga0500587_009667 3300053739 Bacteria 1229
1886 Ga0500661_003998 3300055283 Bacteria 2759
1887 2511242546 2511231002 Bacteria 5042903
1888 2513228680 2513020051 Bacteria 6053213
1889 2548498599 2547132374 Bacteria 5530232
1890 2553004589 2551306416 Bacteria 6152985
1891 2587758680 2585428062 Bacteria 6842168
1892 2599620622 2599185214 Bacteria 8209958
1893 2599673921 2599185226 Bacteria 8233575
1894 2599678762 2599185227 Bacteria 8246414
1895 2599690133 2599185229 Bacteria 8216126
1896 2643864789 2643221570 Bacteria 5103772
1897 2644159027 2643221628 Bacteria 5745828
1898 2644244933 2643221644 Bacteria 6865017
1899 2644257493 2643221646 Bacteria 6433402
1900 2644293980 2643221652 Bacteria 5140275
1901 2644302577 2643221654 Bacteria 5273570
1902 2644400379 2643221672 Bacteria 6322190
1903 2644468252 2643221683 Bacteria 5749203
1904 2644649334 2643221717 Bacteria 5676132
1905 2738717815 2738541277 Bacteria 7458140
1906 2738723725 2738541277 Bacteria 7458140
1907 2738739727 2738541280 Bacteria 6630198
1908 2738830461 2738541297 Bacteria 6549566
1909 2738879436 2738541307 Bacteria 8606193
1910 2739154257 2738541357 Bacteria 6549408
1911 2739196210 2738543003 Bacteria 6549560
1912 2739249426 2738543013 Bacteria 5618633
1913 2739278501 2738543019 Bacteria 7459457
1914 2739284456 2738543019 Bacteria 7459457
1915 2739322653 2738543026 Bacteria 6549408
1916 2739340894 2738543029 Bacteria 6549249
1917 2819601198 2818991446 Bacteria 7757362
1918 2831271487 2831265667 Bacteria 7184833
1919 2838055386 2838054893 Bacteria 7451788
1920 2842679996 2842677519 Bacteria 5615038
1921 2842735283 2842733646 Bacteria 5716726
1922 2842749961 2842747753 Bacteria 5578255
1923 2885201115 2885198086 Bacteria 7212419
1924 2885214101 2885211737 Bacteria 7212420
1925 2899927455 2899924645 Bacteria 7487985
1926 2904453290 2904449895 Bacteria 6927402
1927 2904459284 2904456579 Bacteria 6819253
1928 2904532422 2904530477 Bacteria 5876334
1929 2904548342 2904541872 Bacteria 8915136
1930 2919466116 2919462493 Bacteria 5817112
1931 2919708845 2919704043 Bacteria 5560311
1932 2923515417 2923510766 Bacteria 5926163
1933 2928042633 2928037797 Bacteria 7273642
1934 2928048940 2928044640 Bacteria 7271509
1935 2928051490 2928051484 Bacteria 7773759
1936 2928068702 2928064002 Bacteria 7419480
1937 2928073330 2928070936 Bacteria 8062541
1938 2928084432 2928084124 Bacteria 7159212
1939 2928117795 2928115317 Bacteria 6477646
1940 2929163332 2929160207 Bacteria 9075316
1941 2929523212 2929520902 Bacteria 6765052
1942 2939634006 2939631187 Bacteria 6118131
1943 2945912018 2945909444 Bacteria 7065066
1944 2945947977 2945945610 Bacteria 5951079
1945 2945972083 2945972063 Bacteria 6086495
1946 2945985711 2945984333 Bacteria 7358892
1947 2954772223 2954767861 Bacteria 5535784
1948 2990712005 2990710928 Bacteria 5002431
1949 639787670 639633007 Bacteria 4376040
1950 Ga0501067_0457017
1951 JGI24740J21852_10014352
1952 JGI24739J22299_10005780
1953 JGI25155J39150_1000062
1954 JGI25156J39149_1000012
1955 JGI25154J39366_1000029
1956 JGI25154J39366_1000278
1957 JGI25158J39367_1004986
1958 JGI25157J39369_1000014
1959 JGI25152J39213_1001366
1960 JGI25152J39213_1006035
1961 JGI25150J39212_1000869
1962 JGI25150J39212_1014431
1963 JGI25159J45721_1000054
1964 JGI25159J45721_1005152
1965 JGI25151J46595_10000507
1966 JGI25151J46595_10002599
1967 JGI25151J46595_10002870
1968 JGI25151J46595_10004424
1969 JGI25151J46595_10006031
1970 JGI25151J46595_10006574
1971 JGI25153J46596_10002045
1972 rootL2_10020233
1973 rootL2_10167114
1974 rootH1_10030289
1975 JGI25160J50197_1000088
1976 JGI25160J50197_1000119
1977 JGI25160J50197_1001065
1978 JGI25160J50197_1005159
1979 JGI25160J50197_1037137
1980 JGI25161J50226_1000056
1981 JGI25161J50226_1003182
1982 Ga0055532_1013650
1983 Ga0055525_1000001
1984 Ga0055535_1000286
1985 Ga0055535_1001184
1986 Ga0055542_1000080
1987 Ga0055542_1001176
1988 Ga0055526_1006187
1989 Ga0055526_1011254
1990 Ga0055526_1024874
1991 Ga0055526_1024934
1992 Ga0055537_1000024
1993 Ga0055537_1000047
1994 Ga0055537_1001263
1995 Ga0055537_1006648
1996 Ga0055537_1007290
1997 Ga0055524_1000039
1998 Ga0055524_1008821
1999 Ga0055524_1009148
2000 Ga0055536_1002675
2001 Ga0055536_1009284
2002 Ga0055536_1009897
2003 Ga0055536_1028754
2004 Ga0055534_1000032
2005 Ga0055534_1000141
2006 Ga0055534_1001229
2007 Ga0055534_1002784
2008 Ga0055534_1038206
2009 Ga0055528_1002122
2010 Ga0055528_1002521
2011 Ga0055528_1002981
2012 Ga0055528_1009497
2013 Ga0055530_10000532
2014 Ga0055530_10002093
2015 Ga0055530_10004782
2016 Ga0055530_10022158
2017 Ga0055530_10024142
2018 Ga0055530_10053041
2019 Ga0055540_1000047
2020 Ga0055540_1000365
2021 Ga0055540_1000440
2022 Ga0055540_1002293
2023 Ga0055540_1008010
2024 Ga0055531_10000454
2025 Ga0055531_10011051
2026 Ga0055531_10012021
2027 Ga0055531_10012911
2028 Ga0055531_10057654
2029 Ga0055543_1000904
2030 Ga0055543_1001077
2031 Ga0055543_1001260
2032 Ga0065165_1003589
2033 Ga0065165_1005321
2034 Ga0065165_1023989
2035 Ga0065165_1024242
2036 Ga0065165_1081429
2037 Ga0065714_10066369
2038 Ga0065715_10244020
2039 Ga0065707_10087747
2040 Ga0070658_10125538
2041 Ga0070658_10176893
2042 Ga0070676_10004494
2043 Ga0070676_10032895
2044 Ga0070676_10203602
2045 Ga0070676_10285396
2046 Ga0070683_100131089
2047 Ga0070683_100154993
2048 Ga0070690_100037460
2049 Ga0070690_100165870
2050 Ga0070690_101040912
2051 Ga0070670_100031372
2052 Ga0070670_100097851
2053 Ga0070670_100398756
2054 Ga0070670_100427560
2055 Ga0070670_100483723
2056 Ga0070670_100773935
2057 Ga0070670_101137033
2058 Ga0070677_10020521
2059 Ga0070677_10096467
2060 Ga0070677_10284039
2061 Ga0070677_10352729
2062 Ga0068869_100000109
2063 Ga0068869_100011409
2064 Ga0068869_100061469
2065 Ga0068869_100118296
2066 Ga0068869_100322628
2067 Ga0068869_100600166
2068 Ga0068869_101125485
2069 Ga0070666_10006231
2070 Ga0070666_10009271
2071 Ga0070666_10146619
2072 Ga0070666_10772301
2073 Ga0070680_100063118
2074 Ga0070682_100473027
2075 Ga0068868_100000928
2076 Ga0068868_100002606
2077 Ga0068868_100009104
2078 Ga0068868_100043506
2079 Ga0068868_100068559
2080 Ga0068868_100094776
2081 Ga0068868_100327397
2082 Ga0068868_100618047
2083 Ga0068868_101543346
2084 Ga0070660_100102495
2085 Ga0070660_100113595
2086 Ga0070660_101555058
2087 Ga0070687_100121070
