F496145

General Info

Members Datasets Scaffolds Average Seq Length
1958 472 1958 81

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100144441|Ga0070683_1001444413
Length 87
Sequence MIDPRIDELLSHTPTDGGPASRYALVIVSAKRARQINNYHHQLGEGMGLEDAPPPLVESRSKNYLTMAMEEIAHGKLTFSYGAPQAQ

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
139 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
140 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
274 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
275 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
276 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
277 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
278 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
279 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
280 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
281 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
282 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
283 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
286 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
290 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
291 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
292 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
293 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
294 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
295 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
299 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
300 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
301 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
302 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
303 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
304 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
305 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
306 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
309 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
310 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
311 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
312 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
313 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
314 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
329 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
330 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
331 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
332 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
333 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
334 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
338 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
339 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
340 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
341 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
342 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
343 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
344 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
358 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
361 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
372 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
373 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
374 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
380 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
381 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
403 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
430 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
431 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
435 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
448 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
449 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
450 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
451 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
454 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 6.79
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002177 3300000041 Bacteria 1845
2 ARcpr5yngRDRAFT_c003093 3300000043 Bacteria 1670
3 ARSoilOldRDRAFT_c029933 3300000044 Unclassified 501
4 ARCol0yngRDRAFT_1012314 3300000652 Unclassified 633
5 JGI24746J21847_1033644 3300001977 Bacteria 708
6 JGI24739J22299_10029318 3300001989 Unclassified 1915
7 JGI24737J22298_10203090 3300001990 Bacteria 585
8 JGI24743J22301_10011312 3300001991 Bacteria 1606
9 JGI24750J21931_1080031 3300002070 Bacteria 542
10 JGI24748J21848_1037401 3300002074 Bacteria 612
11 JGI24738J21930_10026763 3300002075 Bacteria 1183
12 JGI24744J21845_10010582 3300002077 Bacteria 1890
13 JGI24744J21845_10042346 3300002077 Bacteria 850
14 JGI24033J26618_1025498 3300002155 Bacteria 776
15 JGI24742J22300_10052558 3300002244 Bacteria 740
16 JGI24742J22300_10115031 3300002244 Bacteria 528
17 JGI24742J22300_10120749 3300002244 Bacteria 517
18 JGI24751J29686_10012957 3300002459 Bacteria 1722
19 JGI24751J29686_10105521 3300002459 Unclassified 589
20 JGI25406J46586_10007814 3300003203 Bacteria 4865
21 Ga0058859_11466280 3300004798 Bacteria 525
22 Ga0065712_10321828 3300005290 Bacteria 827
23 Ga0070658_10034020 3300005327 Bacteria 4101
24 Ga0070658_10223620 3300005327 Unclassified 1593
25 Ga0070676_10295817 3300005328 Bacteria 1096
26 Ga0070676_10802745 3300005328 Bacteria 694
27 Ga0070676_11240665 3300005328 Bacteria 568
28 Ga0070683_100030559 3300005329 Bacteria 4892
29 Ga0070683_100093597 3300005329 Bacteria 2823
30 Ga0070683_100107520 3300005329 Unclassified 2630
31 Ga0070683_100144441 3300005329 Bacteria 2254
32 Ga0070683_100628841 3300005329 Bacteria 1028
33 Ga0070683_101219148 3300005329 Bacteria 723
34 Ga0070683_101915058 3300005329 Bacteria 570
35 Ga0070690_100088437 3300005330 Bacteria 2036
36 Ga0070690_100189897 3300005330 Bacteria 1424
37 Ga0070690_100440579 3300005330 Bacteria 964
38 Ga0070670_100035122 3300005331 Bacteria 4315
39 Ga0070670_100090955 3300005331 Bacteria 2623
40 Ga0070670_101571225 3300005331 Bacteria 604
41 Ga0070677_10181722 3300005333 Bacteria 1002
42 Ga0070677_10479080 3300005333 Unclassified 671
43 Ga0068869_100095555 3300005334 Bacteria 2242
44 Ga0068869_100242077 3300005334 Bacteria 1438
45 Ga0068869_100910443 3300005334 Bacteria 761
46 Ga0068869_101499566 3300005334 Unclassified 599
47 Ga0070666_10187625 3300005335 Bacteria 1452
48 Ga0070666_10254454 3300005335 Bacteria 1244
49 Ga0070666_10351510 3300005335 Bacteria 1055
50 Ga0070666_10757817 3300005335 Bacteria 714
51 Ga0070680_100094191 3300005336 Bacteria 2482
52 Ga0070680_100280581 3300005336 Bacteria 1411
53 Ga0070682_100021835 3300005337 Bacteria 3783
54 Ga0070682_100145702 3300005337 Bacteria 1619
55 Ga0070682_100146983 3300005337 Bacteria 1613
56 Ga0070682_100222468 3300005337 Bacteria 1344
57 Ga0070682_101494996 3300005337 Bacteria 581
58 Ga0070682_101703143 3300005337 Unclassified 548
59 Ga0068868_100004645 3300005338 Bacteria 9641
60 Ga0068868_100036276 3300005338 Bacteria 3815
61 Ga0068868_100036558 3300005338 Bacteria 3802
62 Ga0068868_100107743 3300005338 Bacteria 2261
63 Ga0068868_100306229 3300005338 Bacteria 1351
64 Ga0068868_100411464 3300005338 Bacteria 1169
65 Ga0068868_100505075 3300005338 Unclassified 1060
66 Ga0068868_100583503 3300005338 Bacteria 988
67 Ga0068868_101332347 3300005338 Bacteria 668
68 Ga0068868_101506434 3300005338 Bacteria 630
69 Ga0068868_101602335 3300005338 Bacteria 612
70 Ga0070660_100051168 3300005339 Bacteria 3180
71 Ga0070660_100212716 3300005339 Bacteria 1570
72 Ga0070660_100216349 3300005339 Bacteria 1556
73 Ga0070660_100384759 3300005339 Bacteria 1158
74 Ga0070660_101565459 3300005339 Bacteria 561
75 Ga0070660_101639298 3300005339 Bacteria 548
76 Ga0070660_101717161 3300005339 Unclassified 535
77 Ga0070689_100075585 3300005340 Bacteria 2637
78 Ga0070689_100392350 3300005340 Bacteria 1172
79 Ga0070689_100474709 3300005340 Bacteria 1067
80 Ga0070691_10000781 3300005341 Bacteria 12645
81 Ga0070691_10050107 3300005341 Bacteria 1992
82 Ga0070687_100035058 3300005343 Bacteria 2488
83 Ga0070687_100050997 3300005343 Bacteria 2140
84 Ga0070687_100057945 3300005343 Bacteria 2033
85 Ga0070687_100231667 3300005343 Viruses 1137
86 Ga0070687_100400774 3300005343 Bacteria 900
87 Ga0070661_100127493 3300005344 Bacteria 1910
88 Ga0070661_100291282 3300005344 Bacteria 1268
89 Ga0070661_100350634 3300005344 Bacteria 1158
90 Ga0070661_100584411 3300005344 Bacteria 902
91 Ga0070661_100615685 3300005344 Bacteria 879
92 Ga0070661_101165736 3300005344 Bacteria 644
93 Ga0070692_10006436 3300005345 Bacteria 5099
94 Ga0070692_10019140 3300005345 Unclassified 3302
95 Ga0070692_10244186 3300005345 Bacteria 1072
96 Ga0070692_10525884 3300005345 Viruses 771
97 Ga0070668_100052043 3300005347 Bacteria 3156
98 Ga0070668_100138126 3300005347 Bacteria 1962
99 Ga0070668_100765461 3300005347 Bacteria 856
100 Ga0070669_100116311 3300005353 Bacteria 2035
101 Ga0070669_100137167 3300005353 Bacteria 1883
102 Ga0070669_101121927 3300005353 Bacteria 678
103 Ga0070669_101461091 3300005353 Bacteria 594
104 Ga0070669_101625241 3300005353 Unclassified 563
105 Ga0070669_101702887 3300005353 Bacteria 550
106 Ga0070675_100059601 3300005354 Bacteria 3149
107 Ga0070675_100086477 3300005354 Unclassified 2620
108 Ga0070675_100114149 3300005354 Bacteria 2289
109 Ga0070675_100355596 3300005354 Bacteria 1300
110 Ga0070675_100369674 3300005354 Bacteria 1275
111 Ga0070671_100132893 3300005355 Unclassified 2096
112 Ga0070671_100276851 3300005355 Bacteria 1427
113 Ga0070671_100377988 3300005355 Bacteria 1210
114 Ga0070674_100012612 3300005356 Bacteria 5195
115 Ga0070674_100017188 3300005356 Bacteria 4545
116 Ga0070674_100018721 3300005356 Bacteria 4385
117 Ga0070674_100068919 3300005356 Bacteria 2494
118 Ga0070674_100108733 3300005356 Bacteria 2032
119 Ga0070674_100171519 3300005356 Bacteria 1654
120 Ga0070674_100331376 3300005356 Bacteria 1223
121 Ga0070674_100383673 3300005356 Bacteria 1144
122 Ga0070674_100539557 3300005356 Bacteria 977
123 Ga0070674_101460090 3300005356 Bacteria 614
124 Ga0070674_101705391 3300005356 Bacteria 570
125 Ga0070673_100051568 3300005364 Bacteria 3223
126 Ga0070673_100628174 3300005364 Unclassified 982
127 Ga0070673_100703896 3300005364 Bacteria 928
128 Ga0070673_101095620 3300005364 Bacteria 744
129 Ga0070673_101784467 3300005364 Bacteria 583
130 Ga0070673_102046588 3300005364 Bacteria 544
131 Ga0070688_100008188 3300005365 Bacteria 5664
132 Ga0070688_100034129 3300005365 Bacteria 3079
133 Ga0070688_100500419 3300005365 Bacteria 916
134 Ga0070688_100951268 3300005365 Unclassified 680
135 Ga0070688_101644248 3300005365 Bacteria 525
136 Ga0070659_100039369 3300005366 Bacteria 3690
137 Ga0070659_100063946 3300005366 Bacteria 2911
138 Ga0070659_100597798 3300005366 Bacteria 948
139 Ga0070659_100953356 3300005366 Bacteria 752
140 Ga0070659_101014896 3300005366 Unclassified 729
141 Ga0070659_101801151 3300005366 Bacteria 548
142 Ga0070667_100753352 3300005367 Bacteria 903
143 Ga0070667_100957960 3300005367 Bacteria 798
144 Ga0070703_10016151 3300005406 Bacteria 2141
145 Ga0070703_10036500 3300005406 Bacteria 1510
146 Ga0070703_10156817 3300005406 Unclassified 860
147 Ga0070709_10067280 3300005434 Bacteria 2300
148 Ga0070713_100278927 3300005436 Bacteria 1533
149 Ga0070713_102195319 3300005436 Bacteria 535
150 Ga0070710_10009995 3300005437 Bacteria 4651
151 Ga0070710_11051265 3300005437 Bacteria 596
152 Ga0070701_10011271 3300005438 Bacteria 3990
153 Ga0070701_10075200 3300005438 Unclassified 1815
154 Ga0070701_10177726 3300005438 Bacteria 1244
155 Ga0070701_10227411 3300005438 Bacteria 1115
156 Ga0070701_10343113 3300005438 Bacteria 931
157 Ga0070701_10514926 3300005438 Unclassified 779
158 Ga0070701_10690002 3300005438 Bacteria 686
159 Ga0070701_11357721 3300005438 Bacteria 510
160 Ga0070711_100017725 3300005439 Bacteria 4537
161 Ga0070711_100052554 3300005439 Bacteria 2804
162 Ga0070711_101542818 3300005439 Bacteria 580
163 Ga0070705_100128329 3300005440 Bacteria 1650
164 Ga0070705_100186589 3300005440 Bacteria 1409
165 Ga0070705_100273433 3300005440 Bacteria 1197
166 Ga0070705_100557331 3300005440 Bacteria 880
167 Ga0070700_100008857 3300005441 Bacteria 5501
168 Ga0070700_100015485 3300005441 Unclassified 4325
169 Ga0070700_100021254 3300005441 Bacteria 3770
170 Ga0070700_100078357 3300005441 Bacteria 2127
171 Ga0070700_100241941 3300005441 Bacteria 1290
172 Ga0070700_100332074 3300005441 Bacteria 1121
173 Ga0070700_100827844 3300005441 Bacteria 748
174 Ga0070700_101834976 3300005441 Bacteria 523
175 Ga0070694_100006011 3300005444 Bacteria 7362
176 Ga0070694_100072927 3300005444 Bacteria 2370
177 Ga0070694_100469242 3300005444 Bacteria 997
178 Ga0070694_100579264 3300005444 Bacteria 902
179 Ga0070708_100023029 3300005445 Bacteria 5291
180 Ga0070708_100440174 3300005445 Bacteria 1229
181 Ga0070663_100129955 3300005455 Bacteria 1912
182 Ga0070663_100131454 3300005455 Bacteria 1901
183 Ga0070663_101422877 3300005455 Bacteria 614
184 Ga0070678_100001665 3300005456 Bacteria 11902
185 Ga0070678_100004139 3300005456 Bacteria 8174