2088 Ga0070661_100071384
2089 Ga0070661_100098854
2090 Ga0070661_100098982
2091 Ga0070661_100760848
2092 Ga0070692_10314546
2093 Ga0070692_10769411
2094 Ga0070668_100005748
2095 Ga0070668_100493696
2096 Ga0070668_100612524
2097 Ga0070669_100003867
2098 Ga0070669_100032291
2099 Ga0070669_100096210
2100 Ga0070669_100206889
2101 Ga0070669_100516365
2102 Ga0070669_101115792
2103 Ga0070675_100000772
2104 Ga0070675_100018873
2105 Ga0070675_100038290
2106 Ga0070675_100145426
2107 Ga0070675_100224640
2108 Ga0070675_100348796
2109 Ga0070675_100485372
2110 Ga0070671_100006491
2111 Ga0070671_100011811
2112 Ga0070671_100030752
2113 Ga0070671_100127377
2114 Ga0070671_100249854
2115 Ga0070671_100411541
2116 Ga0070671_100422072
2117 Ga0070674_100014173
2118 Ga0070674_100146038
2119 Ga0070673_100007669
2120 Ga0070673_100077501
2121 Ga0070673_100086947
2122 Ga0070673_100129628
2123 Ga0070673_100229881
2124 Ga0070673_100316352
2125 Ga0070673_100434024
2126 Ga0070673_100496870
2127 Ga0070673_100653681
2128 Ga0070673_100825658
2129 Ga0070673_100853490
2130 Ga0070673_100926170
2131 Ga0070673_101190219
2132 Ga0070688_100026856
2133 Ga0070659_100015164
2134 Ga0070659_100114676
2135 Ga0070659_100198344
2136 Ga0070659_101053265
2137 Ga0070667_100005806
2138 Ga0070667_100007096
2139 Ga0070667_100064974
2140 Ga0070667_100125372
2141 Ga0070667_100188883
2142 Ga0070667_100484550
2143 Ga0070667_100999049
2144 Ga0070667_101222092
2145 Ga0070701_10383946
2146 Ga0070708_100135616
2147 Ga0070663_100003925
2148 Ga0070663_100313932
2149 Ga0070663_100371878
2150 Ga0070678_100004609
2151 Ga0070678_100035270
2152 Ga0070678_100420817
2153 Ga0070678_101010441
2154 Ga0070662_100000552
2155 Ga0070662_100003920
2156 Ga0070662_100032880
2157 Ga0070662_100160037
2158 Ga0070662_100452663
2159 Ga0070662_100587568
2160 Ga0068867_100000186
2161 Ga0068867_100005611
2162 Ga0068867_100033298
2163 Ga0068867_100064019
2164 Ga0068867_100259388
2165 Ga0068867_100279964
2166 Ga0068867_100316881
2167 Ga0068867_100459729
2168 Ga0068867_100633974
2169 Ga0068867_100832172
2170 Ga0068867_100867902
2171 Ga0068867_100928701
2172 Ga0068867_101856499
2173 Ga0070685_10147935
2174 Ga0070706_100017115
2175 Ga0070706_100960143
2176 Ga0070706_101871002
2177 Ga0070707_100064439
2178 Ga0070707_100154296
2179 Ga0070699_100116427
2180 Ga0070679_100003825
2181 Ga0070684_100023555
2182 Ga0070684_100248441
2183 Ga0068853_100011884
2184 Ga0068853_100059570
2185 Ga0068853_100189341
2186 Ga0068853_100437457
2187 Ga0068853_100898155
2188 Ga0068853_101606701
2189 Ga0070672_100010739
2190 Ga0070672_100016252
2191 Ga0070672_100027229
2192 Ga0070672_100055551
2193 Ga0070672_100164157
2194 Ga0070672_100228801
2195 Ga0070672_100245988
2196 Ga0070672_100369800
2197 Ga0070672_100389330
2198 Ga0070672_100739793
2199 Ga0070672_101241462
2200 Ga0070693_100763512
2201 Ga0070665_100043405
2202 Ga0070665_100144705
2203 Ga0070665_100278353
2204 Ga0070665_100509410
2205 Ga0070665_100668795
2206 Ga0068855_100015116
2207 Ga0068855_100047998
2208 Ga0068855_100173929
2209 Ga0070664_100006998
2210 Ga0070664_100116860
2211 Ga0070664_100211556
2212 Ga0070664_100219576
2213 Ga0070664_100325032
2214 Ga0070664_100769040
2215 Ga0070664_101313837
2216 Ga0068857_100053902
2217 Ga0068857_100134323
2218 Ga0068857_100162697
2219 Ga0068857_100298227
2220 Ga0068857_101269641
2221 Ga0068854_100048398
2222 Ga0068854_100084591
2223 Ga0068854_100120987
2224 Ga0068854_100694332
2225 Ga0068854_100841142
2226 Ga0068854_100935849
2227 Ga0068856_100069854
2228 Ga0068856_100139123
2229 Ga0068856_100226628
2230 Ga0068856_101093590
2231 Ga0070702_100026507
2232 Ga0068852_100012691
2233 Ga0068852_100014348
2234 Ga0068852_100018466
2235 Ga0068852_100097562
2236 Ga0068852_100227802
2237 Ga0068852_100250838
2238 Ga0068852_100274059
2239 Ga0068852_100517269
2240 Ga0068852_100913899
2241 Ga0068852_100919057
2242 Ga0068859_100141793
2243 Ga0068859_100260379
2244 Ga0068859_100306399
2245 Ga0068859_100870067
2246 Ga0068864_100000270
2247 Ga0068864_100010659
2248 Ga0068864_100053816
2249 Ga0068864_100065725
2250 Ga0068864_100207736
2251 Ga0068864_100837819
2252 Ga0068866_10001571
2253 Ga0068866_10148194
2254 Ga0068866_10554989
2255 Ga0068861_100000126
2256 Ga0068861_100006858
2257 Ga0068861_100802485
2258 Ga0068851_10012812
2259 Ga0068851_10019913
2260 Ga0068851_10072851
2261 Ga0068851_10090524
2262 Ga0068851_10325795
2263 Ga0068870_10115031
2264 Ga0068870_10212735
2265 Ga0068863_100000679
2266 Ga0068863_100022577
2267 Ga0068863_100136576
2268 Ga0068863_100227727
2269 Ga0068863_100259471
2270 Ga0068863_100366894
2271 Ga0068863_101408982
2272 Ga0068858_100000225
2273 Ga0068858_100006184
2274 Ga0068858_100011807
2275 Ga0068860_100010530
2276 Ga0068860_100025113
2277 Ga0068860_100071695
2278 Ga0068860_100224709
2279 Ga0068860_100372691
2280 Ga0068860_100678258
2281 Ga0068862_100091077
2282 Ga0068862_100215452
2283 Ga0068862_100274253
2284 Ga0068862_100921771
2285 Ga0070717_11108428
2286 Ga0075365_10040246
2287 Ga0075368_10019359
2288 Ga0075363_100002613
2289 Ga0075363_100098285
2290 Ga0075363_100100513
2291 Ga0075363_100173312
2292 Ga0075363_100282609
2293 Ga0075363_100397393
2294 Ga0075364_10154827
2295 Ga0075432_10028831
2296 Ga0075432_10186761
2297 Ga0070716_100528969
2298 Ga0075362_10006845
2299 Ga0075362_10012721
2300 Ga0075362_10027255
2301 Ga0075362_10027795
2302 Ga0075362_10036217
2303 Ga0075362_10075832
2304 Ga0075362_10078719
2305 Ga0075362_10101318
2306 Ga0075362_10265553
2307 Ga0075362_10268680
2308 Ga0075362_10462436
2309 Ga0075362_10620995
2310 Ga0075367_10003489
2311 Ga0075367_10023278
2312 Ga0075367_10065241
2313 Ga0075367_10086899
2314 Ga0075367_10485085
2315 Ga0075369_10028290
2316 Ga0075369_10053864
2317 Ga0075369_10127102
2318 Ga0075366_10000903
2319 Ga0075366_10004367
2320 Ga0075366_10005063
2321 Ga0075366_10005254
2322 Ga0075366_10020888
2323 Ga0075366_10024928
2324 Ga0075366_10063986
2325 Ga0075366_10076436
2326 Ga0075366_10088553
2327 Ga0075366_10089581
2328 Ga0075366_10103288
2329 Ga0075366_10108492
2330 Ga0075366_10177989
2331 Ga0075366_10205769
2332 Ga0075366_10209479
2333 Ga0075366_10233960
2334 Ga0075366_10310856
2335 Ga0075366_10341979
2336 Ga0075366_10408676
2337 Ga0075366_10553356
2338 Ga0075366_10562262
2339 Ga0075366_10938001
2340 Ga0075366_10968446
2341 Ga0097621_100060271
2342 Ga0097621_100178814
2343 Ga0097621_100226196
2344 Ga0097621_100321941
2345 Ga0097621_100417698
2346 Ga0097621_100423384
2347 Ga0075370_10001385
2348 Ga0075370_10003497
2349 Ga0075370_10006662
2350 Ga0075370_10008356
2351 Ga0075370_10009388
2352 Ga0075370_10011977
2353 Ga0075370_10021716
2354 Ga0075370_10041399
2355 Ga0075370_10072521
2356 Ga0075370_10079534
2357 Ga0075370_10159946
2358 Ga0075370_10169808
2359 Ga0075370_10221285
2360 Ga0075370_10264415
2361 Ga0075370_10393622
2362 Ga0075370_10518841
2363 Ga0068871_100026429
2364 Ga0068871_100044440
2365 Ga0068871_100060141
2366 Ga0068871_100186123
2367 Ga0068871_100412930
2368 Ga0068871_100705121
2369 Ga0068871_100816192
2370 Ga0075430_100464806
2371 Ga0075430_100742798
2372 Ga0075434_100258587
2373 Ga0068865_100031632
2374 Ga0068865_100242195
2375 Ga0068865_100360419
2376 Ga0068865_100717727
2377 Ga0097620_100141795
2378 Ga0097620_100260380
2379 Ga0097620_100306401
2380 Ga0097620_100870165
2381 Ga0075435_100684643
2382 Ga0105244_10002369
2383 Ga0105244_10080538
2384 Ga0105240_10044244
2385 Ga0105240_10376389
2386 Ga0105240_11666270
2387 Ga0111539_10496588
2388 Ga0111539_11076507
2389 Ga0105245_10011498
2390 Ga0105245_10044575
2391 Ga0105245_10429981
2392 Ga0105245_10478639
2393 Ga0105245_10578857
2394 Ga0105245_10587549
2395 Ga0105245_11031379
2396 Ga0105247_10783640
2397 Ga0105243_10002142
2398 Ga0105243_10002791
2399 Ga0105243_10006295
2400 Ga0105243_10066462
2401 Ga0105243_10195426
2402 Ga0105243_10211999
2403 Ga0105243_10307811
2404 Ga0105243_10529961
2405 Ga0105243_10626920
2406 Ga0105243_10824709
2407 Ga0105243_11023162
2408 Ga0105241_10207015
2409 Ga0105241_10680647
2410 Ga0105241_11448252
2411 Ga0105242_10179763
2412 Ga0105242_10785592
2413 Ga0105242_10798183
2414 Ga0105242_11464865
2415 Ga0105248_10020776
2416 Ga0105248_10069162
2417 Ga0105248_10103800
2418 Ga0105248_10140104
2419 Ga0105248_10223348
2420 Ga0105248_10381645
2421 Ga0105248_11065491
2422 Ga0105248_11365687
2423 Ga0105237_10038448
2424 Ga0105237_10210367
2425 Ga0105237_10211438
2426 Ga0105237_10584019
2427 Ga0105237_11719452
2428 Ga0105238_10007445
2429 Ga0105238_10237419
2430 Ga0105238_10554246
2431 Ga0105238_10765782
2432 Ga0105238_12092877
2433 Ga0105249_10020223
2434 Ga0105249_10255488
2435 Ga0105249_10511243
2436 Ga0105239_10008553
2437 Ga0105239_10014688
2438 Ga0105239_10178863
2439 Ga0105239_11428694
2440 Ga0105239_11885533
2441 Ga0105246_10116212
2442 Ga0105246_10261339
2443 Ga0105246_11072474
2444 Ga0105246_11128730
2445 Ga0157347_1007959
2446 Ga0157373_10000764
2447 Ga0157373_10073883
2448 Ga0157373_10289715
2449 Ga0157371_10102848
2450 Ga0157371_10524539
2451 Ga0157371_10891869
2452 Ga0157370_10005548
2453 Ga0157370_10925268
2454 Ga0157374_10149927
2455 Ga0157374_10576304
2456 Ga0157374_11938732
2457 Ga0157378_10204597
2458 Ga0157378_10702504
2459 Ga0163162_10010080
2460 Ga0163162_10077396
2461 Ga0163162_10093880
2462 Ga0163162_10203206
2463 Ga0163162_10242856
2464 Ga0163162_10909509
2465 Ga0157372_10024604
2466 Ga0157372_10276250
2467 Ga0157375_10010897
2468 Ga0157375_10014628
2469 Ga0157375_10051979
2470 Ga0157375_10159166
2471 Ga0157375_10277498
2472 Ga0157375_10364097
2473 Ga0157375_10404100
2474 Ga0157375_10524196
2475 Ga0157375_10626044
2476 Ga0157375_10688444
2477 Ga0163163_10004422
2478 Ga0163163_10961423
2479 Ga0157380_10001564
2480 Ga0157380_10016118
2481 Ga0157380_10343089
2482 Ga0157380_11397059
2483 Ga0182008_10000794
2484 Ga0182008_10043908
2485 Ga0182008_10053057
2486 Ga0157377_10000464
2487 Ga0157377_10074914
2488 Ga0157377_10124000
2489 Ga0157379_10005033
2490 Ga0157379_10012124
2491 Ga0157379_10040104
2492 Ga0157379_10304460
2493 Ga0157376_10001974
2494 Ga0157376_10012956
2495 Ga0157376_10787806
2496 Ga0157376_11260089
2497 Ga0157376_11488441
2498 Ga0157376_11808905
2499 Ga0182006_1000690
2500 Ga0182007_10004716
2501 Ga0182007_10006853
2502 Ga0182007_10394058
2503 Ga0182005_1027614
2504 Ga0182005_1082344
2505 Ga0183362_10002
2506 Ga0163161_10000161
2507 Ga0163161_10016112
2508 Ga0163161_10039405
2509 Ga0163161_10067154
2510 Ga0163161_10071647
2511 Ga0163161_10341235
2512 Ga0163161_10352220
2513 Ga0163161_10851943
2514 Ga0213874_10130485
2515 Ga0213876_10101220
2516 Ga0209435_100002
2517 Ga0209436_103397
2518 Ga0209436_106002
2519 Ga0209672_100711
2520 Ga0209672_101238
2521 Ga0209147_100450
2522 Ga0209147_103013
2523 Ga0209563_100007
2524 Ga0209258_100093
2525 Ga0209258_100519
2526 Ga0207425_1001011
2527 Ga0207425_1001306
2528 Ga0207425_1004714
2529 Ga0207425_1022335
2530 Ga0207425_1023670
2531 Ga0207425_1038846
2532 Ga0207425_1053424
2533 Ga0209646_1000001
2534 Ga0209646_1000023
2535 Ga0209026_1000040
2536 Ga0209026_1013794
2537 Ga0209677_109163
2538 Ga0209148_1000007
2539 Ga0209148_1000067
2540 Ga0209148_1000440
2541 Ga0209759_1000001
2542 Ga0209129_1000024
2543 Ga0209129_1001645
2544 Ga0209129_1008680
2545 Ga0209129_1016572
2546 Ga0209129_1017663
2547 Ga0209129_1035134
2548 Ga0209565_1000039
2549 Ga0209565_1000080
2550 Ga0209565_1000583
2551 Ga0209565_1000645
2552 Ga0209565_1000876
2553 Ga0209673_1000088
2554 Ga0209673_1000284
2555 Ga0209673_1001443
2556 Ga0209673_1002254
2557 Ga0209130_1000040
2558 Ga0209130_1000346
2559 Ga0209130_1000757
2560 Ga0209130_1001429
2561 Ga0209675_1000030
2562 Ga0209675_1000133
2563 Ga0209675_1000471
2564 Ga0209675_1000695
2565 Ga0209675_1001131
2566 Ga0209675_1004254
2567 Ga0209675_1020620
2568 Ga0209676_1000028
2569 Ga0209676_1000073
2570 Ga0209676_1000142
2571 Ga0209676_1000317
2572 Ga0209676_1000383
2573 Ga0209676_1013166
2574 Ga0209676_1042675
2575 Ga0209025_1000088
2576 Ga0209025_1000104
2577 Ga0209025_1001526
2578 Ga0209025_1002084
2579 Ga0209025_1004730
2580 Ga0209025_1006776
2581 Ga0209025_1011727
2582 Ga0209025_1013516
2583 Ga0209025_1040081
2584 Ga0209025_1095901
2585 Ga0209025_1095980
2586 Ga0209564_1000313
2587 Ga0209564_1000823
2588 Ga0209564_1001505
2589 Ga0209564_1002447
2590 Ga0209564_1005212
2591 Ga0209758_1000510
2592 Ga0209758_1000679
2593 Ga0209758_1003918
2594 Ga0209758_1005216
2595 Ga0209758_1050082
2596 Ga0209050_1000008
2597 Ga0209050_1000072
2598 Ga0209050_1000786
2599 Ga0209050_1000952
2600 Ga0209050_1001577
2601 Ga0209050_1005629
2602 Ga0209050_1015985
2603 Ga0209050_1034091
2604 Ga0209256_1000096
2605 Ga0209256_1000151
2606 Ga0209256_1000256