186 Ga0070678_100099170 3300005456 Bacteria 2254
187 Ga0070678_100424304 3300005456 Bacteria 1160
188 Ga0070678_100571999 3300005456 Bacteria 1005
189 Ga0070678_100862365 3300005456 Bacteria 826
190 Ga0070678_101258248 3300005456 Bacteria 688
191 Ga0070678_101717593 3300005456 Bacteria 591
192 Ga0070678_102226809 3300005456 Bacteria 520
193 Ga0070662_100022184 3300005457 Bacteria 4342
194 Ga0070662_100164014 3300005457 Unclassified 1740
195 Ga0070662_100431495 3300005457 Bacteria 1091
196 Ga0070662_100737896 3300005457 Bacteria 835
197 Ga0070662_101062150 3300005457 Bacteria 694
198 Ga0070681_10086083 3300005458 Bacteria 3095
199 Ga0070681_10538165 3300005458 Bacteria 1082
200 Ga0070681_10776921 3300005458 Bacteria 875
201 Ga0070681_10825285 3300005458 Bacteria 845
202 Ga0070681_11359076 3300005458 Bacteria 634
203 Ga0068867_100000419 3300005459 Bacteria 28327
204 Ga0068867_100082047 3300005459 Bacteria 2432
205 Ga0068867_100226075 3300005459 Bacteria 1510
206 Ga0068867_100411630 3300005459 Bacteria 1143
207 Ga0068867_100431975 3300005459 Bacteria 1118
208 Ga0068867_100863571 3300005459 Bacteria 811
209 Ga0068867_101211148 3300005459 Bacteria 694
210 Ga0068867_101351710 3300005459 Bacteria 659
211 Ga0068867_101450244 3300005459 Unclassified 638
212 Ga0068867_101822016 3300005459 Unclassified 572
213 Ga0070685_10003141 3300005466 Bacteria 8398
214 Ga0070685_10009061 3300005466 Bacteria 5135
215 Ga0070685_10012527 3300005466 Bacteria 4459
216 Ga0070685_10024284 3300005466 Bacteria 3327
217 Ga0070685_10115620 3300005466 Bacteria 1659
218 Ga0070685_10295037 3300005466 Bacteria 1091
219 Ga0070685_11595472 3300005466 Bacteria 505
220 Ga0070706_100007379 3300005467 Bacteria 10314
221 Ga0070706_100085948 3300005467 Bacteria 2914
222 Ga0070706_100524596 3300005467 Bacteria 1102
223 Ga0070707_100000635 3300005468 Bacteria 35108
224 Ga0070707_100042074 3300005468 Bacteria 4373
225 Ga0070707_101431018 3300005468 Bacteria 658
226 Ga0070707_101772126 3300005468 Bacteria 585
227 Ga0070707_101805743 3300005468 Unclassified 579
228 Ga0070698_100074422 3300005471 Bacteria 3402
229 Ga0070698_100284930 3300005471 Bacteria 1583
230 Ga0070698_100294761 3300005471 Bacteria 1553
231 Ga0070698_100362479 3300005471 Bacteria 1381
232 Ga0070698_100664390 3300005471 Bacteria 983
233 Ga0070698_101922499 3300005471 Unclassified 545
234 Ga0070699_100146449 3300005518 Bacteria 2087
235 Ga0070699_100259360 3300005518 Bacteria 1554
236 Ga0070699_101089913 3300005518 Bacteria 733
237 Ga0070699_102035496 3300005518 Bacteria 525
238 Ga0070699_102132555 3300005518 Bacteria 512
239 Ga0070679_100001403 3300005530 Bacteria 21260
240 Ga0070679_100116411 3300005530 Bacteria 2657
241 Ga0070679_100329864 3300005530 Bacteria 1474
242 Ga0070684_100068309 3300005535 Bacteria 3123
243 Ga0070684_100092820 3300005535 Bacteria 2686
244 Ga0070684_100132652 3300005535 Bacteria 2248
245 Ga0070684_100187851 3300005535 Bacteria 1880
246 Ga0070684_100196608 3300005535 Bacteria 1836
247 Ga0070684_100202774 3300005535 Bacteria 1807
248 Ga0070684_100216839 3300005535 Bacteria 1745
249 Ga0070684_100268161 3300005535 Bacteria 1562
250 Ga0070684_100988696 3300005535 Bacteria 790
251 Ga0070684_101012417 3300005535 Unclassified 780
252 Ga0070697_100827937 3300005536 Unclassified 819
253 Ga0070697_101151354 3300005536 Unclassified 691
254 Ga0070697_101999752 3300005536 Bacteria 519
255 Ga0068853_100002053 3300005539 Bacteria 14918
256 Ga0068853_100012231 3300005539 Bacteria 6979
257 Ga0068853_100165074 3300005539 Bacteria 2001
258 Ga0068853_101477199 3300005539 Bacteria 658
259 Ga0070672_100029658 3300005543 Bacteria 4104
260 Ga0070672_100089935 3300005543 Bacteria 2475
261 Ga0070672_100090127 3300005543 Bacteria 2472
262 Ga0070672_100093704 3300005543 Bacteria 2427
263 Ga0070672_100620362 3300005543 Bacteria 943
264 Ga0070672_101682915 3300005543 Bacteria 570
265 Ga0070686_100013865 3300005544 Bacteria 4628
266 Ga0070686_100068848 3300005544 Bacteria 2310
267 Ga0070686_100755880 3300005544 Bacteria 780
268 Ga0070686_100860353 3300005544 Bacteria 735
269 Ga0070686_101158413 3300005544 Bacteria 641
270 Ga0070686_101213581 3300005544 Bacteria 627
271 Ga0070686_101360329 3300005544 Bacteria 595
272 Ga0070695_100727527 3300005545 Bacteria 790
273 Ga0070695_100850565 3300005545 Unclassified 734
274 Ga0070695_101252121 3300005545 Bacteria 612
275 Ga0070695_101425125 3300005545 Unclassified 575
276 Ga0070696_100052553 3300005546 Bacteria 2834
277 Ga0070696_100188523 3300005546 Bacteria 1534
278 Ga0070696_100189412 3300005546 Unclassified 1530
279 Ga0070696_100414604 3300005546 Bacteria 1056
280 Ga0070696_100505644 3300005546 Bacteria 962
281 Ga0070696_100632559 3300005546 Bacteria 866
282 Ga0070693_100037999 3300005547 Bacteria 2688
283 Ga0070693_100436609 3300005547 Bacteria 916
284 Ga0070693_100455653 3300005547 Unclassified 898
285 Ga0070665_100057777 3300005548 Bacteria 3889
286 Ga0070665_100195649 3300005548 Bacteria 2023
287 Ga0070665_100349722 3300005548 Bacteria 1483
288 Ga0070665_101975877 3300005548 Bacteria 589
289 Ga0070704_100011069 3300005549 Bacteria 5508
290 Ga0070704_100041763 3300005549 Bacteria 3168
291 Ga0070704_100130883 3300005549 Bacteria 1944
292 Ga0070704_100883396 3300005549 Bacteria 803
293 Ga0068855_100070836 3300005563 Bacteria 4055
294 Ga0068855_100492816 3300005563 Bacteria 1333
295 Ga0068855_101277448 3300005563 Bacteria 761
296 Ga0070664_100015680 3300005564 Bacteria 6200
297 Ga0070664_100040958 3300005564 Bacteria 3908
298 Ga0070664_100190360 3300005564 Bacteria 1828
299 Ga0070664_100201688 3300005564 Bacteria 1775
300 Ga0070664_100450391 3300005564 Bacteria 1182
301 Ga0070664_100563873 3300005564 Bacteria 1054
302 Ga0070664_100591979 3300005564 Bacteria 1028
303 Ga0070664_100596916 3300005564 Bacteria 1024
304 Ga0068857_100086906 3300005577 Bacteria 2797
305 Ga0068857_100302560 3300005577 Bacteria 1474
306 Ga0068857_100347802 3300005577 Bacteria 1372
307 Ga0068857_100776531 3300005577 Bacteria 914
308 Ga0068854_100163424 3300005578 Bacteria 1726
309 Ga0068854_100422521 3300005578 Bacteria 1107
310 Ga0068854_101270942 3300005578 Bacteria 662
311 Ga0068856_100095770 3300005614 Bacteria 2957
312 Ga0068856_100501872 3300005614 Bacteria 1234
313 Ga0068856_100548110 3300005614 Bacteria 1178
314 Ga0070702_100004258 3300005615 Bacteria 6522
315 Ga0070702_100004263 3300005615 Bacteria 6515
316 Ga0070702_100133479 3300005615 Bacteria 1571
317 Ga0070702_100192565 3300005615 Bacteria 1343
318 Ga0070702_100309865 3300005615 Bacteria 1096
319 Ga0070702_100963269 3300005615 Bacteria 673
320 Ga0070702_101197582 3300005615 Bacteria 612
321 Ga0068852_100002371 3300005616 Bacteria 12983
322 Ga0068852_100040437 3300005616 Bacteria 3934
323 Ga0068852_100718449 3300005616 Bacteria 1010
324 Ga0068852_100807019 3300005616 Bacteria 953
325 Ga0068852_100943671 3300005616 Bacteria 881
326 Ga0068852_101497896 3300005616 Bacteria 697
327 Ga0068852_102607359 3300005616 Archaea 525
328 Ga0068859_100588919 3300005617 Bacteria 1206
329 Ga0068859_100709683 3300005617 Bacteria 1096
330 Ga0068864_100027376 3300005618 Bacteria 4814
331 Ga0068864_100143287 3300005618 Bacteria 2157
332 Ga0068864_100167875 3300005618 Bacteria 1999
333 Ga0068864_100554087 3300005618 Bacteria 1112
334 Ga0068864_100820924 3300005618 Bacteria 915
335 Ga0068864_101777116 3300005618 Bacteria 622
336 Ga0068866_10001799 3300005718 Bacteria 9030
337 Ga0068866_10091983 3300005718 Bacteria 1654
338 Ga0068866_10093140 3300005718 Bacteria 1645
339 Ga0068866_10156986 3300005718 Bacteria 1323
340 Ga0068866_10221062 3300005718 Unclassified 1143
341 Ga0068866_10854030 3300005718 Bacteria 637
342 Ga0068861_100014718 3300005719 Bacteria 5495
343 Ga0068861_100372807 3300005719 Bacteria 1258
344 Ga0068861_100435971 3300005719 Bacteria 1171
345 Ga0068861_100485676 3300005719 Bacteria 1114
346 Ga0068861_101848275 3300005719 Bacteria 600
347 Ga0068861_102006662 3300005719 Bacteria 577
348 Ga0068851_10024007 3300005834 Bacteria 2983
349 Ga0068870_10002500 3300005840 Bacteria 7669
350 Ga0068870_10003552 3300005840 Bacteria 6615
351 Ga0068870_10613563 3300005840 Bacteria 741
352 Ga0068870_11222169 3300005840 Bacteria 545
353 Ga0068863_100138507 3300005841 Bacteria 2325
354 Ga0068863_100952274 3300005841 Bacteria 860
355 Ga0068863_101058552 3300005841 Unclassified 815
356 Ga0068858_100015199 3300005842 Bacteria 7242
357 Ga0068860_100129535 3300005843 Bacteria 2420
358 Ga0068860_100223434 3300005843 Bacteria 1829
359 Ga0068860_100457186 3300005843 Bacteria 1270
360 Ga0068862_100245095 3300005844 Bacteria 1631
361 Ga0068862_100787121 3300005844 Unclassified 928
362 Ga0068862_100805977 3300005844 Bacteria 917
363 Ga0068862_100961371 3300005844 Bacteria 843
364 Ga0068862_101520990 3300005844 Unclassified 675
365 Ga0081455_10011661 3300005937 Bacteria 8815
366 Ga0081455_10024025 3300005937 Bacteria 5655
367 Ga0081455_10041491 3300005937 Bacteria 4045
368 Ga0081455_10055663 3300005937 Bacteria 3364
369 Ga0081455_10081973 3300005937 Bacteria 2640
370 Ga0081455_10618089 3300005937 Bacteria 703
371 Ga0081455_10806584 3300005937 Bacteria 589
372 Ga0081538_10110862 3300005981 Bacteria 1347
373 Ga0081538_10238767 3300005981 Bacteria 703
374 Ga0081540_1283617 3300005983 Bacteria 571
375 Ga0081539_10001263 3300005985 Bacteria 44753
376 Ga0081539_10044508 3300005985 Bacteria 2562
377 Ga0081539_10270896 3300005985 Unclassified 744
378 Ga0070717_10154436 3300006028 Bacteria 1987
379 Ga0075365_10164734 3300006038 Bacteria 1546
380 Ga0075365_10207403 3300006038 Bacteria 1374
381 Ga0075365_10275801 3300006038 Bacteria 1183
382 Ga0075365_10308570 3300006038 Bacteria 1114
383 Ga0075365_10312402 3300006038 Bacteria 1106
384 Ga0075368_10027686 3300006042 Bacteria 2188
385 Ga0075363_100120444 3300006048 Bacteria 1465
386 Ga0075363_100946299 3300006048 Bacteria 529
387 Ga0075364_10182424 3300006051 Bacteria 1421
388 Ga0075364_10203298 3300006051 Bacteria 1343
389 Ga0075432_10006412 3300006058 Bacteria 4004
390 Ga0075432_10027343 3300006058 Bacteria 1964
391 Ga0075432_10197840 3300006058 Bacteria 794
392 Ga0075432_10215153 3300006058 Bacteria 766
393 Ga0075432_10225096 3300006058 Bacteria 752
394 Ga0070715_10097896 3300006163 Bacteria 1363
395 Ga0070716_100113437 3300006173 Bacteria 1684
396 Ga0070716_100810523 3300006173 Bacteria 726
397 Ga0070712_100011677 3300006175 Bacteria 5579
398 Ga0070712_100349498 3300006175 Bacteria 1210
399 Ga0070712_100396016 3300006175 Bacteria 1139
400 Ga0070712_100726067 3300006175 Bacteria 849
401 Ga0070712_101877371 3300006175 Bacteria 525
402 Ga0075362_10420044 3300006177 Bacteria 676
403 Ga0075367_10300116 3300006178 Bacteria 1011
404 Ga0075367_10733676 3300006178 Bacteria 629
405 Ga0075367_10795318 3300006178 Bacteria 602
406 Ga0097621_100005304 3300006237 Bacteria 9078
407 Ga0097621_100091151 3300006237 Bacteria 2551
408 Ga0097621_100939578 3300006237 Bacteria 807
409 Ga0075370_10231634 3300006353 Bacteria 1093
410 Ga0068871_100003722 3300006358 Bacteria 10489
411 Ga0068871_100035544 3300006358 Bacteria 3960
412 Ga0068871_100083298 3300006358 Bacteria 2653
413 Ga0068871_100472532 3300006358 Bacteria 1127
414 Ga0068871_100488067 3300006358 Bacteria 1109
415 Ga0068871_101150220 3300006358 Bacteria 727
416 Ga0068871_101901279 3300006358 Bacteria 566
417 Ga0075428_100000369 3300006844 Bacteria 44666
418 Ga0075428_100005557 3300006844 Bacteria 14021
419 Ga0075428_100326752 3300006844 Bacteria 1648
420 Ga0075428_101036234 3300006844 Bacteria 868
421 Ga0075428_101065516 3300006844 Bacteria 854
422 Ga0075428_101383876 3300006844 Bacteria 739
423 Ga0075430_100004112 3300006846 Bacteria 12276
424 Ga0075430_100040721 3300006846 Bacteria 3932
425 Ga0075431_100012539 3300006847 Bacteria 8555
426 Ga0075431_100132018 3300006847 Bacteria 2575
427 Ga0075431_100165543 3300006847 Bacteria 2273
428 Ga0075431_101213341 3300006847 Bacteria 717
429 Ga0075431_101620792 3300006847 Unclassified 605
430 Ga0075433_10040442 3300006852 Bacteria 4036
431 Ga0075433_10438138 3300006852 Bacteria 1152
432 Ga0075433_10463648 3300006852 Bacteria 1116
433 Ga0075433_10475575 3300006852 Bacteria 1101
434 Ga0075433_10697038 3300006852 Bacteria 889
435 Ga0075433_11708315 3300006852 Unclassified 542
436 Ga0075434_100192329 3300006871 Bacteria 2061
437 Ga0075434_100205399 3300006871 Bacteria 1990
438 Ga0075434_100433538 3300006871 Bacteria 1336
439 Ga0075434_100510717 3300006871 Bacteria 1222
440 Ga0075434_100817970 3300006871 Bacteria 947
441 Ga0075434_102363588 3300006871 Bacteria 534
442 Ga0075429_100011703 3300006880 Bacteria 7608
443 Ga0075429_100030514 3300006880 Bacteria 4684
444 Ga0075429_100399516 3300006880 Bacteria 1204
445 Ga0075429_100876547 3300006880 Bacteria 786
446 Ga0068865_100000269 3300006881 Bacteria 28461
447 Ga0068865_100079561 3300006881 Bacteria 2348
448 Ga0068865_100180865 3300006881 Bacteria 1624
449 Ga0068865_100218127 3300006881 Bacteria 1490
450 Ga0068865_100371598 3300006881 Bacteria 1164