2607 Ga0209256_1040804
2608 Ga0209256_1056004
2609 Ga0207426_1000049
2610 Ga0207426_1000188
2611 Ga0207426_1000315
2612 Ga0207426_1001354
2613 Ga0209051_1000005
2614 Ga0209051_1000015
2615 Ga0209051_1000056
2616 Ga0209051_1000161
2617 Ga0209051_1000259
2618 Ga0209051_1000416
2619 Ga0209051_1084184
2620 Ga0209051_1136246
2621 Ga0209257_1000031
2622 Ga0209257_1000037
2623 Ga0209257_1000116
2624 Ga0209257_1002902
2625 Ga0209257_1004513
2626 Ga0209257_1022591
2627 Ga0207697_10046109
2628 Ga0207697_10070620
2629 Ga0207656_10020678
2630 Ga0207656_10027516
2631 Ga0207656_10103921
2632 Ga0207656_10234090
2633 Ga0207656_10328922
2634 Ga0207655_1015947
2635 Ga0207682_10032758
2636 Ga0207682_10044699
2637 Ga0207682_10247434
2638 Ga0207642_10006015
2639 Ga0207642_10024373
2640 Ga0207688_10078411
2641 Ga0207688_10188104
2642 Ga0207688_10652489
2643 Ga0207680_10028766
2644 Ga0207680_10191237
2645 Ga0207647_10357268
2646 Ga0207645_10004614
2647 Ga0207645_10041857
2648 Ga0207645_10309051
2649 Ga0207643_10009830
2650 Ga0207643_10166620
2651 Ga0207643_10252977
2652 Ga0207705_10164082
2653 Ga0207684_10119778
2654 Ga0207654_10402338
2655 Ga0207695_10130175
2656 Ga0207695_10145157
2657 Ga0207671_10075823
2658 Ga0207671_10219270
2659 Ga0207671_10494572
2660 Ga0207660_10026081
2661 Ga0207662_10013391
2662 Ga0207662_10089116
2663 Ga0207657_10038426
2664 Ga0207657_10082664
2665 Ga0207657_10308033
2666 Ga0207657_10320421
2667 Ga0207649_10314732
2668 Ga0207649_10762319
2669 Ga0207649_10792593
2670 Ga0207652_10073735
2671 Ga0207646_10015873
2672 Ga0207681_10000826
2673 Ga0207681_10008765
2674 Ga0207681_10114005
2675 Ga0207681_10243304
2676 Ga0207694_10041437
2677 Ga0207694_10111689
2678 Ga0207694_10164283
2679 Ga0207694_10603891
2680 Ga0207650_10120072
2681 Ga0207650_10204515
2682 Ga0207650_10224507
2683 Ga0207650_10315573
2684 Ga0207650_10512274
2685 Ga0207650_10576954
2686 Ga0207659_10001869
2687 Ga0207659_10029827
2688 Ga0207659_10839328
2689 Ga0207659_11273276
2690 Ga0207687_10013703
2691 Ga0207687_10056676
2692 Ga0207687_10211834
2693 Ga0207687_10421403
2694 Ga0207644_10000223
2695 Ga0207644_10008993
2696 Ga0207644_10065196
2697 Ga0207644_10070563
2698 Ga0207644_10347830
2699 Ga0207644_10382331
2700 Ga0207644_10672504
2701 Ga0207690_10032585
2702 Ga0207690_10456255
2703 Ga0207690_10664135
2704 Ga0207706_10000736
2705 Ga0207706_10012885
2706 Ga0207706_10172590
2707 Ga0207706_10379576
2708 Ga0207706_10573407
2709 Ga0207706_10720062
2710 Ga0207706_10830020
2711 Ga0207706_10850399
2712 Ga0207686_10030421
2713 Ga0207686_10088915
2714 Ga0207686_10476777
2715 Ga0207709_10000771
2716 Ga0207709_10001444
2717 Ga0207709_10011940
2718 Ga0207709_10012398
2719 Ga0207709_10039692
2720 Ga0207709_10076505
2721 Ga0207709_10157185
2722 Ga0207709_10616933
2723 Ga0207709_10650558
2724 Ga0207669_10002159
2725 Ga0207669_10636871
2726 Ga0207669_11385823
2727 Ga0207704_10002371
2728 Ga0207704_10205529
2729 Ga0207704_10221663
2730 Ga0207704_10262680
2731 Ga0207704_10376209
2732 Ga0207704_10404880
2733 Ga0207665_10140128
2734 Ga0207691_10002576
2735 Ga0207691_10023739
2736 Ga0207691_10075275
2737 Ga0207691_10081432
2738 Ga0207691_10087282
2739 Ga0207691_10153924
2740 Ga0207691_10337776
2741 Ga0207691_10363434
2742 Ga0207711_10002181
2743 Ga0207711_10008423
2744 Ga0207711_10093737
2745 Ga0207711_10205036
2746 Ga0207711_10501111
2747 Ga0207711_10666528
2748 Ga0207689_10000259
2749 Ga0207689_10006174
2750 Ga0207689_10018504
2751 Ga0207689_10120756
2752 Ga0207689_10180386
2753 Ga0207689_10202186
2754 Ga0207689_10202319
2755 Ga0207689_10269083
2756 Ga0207689_10644972
2757 Ga0207689_10983709
2758 Ga0207661_10025802
2759 Ga0207661_10151431
2760 Ga0207679_10044865
2761 Ga0207679_10134308
2762 Ga0207679_10212816
2763 Ga0207679_10548238
2764 Ga0207679_11094158
2765 Ga0207667_10110625
2766 Ga0207651_10005547
2767 Ga0207651_10100796
2768 Ga0207651_10128082
2769 Ga0207651_10140033
2770 Ga0207651_10184316
2771 Ga0207651_10317868
2772 Ga0207651_10330439
2773 Ga0207651_10656942
2774 Ga0207651_11063547
2775 Ga0207712_10013171
2776 Ga0207712_10375071
2777 Ga0207712_10391396
2778 Ga0207668_10030116
2779 Ga0207668_10524630
2780 Ga0207640_10072192
2781 Ga0207640_11067399
2782 Ga0207658_10002825
2783 Ga0207658_10005834
2784 Ga0207658_10013147
2785 Ga0207658_10411655
2786 Ga0207658_10742933
2787 Ga0207658_10804600
2788 Ga0207658_11137489
2789 Ga0207658_11537809
2790 Ga0207677_10001179
2791 Ga0207677_10001436
2792 Ga0207677_10015394
2793 Ga0207677_10040367
2794 Ga0207677_10117791
2795 Ga0207677_10260398
2796 Ga0207677_10426178
2797 Ga0207703_10000408
2798 Ga0207703_10018563
2799 Ga0207703_10036310
2800 Ga0207703_10037004
2801 Ga0207703_11561808
2802 Ga0207639_10043276
2803 Ga0207639_10278290
2804 Ga0207639_10811434
2805 Ga0207639_11560680
2806 Ga0207678_10005998
2807 Ga0207678_10049813
2808 Ga0207678_10171827
2809 Ga0207678_10641644
2810 Ga0207702_10037491
2811 Ga0207702_10248514
2812 Ga0207702_10979134
2813 Ga0207702_11659806
2814 Ga0207641_10002065
2815 Ga0207641_10004421
2816 Ga0207641_10037985
2817 Ga0207641_10135068
2818 Ga0207641_10136517
2819 Ga0207641_10188888
2820 Ga0207648_10000686
2821 Ga0207648_10012681
2822 Ga0207648_10017873
2823 Ga0207648_10019036
2824 Ga0207648_10044650
2825 Ga0207648_10292659
2826 Ga0207648_10322549
2827 Ga0207648_10400077
2828 Ga0207648_10516637
2829 Ga0207648_10522031
2830 Ga0207648_11580882
2831 Ga0207676_10000269
2832 Ga0207676_10054658
2833 Ga0207676_10065398
2834 Ga0207676_10161348
2835 Ga0207676_11046571
2836 Ga0207676_11577421
2837 Ga0207674_10016515
2838 Ga0207674_10029563
2839 Ga0207674_10038674
2840 Ga0207674_10139045
2841 Ga0207674_10411475
2842 Ga0207674_10604400
2843 Ga0207674_10921920
2844 Ga0207674_11470051
2845 Ga0207675_100000307
2846 Ga0207675_100001416
2847 Ga0207675_100076361
2848 Ga0207675_100466401
2849 Ga0207683_10001051
2850 Ga0207683_10066755
2851 Ga0207683_10237209
2852 Ga0207683_10385382
2853 Ga0207683_10416789
2854 Ga0207683_10564333
2855 Ga0207683_10569559
2856 Ga0207683_11007022
2857 Ga0207683_11075958
2858 Ga0207698_10037962
2859 Ga0207698_10090847
2860 Ga0207698_10104934
2861 Ga0207698_10109147
2862 Ga0207698_10196658
2863 Ga0207698_10210647
2864 Ga0207698_10337349
2865 Ga0207698_10402939
2866 Ga0207698_10411559
2867 Ga0207698_10421196
2868 Ga0207698_10425227
2869 Ga0207698_10549355