451 Ga0068865_100459129 3300006881 Bacteria 1055
452 Ga0068865_101427238 3300006881 Unclassified 619
453 Ga0068865_102047531 3300006881 Bacteria 520
454 Ga0075436_100004039 3300006914 Bacteria 10062
455 Ga0075436_100052705 3300006914 Unclassified 2809
456 Ga0075436_100193893 3300006914 Bacteria 1438
457 Ga0075436_100244410 3300006914 Bacteria 1277
458 Ga0075436_100268952 3300006914 Bacteria 1217
459 Ga0075436_100800624 3300006914 Bacteria 702
460 Ga0075436_100893725 3300006914 Bacteria 664
461 Ga0075436_101354552 3300006914 Bacteria 539
462 Ga0097620_100588925 3300006931 Bacteria 1206
463 Ga0097620_100709648 3300006931 Bacteria 1096
464 Ga0075435_100008556 3300007076 Bacteria 7355
465 Ga0075435_100069236 3300007076 Bacteria 2877
466 Ga0075435_100421232 3300007076 Bacteria 1150
467 Ga0075435_100781117 3300007076 Unclassified 831
468 Ga0075435_101804005 3300007076 Bacteria 537
469 Ga0099794_10124121 3300007265 Bacteria 1301
470 Ga0105251_10545624 3300009011 Bacteria 546
471 Ga0105244_10446431 3300009036 Bacteria 595
472 Ga0111539_10001582 3300009094 Bacteria 30297
473 Ga0111539_10019651 3300009094 Bacteria 8334
474 Ga0111539_10034653 3300009094 Bacteria 6117
475 Ga0111539_10056875 3300009094 Bacteria 4648
476 Ga0111539_10282038 3300009094 Bacteria 1933
477 Ga0111539_10336487 3300009094 Bacteria 1757
478 Ga0111539_10390216 3300009094 Bacteria 1621
479 Ga0111539_10398790 3300009094 Bacteria 1602
480 Ga0111539_10678207 3300009094 Bacteria 1200
481 Ga0111539_10886383 3300009094 Bacteria 1038
482 Ga0111539_11004528 3300009094 Bacteria 970
483 Ga0111539_11560908 3300009094 Bacteria 766
484 Ga0111539_11745516 3300009094 Archaea 722
485 Ga0111539_12578912 3300009094 Bacteria 589
486 Ga0105245_10007978 3300009098 Bacteria 9257
487 Ga0105245_10008137 3300009098 Bacteria 9169
488 Ga0105245_10027262 3300009098 Bacteria 5034
489 Ga0105245_10145927 3300009098 Bacteria 2233
490 Ga0105245_10214465 3300009098 Bacteria 1854
491 Ga0105245_10229027 3300009098 Bacteria 1797
492 Ga0105245_10232489 3300009098 Bacteria 1784
493 Ga0105245_10304818 3300009098 Bacteria 1564
494 Ga0105245_10323251 3300009098 Bacteria 1520
495 Ga0105245_10360111 3300009098 Bacteria 1443
496 Ga0105245_11451147 3300009098 Bacteria 736
497 Ga0105245_12658804 3300009098 Bacteria 554
498 Ga0105247_10022080 3300009101 Bacteria 3831
499 Ga0105247_10282546 3300009101 Unclassified 1145
500 Ga0105247_10963814 3300009101 Bacteria 663
501 Ga0105247_11673921 3300009101 Unclassified 525
502 Ga0114129_10001278 3300009147 Bacteria 33592
503 Ga0114129_10021820 3300009147 Bacteria 9089
504 Ga0114129_10029357 3300009147 Bacteria 7790
505 Ga0114129_10153264 3300009147 Bacteria 3153
506 Ga0114129_10224614 3300009147 Bacteria 2532
507 Ga0114129_10233403 3300009147 Unclassified 2477
508 Ga0114129_10249409 3300009147 Bacteria 2384
509 Ga0114129_10284065 3300009147 Unclassified 2210
510 Ga0114129_10636896 3300009147 Bacteria 1377
511 Ga0114129_11102219 3300009147 Unclassified 994
512 Ga0114129_11233221 3300009147 Bacteria 930
513 Ga0114129_11275508 3300009147 Bacteria 912
514 Ga0105243_10002162 3300009148 Bacteria 16608
515 Ga0105243_10007875 3300009148 Bacteria 8184
516 Ga0105243_10011092 3300009148 Bacteria 6818
517 Ga0105243_10016268 3300009148 Bacteria 5629
518 Ga0105243_10021934 3300009148 Bacteria 4850
519 Ga0105243_10040153 3300009148 Bacteria 3652
520 Ga0105243_10118512 3300009148 Bacteria 2228
521 Ga0105243_10264560 3300009148 Bacteria 1541
522 Ga0105243_10299862 3300009148 Bacteria 1456
523 Ga0105243_10486371 3300009148 Bacteria 1166
524 Ga0105243_10844117 3300009148 Unclassified 906
525 Ga0105243_11827459 3300009148 Bacteria 639
526 Ga0105241_10708564 3300009174 Bacteria 919
527 Ga0105241_10829708 3300009174 Bacteria 853
528 Ga0105241_11635600 3300009174 Unclassified 624
529 Ga0105241_11768283 3300009174 Bacteria 602
530 Ga0105242_10012809 3300009176 Bacteria 6460
531 Ga0105242_10077596 3300009176 Bacteria 2771
532 Ga0105242_10168633 3300009176 Bacteria 1922
533 Ga0105242_10216289 3300009176 Bacteria 1710
534 Ga0105242_10267767 3300009176 Bacteria 1546
535 Ga0105242_10360670 3300009176 Bacteria 1345
536 Ga0105242_11019777 3300009176 Unclassified 836
537 Ga0105242_11679693 3300009176 Bacteria 671
538 Ga0105242_12954459 3300009176 Bacteria 526
539 Ga0105248_10012514 3300009177 Bacteria 9357
540 Ga0105248_10045934 3300009177 Bacteria 4897
541 Ga0105248_10523449 3300009177 Unclassified 1337
542 Ga0105248_10752253 3300009177 Bacteria 1100
543 Ga0105248_10868549 3300009177 Bacteria 1018
544 Ga0105248_10913093 3300009177 Bacteria 992
545 Ga0105248_11143686 3300009177 Bacteria 880
546 Ga0105237_10053556 3300009545 Bacteria 4046
547 Ga0105237_10424321 3300009545 Bacteria 1335
548 Ga0105237_11500405 3300009545 Bacteria 681
549 Ga0105238_10022048 3300009551 Bacteria 6492
550 Ga0105238_10337223 3300009551 Bacteria 1495
551 Ga0105238_10368876 3300009551 Bacteria 1426
552 Ga0105238_10377674 3300009551 Bacteria 1408
553 Ga0105238_11062898 3300009551 Bacteria 831
554 Ga0105238_12171292 3300009551 Bacteria 590
555 Ga0105249_10019358 3300009553 Bacteria 6072
556 Ga0105249_10112581 3300009553 Bacteria 2574
557 Ga0105249_10254474 3300009553 Bacteria 1742
558 Ga0105249_10618041 3300009553 Bacteria 1139
559 Ga0105249_11072764 3300009553 Bacteria 875
560 Ga0105249_11711385 3300009553 Bacteria 701
561 Ga0105249_11843250 3300009553 Bacteria 678
562 Ga0105030_110738 3300009987 Bacteria 789
563 Ga0105239_10040773 3300010375 Bacteria 5087
564 Ga0105239_10061619 3300010375 Bacteria 4117
565 Ga0105239_10073297 3300010375 Bacteria 3764
566 Ga0105239_10095144 3300010375 Bacteria 3291
567 Ga0105239_10550067 3300010375 Bacteria 1314
568 Ga0105239_10630896 3300010375 Bacteria 1223
569 Ga0105239_10941223 3300010375 Bacteria 992
570 Ga0105239_12949968 3300010375 Unclassified 555
571 Ga0105246_10004161 3300011119 Bacteria 8793
572 Ga0105246_10022665 3300011119 Bacteria 4055
573 Ga0105246_10042946 3300011119 Bacteria 3064
574 Ga0105246_10116600 3300011119 Bacteria 1972
575 Ga0105246_10128482 3300011119 Bacteria 1889
576 Ga0105246_10319343 3300011119 Bacteria 1261
577 Ga0105246_10324430 3300011119 Bacteria 1253
578 Ga0105246_10417988 3300011119 Bacteria 1118
579 Ga0105246_10553326 3300011119 Bacteria 986
580 Ga0105246_10871806 3300011119 Unclassified 805
581 Ga0105246_11057693 3300011119 Bacteria 738
582 Ga0105246_11236398 3300011119 Bacteria 689
583 Ga0157322_1036125 3300012490 Bacteria 549
584 Ga0157313_1013634 3300012503 Bacteria 740
585 Ga0157324_1015704 3300012506 Bacteria 712
586 Ga0157373_10074264 3300013100 Unclassified 2399
587 Ga0157373_10658848 3300013100 Bacteria 765
588 Ga0157373_10863033 3300013100 Bacteria 670
589 Ga0157371_10003237 3300013102 Bacteria 14944
590 Ga0157371_10182684 3300013102 Bacteria 1500
591 Ga0157371_10373942 3300013102 Bacteria 1040
592 Ga0157371_10696651 3300013102 Bacteria 760
593 Ga0157371_10721469 3300013102 Bacteria 747
594 Ga0157370_10123060 3300013104 Bacteria 2422
595 Ga0157370_10965341 3300013104 Bacteria 772
596 Ga0157369_11533620 3300013105 Bacteria 678
597 Ga0157369_11782301 3300013105 Unclassified 625
598 Ga0157374_10059544 3300013296 Bacteria 3571
599 Ga0157374_10346258 3300013296 Bacteria 1476
600 Ga0157374_12645259 3300013296 Bacteria 529
601 Ga0157378_10011528 3300013297 Bacteria 7739
602 Ga0157378_10049175 3300013297 Bacteria 3751
603 Ga0157378_10590266 3300013297 Bacteria 1121
604 Ga0157378_10865412 3300013297 Bacteria 933
605 Ga0157378_11147329 3300013297 Unclassified 815
606 Ga0157378_11454375 3300013297 Bacteria 729
607 Ga0157378_12521010 3300013297 Bacteria 566
608 Ga0163162_10028626 3300013306 Bacteria 5514
609 Ga0163162_10136725 3300013306 Bacteria 2562
610 Ga0163162_10350658 3300013306 Bacteria 1609
611 Ga0163162_10815397 3300013306 Bacteria 1050
612 Ga0163162_11559461 3300013306 Unclassified 753
613 Ga0163162_12330449 3300013306 Bacteria 615
614 Ga0157372_10008369 3300013307 Bacteria 10997
615 Ga0157372_10394584 3300013307 Bacteria 1613
616 Ga0157372_10651077 3300013307 Bacteria 1227
617 Ga0157372_11239548 3300013307 Bacteria 861
618 Ga0157372_11275511 3300013307 Bacteria 848
619 Ga0157372_12677215 3300013307 Bacteria 572
620 Ga0157375_10012667 3300013308 Bacteria 7485
621 Ga0157375_10023843 3300013308 Bacteria 5653
622 Ga0157375_10028457 3300013308 Bacteria 5238
623 Ga0157375_10043940 3300013308 Bacteria 4336
624 Ga0157375_10049906 3300013308 Bacteria 4102
625 Ga0157375_10064424 3300013308 Bacteria 3649
626 Ga0157375_10117670 3300013308 Bacteria 2763
627 Ga0157375_10423698 3300013308 Bacteria 1497
628 Ga0157375_10430803 3300013308 Bacteria 1485
629 Ga0157375_11189805 3300013308 Bacteria 894
630 Ga0157375_11280285 3300013308 Bacteria 861
631 Ga0163163_10052644 3300014325 Bacteria 4017
632 Ga0163163_10216277 3300014325 Bacteria 1965
633 Ga0163163_10259255 3300014325 Bacteria 1789
634 Ga0163163_10293576 3300014325 Unclassified 1678
635 Ga0163163_10889711 3300014325 Bacteria 954
636 Ga0163163_11042362 3300014325 Bacteria 881
637 Ga0163163_11517716 3300014325 Bacteria 731
638 Ga0163163_11983933 3300014325 Unclassified 642
639 Ga0157380_10031445 3300014326 Bacteria 4075
640 Ga0157380_10044826 3300014326 Bacteria 3468
641 Ga0157380_10045856 3300014326 Bacteria 3433
642 Ga0157380_10088507 3300014326 Bacteria 2548
643 Ga0157380_10118482 3300014326 Bacteria 2238
644 Ga0157380_10541352 3300014326 Bacteria 1140
645 Ga0157380_10685253 3300014326 Bacteria 1028
646 Ga0157380_11583899 3300014326 Bacteria 710
647 Ga0157380_12390040 3300014326 Bacteria 594
648 Ga0157380_12857561 3300014326 Bacteria 549
649 Ga0157377_10005311 3300014745 Bacteria 6043
650 Ga0157377_10010385 3300014745 Bacteria 4604
651 Ga0157377_10021987 3300014745 Bacteria 3363
652 Ga0157377_10074303 3300014745 Bacteria 1972
653 Ga0157377_10155151 3300014745 Bacteria 1419
654 Ga0157377_10290880 3300014745 Bacteria 1074
655 Ga0157377_10367977 3300014745 Bacteria 970
656 Ga0157377_10958061 3300014745 Bacteria 644
657 Ga0157379_10216341 3300014968 Bacteria 1735
658 Ga0157379_10630421 3300014968 Bacteria 1002
659 Ga0157379_10994500 3300014968 Unclassified 799
660 Ga0157379_11793521 3300014968 Bacteria 603
661 Ga0157376_10007465 3300014969 Bacteria 7807
662 Ga0157376_10026686 3300014969 Bacteria 4567
663 Ga0157376_10134689 3300014969 Bacteria 2209
664 Ga0157376_10316018 3300014969 Bacteria 1483
665 Ga0157376_10832664 3300014969 Bacteria 937
666 Ga0157376_11302972 3300014969 Bacteria 756
667 Ga0157376_12777490 3300014969 Unclassified 529
668 Ga0163161_10141290 3300017792 Bacteria 1823
669 Ga0163161_10187100 3300017792 Bacteria 1590
670 Ga0163161_10294954 3300017792 Bacteria 1275
671 Ga0163161_10906087 3300017792 Bacteria 747
672 Ga0163161_11037735 3300017792 Unclassified 702
673 Ga0163161_11167827 3300017792 Bacteria 664
674 Ga0163161_11615187 3300017792 Bacteria 572
675 Ga0197907_10819896 3300020069 Bacteria 1084
676 Ga0206356_10492736 3300020070 Bacteria 1880
677 Ga0206354_10240647 3300020081 Bacteria 1787
678 Ga0206353_11564503 3300020082 Bacteria 642
679 Ga0206353_11939242 3300020082 Bacteria 1264
680 Ga0224712_10186629 3300022467 Bacteria 937
681 Ga0207697_10313437 3300025315 Unclassified 696
682 Ga0207653_10024307 3300025885 Bacteria 1933
683 Ga0207653_10159217 3300025885 Bacteria 835
684 Ga0207682_10287375 3300025893 Bacteria 770
685 Ga0207682_10485370 3300025893 Bacteria 585
686 Ga0207692_10120397 3300025898 Bacteria 1469
687 Ga0207692_10478755 3300025898 Bacteria 787
688 Ga0207692_10595949 3300025898 Bacteria 710
689 Ga0207642_10002284 3300025899 Bacteria 5971
690 Ga0207642_10041407 3300025899 Unclassified 2016
691 Ga0207642_10280131 3300025899 Bacteria 959
692 Ga0207642_10420466 3300025899 Unclassified 804
693 Ga0207642_10476017 3300025899 Bacteria 761
694 Ga0207710_10011778 3300025900 Bacteria 3678
695 Ga0207688_10004625 3300025901 Bacteria 7501
696 Ga0207688_10036367 3300025901 Bacteria 2729
697 Ga0207688_10082129 3300025901 Bacteria 1841
698 Ga0207688_10138723 3300025901 Unclassified 1430
699 Ga0207688_10210054 3300025901 Bacteria 1169
700 Ga0207680_10117944 3300025903 Bacteria 1732
701 Ga0207680_10121380 3300025903 Bacteria 1709
702 Ga0207680_10294909 3300025903 Bacteria 1129
703 Ga0207647_10118869 3300025904 Bacteria 1559
704 Ga0207647_10358296 3300025904 Bacteria 825
705 Ga0207685_10051713 3300025905 Bacteria 1588
706 Ga0207699_10194661 3300025906 Bacteria 1370
707 Ga0207645_10091719 3300025907 Archaea 1954
708 Ga0207645_10194195 3300025907 Bacteria 1334
709 Ga0207643_10006654 3300025908 Bacteria 6197
710 Ga0207643_10015663 3300025908 Bacteria 4129
711 Ga0207643_10158217 3300025908 Bacteria 1362
712 Ga0207643_10212126 3300025908 Bacteria 1182
713 Ga0207643_10830939 3300025908 Bacteria 599
714 Ga0207705_10184648 3300025909 Bacteria 1575
715 Ga0207705_10766480 3300025909 Bacteria 749
716 Ga0207684_10003747 3300025910 Bacteria 14694
717 Ga0207684_10511654 3300025910 Bacteria 1029
718 Ga0207684_10589783 3300025910 Bacteria 950
719 Ga0207684_10783191 3300025910 Bacteria 807
720 Ga0207684_10927556 3300025910 Bacteria 731