2870 Ga0207698_10899207
2871 Ga0207698_11212884
2872 Ga0207698_11341165
2873 Ga0209996_1001867
2874 Ga0209968_1000702
2875 Ga0209282_1011860
2876 Ga0209966_1000040
2877 Ga0209998_10021105
2878 Ga0209813_10023158
2879 Ga0209813_10222054
2880 Ga0209974_10006173
2881 Ga0207428_10578269
2882 Ga0268266_10010170
2883 Ga0268266_10061450
2884 Ga0268266_10317098
2885 Ga0268266_10455050
2886 Ga0268266_10817657
2887 Ga0268265_10087552
2888 Ga0268265_10179219
2889 Ga0268265_10260150
2890 Ga0268265_10260891
2891 Ga0268265_10268500
2892 Ga0268265_11578579
2893 Ga0268264_10004973
2894 Ga0268264_10019709
2895 Ga0268264_10077625
2896 Ga0268264_10180300
2897 Ga0268264_10269302
2898 Ga0268264_10275052
2899 Ga0268264_10825647
2900 Ga0307517_10000160
2901 Ga0307517_10000395
2902 Ga0307517_10074719
2903 Ga0307517_10179818
2904 Ga0307515_10000006
2905 Ga0307515_10000160
2906 Ga0307515_10000332
2907 Ga0307515_10000893
2908 Ga0307515_10001283
2909 Ga0307515_10007639
2910 Ga0307515_10012223
2911 Ga0307515_10022830
2912 Ga0307515_10033807
2913 Ga0307515_10060601
2914 Ga0307515_10080735
2915 Ga0307515_10147322
2916 Ga0307515_10179656
2917 Ga0307515_10206740
2918 Ga0307515_10223497
2919 Ga0307515_10281623
2920 Ga0307515_10364123
2921 Ga0307515_10635715
2922 Ga0307511_10013142
2923 Ga0307512_10041345
2924 Ga0307512_10102024
2925 Ga0307512_10139063
2926 Ga0307512_10289617
2927 Ga0316177_1091352
2928 Ga0316176_1071075
2929 Ga0314311_1059274
2930 Ga0316179_1119471
2931 Ga0316178_1094522
2932 Ga0316180_1037515
2933 Ga0316183_1042467
2934 Ga0316181_1174890
2935 Ga0316182_1176401
2936 Ga0316182_1440727
2937 Ga0265327_10002595
2938 Ga0307513_10003528
2939 Ga0307513_10020560
2940 Ga0307513_10037147
2941 Ga0307513_10097939
2942 Ga0307513_10215434
2943 Ga0307513_11091140
2944 Ga0307509_10000212
2945 Ga0307509_10000317
2946 Ga0307509_10001515
2947 Ga0307509_10002052
2948 Ga0307509_10057914
2949 Ga0307509_10117990
2950 Ga0307509_10161551
2951 Ga0307509_10250752
2952 Ga0307509_10478928
2953 Ga0307509_10529824
2954 Ga0307408_100026572
2955 Ga0307408_100073052
2956 Ga0307408_100113754
2957 Ga0307408_100199041
2958 Ga0307408_100225286
2959 Ga0307408_100323704
2960 Ga0307408_100912915
2961 Ga0307508_10000097
2962 Ga0307508_10000332
2963 Ga0307508_10001697
2964 Ga0307508_10005499
2965 Ga0307508_10006375
2966 Ga0307508_10118737
2967 Ga0307508_10191308
2968 Ga0307508_10394920
2969 Ga0307514_10000795
2970 Ga0307514_10003838
2971 Ga0307514_10005414
2972 Ga0307514_10026427
2973 Ga0307514_10066783
2974 Ga0307514_10176693
2975 Ga0307516_10006132
2976 Ga0307516_10126756
2977 Ga0307516_10166406
2978 Ga0307516_10269308
2979 Ga0307516_10307928
2980 Ga0307516_10513847
2981 Ga0307405_10008706
2982 Ga0307405_10044351
2983 Ga0307405_10199037
2984 Ga0307405_10510250
2985 Ga0307405_10542540
2986 Ga0307405_10948442
2987 Ga0307405_11726206
2988 Ga0307413_10709507
2989 Ga0307413_10984130
2990 Ga0307410_10450209
2991 Ga0307410_10678872
2992 Ga0307406_10067497
2993 Ga0307406_10083841
2994 Ga0307406_10717461
2995 Ga0307406_11592248
2996 Ga0307412_10017936
2997 Ga0307412_10032642
2998 Ga0307412_10096348
2999 Ga0307412_10203425
3000 Ga0307412_10309707
3001 Ga0307412_10625997
3002 Ga0307412_11142263
3003 Ga0307409_100005809
3004 Ga0307409_101227328
3005 Ga0307416_100001574
3006 Ga0307416_100216574
3007 Ga0307416_100360975
3008 Ga0307416_100420709
3009 Ga0307416_100891181
3010 Ga0307414_10142492
3011 Ga0307414_10173251
3012 Ga0307414_11522563
3013 Ga0307411_10013253
3014 Ga0307411_10132222
3015 Ga0307411_10780284
3016 Ga0307415_100007021
3017 Ga0307507_10269557
3018 Ga0307507_10369216
3019 Ga0307510_10129347
3020 Ga0307510_10262467
3021 Ga0307510_10395991
3022 Ga0307510_10538721
3023 Ga0373930_0047804
3024 Ga0373948_0053027
3025 Ga0373938_0083037
3026 Ga0373926_0317095
3027 Ga0373929_0004656
3028 Ga0373940_0078320
3029 Ga0373944_0026045
3030 Ga0373923_0056861
3031 Ga0373923_0151710
3032 Ga0373932_0020198
3033 Ga0373932_0059406
3034 Ga0373936_0001484
3035 Ga0373936_0270213
3036 Ga0373941_0021775
3037 Ga0373956_0089353
3038 Ga0373943_0008038
3039 Ga0373943_0082489
3040 Ga0373946_0124206
3041 Ga0373962_0098964
3042 Ga0373924_0001472
3043 Ga0373931_0010336
3044 Ga0373935_0166599
3045 Ga0373935_0418713
3046 Ga0373935_0585758
3047 Ga0373927_0032371
3048 Ga0373947_0162803
3049 Ga0373947_0732890
3050 Ga0373937_0171129
3051 Ga0373937_0539793
3052 Ga0373925_0125496
3053 Ga0395899_0000970
3054 Ga0395899_0001451
3055 Ga0395899_0003277
3056 Ga0395899_0115511
3057 Ga0395900_0000091
3058 Ga0395900_0000602
3059 Ga0395900_0006947
3060 Ga0395900_0012073
3061 Ga0395900_0109955
3062 Ga0395900_0313416
3063 Ga0395898_0008585
3064 Ga0395898_0304421
3065 Ga0395898_0310389
3066 Ga0395898_0708158
3067 Ga0395905_0000269
3068 Ga0395905_0003396
3069 Ga0395905_0008793
3070 Ga0395905_0011217
3071 Ga0395905_0018561
3072 Ga0395905_0115052
3073 Ga0395905_0136166
3074 Ga0395905_0137658
3075 Ga0395905_0237491
3076 Ga0395905_0243446
3077 Ga0395905_0603517
3078 Ga0395901_0010721
3079 Ga0395901_0085465
3080 Ga0395901_0137392
3081 Ga0395901_0646484
3082 Ga0395901_1085880
3083 Ga0436365_1128978
3084 Ga0436363_1660049
3085 Ga0439436_0052251
3086 Ga0439439_0039272
3087 Ga0439439_0047623
3088 Ga0439439_0109082
3089 Ga0439447_025014
3090 Ga0439465_0248345
3091 Ga0451791_0516807
3092 Ga0451791_1822013
3093 Ga0451793_0849783
3094 Ga0451797_0036350
3095 Ga0451795_1156050
3096 Ga0451798_0365603
3097 Ga0451798_0783119
3098 Ga0451798_1050572
3099 Ga0451798_1073454
3100 Ga0451800_0507924
3101 Ga0451800_1125983
3102 Ga0451807_0531094
3103 Ga0451807_0955082
3104 Ga0451833_1039235
3105 Ga0451839_0995859
3106 Ga0451845_0395844
3107 Ga0451847_0890968
3108 Ga0451849_0455082
3109 Ga0451849_0763045
3110 Ga0451855_0676908
3111 Ga0451853_0929926
3112 Ga0451853_2031670
3113 Ga0451853_2256767
3114 Ga0451853_2771872
3115 Ga0439433_0013375
3116 Ga0439433_0019350
3117 Ga0439442_009722
3118 Ga0439445_0055849
3119 Ga0439432_075318
3120 Ga0439432_200791
3121 Ga0439449_0001455
3122 Ga0439449_0012086
3123 Ga0439452_031211
3124 Ga0439455_0003947
3125 Ga0439457_067024
3126 Ga0439462_0007888
3127 Ga0439462_0010211
3128 Ga0450921_001983
3129 Ga0450923_003206
3130 Ga0450923_020511
3131 Ga0450923_035316
3132 Ga0450897_008249
3133 Ga0450896_007410
3134 Ga0450898_005481
3135 Ga0450898_020412
3136 Ga0450905_056568