721 Ga0207654_10950918 3300025911 Bacteria 624
722 Ga0207707_10061685 3300025912 Bacteria 3263
723 Ga0207707_10261499 3300025912 Unclassified 1502
724 Ga0207707_10921784 3300025912 Bacteria 721
725 Ga0207671_10164000 3300025914 Bacteria 1722
726 Ga0207671_10202555 3300025914 Bacteria 1550
727 Ga0207671_10643754 3300025914 Bacteria 844
728 Ga0207693_10001049 3300025915 Bacteria 24711
729 Ga0207693_10033187 3300025915 Bacteria 4074
730 Ga0207693_10462767 3300025915 Bacteria 991
731 Ga0207663_10110772 3300025916 Bacteria 1862
732 Ga0207663_11239423 3300025916 Bacteria 601
733 Ga0207660_10218270 3300025917 Bacteria 1496
734 Ga0207660_10252878 3300025917 Bacteria 1391
735 Ga0207660_10535079 3300025917 Bacteria 952
736 Ga0207662_10007345 3300025918 Bacteria 5996
737 Ga0207662_10026650 3300025918 Bacteria 3334
738 Ga0207662_10076125 3300025918 Bacteria 2039
739 Ga0207662_10163016 3300025918 Bacteria 1425
740 Ga0207657_10005734 3300025919 Bacteria 12955
741 Ga0207657_10125198 3300025919 Bacteria 2111
742 Ga0207657_10143227 3300025919 Unclassified 1951
743 Ga0207657_10155186 3300025919 Unclassified 1862
744 Ga0207657_10370995 3300025919 Unclassified 1128
745 Ga0207649_10023736 3300025920 Bacteria 3555
746 Ga0207649_10058793 3300025920 Bacteria 2409
747 Ga0207649_11148579 3300025920 Unclassified 613
748 Ga0207649_11652916 3300025920 Bacteria 507
749 Ga0207652_10014907 3300025921 Bacteria 6302
750 Ga0207652_10190678 3300025921 Bacteria 1844
751 Ga0207646_10002084 3300025922 Bacteria 24000
752 Ga0207646_10106219 3300025922 Bacteria 2518
753 Ga0207646_10860160 3300025922 Bacteria 806
754 Ga0207646_10878439 3300025922 Bacteria 796
755 Ga0207681_10569950 3300025923 Bacteria 933
756 Ga0207681_11192999 3300025923 Bacteria 639
757 Ga0207681_11313569 3300025923 Bacteria 607
758 Ga0207694_10033429 3300025924 Bacteria 3940
759 Ga0207694_10236562 3300025924 Bacteria 1492
760 Ga0207694_10616994 3300025924 Bacteria 913
761 Ga0207650_10027425 3300025925 Bacteria 4077
762 Ga0207650_10512245 3300025925 Bacteria 1003
763 Ga0207650_11120141 3300025925 Bacteria 670
764 Ga0207650_11653268 3300025925 Bacteria 543
765 Ga0207650_11697645 3300025925 Bacteria 535
766 Ga0207659_10125186 3300025926 Bacteria 1975
767 Ga0207659_10185936 3300025926 Bacteria 1650
768 Ga0207659_10203621 3300025926 Bacteria 1582
769 Ga0207659_10725789 3300025926 Bacteria 851
770 Ga0207659_11240047 3300025926 Bacteria 641
771 Ga0207659_11454286 3300025926 Bacteria 587
772 Ga0207687_10061086 3300025927 Bacteria 2660
773 Ga0207687_10082800 3300025927 Bacteria 2322
774 Ga0207687_10084108 3300025927 Bacteria 2306
775 Ga0207687_10127390 3300025927 Bacteria 1914
776 Ga0207687_10194515 3300025927 Bacteria 1581
777 Ga0207687_10588203 3300025927 Bacteria 937
778 Ga0207687_10656036 3300025927 Bacteria 888
779 Ga0207687_10883157 3300025927 Archaea 765
780 Ga0207687_11181756 3300025927 Bacteria 657
781 Ga0207687_11446366 3300025927 Unclassified 591
782 Ga0207644_10076517 3300025931 Bacteria 2462
783 Ga0207644_10113490 3300025931 Unclassified 2052
784 Ga0207644_10303626 3300025931 Bacteria 1287
785 Ga0207644_11371718 3300025931 Bacteria 594
786 Ga0207690_10036657 3300025932 Bacteria 3177
787 Ga0207690_10047809 3300025932 Bacteria 2841
788 Ga0207690_10553397 3300025932 Bacteria 935
789 Ga0207690_11117598 3300025932 Unclassified 657
790 Ga0207706_10029290 3300025933 Bacteria 4916
791 Ga0207706_10083534 3300025933 Unclassified 2808
792 Ga0207706_10253951 3300025933 Bacteria 1535
793 Ga0207706_10965514 3300025933 Bacteria 717
794 Ga0207706_11266353 3300025933 Bacteria 610
795 Ga0207686_10018659 3300025934 Bacteria 3929
796 Ga0207686_10067059 3300025934 Bacteria 2294
797 Ga0207686_10074148 3300025934 Bacteria 2198
798 Ga0207686_10279194 3300025934 Bacteria 1232
799 Ga0207686_10306238 3300025934 Bacteria 1182
800 Ga0207686_11017245 3300025934 Unclassified 673
801 Ga0207709_10002279 3300025935 Bacteria 12176
802 Ga0207709_10005971 3300025935 Bacteria 6868
803 Ga0207709_10073974 3300025935 Bacteria 2173
804 Ga0207709_10080848 3300025935 Bacteria 2094
805 Ga0207709_10105143 3300025935 Bacteria 1875
806 Ga0207709_10300259 3300025935 Bacteria 1194
807 Ga0207709_10351343 3300025935 Bacteria 1113
808 Ga0207709_10407980 3300025935 Bacteria 1040
809 Ga0207709_10821738 3300025935 Bacteria 751
810 Ga0207709_11690015 3300025935 Unclassified 526
811 Ga0207670_10069263 3300025936 Bacteria 2433
812 Ga0207670_10482394 3300025936 Bacteria 1004
813 Ga0207670_11230475 3300025936 Bacteria 634
814 Ga0207669_10005001 3300025937 Bacteria 5897
815 Ga0207669_10145651 3300025937 Bacteria 1651
816 Ga0207669_10147643 3300025937 Bacteria 1642
817 Ga0207669_10163500 3300025937 Bacteria 1575
818 Ga0207669_10171463 3300025937 Bacteria 1545
819 Ga0207669_10230351 3300025937 Bacteria 1366
820 Ga0207669_10771895 3300025937 Unclassified 795
821 Ga0207669_11264158 3300025937 Bacteria 626
822 Ga0207669_11792750 3300025937 Bacteria 524
823 Ga0207704_10037206 3300025938 Bacteria 2810
824 Ga0207704_10115558 3300025938 Bacteria 1824
825 Ga0207704_10160711 3300025938 Bacteria 1598
826 Ga0207704_10302720 3300025938 Bacteria 1225
827 Ga0207704_10321134 3300025938 Bacteria 1194
828 Ga0207704_10396629 3300025938 Bacteria 1087
829 Ga0207704_10411941 3300025938 Bacteria 1069
830 Ga0207704_10986741 3300025938 Bacteria 712
831 Ga0207704_11011654 3300025938 Bacteria 703
832 Ga0207704_11490942 3300025938 Bacteria 580
833 Ga0207665_11166650 3300025939 Unclassified 614
834 Ga0207691_10006369 3300025940 Bacteria 11405
835 Ga0207691_10010651 3300025940 Bacteria 8824
836 Ga0207691_10089027 3300025940 Bacteria 2768
837 Ga0207691_10105454 3300025940 Bacteria 2511
838 Ga0207691_10158656 3300025940 Bacteria 1986
839 Ga0207691_10171134 3300025940 Bacteria 1902
840 Ga0207711_10048602 3300025941 Bacteria 3629
841 Ga0207711_10148242 3300025941 Bacteria 2115
842 Ga0207711_10931916 3300025941 Bacteria 807
843 Ga0207711_11039159 3300025941 Bacteria 759
844 Ga0207711_11612532 3300025941 Bacteria 592
845 Ga0207689_10029711 3300025942 Bacteria 4560
846 Ga0207689_10046032 3300025942 Bacteria 3607
847 Ga0207689_10143327 3300025942 Bacteria 1969
848 Ga0207689_10458659 3300025942 Bacteria 1066
849 Ga0207689_10620642 3300025942 Bacteria 910
850 Ga0207661_10008635 3300025944 Bacteria 7280
851 Ga0207661_10046214 3300025944 Bacteria 3452
852 Ga0207661_10074976 3300025944 Bacteria 2774
853 Ga0207661_10147981 3300025944 Bacteria 2028
854 Ga0207661_10168050 3300025944 Unclassified 1907
855 Ga0207661_10309104 3300025944 Bacteria 1419
856 Ga0207661_10734066 3300025944 Bacteria 909
857 Ga0207661_10972888 3300025944 Bacteria 782
858 Ga0207661_11540302 3300025944 Bacteria 609
859 Ga0207661_11715096 3300025944 Bacteria 573
860 Ga0207679_10122622 3300025945 Bacteria 2072
861 Ga0207679_10317269 3300025945 Bacteria 1348
862 Ga0207679_10713477 3300025945 Bacteria 911
863 Ga0207679_11142184 3300025945 Bacteria 715
864 Ga0207667_10073767 3300025949 Bacteria 3545
865 Ga0207667_10801378 3300025949 Bacteria 939
866 Ga0207667_11837225 3300025949 Bacteria 569
867 Ga0207651_10013495 3300025960 Bacteria 4677
868 Ga0207651_10051927 3300025960 Bacteria 2793
869 Ga0207651_10065590 3300025960 Unclassified 2547
870 Ga0207651_10335363 3300025960 Bacteria 1269
871 Ga0207651_10529899 3300025960 Bacteria 1022
872 Ga0207651_10677728 3300025960 Bacteria 907
873 Ga0207651_10789893 3300025960 Bacteria 841
874 Ga0207712_10017012 3300025961 Bacteria 4718
875 Ga0207712_10086834 3300025961 Bacteria 2292
876 Ga0207712_11198873 3300025961 Unclassified 677
877 Ga0207712_12111238 3300025961 Unclassified 504
878 Ga0207668_10150862 3300025972 Bacteria 1799
879 Ga0207668_10241453 3300025972 Bacteria 1462
880 Ga0207668_10665446 3300025972 Bacteria 912
881 Ga0207668_10790578 3300025972 Bacteria 839
882 Ga0207668_11352817 3300025972 Bacteria 641
883 Ga0207640_10060700 3300025981 Bacteria 2500
884 Ga0207640_10511279 3300025981 Bacteria 1002
885 Ga0207640_11673716 3300025981 Bacteria 574
886 Ga0207658_10423210 3300025986 Bacteria 1175
887 Ga0207677_10032872 3300026023 Bacteria 3339
888 Ga0207677_10068599 3300026023 Bacteria 2490
889 Ga0207677_10146194 3300026023 Bacteria 1817
890 Ga0207677_10236874 3300026023 Bacteria 1474
891 Ga0207677_10749657 3300026023 Bacteria 870
892 Ga0207677_11215515 3300026023 Bacteria 690
893 Ga0207677_11512395 3300026023 Bacteria 620
894 Ga0207677_11839284 3300026023 Bacteria 562
895 Ga0207677_12077461 3300026023 Bacteria 528
896 Ga0207703_10073898 3300026035 Bacteria 2821
897 Ga0207703_11917104 3300026035 Bacteria 569
898 Ga0207639_10036381 3300026041 Bacteria 3648
899 Ga0207639_10133405 3300026041 Unclassified 2059
900 Ga0207639_10771859 3300026041 Bacteria 895
901 Ga0207678_10040965 3300026067 Bacteria 4016
902 Ga0207678_10095360 3300026067 Unclassified 2543
903 Ga0207678_10209360 3300026067 Bacteria 1668
904 Ga0207678_10642799 3300026067 Bacteria 932
905 Ga0207678_12020859 3300026067 Bacteria 501
906 Ga0207708_10001945 3300026075 Bacteria 15228
907 Ga0207708_10012405 3300026075 Bacteria 6351
908 Ga0207708_10048411 3300026075 Bacteria 3236
909 Ga0207708_10105419 3300026075 Bacteria 2185
910 Ga0207708_10472967 3300026075 Bacteria 1047
911 Ga0207702_10155856 3300026078 Bacteria 2082
912 Ga0207702_12116570 3300026078 Bacteria 552
913 Ga0207641_10935159 3300026088 Bacteria 862
914 Ga0207641_11011420 3300026088 Unclassified 828
915 Ga0207641_11076338 3300026088 Bacteria 802
916 Ga0207648_10000729 3300026089 Bacteria 36820
917 Ga0207648_10116194 3300026089 Bacteria 2351
918 Ga0207648_10161256 3300026089 Bacteria 1980
919 Ga0207648_10411946 3300026089 Bacteria 1226
920 Ga0207648_10479189 3300026089 Bacteria 1136
921 Ga0207648_10668808 3300026089 Bacteria 961
922 Ga0207648_11361990 3300026089 Unclassified 667
923 Ga0207648_12141692 3300026089 Unclassified 520
924 Ga0207676_10038407 3300026095 Bacteria 3654
925 Ga0207676_10441727 3300026095 Bacteria 1225
926 Ga0207676_10638541 3300026095 Bacteria 1026
927 Ga0207676_10752460 3300026095 Bacteria 948
928 Ga0207676_10980317 3300026095 Bacteria 832
929 Ga0207676_11041551 3300026095 Bacteria 807
930 Ga0207676_11635092 3300026095 Bacteria 642
931 Ga0207674_10110289 3300026116 Bacteria 2727
932 Ga0207674_10144951 3300026116 Bacteria 2333
933 Ga0207674_10192944 3300026116 Bacteria 1987
934 Ga0207674_10432277 3300026116 Bacteria 1272
935 Ga0207674_10671347 3300026116 Bacteria 1001
936 Ga0207674_10731466 3300026116 Bacteria 955
937 Ga0207675_100034654 3300026118 Bacteria 4708
938 Ga0207675_100036337 3300026118 Bacteria 4596
939 Ga0207675_100226366 3300026118 Bacteria 1803
940 Ga0207675_100265151 3300026118 Unclassified 1666
941 Ga0207675_100483750 3300026118 Bacteria 1231
942 Ga0207675_100876561 3300026118 Unclassified 913
943 Ga0207675_101306771 3300026118 Bacteria 746
944 Ga0207683_10000371 3300026121 Bacteria 41225
945 Ga0207683_10003740 3300026121 Bacteria 13203
946 Ga0207683_10034751 3300026121 Bacteria 4382
947 Ga0207683_10110959 3300026121 Bacteria 2456
948 Ga0207683_10115021 3300026121 Bacteria 2411
949 Ga0207683_10142240 3300026121 Bacteria 2162
950 Ga0207683_10323703 3300026121 Bacteria 1412
951 Ga0207683_10845016 3300026121 Bacteria 850
952 Ga0207683_11113357 3300026121 Bacteria 732
953 Ga0207683_11125968 3300026121 Bacteria 728
954 Ga0207683_11165778 3300026121 Bacteria 714
955 Ga0207683_11514111 3300026121 Bacteria 619
956 Ga0207698_10018342 3300026142 Bacteria 4766
957 Ga0207698_11044906 3300026142 Bacteria 828
958 Ga0207698_11426113 3300026142 Bacteria 708
959 Ga0207698_12493590 3300026142 Unclassified 527
960 Ga0209996_1059407 3300027395 Bacteria 586
961 Ga0209970_1018370 3300027614 Bacteria 1174
962 Ga0209983_1139798 3300027665 Bacteria 554
963 Ga0209966_1074024 3300027695 Bacteria 749
964 Ga0207428_10000281 3300027907 Bacteria 68694
965 Ga0207428_10036308 3300027907 Bacteria 4021
966 Ga0207428_10123837 3300027907 Unclassified 1981
967 Ga0207428_10137240 3300027907 Viruses 1869
968 Ga0207428_10151321 3300027907 Bacteria 1766
969 Ga0207428_10153859 3300027907 Bacteria 1750
970 Ga0207428_10734482 3300027907 Bacteria 704
971 Ga0207428_10842118 3300027907 Bacteria 650
972 Ga0268266_10083927 3300028379 Bacteria 2781
973 Ga0268266_10084202 3300028379 Bacteria 2777
974 Ga0268266_10088543 3300028379 Bacteria 2709
975 Ga0268266_10302514 3300028379 Bacteria 1492
976 Ga0268266_11319796 3300028379 Bacteria 697
977 Ga0268265_10627911 3300028380 Bacteria 1030
978 Ga0268265_10944260 3300028380 Unclassified 849
979 Ga0268265_12318961 3300028380 Unclassified 543
980 Ga0268264_10249503 3300028381 Bacteria 1648
981 Ga0268264_10939491 3300028381 Bacteria 869
982 Ga0268264_11170057 3300028381 Bacteria 778
983 Ga0307408_100211308 3300031548 Bacteria 1577
984 Ga0307408_100329000 3300031548 Bacteria 1290
985 Ga0307405_11357082 3300031731 Bacteria 620
986 Ga0307413_10973168 3300031824 Unclassified 725
987 Ga0307413_11804671 3300031824 Bacteria 547
988 Ga0307410_10273843 3300031852 Bacteria 1321
989 Ga0307406_10419448 3300031901 Bacteria 1066
990 Ga0307406_10494230 3300031901 Unclassified 991
991 Ga0307406_10511425 3300031901 Bacteria 975
992 Ga0307407_10218963 3300031903 Bacteria 1286
993 Ga0307407_11339629 3300031903 Unclassified 562
994 Ga0307412_10277027 3300031911 Bacteria 1315
995 Ga0307409_100274520 3300031995 Bacteria 1554
996 Ga0307416_100002165 3300032002 Bacteria 11126
997 Ga0307416_100202071 3300032002 Bacteria 1886
998 Ga0307416_103366626 3300032002 Archaea 535
999 Ga0307414_10093969 3300032004 Bacteria 2237
1000 Ga0307411_10006254 3300032005 Bacteria 5939
1001 Ga0307411_11904928 3300032005 Bacteria 553
1002 Ga0307415_100262326 3300032126 Bacteria 1410
1003 Ga0307415_101443643 3300032126 Bacteria 656
1004 Ga0307415_102336213 3300032126 Bacteria 525
1005 Ga0373948_0075426 3300034817 Bacteria 762
1006 Ga0373958_0117564 3300034819 Bacteria 639
1007 Ga0373959_0009124 3300034820 Bacteria 1704
1008 Ga0373959_0189772 3300034820 Bacteria 538
1009 Ga0373938_0254501 3300034957 Bacteria 503
1010 Ga0373940_0083358 3300035088 Bacteria 949
1011 Ga0373944_0072385 3300035089 Bacteria 1125
1012 Ga0373951_0083106 3300035091 Bacteria 831
1013 Ga0373952_0054182 3300035092 Bacteria 964
1014 Ga0373932_0016563 3300035112 Bacteria 1883
1015 Ga0373939_0094004 3300035114 Bacteria 1018
1016 Ga0373941_0059146 3300035115 Bacteria 1242
1017 Ga0373945_0317780 3300035116 Bacteria 670
1018 Ga0373960_0181143 3300035121 Bacteria 735
1019 Ga0373960_0201523 3300035121 Bacteria 704
1020 Ga0373960_0281106 3300035121 Unclassified 613
1021 Ga0373943_0154117 3300035170 Bacteria 1247
1022 Ga0373946_0269478 3300035171 Bacteria 835
1023 Ga0373946_0478711 3300035171 Bacteria 636
1024 Ga0373942_0077560 3300035207 Bacteria 981
1025 Ga0373961_0058706 3300035241 Bacteria 1161
1026 Ga0373962_0018881 3300035242 Bacteria 1799
1027 Ga0373962_0146758 3300035242 Bacteria 770
1028 Ga0373924_0245885 3300035410 Bacteria 792
1029 Ga0373931_0117198 3300035691 Bacteria 1518
1030 Ga0373931_0121665 3300035691 Bacteria 1492
1031 Ga0373935_0454210 3300035692 Bacteria 926
1032 Ga0373935_0628699 3300035692 Bacteria 786
1033 Ga0373947_0447185 3300035725 Bacteria 875
1034 Ga0373947_0727323 3300035725 Bacteria 677
1035 Ga0373925_0787965 3300037068 Bacteria 784
1036 Ga0395899_0022531 3300037312 Bacteria 4774
1037 Ga0395899_0033165 3300037312 Bacteria 3878
1038 Ga0395899_0038343 3300037312 Bacteria 3589
1039 Ga0395899_0088914 3300037312 Bacteria 2241
1040 Ga0395899_0099786 3300037312 Bacteria 2097
1041 Ga0395899_0190534 3300037312 Bacteria 1435
1042 Ga0395899_0254580 3300037312 Bacteria 1203
1043 Ga0395899_0645185 3300037312 Bacteria 669
1044 Ga0395900_0000988 3300037418 Bacteria 36988
1045 Ga0395900_0002063 3300037418 Bacteria 22548
1046 Ga0395900_0005985 3300037418 Bacteria 12701
1047 Ga0395900_0053920 3300037418 Bacteria 4139
1048 Ga0395900_0057355 3300037418 Bacteria 4009
1049 Ga0395900_0080628 3300037418 Bacteria 3344
1050 Ga0395900_0088912 3300037418 Bacteria 3175
1051 Ga0395900_0113594 3300037418 Bacteria 2779
1052 Ga0395900_0144113 3300037418 Bacteria 2437
1053 Ga0395900_0389205 3300037418 Bacteria 1360
1054 Ga0395900_0612616 3300037418 Bacteria 1028
1055 Ga0395900_0637948 3300037418 Bacteria 1003
1056 Ga0395900_1090026 3300037418 Bacteria 716
1057 Ga0395900_1498205 3300037418 Unclassified 587
1058 Ga0395898_0002378 3300037466 Bacteria 22342
1059 Ga0395898_0008324 3300037466 Bacteria 10965
1060 Ga0395898_0013193 3300037466 Bacteria 8512
1061 Ga0395898_0013852 3300037466 Bacteria 8287
1062 Ga0395898_0017918 3300037466 Bacteria 7225
1063 Ga0395898_0032460 3300037466 Bacteria 5212
1064 Ga0395898_0035150 3300037466 Bacteria 4987
1065 Ga0395898_0106469 3300037466 Bacteria 2689
1066 Ga0395898_0409112 3300037466 Bacteria 1293
1067 Ga0395898_0478844 3300037466 Unclassified 1184
1068 Ga0395898_0619327 3300037466 Bacteria 1025
1069 Ga0395898_0640903 3300037466 Bacteria 1005
1070 Ga0395898_0743063 3300037466 Bacteria 922
1071 Ga0395898_0938463 3300037466 Bacteria 803
1072 Ga0395898_1360257 3300037466 Bacteria 638
1073 Ga0395905_0002715 3300037471 Bacteria 19391
1074 Ga0395905_0003035 3300037471 Bacteria 18184
1075 Ga0395905_0007299 3300037471 Bacteria 11015
1076 Ga0395905_0059256 3300037471 Bacteria 3579
1077 Ga0395905_0082063 3300037471 Bacteria 3021
1078 Ga0395905_0097845 3300037471 Bacteria 2755
1079 Ga0395905_0117956 3300037471 Bacteria 2494
1080 Ga0395905_0121054 3300037471 Bacteria 2460
1081 Ga0395905_0299902 3300037471 Bacteria 1494
1082 Ga0395905_0301623 3300037471 Bacteria 1489
1083 Ga0395905_0472511 3300037471 Bacteria 1153
1084 Ga0395905_0780304 3300037471 Bacteria 858
1085 Ga0395905_1033072 3300037471 Unclassified 725
1086 Ga0395905_1047519 3300037471 Unclassified 719
1087 Ga0395901_0001046 3300038443 Bacteria 29844
1088 Ga0395901_0001699 3300038443 Bacteria 22721
1089 Ga0395901_0003426 3300038443 Bacteria 15984
1090 Ga0395901_0010485 3300038443 Bacteria 9386
1091 Ga0395901_0018396 3300038443 Bacteria 7131
1092 Ga0395901_0018546 3300038443 Bacteria 7104
1093 Ga0395901_0042124 3300038443 Bacteria 4733
1094 Ga0395901_0093900 3300038443 Bacteria 3142
1095 Ga0395901_0123365 3300038443 Bacteria 2722
1096 Ga0395901_0148878 3300038443 Bacteria 2460
1097 Ga0395901_0233990 3300038443 Bacteria 1918
1098 Ga0395901_0244233 3300038443 Unclassified 1872
1099 Ga0395901_0255087 3300038443 Bacteria 1826
1100 Ga0395901_0518308 3300038443 Bacteria 1211
1101 Ga0395901_2156164 3300038443 Unclassified 502
1102 Ga0242420_040922 3300038996 Bacteria 885
1103 Ga0439438_050472 3300041405 Bacteria 1059
1104 Ga0439438_067681 3300041405 Bacteria 887
1105 Ga0439439_0007490 3300041406 Bacteria 2556
1106 Ga0439447_057347 3300041407 Bacteria 921
1107 Ga0439453_0008494 3300041408 Bacteria 1652
1108 Ga0439453_0016934 3300041408 Bacteria 1275
1109 Ga0439461_0009675 3300041410 Bacteria 1753
1110 Ga0439461_0034553 3300041410 Bacteria 1068
1111 Ga0439461_0099152 3300041410 Unclassified 707
1112 Ga0439461_0181543 3300041410 Bacteria 558
1113 Ga0439466_0017305 3300041411 Bacteria 2598
1114 Ga0439466_0093021 3300041411 Bacteria 944
1115 Ga0451787_779493 3300041441 Bacteria 543
1116 Ga0451791_0313989 3300041451 Unclassified 609
1117 Ga0451798_1038471 3300041458 Bacteria 519
1118 Ga0451804_0468228 3300041463 Bacteria 558
1119 Ga0451807_1707017 3300041486 Bacteria 862
1120 Ga0451807_2106395 3300041486 Bacteria 551
1121 Ga0451807_2349782 3300041486 Bacteria 1163
1122 Ga0451845_0055735 3300041501 Bacteria 569
1123 Ga0451845_0678149 3300041501 Bacteria 557
1124 Ga0451851_0221635 3300041507 Bacteria 566
1125 Ga0451851_0813741 3300041507 Bacteria 771
1126 Ga0451853_1211212 3300041512 Bacteria 555
1127 Ga0451853_1978009 3300041512 Unclassified 979
1128 Ga0451853_3554456 3300041512 Bacteria 1190
1129 Ga0439431_0056367 3300041997 Bacteria 1027
1130 Ga0439431_0059363 3300041997 Bacteria 1004
1131 Ga0439433_0022736 3300041999 Bacteria 1408
1132 Ga0439441_001131 3300042001 Bacteria 3345
1133 Ga0439442_008538 3300042002 Bacteria 2067
1134 Ga0439445_0050291 3300042004 Bacteria 1124
1135 Ga0439448_0091428 3300042005 Bacteria 1029
1136 Ga0439448_0265233 3300042005 Bacteria 607
1137 Ga0439432_116182 3300042006 Bacteria 794
1138 Ga0439449_0104827 3300042007 Bacteria 1046
1139 Ga0439449_0284230 3300042007 Bacteria 624
1140 Ga0439450_209476 3300042008 Bacteria 523
1141 Ga0439454_018346 3300042011 Bacteria 1008
1142 Ga0439455_0254983 3300042012 Bacteria 514
1143 Ga0439462_0170798 3300042015 Bacteria 615
1144 Ga0450917_025194 3300042120 Bacteria 548
1145 Ga0450920_014363 3300042122 Bacteria 1497
1146 Ga0450920_031056 3300042122 Bacteria 1052
1147 Ga0450920_060167 3300042122 Bacteria 767
1148 Ga0450891_006014 3300042129 Bacteria 1118
1149 Ga0450894_065904 3300042131 Bacteria 550
1150 Ga0450906_015853 3300042145 Bacteria 1368
1151 Ga0450906_027676 3300042145 Bacteria 1005
1152 Ga0450906_085820 3300042145 Bacteria 569
1153 Ga0450907_012687 3300042146 Bacteria 1403
1154 Ga0450907_013736 3300042146 Bacteria 1350
1155 Ga0450907_027345 3300042146 Bacteria 967
1156 Ga0450910_035784 3300042147 Bacteria 792
1157 Ga0439446_0001134 3300042156 Bacteria 5908
1158 Ga0439446_0012386 3300042156 Bacteria 2328
1159 Ga0439446_0022934 3300042156 Bacteria 1772
1160 Ga0439434_0008986 3300042435 Bacteria 2937
1161 Ga0439434_0024871 3300042435 Bacteria 1807
1162 Ga0439434_0040169 3300042435 Unclassified 1436
1163 Ga0439435_0053814 3300042436 Bacteria 1158
1164 Ga0439435_0102653 3300042436 Bacteria 880
1165 Ga0439435_0365965 3300042436 Unclassified 503
1166 Ga0439444_0071645 3300042437 Bacteria 743
1167 Ga0439459_0039989 3300042438 Bacteria 993
1168 Ga0439459_0174219 3300042438 Bacteria 575
1169 Ga0439460_0339529 3300042461 Bacteria 529
1170 Ga0439460_0372408 3300042461 Unclassified 505
1171 Ga0450916_006961 3300042530 Bacteria 1346
1172 Ga0450916_039231 3300042530 Bacteria 715
1173 Ga0450918_014389 3300042531 Bacteria 1375
1174 Ga0450918_108498 3300042531 Unclassified 548
1175 Ga0466968_0684648 3300044735 Bacteria 523
1176 Ga0466960_0491204 3300044901 Bacteria 718
1177 Ga0451576_1189695 3300045051 Bacteria 796
1178 Ga0451576_1770628 3300045051 Bacteria 639
1179 Ga0495617_090807 3300046452 Bacteria 997
1180 Ga0495627_175804 3300046453 Unclassified 594
1181 Ga0495603_0003598 3300046455 Bacteria 9218
1182 Ga0495603_0029698 3300046455 Bacteria 3295
1183 Ga0495603_0395392 3300046455 Bacteria 792
1184 Ga0495603_0854936 3300046455 Bacteria 518
1185 Ga0495591_076096 3300046458 Bacteria 863
1186 Ga0495629_0320215 3300046459 Bacteria 1060
1187 Ga0495629_0354558 3300046459 Bacteria 1000
1188 Ga0495641_0016694 3300046461 Bacteria 3858
1189 Ga0495641_0051667 3300046461 Bacteria 1875
1190 Ga0495650_0293912 3300046471 Bacteria 545
1191 Ga0495580_0506543 3300046472 Bacteria 805
1192 Ga0495582_0018874 3300046473 Bacteria 3771
1193 Ga0495582_0054494 3300046473 Unclassified 2205
1194 Ga0495582_0121166 3300046473 Bacteria 1474
1195 Ga0495605_0017402 3300046474 Bacteria 3872
1196 Ga0495639_0029403 3300046475 Bacteria 2439
1197 Ga0495662_0135958 3300046476 Bacteria 1209
1198 Ga0495664_0545873 3300046477 Bacteria 691
1199 Ga0495584_0138465 3300046491 Bacteria 1236
1200 Ga0495584_0299410 3300046491 Unclassified 817
1201 Ga0495584_0366049 3300046491 Bacteria 732
1202 Ga0495585_0127681 3300046492 Bacteria 1341
1203 Ga0495585_0139613 3300046492 Bacteria 1270
1204 Ga0495585_0468307 3300046492 Unclassified 601
1205 Ga0495594_0064016 3300046499 Bacteria 2038
1206 Ga0495594_0262241 3300046499 Bacteria 984
1207 Ga0495594_0403188 3300046499 Bacteria 778
1208 Ga0495594_0466877 3300046499 Bacteria 717
1209 Ga0495596_0085391 3300046500 Bacteria 1225
1210 Ga0495596_0090469 3300046500 Unclassified 1188
1211 Ga0495596_0098507 3300046500 Bacteria 1135
1212 Ga0495596_0111120 3300046500 Bacteria 1064
1213 Ga0495596_0213644 3300046500 Bacteria 749
1214 Ga0495596_0389189 3300046500 Unclassified 543
1215 Ga0495607_0353378 3300046501 Bacteria 678
1216 Ga0495607_0378449 3300046501 Bacteria 648
1217 Ga0495608_0861703 3300046511 Bacteria 532
1218 Ga0495616_0247401 3300046513 Bacteria 767
1219 Ga0495618_0634225 3300046514 Bacteria 633
1220 Ga0495620_0071375 3300046515 Bacteria 1420
1221 Ga0495630_0012009 3300046517 Bacteria 6281
1222 Ga0495630_0110219 3300046517 Bacteria 2085
1223 Ga0495630_0727134 3300046517 Bacteria 759
1224 Ga0495631_0190038 3300046518 Bacteria 879
1225 Ga0495631_0297570 3300046518 Unclassified 687
1226 Ga0495631_0315503 3300046518 Bacteria 665
1227 Ga0495637_0184951 3300046520 Bacteria 771
1228 Ga0495644_0052010 3300046523 Bacteria 1538
1229 Ga0495644_0101181 3300046523 Bacteria 1090
1230 Ga0495644_0262322 3300046523 Bacteria 672
1231 Ga0495644_0273880 3300046523 Bacteria 658
1232 Ga0495644_0346127 3300046523 Bacteria 585
1233 Ga0495644_0442032 3300046523 Unclassified 517
1234 Ga0495663_0036900 3300046525 Bacteria 1473
1235 Ga0495663_0264362 3300046525 Bacteria 613
1236 Ga0495666_0321865 3300046526 Bacteria 698
1237 Ga0495642_0034277 3300046528 Bacteria 2044
1238 Ga0495642_0037234 3300046528 Bacteria 1968
1239 Ga0495642_0554790 3300046528 Unclassified 510
1240 Ga0495654_0282489 3300046530 Bacteria 682
1241 Ga0495665_0044630 3300046531 Bacteria 2355
1242 Ga0495640_0142921 3300046533 Bacteria 1542
1243 Ga0495640_0345073 3300046533 Unclassified 920
1244 Ga0495609_0061570 3300046538 Bacteria 1658
1245 Ga0495609_0140760 3300046538 Bacteria 1030
1246 Ga0495609_0167691 3300046538 Bacteria 928
1247 Ga0495609_0364480 3300046538 Bacteria 582
1248 Ga0495621_0236033 3300046539 Bacteria 744
1249 Ga0495621_0437540 3300046539 Unclassified 558
1250 Ga0495622_0168160 3300046557 Bacteria 987
1251 Ga0495667_0256354 3300046559 Bacteria 1113
1252 Ga0495667_0371000 3300046559 Bacteria 903
1253 Ga0495656_0019782 3300046615 Bacteria 2603
1254 Ga0495656_0147414 3300046615 Bacteria 1134
1255 Ga0495656_0274774 3300046615 Bacteria 857
1256 Ga0495656_0476277 3300046615 Bacteria 660
1257 Ga0495656_0499185 3300046615 Unclassified 645
1258 Ga0495656_0792344 3300046615 Unclassified 512
1259 Ga0495656_0830679 3300046615 Bacteria 500
1260 Ga0495668_0140649 3300046616 Bacteria 1321