3137 Ga0450910_025753
3138 Ga0439446_0011968
3139 Ga0439446_0194101
3140 Ga0439458_0006040
3141 Ga0450908_011589
3142 Ga0450908_030358
3143 Ga0450909_037887
3144 Ga0439434_0104381
3145 Ga0439434_0115615
3146 Ga0450893_0005187
3147 Ga0450893_0019015
3148 Ga0451577_0012109
3149 Ga0451577_0694118
3150 Ga0466969_0194702
3151 Ga0466972_0026237
3152 Ga0466965_0124831
3153 Ga0466961_0965815
3154 Ga0466963_0387885
3155 Ga0466964_0070136
3156 Ga0453684_0009557
3157 Ga0453684_0067062
3158 Ga0466968_0578281
3159 Ga0466960_0187524
3160 Ga0451576_0035144
3161 Ga0451576_0804264
3162 Ga0451576_0993627
3163 Ga0466958_0525569
3164 Ga0495627_049188
3165 Ga0495627_143442
3166 Ga0495592_0000175
3167 Ga0495592_0003711
3168 Ga0495603_0337394
3169 Ga0495590_0000001
3170 Ga0495590_0014398
3171 Ga0495590_0015858
3172 Ga0495590_0151583
3173 Ga0495638_0002754
3174 Ga0495638_0005353
3175 Ga0495638_0086048
3176 Ga0495638_0105756
3177 Ga0495638_0421708
3178 Ga0495641_0300235
3179 Ga0495653_0000009
3180 Ga0495653_0316734
3181 Ga0495653_0406350
3182 Ga0495650_0000001
3183 Ga0495650_0000051
3184 Ga0495650_0000213
3185 Ga0495650_0009697
3186 Ga0495650_0030124
3187 Ga0495580_0355786
3188 Ga0495580_0685529
3189 Ga0495605_0000040
3190 Ga0495605_0024096
3191 Ga0495605_0049002
3192 Ga0495605_0284035
3193 Ga0495605_0386324
3194 Ga0495639_0021593
3195 Ga0495639_0127151
3196 Ga0495639_0457425
3197 Ga0495639_0629862
3198 Ga0495662_0401925
3199 Ga0495584_0015103
3200 Ga0495584_0047944
3201 Ga0495584_0084559
3202 Ga0495584_0269858
3203 Ga0495585_0000587
3204 Ga0495585_0005376
3205 Ga0495585_0292387
3206 Ga0495596_0000029
3207 Ga0495596_0000177
3208 Ga0495596_0000309
3209 Ga0495596_0002217
3210 Ga0495596_0002850
3211 Ga0495596_0003951
3212 Ga0495596_0006338
3213 Ga0495596_0032721
3214 Ga0495596_0046851
3215 Ga0495607_0000867
3216 Ga0495607_0003055
3217 Ga0495607_0035858
3218 Ga0495607_0035916
3219 Ga0495607_0058891
3220 Ga0495607_0060055
3221 Ga0495607_0095182
3222 Ga0495583_0000127
3223 Ga0495583_0002687
3224 Ga0495583_0003009
3225 Ga0495583_0009275
3226 Ga0495583_0016689
3227 Ga0495583_0018534
3228 Ga0495583_0108944
3229 Ga0495583_0259338
3230 Ga0495606_0019807
3231 Ga0495606_0163844
3232 Ga0495606_0316167
3233 Ga0495610_0000008
3234 Ga0495610_0001018
3235 Ga0495610_0081480
3236 Ga0495610_0119289
3237 Ga0495616_0000034
3238 Ga0495616_0000071
3239 Ga0495616_0000294
3240 Ga0495616_0002129
3241 Ga0495616_0004940
3242 Ga0495616_0008342
3243 Ga0495616_0014033
3244 Ga0495616_0132029
3245 Ga0495616_0221478
3246 Ga0495620_0031646
3247 Ga0495620_0061356
3248 Ga0495620_0072090
3249 Ga0495620_0224872
3250 Ga0495628_0377451
3251 Ga0495630_0225575
3252 Ga0495630_0288158
3253 Ga0495631_0000042
3254 Ga0495631_0000408
3255 Ga0495631_0001648
3256 Ga0495631_0037703
3257 Ga0495631_0042931
3258 Ga0495631_0321971
3259 Ga0495632_0000033
3260 Ga0495632_0000086
3261 Ga0495632_0000321
3262 Ga0495632_0001237
3263 Ga0495632_0005196
3264 Ga0495632_0008164
3265 Ga0495632_0028978
3266 Ga0495632_0112266
3267 Ga0495632_0204880
3268 Ga0495637_0003831
3269 Ga0495637_0005223
3270 Ga0495637_0018995
3271 Ga0495637_0020863
3272 Ga0495637_0052143
3273 Ga0495637_0052357
3274 Ga0495637_0068682
3275 Ga0495637_0097785
3276 Ga0495637_0193181
3277 Ga0495643_0000044
3278 Ga0495643_0000096
3279 Ga0495643_0000398
3280 Ga0495643_0000760
3281 Ga0495643_0001857
3282 Ga0495643_0024026
3283 Ga0495643_0035116
3284 Ga0495643_0048354
3285 Ga0495643_0063146
3286 Ga0495643_0068006
3287 Ga0495643_0084857
3288 Ga0495643_0197664
3289 Ga0495643_0274842
3290 Ga0495644_0000030
3291 Ga0495644_0033198
3292 Ga0495648_0000001
3293 Ga0495648_0000505
3294 Ga0495648_0001508
3295 Ga0495648_0011019
3296 Ga0495648_0016203
3297 Ga0495648_0020401
3298 Ga0495648_0024378
3299 Ga0495648_0036767
3300 Ga0495648_0041837
3301 Ga0495648_0054396
3302 Ga0495648_0115262
3303 Ga0495648_0292683
3304 Ga0495642_0000246
3305 Ga0495642_0000273
3306 Ga0495642_0000401
3307 Ga0495642_0003450
3308 Ga0495642_0054844
3309 Ga0495642_0063629
3310 Ga0495642_0099496
3311 Ga0495642_0218528
3312 Ga0495654_0000058
3313 Ga0495654_0001164
3314 Ga0495654_0002363
3315 Ga0495654_0008964
3316 Ga0495654_0020402
3317 Ga0495654_0045998
3318 Ga0495654_0054787
3319 Ga0495654_0058094
3320 Ga0495654_0174153
3321 Ga0495654_0205785
3322 Ga0495586_0509190
3323 Ga0495587_0200705
3324 Ga0495587_0292480
3325 Ga0495598_0069329
3326 Ga0495609_0000044
3327 Ga0495609_0000628
3328 Ga0495609_0000913
3329 Ga0495609_0000919
3330 Ga0495609_0002371
3331 Ga0495609_0002960
3332 Ga0495609_0005079
3333 Ga0495609_0034221
3334 Ga0495609_0094690
3335 Ga0495609_0199349
3336 Ga0495621_0041382
3337 Ga0495621_0098758
3338 Ga0495621_0099677
3339 Ga0495621_0100499
3340 Ga0495597_0000115
3341 Ga0495597_0000996
3342 Ga0495597_0001025
3343 Ga0495597_0003730
3344 Ga0495597_0030025
3345 Ga0495597_0041564
3346 Ga0495597_0084653
3347 Ga0495597_0100640
3348 Ga0495597_0157684
3349 Ga0495645_0181194
3350 Ga0495622_0051350
3351 Ga0495622_0063469
3352 Ga0495633_0000521
3353 Ga0495633_0003990
3354 Ga0495633_0019390
3355 Ga0495633_0044952
3356 Ga0495633_0073496
3357 Ga0495633_0111838
3358 Ga0495633_0243430
3359 Ga0495633_0249677
3360 Ga0495633_0310676
3361 Ga0495667_0081116
3362 Ga0495656_0001972
3363 Ga0495656_0006352
3364 Ga0495668_0000045
3365 Ga0495668_0000193
3366 Ga0495668_0000669
3367 Ga0495668_0013890
3368 Ga0495668_0051691
3369 Ga0495668_0123854
3370 Ga0495668_0133597
3371 Ga0495668_0255204
3372 Ga0495668_0312677
3373 Ga0495668_0373975
3374 Ga0495668_0375524
3375 Ga0495634_0293425
3376 Ga0495634_0438806
3377 Ga0495611_0000439
3378 Ga0495611_0179729
3379 Ga0495611_0192884
3380 Ga0495625_0000065
3381 Ga0495625_0000224
3382 Ga0495625_0001600
3383 Ga0495625_0004383
3384 Ga0495625_0010559
3385 Ga0495625_0010801
3386 Ga0495625_0021731
3387 Ga0495625_0027912
3388 Ga0495625_0054514
3389 Ga0495625_0080161
3390 Ga0495625_0083807
3391 Ga0495625_0114980
3392 Ga0495625_0147503
3393 Ga0495625_0227577
3394 Ga0495625_0385197
3395 Ga0495625_0451389
3396 Ga0495625_0592313
3397 Ga0495635_0418108
3398 Ga0495659_0000041
3399 Ga0495659_0002529
3400 Ga0495661_0000049
3401 Ga0495661_0000170
3402 Ga0495661_0000325
3403 Ga0495661_0000843
3404 Ga0495661_0001206
3405 Ga0495661_0002108
3406 Ga0495661_0005969
3407 Ga0495661_0024188
3408 Ga0495661_0040999
3409 Ga0495661_0049889