1261 Ga0495668_0556497 3300046616 Bacteria 633
1262 Ga0495668_0612493 3300046616 Bacteria 602
1263 Ga0495634_0187769 3300046642 Bacteria 1291
1264 Ga0495635_0105476 3300046663 Bacteria 1925
1265 Ga0495635_0182985 3300046663 Bacteria 1424
1266 Ga0495635_0649356 3300046663 Bacteria 686
1267 Ga0495659_0016908 3300046664 Unclassified 2411
1268 Ga0495659_0022431 3300046664 Bacteria 2137
1269 Ga0495661_0419653 3300046665 Bacteria 648
1270 Ga0495588_0157446 3300046674 Bacteria 1201
1271 Ga0495588_0184588 3300046674 Bacteria 1102
1272 Ga0495588_0383476 3300046674 Unclassified 738
1273 Ga0495657_0476324 3300046675 Unclassified 729
1274 Ga0495647_0132687 3300046681 Bacteria 1056
1275 Ga0495647_0319686 3300046681 Bacteria 702
1276 Ga0495647_0478649 3300046681 Bacteria 578
1277 Ga0495658_0162276 3300046683 Bacteria 1379
1278 Ga0495658_0649578 3300046683 Bacteria 676
1279 Ga0495613_0321373 3300046689 Bacteria 1068
1280 Ga0495624_0531269 3300046690 Unclassified 703
1281 Ga0495670_0660329 3300046691 Bacteria 570
1282 Ga0495589_0025438 3300046794 Bacteria 3004
1283 Ga0495589_0133469 3300046794 Unclassified 1191
1284 Ga0495589_0170355 3300046794 Bacteria 1035
1285 Ga0495589_0332904 3300046794 Bacteria 701
1286 Ga0495589_0431545 3300046794 Bacteria 604
1287 Ga0495600_0947538 3300046809 Bacteria 506
1288 Ga0495660_0211417 3300046810 Bacteria 920
1289 Ga0495660_0240265 3300046810 Bacteria 845
1290 Ga0495581_0023230 3300047315 Bacteria 3593
1291 Ga0495581_0313574 3300047315 Bacteria 916
1292 Ga0495636_0133745 3300047318 Bacteria 1104
1293 Ga0495636_0427675 3300047318 Unclassified 634
1294 Ga0495636_0548608 3300047318 Unclassified 562
1295 Ga0495636_0659017 3300047318 Bacteria 515
1296 Ga0495674_0607086 3300047319 Bacteria 866
1297 Ga0495676_0031351 3300047321 Bacteria 4498
1298 Ga0495676_0408772 3300047321 Bacteria 900
1299 Ga0495676_0465769 3300047321 Bacteria 832
1300 Ga0495676_0637282 3300047321 Unclassified 692
1301 Ga0495676_0737285 3300047321 Bacteria 636
1302 Ga0495680_0033835 3300047322 Bacteria 4135
1303 Ga0495680_0596448 3300047322 Bacteria 740
1304 Ga0495683_0317515 3300047323 Bacteria 665
1305 Ga0495683_0434252 3300047323 Bacteria 541
1306 Ga0495675_0260068 3300047444 Bacteria 1040
1307 Ga0495677_0082340 3300047445 Bacteria 1207
1308 Ga0495677_0113001 3300047445 Bacteria 1033
1309 Ga0495677_0124581 3300047445 Bacteria 984
1310 Ga0495677_0169645 3300047445 Bacteria 844
1311 Ga0495677_0306658 3300047445 Bacteria 625
1312 Ga0495679_215436 3300047446 Bacteria 503
1313 Ga0495673_0237768 3300047469 Bacteria 669
1314 Ga0495681_0380779 3300047470 Bacteria 531
1315 Ga0495684_0142056 3300047471 Bacteria 1800
1316 Ga0495684_0820438 3300047471 Bacteria 606
1317 Ga0495593_0407298 3300047673 Unclassified 680
1318 Ga0495593_0576006 3300047673 Bacteria 565
1319 Ga0495614_0033172 3300048089 Bacteria 2221
1320 Ga0495614_0154491 3300048089 Bacteria 1025
1321 Ga0495615_0184064 3300048090 Bacteria 638
1322 Ga0496100_0035339 3300048903 Bacteria 3142
1323 Ga0496100_0105983 3300048903 Bacteria 1945
1324 Ga0496100_0109827 3300048903 Bacteria 1914
1325 Ga0496100_0529955 3300048903 Unclassified 910
1326 Ga0496100_0574888 3300048903 Bacteria 873
1327 Ga0496100_0826823 3300048903 Bacteria 726
1328 Ga0496100_1098860 3300048903 Unclassified 627
1329 Ga0496100_1124085 3300048903 Bacteria 619
1330 Ga0496100_1607404 3300048903 Bacteria 514
1331 Ga0496101_0050410 3300048904 Bacteria 2996
1332 Ga0496101_0120147 3300048904 Bacteria 1986
1333 Ga0496101_0127460 3300048904 Bacteria 1930
1334 Ga0496101_0274161 3300048904 Bacteria 1317
1335 Ga0496101_0365087 3300048904 Bacteria 1135
1336 Ga0496101_0568365 3300048904 Bacteria 896
1337 Ga0496101_0727362 3300048904 Bacteria 783
1338 Ga0496101_1318314 3300048904 Bacteria 564
1339 Ga0496102_0162996 3300048905 Bacteria 2097
1340 Ga0496102_0300467 3300048905 Bacteria 1513
1341 Ga0496102_0309560 3300048905 Bacteria 1488
1342 Ga0496102_0314392 3300048905 Bacteria 1476
1343 Ga0496102_0708447 3300048905 Bacteria 929
1344 Ga0496102_0847462 3300048905 Unclassified 836
1345 Ga0496103_0003329 3300048906 Bacteria 9830
1346 Ga0496103_0170263 3300048906 Bacteria 1398
1347 Ga0496103_0737572 3300048906 Bacteria 623
1348 Ga0496104_0010781 3300048907 Bacteria 8175
1349 Ga0496104_0056192 3300048907 Bacteria 3721
1350 Ga0496104_0093973 3300048907 Bacteria 2868
1351 Ga0496104_0110759 3300048907 Bacteria 2632
1352 Ga0496104_0337652 3300048907 Bacteria 1419
1353 Ga0496104_0707269 3300048907 Bacteria 915
1354 Ga0496104_0719935 3300048907 Bacteria 905
1355 Ga0496104_0891842 3300048907 Unclassified 794
1356 Ga0496104_0964894 3300048907 Bacteria 757
1357 Ga0496105_0035782 3300048908 Bacteria 4089
1358 Ga0496105_0038830 3300048908 Bacteria 3923
1359 Ga0496105_0074441 3300048908 Bacteria 2805
1360 Ga0496105_0247255 3300048908 Bacteria 1446
1361 Ga0496105_0262070 3300048908 Bacteria 1398
1362 Ga0496105_0265897 3300048908 Bacteria 1386
1363 Ga0496105_0706999 3300048908 Bacteria 773
1364 Ga0496105_0962457 3300048908 Bacteria 640
1365 Ga0496106_0131870 3300048909 Bacteria 1960
1366 Ga0496106_0341441 3300048909 Bacteria 1203
1367 Ga0496106_0463972 3300048909 Bacteria 1017
1368 Ga0496106_0743058 3300048909 Bacteria 780
1369 Ga0496106_1454037 3300048909 Bacteria 528
1370 Ga0496107_0025226 3300048910 Bacteria 4207
1371 Ga0496107_0069669 3300048910 Bacteria 2553
1372 Ga0496107_0164978 3300048910 Bacteria 1642
1373 Ga0496107_0217003 3300048910 Bacteria 1423
1374 Ga0496107_0269462 3300048910 Bacteria 1267
1375 Ga0496107_0481286 3300048910 Bacteria 921
1376 Ga0496107_0790897 3300048910 Bacteria 695
1377 Ga0496107_0985240 3300048910 Unclassified 612
1378 Ga0496108_0000888 3300048911 Bacteria 23275
1379 Ga0496108_0021551 3300048911 Bacteria 5294
1380 Ga0496108_0023356 3300048911 Bacteria 5087
1381 Ga0496108_0029530 3300048911 Bacteria 4541
1382 Ga0496108_0037251 3300048911 Bacteria 4050
1383 Ga0496108_0079703 3300048911 Bacteria 2773
1384 Ga0496108_0361643 3300048911 Bacteria 1267
1385 Ga0496108_0556450 3300048911 Bacteria 1000
1386 Ga0496108_0928480 3300048911 Bacteria 746
1387 Ga0496108_1109214 3300048911 Bacteria 672
1388 Ga0496108_1454918 3300048911 Bacteria 571
1389 Ga0496109_0000579 3300048912 Bacteria 30650
1390 Ga0496109_0023066 3300048912 Bacteria 5519
1391 Ga0496109_0035147 3300048912 Bacteria 4519
1392 Ga0496109_0046089 3300048912 Bacteria 3958
1393 Ga0496109_0077378 3300048912 Bacteria 3061
1394 Ga0496109_0103298 3300048912 Bacteria 2645
1395 Ga0496109_0252043 3300048912 Bacteria 1662
1396 Ga0496109_0255175 3300048912 Bacteria 1651
1397 Ga0496109_0304372 3300048912 Bacteria 1503
1398 Ga0496109_0368509 3300048912 Bacteria 1357
1399 Ga0496109_0777619 3300048912 Unclassified 895
1400 Ga0496109_1418749 3300048912 Bacteria 630
1401 Ga0496109_2037791 3300048912 Bacteria 506
1402 Ga0496110_0046372 3300048913 Bacteria 3802
1403 Ga0496110_0082414 3300048913 Bacteria 2869
1404 Ga0496110_0128156 3300048913 Bacteria 2290
1405 Ga0496110_0146639 3300048913 Bacteria 2135
1406 Ga0496110_0149457 3300048913 Unclassified 2114
1407 Ga0496110_0254499 3300048913 Unclassified 1598
1408 Ga0496110_0397731 3300048913 Archaea 1256
1409 Ga0496110_0483113 3300048913 Bacteria 1128
1410 Ga0496110_0502764 3300048913 Bacteria 1103
1411 Ga0496110_1305396 3300048913 Bacteria 635
1412 Ga0496111_0000740 3300048914 Bacteria 17415
1413 Ga0496111_0010160 3300048914 Bacteria 6303
1414 Ga0496111_0104052 3300048914 Unclassified 2088
1415 Ga0496111_0110475 3300048914 Bacteria 2025
1416 Ga0496111_0128560 3300048914 Bacteria 1874
1417 Ga0496111_0132691 3300048914 Bacteria 1844
1418 Ga0496111_0147176 3300048914 Bacteria 1746
1419 Ga0496111_0173037 3300048914 Bacteria 1604
1420 Ga0496111_0300235 3300048914 Bacteria 1190
1421 Ga0496111_0511390 3300048914 Bacteria 883
1422 Ga0496111_0590572 3300048914 Bacteria 813
1423 Ga0496112_0023965 3300048915 Bacteria 5839
1424 Ga0496112_0025847 3300048915 Bacteria 5642
1425 Ga0496112_0268839 3300048915 Bacteria 1653
1426 Ga0496112_0385940 3300048915 Bacteria 1341
1427 Ga0496112_0543994 3300048915 Bacteria 1095
1428 Ga0496112_0559544 3300048915 Bacteria 1077
1429 Ga0496112_0730463 3300048915 Bacteria 917
1430 Ga0496112_1469871 3300048915 Bacteria 596
1431 Ga0496113_0002956 3300048916 Bacteria 10046
1432 Ga0496113_0027155 3300048916 Bacteria 4100
1433 Ga0496113_0109168 3300048916 Bacteria 2151
1434 Ga0496113_0601799 3300048916 Unclassified 880
1435 Ga0496113_1353574 3300048916 Unclassified 552
1436 Ga0496114_0004206 3300048917 Bacteria 11154
1437 Ga0496114_0048630 3300048917 Bacteria 3528
1438 Ga0496114_0083542 3300048917 Bacteria 2702
1439 Ga0496114_0097333 3300048917 Bacteria 2506
1440 Ga0496114_0120337 3300048917 Bacteria 2257
1441 Ga0496114_0141106 3300048917 Bacteria 2086
1442 Ga0496114_0331155 3300048917 Unclassified 1346
1443 Ga0496114_0420997 3300048917 Bacteria 1183
1444 Ga0496114_0583412 3300048917 Bacteria 986
1445 Ga0496114_1261673 3300048917 Bacteria 625
1446 Ga0496115_0025065 3300048918 Bacteria 4640
1447 Ga0496115_0090245 3300048918 Bacteria 2503
1448 Ga0495682_0354447 3300049460 Bacteria 517
1449 Ga0501299_078376 3300049522 Bacteria 730
1450 Ga0501031_0002104 3300049568 Bacteria 12555
1451 Ga0501031_0005456 3300049568 Bacteria 8274
1452 Ga0501031_0008345 3300049568 Bacteria 6738
1453 Ga0501031_0010811 3300049568 Bacteria 5944
1454 Ga0501031_0024921 3300049568 Bacteria 3902
1455 Ga0501031_0027308 3300049568 Bacteria 3722
1456 Ga0501031_0032494 3300049568 Bacteria 3403
1457 Ga0501031_0034432 3300049568 Bacteria 3305
1458 Ga0501031_0172366 3300049568 Bacteria 1414
1459 Ga0501031_0257974 3300049568 Bacteria 1133
1460 Ga0501031_0356701 3300049568 Bacteria 946
1461 Ga0501031_0460897 3300049568 Bacteria 821
1462 Ga0501031_0672637 3300049568 Bacteria 665
1463 Ga0501031_0981942 3300049568 Unclassified 540
1464 Ga0501032_0011530 3300049569 Bacteria 6347
1465 Ga0501032_0024599 3300049569 Bacteria 4156
1466 Ga0501032_0222116 3300049569 Bacteria 1229
1467 Ga0501032_0352974 3300049569 Bacteria 947
1468 Ga0501032_0878570 3300049569 Bacteria 565
1469 Ga0501033_0027249 3300049570 Bacteria 4296
1470 Ga0501033_0033545 3300049570 Bacteria 3854
1471 Ga0501033_0109978 3300049570 Bacteria 2006
1472 Ga0501033_0148355 3300049570 Bacteria 1693
1473 Ga0501033_0306205 3300049570 Bacteria 1118
1474 Ga0501033_0306530 3300049570 Bacteria 1117
1475 Ga0501033_0760350 3300049570 Bacteria 657
1476 Ga0501034_0301122 3300049571 Bacteria 1540
1477 Ga0501034_1261068 3300049571 Bacteria 616
1478 Ga0501036_0003750 3300049572 Bacteria 12175
1479 Ga0501036_0011577 3300049572 Bacteria 7309
1480 Ga0501036_0043992 3300049572 Bacteria 3781
1481 Ga0501036_0050459 3300049572 Bacteria 3523
1482 Ga0501036_0059785 3300049572 Bacteria 3229
1483 Ga0501036_0085508 3300049572 Bacteria 2666
1484 Ga0501036_0145198 3300049572 Bacteria 2001
1485 Ga0501036_0192346 3300049572 Bacteria 1716
1486 Ga0501036_0231544 3300049572 Bacteria 1550
1487 Ga0501036_0265039 3300049572 Bacteria 1439
1488 Ga0501036_0304279 3300049572 Bacteria 1333
1489 Ga0501036_0305113 3300049572 Bacteria 1331
1490 Ga0501036_0385801 3300049572 Bacteria 1169
1491 Ga0501036_0510267 3300049572 Bacteria 1000
1492 Ga0501036_0710736 3300049572 Bacteria 830
1493 Ga0501036_0817733 3300049572 Bacteria 767
1494 Ga0501037_0011191 3300049573 Bacteria 6603
1495 Ga0501037_0012070 3300049573 Bacteria 6362
1496 Ga0501037_0083516 3300049573 Bacteria 2314
1497 Ga0501037_0168864 3300049573 Bacteria 1556
1498 Ga0501037_0169349 3300049573 Bacteria 1553
1499 Ga0501037_0310841 3300049573 Bacteria 1092
1500 Ga0501038_0001738 3300049574 Bacteria 20249
1501 Ga0501038_0028181 3300049574 Bacteria 4990
1502 Ga0501038_0032597 3300049574 Bacteria 4596
1503 Ga0501038_0043032 3300049574 Bacteria 3930
1504 Ga0501038_0075933 3300049574 Bacteria 2839
1505 Ga0501038_0094034 3300049574 Bacteria 2506
1506 Ga0501038_0125566 3300049574 Bacteria 2112
1507 Ga0501038_0677153 3300049574 Bacteria 775
1508 Ga0501038_1407834 3300049574 Bacteria 501
1509 Ga0501039_0004321 3300049575 Bacteria 10713
1510 Ga0501039_0034274 3300049575 Bacteria 3918
1511 Ga0501039_0035012 3300049575 Bacteria 3875
1512 Ga0501039_0048604 3300049575 Bacteria 3279
1513 Ga0501039_0057186 3300049575 Bacteria 3020
1514 Ga0501039_0080583 3300049575 Bacteria 2533
1515 Ga0501039_0219827 3300049575 Bacteria 1493
1516 Ga0501039_0246724 3300049575 Bacteria 1404
1517 Ga0501039_0351622 3300049575 Unclassified 1158
1518 Ga0501039_0770413 3300049575 Bacteria 751
1519 Ga0501039_1418408 3300049575 Bacteria 534
1520 Ga0501039_1522167 3300049575 Archaea 514
1521 Ga0501039_1592248 3300049575 Bacteria 501
1522 Ga0501040_0018166 3300049576 Bacteria 4670
1523 Ga0501040_0020310 3300049576 Bacteria 4425
1524 Ga0501040_0021388 3300049576 Bacteria 4320
1525 Ga0501040_0024973 3300049576 Bacteria 4015
1526 Ga0501040_0025076 3300049576 Bacteria 4007
1527 Ga0501040_0096298 3300049576 Bacteria 2060
1528 Ga0501040_0138193 3300049576 Bacteria 1715
1529 Ga0501040_0147011 3300049576 Bacteria 1661
1530 Ga0501040_0161758 3300049576 Bacteria 1583
1531 Ga0501040_0199231 3300049576 Bacteria 1421
1532 Ga0501040_0220096 3300049576 Bacteria 1350
1533 Ga0501040_0375296 3300049576 Bacteria 1020
1534 Ga0501040_0535967 3300049576 Bacteria 845
1535 Ga0501040_0795733 3300049576 Bacteria 684
1536 Ga0501040_1047482 3300049576 Bacteria 592
1537 Ga0501041_0006004 3300049577 Bacteria 7105
1538 Ga0501041_0006678 3300049577 Bacteria 6759
1539 Ga0501041_0007434 3300049577 Bacteria 6433
1540 Ga0501041_0011358 3300049577 Bacteria 5262
1541 Ga0501041_0013965 3300049577 Bacteria 4764
1542 Ga0501041_0014769 3300049577 Bacteria 4637
1543 Ga0501041_0015431 3300049577 Bacteria 4535
1544 Ga0501041_0048515 3300049577 Bacteria 2586
1545 Ga0501041_0151877 3300049577 Bacteria 1446
1546 Ga0501041_0313020 3300049577 Bacteria 990
1547 Ga0501041_0465831 3300049577 Bacteria 803
1548 Ga0501041_0536590 3300049577 Bacteria 745
1549 Ga0501041_1049155 3300049577 Unclassified 525
1550 Ga0501042_0005142 3300049578 Bacteria 8397
1551 Ga0501042_0016562 3300049578 Bacteria 5063
1552 Ga0501042_0018322 3300049578 Bacteria 4845
1553 Ga0501042_0023072 3300049578 Bacteria 4349
1554 Ga0501042_0041146 3300049578 Bacteria 3285
1555 Ga0501042_0055945 3300049578 Bacteria 2815
1556 Ga0501042_0235768 3300049578 Bacteria 1320
1557 Ga0501042_0243955 3300049578 Bacteria 1296
1558 Ga0501042_0279042 3300049578 Bacteria 1207
1559 Ga0501042_0355071 3300049578 Bacteria 1060
1560 Ga0501042_0371099 3300049578 Bacteria 1035
1561 Ga0501042_0660595 3300049578 Bacteria 760
1562 Ga0501042_0695148 3300049578 Bacteria 740
1563 Ga0501042_0742441 3300049578 Bacteria 714
1564 Ga0501042_1176339 3300049578 Bacteria 559
1565 Ga0501042_1370096 3300049578 Unclassified 516
1566 Ga0501042_1417282 3300049578 Unclassified 507
1567 Ga0501043_0014994 3300049579 Bacteria 6069
1568 Ga0501043_0026222 3300049579 Bacteria 4572
1569 Ga0501043_0057037 3300049579 Bacteria 3067
1570 Ga0501043_0063719 3300049579 Bacteria 2895
1571 Ga0501043_0243417 3300049579 Bacteria 1387
1572 Ga0501043_0245300 3300049579 Bacteria 1381
1573 Ga0501043_0406575 3300049579 Bacteria 1028
1574 Ga0501046_0002143 3300049580 Bacteria 18641
1575 Ga0501046_0007988 3300049580 Bacteria 9251
1576 Ga0501046_0014203 3300049580 Bacteria 6726
1577 Ga0501046_0016257 3300049580 Bacteria 6238
1578 Ga0501046_0024687 3300049580 Bacteria 4926
1579 Ga0501046_0053029 3300049580 Bacteria 3195
1580 Ga0501046_0431535 3300049580 Bacteria 949
1581 Ga0501046_1117145 3300049580 Unclassified 544
1582 Ga0501046_1231237 3300049580 Bacteria 513
1583 Ga0501047_0283721 3300049581 Bacteria 1500
1584 Ga0501047_0422818 3300049581 Bacteria 1164
1585 Ga0501047_0520766 3300049581 Bacteria 1015
1586 Ga0501048_0012639 3300049582 Bacteria 6279
1587 Ga0501048_0014089 3300049582 Bacteria 5926
1588 Ga0501048_0015761 3300049582 Bacteria 5577
1589 Ga0501048_0068375 3300049582 Bacteria 2509
1590 Ga0501048_0082395 3300049582 Bacteria 2269
1591 Ga0501048_0096929 3300049582 Bacteria 2080
1592 Ga0501048_0097088 3300049582 Bacteria 2079
1593 Ga0501048_0128811 3300049582 Bacteria 1789
1594 Ga0501048_0506957 3300049582 Bacteria 865
1595 Ga0501048_0650410 3300049582 Bacteria 757
1596 Ga0501067_0023969 3300049583 Bacteria 3384
1597 Ga0501067_0052292 3300049583 Bacteria 2263
1598 Ga0501067_0063060 3300049583 Bacteria 2052
1599 Ga0501067_0074685 3300049583 Bacteria 1878
1600 Ga0501067_0263624 3300049583 Bacteria 959
1601 Ga0501067_0407371 3300049583 Unclassified 758
1602 Ga0501067_0551036 3300049583 Unclassified 646
1603 Ga0501067_0554346 3300049583 Bacteria 644
1604 Ga0501067_0597330 3300049583 Unclassified 619
1605 Ga0501068_0005542 3300049584 Bacteria 6915
1606 Ga0501068_0014980 3300049584 Bacteria 4443
1607 Ga0501068_0015318 3300049584 Bacteria 4400
1608 Ga0501068_0018445 3300049584 Bacteria 4041
1609 Ga0501068_0070302 3300049584 Bacteria 2135
1610 Ga0501068_0082801 3300049584 Bacteria 1971
1611 Ga0501068_0085150 3300049584 Bacteria 1945
1612 Ga0501068_0166829 3300049584 Bacteria 1389
1613 Ga0501068_0411290 3300049584 Bacteria 873
1614 Ga0501068_0758535 3300049584 Unclassified 635
1615 Ga0501068_0831475 3300049584 Unclassified 606
1616 Ga0501069_0017407 3300049585 Bacteria 3866
1617 Ga0501069_0020250 3300049585 Bacteria 3603
1618 Ga0501069_0021451 3300049585 Bacteria 3506
1619 Ga0501069_0024839 3300049585 Bacteria 3271
1620 Ga0501069_0039376 3300049585 Bacteria 2611
1621 Ga0501069_0059015 3300049585 Bacteria 2141
1622 Ga0501069_0079231 3300049585 Bacteria 1849
1623 Ga0501069_0093285 3300049585 Bacteria 1703
1624 Ga0501069_0220381 3300049585 Bacteria 1102
1625 Ga0501069_0328763 3300049585 Bacteria 899
1626 Ga0501069_0506787 3300049585 Bacteria 720
1627 Ga0501069_0865369 3300049585 Bacteria 549
1628 Ga0501069_1006694 3300049585 Bacteria 509
1629 Ga0501069_1008364 3300049585 Unclassified 509
1630 Ga0501070_0018595 3300049586 Bacteria 5829
1631 Ga0501070_0028099 3300049586 Bacteria 4717
1632 Ga0501070_0032622 3300049586 Bacteria 4359
1633 Ga0501070_0040915 3300049586 Bacteria 3862
1634 Ga0501070_0088405 3300049586 Bacteria 2564
1635 Ga0501070_0199156 3300049586 Bacteria 1645
1636 Ga0501070_0304718 3300049586 Bacteria 1297
1637 Ga0501070_0703439 3300049586 Unclassified 799
1638 Ga0501070_0838242 3300049586 Unclassified 720
1639 Ga0501071_0002739 3300049587 Bacteria 10807
1640 Ga0501071_0003010 3300049587 Bacteria 10431
1641 Ga0501071_0009045 3300049587 Bacteria 6612
1642 Ga0501071_0012703 3300049587 Bacteria 5724
1643 Ga0501071_0012914 3300049587 Bacteria 5682
1644 Ga0501071_0021703 3300049587 Bacteria 4475
1645 Ga0501071_0023319 3300049587 Bacteria 4322
1646 Ga0501071_0115195 3300049587 Bacteria 1989
1647 Ga0501071_0130774 3300049587 Bacteria 1864
1648 Ga0501071_0160448 3300049587 Bacteria 1680
1649 Ga0501071_0293794 3300049587 Bacteria 1231
1650 Ga0501071_0302394 3300049587 Bacteria 1213
1651 Ga0501071_0500831 3300049587 Bacteria 932
1652 Ga0501071_0576016 3300049587 Bacteria 865
1653 Ga0501071_0727753 3300049587 Bacteria 764
1654 Ga0501071_0826674 3300049587 Unclassified 714
1655 Ga0501071_1463059 3300049587 Bacteria 527
1656 Ga0501072_0004009 3300049588 Bacteria 11144
1657 Ga0501072_0004983 3300049588 Bacteria 10101
1658 Ga0501072_0008209 3300049588 Bacteria 7929
1659 Ga0501072_0020866 3300049588 Bacteria 5079
1660 Ga0501072_0021085 3300049588 Bacteria 5055
1661 Ga0501072_0024983 3300049588 Bacteria 4651
1662 Ga0501072_0070915 3300049588 Bacteria 2752
1663 Ga0501072_0096841 3300049588 Bacteria 2345
1664 Ga0501072_0263639 3300049588 Bacteria 1371
1665 Ga0501072_0314259 3300049588 Bacteria 1245
1666 Ga0501072_0343949 3300049588 Bacteria 1184
1667 Ga0501072_0351204 3300049588 Bacteria 1171
1668 Ga0501072_0545975 3300049588 Bacteria 915
1669 Ga0501072_0570350 3300049588 Unclassified 893
1670 Ga0501072_1326914 3300049588 Bacteria 557
1671 Ga0501073_0035084 3300049589 Bacteria 3566
1672 Ga0501073_0098919 3300049589 Bacteria 2025
1673 Ga0501073_0141889 3300049589 Bacteria 1664
1674 Ga0501073_0509781 3300049589 Unclassified 832
1675 Ga0501073_0535392 3300049589 Bacteria 809
1676 Ga0501073_0604705 3300049589 Bacteria 757
1677 Ga0501074_0007685 3300049590 Bacteria 7806
1678 Ga0501074_0021751 3300049590 Bacteria 4657
1679 Ga0501074_0032754 3300049590 Bacteria 3764
1680 Ga0501074_0042618 3300049590 Bacteria 3284
1681 Ga0501074_0229542 3300049590 Bacteria 1321
1682 Ga0501074_0324450 3300049590 Unclassified 1093
1683 Ga0501074_0602645 3300049590 Bacteria 777
1684 Ga0501074_0735337 3300049590 Unclassified 696
1685 Ga0501075_0006741 3300049591 Bacteria 7927
1686 Ga0501075_0012405 3300049591 Bacteria 6057
1687 Ga0501075_0021058 3300049591 Bacteria 4751
1688 Ga0501075_0038960 3300049591 Bacteria 3555
1689 Ga0501075_0042441 3300049591 Bacteria 3410
1690 Ga0501075_0074277 3300049591 Bacteria 2571
1691 Ga0501075_0095151 3300049591 Bacteria 2260
1692 Ga0501075_0153829 3300049591 Bacteria 1753
1693 Ga0501075_0240669 3300049591 Bacteria 1379
1694 Ga0501075_0442826 3300049591 Bacteria 991
1695 Ga0501075_0541864 3300049591 Bacteria 888
1696 Ga0501075_0796745 3300049591 Unclassified 719
1697 Ga0501075_0973044 3300049591 Bacteria 645
1698 Ga0501075_0994411 3300049591 Bacteria 637
1699 Ga0501075_1450743 3300049591 Unclassified 519
1700 Ga0501076_0014185 3300049592 Bacteria 5995
1701 Ga0501076_0014748 3300049592 Bacteria 5891
1702 Ga0501076_0015920 3300049592 Bacteria 5690
1703 Ga0501076_0022704 3300049592 Bacteria 4824
1704 Ga0501076_0025718 3300049592 Bacteria 4557
1705 Ga0501076_0026424 3300049592 Bacteria 4497
1706 Ga0501076_0040309 3300049592 Bacteria 3669
1707 Ga0501076_0059183 3300049592 Bacteria 3047
1708 Ga0501076_0063359 3300049592 Bacteria 2945
1709 Ga0501076_0103895 3300049592 Bacteria 2292
1710 Ga0501076_0139484 3300049592 Bacteria 1969
1711 Ga0501076_0148384 3300049592 Bacteria 1907
1712 Ga0501076_0181848 3300049592 Bacteria 1714
1713 Ga0501076_0199490 3300049592 Bacteria 1633
1714 Ga0501076_0673253 3300049592 Bacteria 854
1715 Ga0501076_1460587 3300049592 Bacteria 561
1716 Ga0501077_0002968 3300049593 Bacteria 10175
1717 Ga0501077_0003160 3300049593 Bacteria 9911
1718 Ga0501077_0010173 3300049593 Bacteria 5856
1719 Ga0501077_0019528 3300049593 Bacteria 4286
1720 Ga0501077_0030319 3300049593 Bacteria 3441
1721 Ga0501077_0049142 3300049593 Bacteria 2680
1722 Ga0501077_0057383 3300049593 Bacteria 2472
1723 Ga0501077_0081340 3300049593 Bacteria 2052
1724 Ga0501077_0081643 3300049593 Bacteria 2048
1725 Ga0501077_0179981 3300049593 Bacteria 1344
1726 Ga0501077_0391937 3300049593 Bacteria 887
1727 Ga0501077_0622466 3300049593 Bacteria 693
1728 Ga0501077_0987687 3300049593 Unclassified 542
1729 Ga0501077_1028909 3300049593 Bacteria 530
1730 Ga0501077_1123864 3300049593 Bacteria 506
1731 Ga0501202_115537 3300049652 Bacteria 669
1732 Ga0501208_057734 3300049655 Bacteria 754
1733 Ga0501225_0194502 3300049705 Bacteria 640
1734 Ga0501079_0013520 3300049741 Bacteria 6225
1735 Ga0501079_0015725 3300049741 Bacteria 5780
1736 Ga0501079_0018804 3300049741 Bacteria 5280
1737 Ga0501079_0027741 3300049741 Bacteria 4343
1738 Ga0501079_0033485 3300049741 Bacteria 3953
1739 Ga0501079_0035736 3300049741 Bacteria 3825
1740 Ga0501079_0037371 3300049741 Bacteria 3743
1741 Ga0501079_0052322 3300049741 Bacteria 3151
1742 Ga0501079_0085473 3300049741 Bacteria 2442
1743 Ga0501079_0108925 3300049741 Bacteria 2151
1744 Ga0501079_0220433 3300049741 Bacteria 1482
1745 Ga0501079_0317583 3300049741 Bacteria 1219
1746 Ga0501079_0427680 3300049741 Bacteria 1039
1747 Ga0501079_0551937 3300049741 Bacteria 906
1748 Ga0501079_0883556 3300049741 Bacteria 704
1749 Ga0501079_0916933 3300049741 Bacteria 690
1750 Ga0501079_1144707 3300049741 Bacteria 613
1751 Ga0501079_1261282 3300049741 Unclassified 582
1752 Ga0501079_1274959 3300049741 Bacteria 579
1753 Ga0501079_1446243 3300049741 Unclassified 541
1754 Ga0501079_1535306 3300049741 Bacteria 524
1755 Ga0501080_0005055 3300049742 Bacteria 11749
1756 Ga0501080_0029085 3300049742 Bacteria 5144
1757 Ga0501080_0039522 3300049742 Bacteria 4403
1758 Ga0501080_0041910 3300049742 Bacteria 4265
1759 Ga0501080_0043767 3300049742 Bacteria 4169
1760 Ga0501080_0049915 3300049742 Bacteria 3894
1761 Ga0501080_0068850 3300049742 Bacteria 3292
1762 Ga0501080_0077142 3300049742 Bacteria 3098
1763 Ga0501080_0144233 3300049742 Bacteria 2201
1764 Ga0501080_0226381 3300049742 Bacteria 1710
1765 Ga0501080_1549596 3300049742 Bacteria 562
1766 Ga0501080_1726736 3300049742 Bacteria 527
1767 Ga0501081_0005337 3300049743 Bacteria 8292
1768 Ga0501081_0014398 3300049743 Bacteria 5217
1769 Ga0501081_0023884 3300049743 Bacteria 4101
1770 Ga0501081_0032432 3300049743 Bacteria 3543
1771 Ga0501081_0051630 3300049743 Bacteria 2835
1772 Ga0501081_0054513 3300049743 Bacteria 2762
1773 Ga0501081_0070856 3300049743 Bacteria 2429
1774 Ga0501081_0133393 3300049743 Bacteria 1776
1775 Ga0501081_0153578 3300049743 Bacteria 1655
1776 Ga0501081_0337164 3300049743 Bacteria 1110
1777 Ga0501081_0341546 3300049743 Bacteria 1102
1778 Ga0501081_0348627 3300049743 Bacteria 1091
1779 Ga0501081_0358947 3300049743 Bacteria 1075
1780 Ga0501081_0594964 3300049743 Bacteria 828
1781 Ga0501081_0927018 3300049743 Unclassified 657
1782 Ga0501081_0934705 3300049743 Bacteria 654
1783 Ga0501081_0944927 3300049743 Bacteria 651
1784 Ga0501081_1143204 3300049743 Bacteria 589
1785 Ga0501081_1299926 3300049743 Bacteria 551
1786 Ga0501083_0011129 3300049744 Bacteria 6316
1787 Ga0501083_0018799 3300049744 Bacteria 4812
1788 Ga0501083_0025651 3300049744 Bacteria 4080
1789 Ga0501083_0056064 3300049744 Bacteria 2641
1790 Ga0501083_0098741 3300049744 Bacteria 1926
1791 Ga0501083_0134995 3300049744 Bacteria 1617
1792 Ga0501083_0173520 3300049744 Bacteria 1409
1793 Ga0501035_0020546 3300049822 Bacteria 6064
1794 Ga0501035_0036250 3300049822 Bacteria 4471
1795 Ga0501035_0062145 3300049822 Bacteria 3323
1796 Ga0501035_0105782 3300049822 Bacteria 2467
1797 Ga0501035_0192702 3300049822 Bacteria 1752
1798 Ga0501035_0212405 3300049822 Bacteria 1655
1799 Ga0501035_0254253 3300049822 Bacteria 1491