3410 Ga0495661_0062830
3411 Ga0495661_0126875
3412 Ga0495661_0166230
3413 Ga0495661_0217644
3414 Ga0495661_0478153
3415 Ga0495588_0020475
3416 Ga0495588_0026306
3417 Ga0495588_0191695
3418 Ga0495588_0218584
3419 Ga0495657_0274252
3420 Ga0495646_0005993
3421 Ga0495646_0284957
3422 Ga0495647_0116960
3423 Ga0495647_0122974
3424 Ga0495647_0150415
3425 Ga0495647_0157311
3426 Ga0495658_0010460
3427 Ga0495658_0037225
3428 Ga0495658_0068835
3429 Ga0495658_0180529
3430 Ga0495658_0327932
3431 Ga0495658_0525918
3432 Ga0495669_0000091
3433 Ga0495669_0015836
3434 Ga0495669_0029860
3435 Ga0495669_0256211
3436 Ga0495613_0387219
3437 Ga0495670_0024393
3438 Ga0495670_0030552
3439 Ga0495670_0038070
3440 Ga0495670_0257154
3441 Ga0495670_0492896
3442 Ga0495671_0000002
3443 Ga0495671_0000131
3444 Ga0495671_0000198
3445 Ga0495671_0001101
3446 Ga0495671_0062030
3447 Ga0495671_0241127
3448 Ga0495671_0334160
3449 Ga0495649_0000303
3450 Ga0495649_0001551
3451 Ga0495649_0007850
3452 Ga0495649_0076699
3453 Ga0495649_0077226
3454 Ga0495649_0152523
3455 Ga0495649_0287073
3456 Ga0495649_0497529
3457 Ga0495589_0000035
3458 Ga0495589_0000219
3459 Ga0495589_0004514
3460 Ga0495589_0014524
3461 Ga0495589_0086051
3462 Ga0495589_0145767
3463 Ga0495589_0157520
3464 Ga0495589_0294625
3465 Ga0495600_0177981
3466 Ga0495600_0459836
3467 Ga0495660_0002312
3468 Ga0495660_0004863
3469 Ga0495660_0012822
3470 Ga0495660_0018326
3471 Ga0495660_0027191
3472 Ga0495660_0027838
3473 Ga0495660_0030060
3474 Ga0495660_0092147
3475 Ga0495660_0128877
3476 Ga0495660_0134626
3477 Ga0495660_0141449
3478 Ga0495604_0413231
3479 Ga0495636_0000537
3480 Ga0495636_0005816
3481 Ga0495636_0037481
3482 Ga0495672_0000031
3483 Ga0495672_0000685
3484 Ga0495672_0001603
3485 Ga0495672_0005983
3486 Ga0495672_0021488
3487 Ga0495676_0000398
3488 Ga0495676_0030096
3489 Ga0495676_0069402
3490 Ga0495680_0509407
3491 Ga0495683_0003254
3492 Ga0495683_0072619
3493 Ga0495683_0116569
3494 Ga0495683_0432777
3495 Ga0495687_000002
3496 Ga0495687_000066
3497 Ga0495687_001099
3498 Ga0495687_001273
3499 Ga0495687_001453
3500 Ga0495687_002257
3501 Ga0495687_002986
3502 Ga0495687_004333
3503 Ga0495687_012673
3504 Ga0495687_013163
3505 Ga0495687_018635
3506 Ga0495687_031321
3507 Ga0495677_0000013
3508 Ga0495677_0000512
3509 Ga0495677_0000550
3510 Ga0495677_0002369
3511 Ga0495677_0050369
3512 Ga0495677_0088148
3513 Ga0495677_0148178
3514 Ga0495677_0202949
3515 Ga0495677_0302893
3516 Ga0495679_000296
3517 Ga0495679_002037
3518 Ga0495679_010136
3519 Ga0495679_020858
3520 Ga0495679_045256
3521 Ga0495685_000307
3522 Ga0495685_040375
3523 Ga0495673_0000061
3524 Ga0495673_0000926
3525 Ga0495681_0000016
3526 Ga0495681_0022987
3527 Ga0495681_0104177
3528 Ga0495686_0000054
3529 Ga0495686_0000464
3530 Ga0495686_0001324
3531 Ga0495686_0269510
3532 Ga0495686_0459673
3533 Ga0495593_0000083
3534 Ga0495593_0017089
3535 Ga0495602_0232178
3536 Ga0495614_0004378
3537 Ga0495614_0010642
3538 Ga0495615_0002597
3539 Ga0495626_0000011
3540 Ga0495626_0000071
3541 Ga0495626_0003695
3542 Ga0495626_0005258
3543 Ga0495626_0008223
3544 Ga0495626_0020612
3545 Ga0495626_0029974
3546 Ga0495626_0031597
3547 Ga0495626_0058708
3548 Ga0495626_0059441
3549 Ga0495626_0065283
3550 Ga0495626_0066936
3551 Ga0495626_0086231
3552 Ga0495626_0090886
3553 Ga0495626_0127985
3554 Ga0495626_0127989
3555 Ga0495626_0399090
3556 Ga0496100_0002053
3557 Ga0496100_0007896
3558 Ga0496100_0456306
3559 Ga0496101_0056761
3560 Ga0496101_0067612
3561 Ga0496101_0485113
3562 Ga0496102_0003799
3563 Ga0496102_0047264
3564 Ga0496102_0191157
3565 Ga0496102_0509070
3566 Ga0496103_0246927
3567 Ga0496104_0004101
3568 Ga0496104_0058001
3569 Ga0496104_0330733
3570 Ga0496104_0657970
3571 Ga0496105_0043048
3572 Ga0496105_0592230
3573 Ga0496105_0626676
3574 Ga0496106_0012220
3575 Ga0496106_0055120
3576 Ga0496107_0130976
3577 Ga0496107_0372999
3578 Ga0496108_0067782
3579 Ga0496108_0254884
3580 Ga0496108_0525511
3581 Ga0496109_0034590
3582 Ga0496109_0069873
3583 Ga0496109_1231936
3584 Ga0496110_0094088
3585 Ga0496110_0128599
3586 Ga0496110_0158310
3587 Ga0496110_0353796
3588 Ga0496111_0062777
3589 Ga0496111_0252643
3590 Ga0496111_0669728
3591 Ga0496112_0277695
3592 Ga0496113_0010989
3593 Ga0496113_0122050
3594 Ga0496113_0990754
3595 Ga0496114_0218590
3596 Ga0496114_0314115
3597 Ga0496114_0341868
3598 Ga0496114_0601822
3599 Ga0496115_0259830
3600 Ga0496116_0163029
3601 Ga0496116_0166712
3602 Ga0496116_0266748
3603 Ga0496117_0013508
3604 Ga0496117_0019516
3605 Ga0496117_0052144
3606 Ga0496118_0009116
3607 Ga0496118_0053625
3608 Ga0496121_0045456
3609 Ga0496121_0089403
3610 Ga0496121_0188861
3611 Ga0496122_0000552
3612 Ga0496122_0127986
3613 Ga0496123_0001585
3614 Ga0496123_0025017
3615 Ga0496123_0052955
3616 Ga0496123_0143032
3617 Ga0496124_0089671
3618 Ga0496124_0142076
3619 Ga0496124_0166873
3620 Ga0496124_0189507
3621 Ga0496125_0001368
3622 Ga0496125_0009166
3623 Ga0496125_0034798
3624 Ga0496125_0056434
3625 Ga0496125_0190126
3626 Ga0496125_0256365
3627 Ga0496125_0471999
3628 Ga0496126_0126980
3629 Ga0496126_0496667
3630 Ga0496126_0547004
3631 Ga0495678_000009
3632 Ga0495678_000035
3633 Ga0495678_003416
3634 Ga0495678_014610
3635 Ga0495678_033503
3636 Ga0495678_094668
3637 Ga0495678_112271
3638 Ga0495682_0001939
3639 Ga0495682_0002609
3640 Ga0495682_0007946
3641 Ga0495682_0068522
3642 Ga0501298_011896
3643 Ga0501300_018393
3644 Ga0501303_004894
3645 Ga0501032_0057759
3646 Ga0501034_0735138
3647 Ga0501043_0010569
3648 Ga0501043_0365601
3649 Ga0501043_0623108
3650 Ga0501046_0012537
3651 Ga0501047_0015658
3652 Ga0501048_0068146
3653 Ga0501206_015062
3654 Ga0501222_011032
3655 Ga0501240_015693
3656 Ga0501249_001955
3657 Ga0501225_0009720
3658 Ga0501079_0898240
3659 Ga0501262_000333
3660 Ga0501264_008911
3661 Ga0501265_002430
3662 Ga0501269_051107
3663 nmdc:mga03683_100415_c1
3664 nmdc:mga03683_11059_c1
3665 nmdc:mga03683_121243_c1
3666 nmdc:mga03683_176849_c1
3667 nmdc:mga03683_191079_c1
3668 nmdc:mga03683_2207_c1
3669 nmdc:mga03683_231868_c1
3670 nmdc:mga03683_312174_c1
3671 nmdc:mga03683_351698_c1
3672 nmdc:mga03683_4604_c1
3673 nmdc:mga03683_505229_c1
3674 nmdc:mga03683_52226_c1
3675 nmdc:mga03683_558913_c1
3676 nmdc:mga03683_7947_c2
3677 nmdc:mga03n38_132691_c1
3678 nmdc:mga03n38_395696_c1
3679 nmdc:mga03n38_73274_c1
3680 nmdc:mga00v17_28836_c1
3681 nmdc:mga00v17_309415_c1
3682 nmdc:mga00v17_779504_c1
3683 nmdc:mga0k408_12545_c1
3684 nmdc:mga0k408_136604_c1
3685 nmdc:mga0k408_143867_c1
3686 nmdc:mga0k408_172153_c1
3687 nmdc:mga0k408_18003_c1
3688 nmdc:mga0k408_1832_c1
3689 nmdc:mga0k408_2173_c2
3690 nmdc:mga0k408_23489_c1
3691 nmdc:mga0k408_2403_c1
3692 nmdc:mga0k408_25142_c1
3693 nmdc:mga0k408_3264_c1
3694 nmdc:mga0k408_366874_c1
3695 nmdc:mga0k408_374987_c1
3696 nmdc:mga0k408_38001_c1
3697 nmdc:mga0k408_394745_c1
3698 nmdc:mga0k408_41756_c1
3699 nmdc:mga0k408_483053_c1
3700 nmdc:mga0k408_519125_c1
3701 nmdc:mga0k408_6625_c1
3702 nmdc:mga0k408_69454_c1
3703 nmdc:mga0k408_79993_c1
3704 nmdc:mga0k408_83142_c1
3705 nmdc:mga0k408_83423_c1
3706 nmdc:mga0k408_95654_c1
3707 nmdc:mga06z11_15676_c1
3708 nmdc:mga06z11_251659_c1
3709 nmdc:mga06z11_291793_c1
3710 nmdc:mga06z11_297640_c1
3711 nmdc:mga06z11_431473_c1
3712 nmdc:mga06z11_5404_c1
3713 nmdc:mga04h51_104660_c1
3714 nmdc:mga04h51_257970_c1
3715 nmdc:mga07m45_10967_c1
3716 nmdc:mga07m45_117139_c1
3717 nmdc:mga07m45_13780_c1
3718 nmdc:mga07m45_142433_c1
3719 nmdc:mga07m45_173713_c1
3720 nmdc:mga07m45_23347_c2
3721 nmdc:mga07m45_257119_c1
3722 nmdc:mga07m45_43309_c1
3723 nmdc:mga07m45_48119_c1
3724 nmdc:mga07m45_6011_c1
3725 nmdc:mga07m45_62617_c1
3726 nmdc:mga07m45_70336_c1
3727 nmdc:mga07m45_88815_c1
3728 nmdc:mga0qj67_725633_c1
3729 nmdc:mga0rr50_902513_c1
3730 nmdc:mga0sz30_276124_c1
3731 nmdc:mga0sz30_294999_c1
3732 Ga0495601_0069985
3733 Ga0500610_0000055
3734 Ga0500610_0000454
3735 Ga0500610_0000509
3736 Ga0495655_0078673
3737 Ga0495595_0056914
3738 Ga0495595_0140001
3739 Ga0495619_0694758
3740 Ga0500578_0078098
3741 Ga0500578_0168990
3742 Ga0500643_011260
3743 Ga0500644_0008080
3744 Ga0500644_0014654
3745 Ga0500644_0018208
3746 Ga0500646_0132370
3747 Ga0500647_0050303
3748 Ga0500647_0249347
3749 Ga0500583_0125474
3750 Ga0500583_0318735
3751 Ga0500583_0334033
3752 Ga0500651_0000015
3753 Ga0500651_0000242
3754 Ga0500651_0179287
3755 Ga0500566_0030268
3756 Ga0500566_0129441
3757 Ga0500566_0362801
3758 Ga0500641_0211130
3759 Ga0500650_0128252
3760 Ga0500650_0260854
3761 Ga0500560_096383
3762 Ga0500562_010558
3763 Ga0500569_087057
3764 Ga0500571_000017
3765 Ga0500571_000074
3766 Ga0500572_107590
3767 Ga0500572_210357
3768 Ga0500572_245004
3769 Ga0500591_050154
3770 Ga0500592_006166
3771 Ga0500593_000097
3772 Ga0500593_000242
3773 Ga0500593_003350
3774 Ga0500594_0002529
3775 Ga0500594_0021001
3776 Ga0500607_000025
3777 Ga0500607_000049
3778 Ga0500607_019928
3779 Ga0500607_135680
3780 Ga0500608_012479
3781 Ga0500614_156419
3782 Ga0500618_000173
3783 Ga0500618_015894
3784 Ga0500618_052678
3785 Ga0500618_058291
3786 Ga0500626_009438
3787 Ga0500655_000065
3788 Ga0500655_002857
3789 Ga0500658_0000028
3790 Ga0500658_0000054
3791 Ga0500658_0003025
3792 Ga0500658_0042452
3793 Ga0500559_0001694
3794 Ga0500559_0004268
3795 Ga0500559_0006743
3796 Ga0500559_0015080
3797 Ga0500559_0025318
3798 Ga0500559_0093712
3799 Ga0500559_0226043
3800 Ga0500564_001050
3801 Ga0500564_066263
3802 Ga0500564_118137
3803 Ga0500568_0001518
3804 Ga0500568_0068042
3805 Ga0500573_0005327
3806 Ga0500574_000051
3807 Ga0500574_000431
3808 Ga0500586_000727
3809 Ga0500586_025988
3810 Ga0500616_0025694
3811 Ga0500616_0041391
3812 Ga0500616_0050793
3813 Ga0500616_0332006
3814 Ga0500619_088620
3815 Ga0500622_0001109
3816 Ga0500622_0008524
3817 Ga0500622_0137997
3818 Ga0500627_0000171
3819 Ga0500630_073077
3820 Ga0500633_0087958
3821 Ga0500634_0004247
3822 Ga0500634_0004851
3823 Ga0500634_0063922
3824 Ga0500634_0113662
3825 Ga0500638_000284
3826 Ga0500638_012459
3827 Ga0500639_008998
3828 Ga0500636_0005829
3829 Ga0500636_0221671
3830 Ga0500567_125390
3831 Ga0500565_025083
3832 Ga0500587_002697
3833 Ga0500587_009667
3834 Ga0500661_003998
3835 2511242546
3836 2513228680
3837 2548498599
3838 2553004589
3839 2587758680
3840 2599620622
3841 2599673921
3842 2599678762
3843 2599690133
3844 2643864789
3845 2644159027
3846 2644244933
3847 2644257493
3848 2644293980
3849 2644302577
3850 2644400379
3851 2644468252
3852 2644649334
3853 2738717815
3854 2738723725
3855 2738739727
3856 2738830461
3857 2738879436
3858 2739154257
3859 2739196210
3860 2739249426
3861 2739278501
3862 2739284456
3863 2739322653
3864 2739340894
3865 2819601198
3866 2831271487
3867 2838055386
3868 2842679996
3869 2842735283
3870 2842749961
3871 2885201115
3872 2885214101
3873 2899927455
3874 2904453290
3875 2904459284
3876 2904532422
3877 2904548342
3878 2919466116
3879 2919708845
3880 2923515417
3881 2928042633
3882 2928048940
3883 2928051490
3884 2928068702
3885 2928073330
3886 2928084432
3887 2928117795
3888 2929163332
3889 2929523212
3890 2939634006
3891 2945912018
3892 2945947977
3893 2945972083
3894 2945985711
3895 2954772223
3896 2990712005
3897 639787670

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

46

181

0.89

PF13577

SnoaL_4

SnoaL-like domain

33

171

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chc-assembly1.cif.gz_C structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.9167 2 144
7c8z-assembly2.cif.gz_H crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) 0.9136 1 156
7c8z-assembly2.cif.gz_H crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) 0.9081 1 156
7vju-assembly1.cif.gz_F crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 0.9074 7 156
7q05-assembly1.cif.gz_C crystal structure of tpado in complex with tpa 0.9061 6 156
ID Description Score Start End Superfamily
3ebyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8855 9 156 3.10.450.50
3ef8B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8544 15 143 3.10.450.50
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8494 60 141 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8422 1 148 3.10.450.50
2rfrA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8414 4 147 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A356HL20-F1-model_v4 Salicylate hydroxylase 0.955 1 150
AF-B8ESU3-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase beta subunit 0.9542 1 148 GO:0051213
AF-A0A1Y0BBZ9-F1-model_v4 B172 0.9513 1 148 GO:0016491
AF-A0A537TZC4-F1-model_v4 Ring-hydroxylating dioxygenase subunit beta 0.9421 6 135 GO:0051213
AF-A0A6N8XPX4-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9398 1 148 GO:0051213

Map