1800 Ga0501035_1196984 3300049822 Bacteria 590
1801 Ga0501044_0044590 3300049823 Bacteria 4601
1802 Ga0501044_0095048 3300049823 Bacteria 3004
1803 Ga0501044_0380562 3300049823 Bacteria 1326
1804 Ga0501044_0544094 3300049823 Bacteria 1059
1805 Ga0501045_0006136 3300049824 Bacteria 8326
1806 Ga0501045_0011541 3300049824 Bacteria 6205
1807 Ga0501045_0013577 3300049824 Bacteria 5754
1808 Ga0501045_0028313 3300049824 Bacteria 4040
1809 Ga0501045_0079570 3300049824 Bacteria 2416
1810 Ga0501045_0101768 3300049824 Bacteria 2127
1811 Ga0501045_0117005 3300049824 Bacteria 1978
1812 Ga0501045_0134203 3300049824 Bacteria 1840
1813 Ga0501045_0199348 3300049824 Bacteria 1491
1814 Ga0501045_0262624 3300049824 Bacteria 1285
1815 Ga0501045_0277090 3300049824 Bacteria 1248
1816 Ga0501045_0577096 3300049824 Bacteria 833
1817 Ga0501045_0577597 3300049824 Bacteria 833
1818 Ga0501045_0609276 3300049824 Bacteria 808
1819 Ga0501045_1030655 3300049824 Bacteria 603
1820 Ga0501045_1173605 3300049824 Bacteria 561
1821 Ga0501045_1200583 3300049824 Bacteria 553
1822 nmdc:mga03n38_119650_c1 3300050490 Bacteria 1292
1823 nmdc:mga03n38_130389_c1 3300050490 Bacteria 1245
1824 nmdc:mga00v17_1018011_c1 3300050491 Bacteria 521
1825 nmdc:mga00v17_1067420_c1 3300050491 Bacteria 506
1826 nmdc:mga0yw44_1181603_c1 3300050492 Bacteria 516
1827 nmdc:mga0yw44_176692_c1 3300050492 Bacteria 1404
1828 nmdc:mga0yw44_254684_c1 3300050492 Unclassified 1169
1829 nmdc:mga0yw44_30486_c1 3300050492 Bacteria 3126
1830 nmdc:mga0yw44_382092_c1 3300050492 Bacteria 951
1831 nmdc:mga06z11_73231_c1 3300050494 Bacteria 1818
1832 nmdc:mga06z11_953579_c1 3300050494 Bacteria 523
1833 nmdc:mga07m45_327816_c1 3300050496 Bacteria 890
1834 nmdc:mga05p37_1302037_c1 3300050507 Bacteria 741
1835 nmdc:mga05p37_143122_c1 3300050507 Bacteria 2929
1836 nmdc:mga05p37_1597122_c1 3300050507 Unclassified 643
1837 nmdc:mga05p37_2157702_c1 3300050507 Unclassified 519
1838 nmdc:mga05p37_259469_c1 3300050507 Bacteria 2081
1839 nmdc:mga05p37_366184_c1 3300050507 Bacteria 1693
1840 nmdc:mga05p37_37598_c1 3300050507 Bacteria 5936
1841 nmdc:mga05p37_6099_c1 3300050507 Bacteria 14195
1842 nmdc:mga05p37_789549_c1 3300050507 Bacteria 1040
1843 nmdc:mga05p37_846584_c1 3300050507 Unclassified 994
1844 nmdc:mga05p37_85883_c1 3300050507 Bacteria 3878
1845 nmdc:mga09592_1452417_c1 3300050508 Bacteria 559
1846 nmdc:mga09592_17464_c1 3300050508 Bacteria 5877
1847 nmdc:mga09592_258802_c1 3300050508 Bacteria 1509
1848 nmdc:mga09592_552863_c1 3300050508 Bacteria 989
1849 nmdc:mga09592_844670_c1 3300050508 Unclassified 772
1850 nmdc:mga0qj67_102436_c1 3300050509 Bacteria 2308
1851 nmdc:mga0qj67_86193_c1 3300050509 Bacteria 2520
1852 nmdc:mga06r32_157945_c1 3300050510 Bacteria 2250
1853 nmdc:mga06r32_264597_c1 3300050510 Bacteria 1707
1854 nmdc:mga06r32_531736_c1 3300050510 Bacteria 1151
1855 nmdc:mga06r32_825542_c1 3300050510 Bacteria 886
1856 nmdc:mga08y16_10863_c1 3300050511 Bacteria 9563
1857 nmdc:mga08y16_1240142_c1 3300050511 Unclassified 715
1858 nmdc:mga08y16_1400235_c1 3300050511 Bacteria 663
1859 nmdc:mga08y16_192677_c1 3300050511 Bacteria 2114
1860 nmdc:mga08y16_230320_c1 3300050511 Bacteria 1916
1861 nmdc:mga08y16_460968_c1 3300050511 Bacteria 1295
1862 nmdc:mga08y16_472875_c1 3300050511 Bacteria 1276
1863 nmdc:mga08y16_59955_c1 3300050511 Bacteria 3975
1864 nmdc:mga08y16_662693_c1 3300050511 Viruses 1047
1865 nmdc:mga08y16_994674_c1 3300050511 Bacteria 819
1866 nmdc:mga0n895_292131_c1 3300050512 Bacteria 1652
1867 nmdc:mga0n895_320963_c1 3300050512 Bacteria 1570
1868 nmdc:mga0n895_321690_c1 3300050512 Bacteria 1568
1869 nmdc:mga0n895_625350_c1 3300050512 Bacteria 1077
1870 nmdc:mga0rr50_340238_c1 3300050513 Bacteria 1261
1871 nmdc:mga0rr50_76680_c1 3300050513 Bacteria 2567
1872 nmdc:mga08x19_25564_c1 3300050514 Bacteria 3679
1873 nmdc:mga08x19_285560_c1 3300050514 Bacteria 1144
1874 nmdc:mga08x19_45484_c1 3300050514 Bacteria 2805
1875 nmdc:mga08x19_455034_c1 3300050514 Bacteria 901
1876 nmdc:mga08x19_504073_c1 3300050514 Unclassified 855
1877 nmdc:mga08x19_745889_c1 3300050514 Bacteria 695
1878 nmdc:mga08x19_79298_c1 3300050514 Bacteria 2153
1879 nmdc:mga0a205_1008824_c1 3300050515 Bacteria 679
1880 nmdc:mga0a205_108520_c1 3300050515 Bacteria 2674
1881 nmdc:mga0a205_267850_c1 3300050515 Bacteria 1586
1882 nmdc:mga0a205_4875_c1 3300050515 Bacteria 12070
1883 nmdc:mga0a205_584070_c1 3300050515 Bacteria 971
1884 nmdc:mga0a205_723269_c1 3300050515 Bacteria 845
1885 Ga0495612_0098898 3300053078 Bacteria 1241
1886 Ga0495655_0048842 3300053083 Bacteria 1112
1887 Ga0495655_0064262 3300053083 Bacteria 1010
1888 Ga0495655_0285286 3300053083 Unclassified 564
1889 Ga0495595_0195537 3300053084 Bacteria 1006
1890 Ga0495595_0526165 3300053084 Bacteria 603
1891 Ga0495619_0054047 3300053085 Bacteria 2657
1892 Ga0495619_0148941 3300053085 Bacteria 1614
1893 Ga0495619_0235038 3300053085 Bacteria 1270
1894 Ga0500628_116877 3300053129 Bacteria 721
1895 Ga0501084_0006937 3300054114 Bacteria 9329
1896 Ga0501084_0011448 3300054114 Bacteria 7346
1897 Ga0501084_0016867 3300054114 Bacteria 6068
1898 Ga0501084_0017787 3300054114 Bacteria 5915
1899 Ga0501084_0040475 3300054114 Bacteria 3898
1900 Ga0501084_0046052 3300054114 Bacteria 3652
1901 Ga0501084_0046697 3300054114 Bacteria 3627
1902 Ga0501084_0095429 3300054114 Bacteria 2498
1903 Ga0501084_0164029 3300054114 Bacteria 1875
1904 Ga0501084_0177475 3300054114 Bacteria 1798
1905 Ga0501084_0329999 3300054114 Bacteria 1288
1906 Ga0501084_0522325 3300054114 Bacteria 1003
1907 Ga0501084_0682486 3300054114 Bacteria 866
1908 Ga0501084_0962482 3300054114 Unclassified 718
1909 Ga0501084_1066294 3300054114 Unclassified 679
1910 Ga0501084_1222884 3300054114 Unclassified 630
1911 Ga0501084_1504912 3300054114 Bacteria 563
1912 Ga0501084_1640131 3300054114 Bacteria 537
1913 Ga0590071_029483 3300059421 Bacteria 1304
1914 Ga0590075_004855 3300059424 Bacteria 3180
1915 Ga0590075_033100 3300059424 Bacteria 1312
1916 Ga0587084_157993 3300059477 Unclassified 503
1917 Ga0587066_093327 3300059490 Bacteria 672
1918 Ga0587070_130812 3300059491 Bacteria 610
1919 Ga0587090_139335 3300059510 Bacteria 541
1920 Ga0587091_125332 3300059511 Bacteria 628
1921 Ga0587092_126990 3300059512 Bacteria 550
1922 Ga0587115_070084 3300059626 Unclassified 604
1923 Ga0587076_168735 3300059645 Bacteria 543
1924 Ga0587079_235290 3300059647 Bacteria 515
1925 Ga0587114_142219 3300059655 Bacteria 502
1926 Ga0501082_0009266 3300060353 Bacteria 8486
1927 Ga0501082_0025322 3300060353 Bacteria 5112
1928 Ga0501082_0029396 3300060353 Bacteria 4734
1929 Ga0501082_0030784 3300060353 Bacteria 4626
1930 Ga0501082_0033584 3300060353 Bacteria 4426
1931 Ga0501082_0071463 3300060353 Bacteria 2988
1932 Ga0501082_0075961 3300060353 Bacteria 2895
1933 Ga0501082_0107127 3300060353 Bacteria 2418
1934 Ga0501082_0174915 3300060353 Bacteria 1866
1935 Ga0501082_0217365 3300060353 Bacteria 1663
1936 Ga0501082_0256117 3300060353 Bacteria 1523
1937 Ga0501082_0669774 3300060353 Bacteria 908
1938 Ga0501082_0677469 3300060353 Bacteria 903
1939 Ga0501082_1100455 3300060353 Bacteria 695
1940 Ga0501082_1144842 3300060353 Bacteria 680
1941 Ga0501082_1369625 3300060353 Unclassified 618
1942 Ga0501082_1483412 3300060353 Bacteria 592
1943 Ga0530510_0004573 3300061734 Bacteria 9571
1944 Ga0530510_0005299 3300061734 Bacteria 8912
1945 Ga0530510_0039570 3300061734 Bacteria 3404
1946 Ga0530510_0048859 3300061734 Bacteria 3057
1947 Ga0530510_0059205 3300061734 Bacteria 2770
1948 Ga0530510_0070521 3300061734 Bacteria 2537
1949 Ga0530510_0092860 3300061734 Bacteria 2203
1950 Ga0530510_0222286 3300061734 Bacteria 1404
1951 Ga0530510_0336149 3300061734 Bacteria 1133
1952 Ga0530510_0343790 3300061734 Bacteria 1120
1953 Ga0530510_0350561 3300061734 Bacteria 1109
1954 Ga0530510_0355026 3300061734 Bacteria 1101
1955 Ga0530510_0564009 3300061734 Bacteria 865
1956 Ga0530510_0684747 3300061734 Bacteria 781
1957 Ga0530510_0960835 3300061734 Unclassified 653
1958 Ga0530510_0995624 3300061734 Bacteria 641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0243955 Ga0501042_0243955_1051_1278 72
2 3300049741 Ga0501079_1144707 Ga0501079_1144707_190_417 72
3 3300049743 Ga0501081_0934705 Ga0501081_0934705_220_447 72
4 3300041512 Ga0451853_1211212 Ga0451853_1211212_132_365 75
5 3300005545 Ga0070695_100850565 Ga0070695_1008505652 76
6 3300005616 Ga0068852_102607359 Ga0068852_1026073592 76
7 3300006871 Ga0075434_100205399 Ga0075434_1002053994 76
8 3300006914 Ga0075436_100244410 Ga0075436_1002444102 76
9 3300010375 Ga0105239_12949968 Ga0105239_129499681 76
10 3300013105 Ga0157369_11782301 Ga0157369_117823012 76
11 3300025898 Ga0207692_10595949 Ga0207692_105959492 76
12 3300035725 Ga0373947_0727323 Ga0373947_0727323_269_499 76
13 3300037471 Ga0395905_0472511 Ga0395905_0472511_802_1032 76
14 3300042007 Ga0439449_0284230 Ga0439449_0284230_313_546 76
15 3300046459 Ga0495629_0354558 Ga0495629_0354558_506_736 76
16 3300046461 Ga0495641_0016694 Ga0495641_0016694_1576_1806 76
17 3300046473 Ga0495582_0121166 Ga0495582_0121166_1003_1233 76
18 3300046477 Ga0495664_0545873 Ga0495664_0545873_171_401 76
19 3300046499 Ga0495594_0466877 Ga0495594_0466877_162_392 76
20 3300046514 Ga0495618_0634225 Ga0495618_0634225_146_376 76
21 3300046533 Ga0495640_0345073 Ga0495640_0345073_411_641 76
22 3300046559 Ga0495667_0371000 Ga0495667_0371000_380_610 76
23 3300046663 Ga0495635_0105476 Ga0495635_0105476_158_388 76
24 3300046663 Ga0495635_0649356 Ga0495635_0649356_291_521 76
25 3300046675 Ga0495657_0476324 Ga0495657_0476324_22_252 76
26 3300046681 Ga0495647_0319686 Ga0495647_0319686_447_677 76
27 3300046689 Ga0495613_0321373 Ga0495613_0321373_360_590 76
28 3300046690 Ga0495624_0531269 Ga0495624_0531269_209_439 76
29 3300047321 Ga0495676_0465769 Ga0495676_0465769_187_417 76
30 3300047322 Ga0495680_0033835 Ga0495680_0033835_490_720 76
31 3300047471 Ga0495684_0142056 Ga0495684_0142056_1413_1643 76
32 3300047673 Ga0495593_0407298 Ga0495593_0407298_110_340 76
33 3300048903 Ga0496100_1098860 Ga0496100_1098860_292_522 76
34 3300048907 Ga0496104_0891842 Ga0496104_0891842_326_556 76
35 3300048908 Ga0496105_0247255 Ga0496105_0247255_460_690 76
36 3300048908 Ga0496105_0706999 Ga0496105_0706999_479_709 76
37 3300048911 Ga0496108_1454918 Ga0496108_1454918_19_249 76
38 3300048912 Ga0496109_0777619 Ga0496109_0777619_599_829 76
39 3300048913 Ga0496110_0397731 Ga0496110_0397731_467_697 76
40 3300048914 Ga0496111_0128560 Ga0496111_0128560_715_945 76
41 3300048917 Ga0496114_0331155 Ga0496114_0331155_838_1068 76
42 3300049583 Ga0501067_0052292 Ga0501067_0052292_1601_1837 76
43 3300049584 Ga0501068_0166829 Ga0501068_0166829_347_583 76
44 3300049585 Ga0501069_0039376 Ga0501069_0039376_198_434 76
45 3300049586 Ga0501070_0199156 Ga0501070_0199156_558_794 76
46 3300049588 Ga0501072_0096841 Ga0501072_0096841_416_652 76
47 3300049590 Ga0501074_0735337 Ga0501074_0735337_448_684 76
48 3300049742 Ga0501080_0029085 Ga0501080_0029085_3580_3816 76
49 3300050514 nmdc:mga08x19_745889_c1 nmdc:mga08x19_745889_c1_316_546 76
50 3300053084 Ga0495595_0526165 Ga0495595_0526165_347_577 76
51 3300053085 Ga0495619_0054047 Ga0495619_0054047_2041_2271 76
52 3300053085 Ga0495619_0235038 Ga0495619_0235038_414_644 76
53 3300054114 Ga0501084_0164029 Ga0501084_0164029_764_1000 76
54 3300059510 Ga0587090_139335 Ga0587090_139335_92_322 76
55 3300060353 Ga0501082_0256117 Ga0501082_0256117_385_621 76
56 3300061734 Ga0530510_0960835 Ga0530510_0960835_198_434 76
57 3300001990 JGI24737J22298_10203090 JGI24737J22298_102030902 77
58 3300002077 JGI24744J21845_10010582 JGI24744J21845_100105824 77
59 3300002244 JGI24742J22300_10115031 JGI24742J22300_101150312 77
60 3300004798 Ga0058859_11466280 Ga0058859_114662801 77
61 3300005329 Ga0070683_100628841 Ga0070683_1006288412 77
62 3300005329 Ga0070683_101219148 Ga0070683_1012191481 77
63 3300005329 Ga0070683_101915058 Ga0070683_1019150581 77
64 3300005330 Ga0070690_100189897 Ga0070690_1001898973 77
65 3300005331 Ga0070670_101571225 Ga0070670_1015712252 77
66 3300005333 Ga0070677_10181722 Ga0070677_101817221 77
67 3300005333 Ga0070677_10479080 Ga0070677_104790801 77
68 3300005334 Ga0068869_100242077 Ga0068869_1002420772 77
69 3300005335 Ga0070666_10254454 Ga0070666_102544542 77
70 3300005336 Ga0070680_100094191 Ga0070680_1000941914 77
71 3300005337 Ga0070682_100021835 Ga0070682_1000218354 77
72 3300005337 Ga0070682_101494996 Ga0070682_1014949962 77
73 3300005338 Ga0068868_100036558 Ga0068868_1000365583 77
74 3300005338 Ga0068868_101506434 Ga0068868_1015064341 77
75 3300005338 Ga0068868_101602335 Ga0068868_1016023352 77
76 3300005339 Ga0070660_100051168 Ga0070660_1000511686 77
77 3300005340 Ga0070689_100474709 Ga0070689_1004747092 77
78 3300005341 Ga0070691_10050107 Ga0070691_100501073 77
79 3300005343 Ga0070687_100057945 Ga0070687_1000579453 77
80 3300005344 Ga0070661_100350634 Ga0070661_1003506342 77
81 3300005344 Ga0070661_100615685 Ga0070661_1006156852 77
82 3300005345 Ga0070692_10244186 Ga0070692_102441862 77
83 3300005353 Ga0070669_100116311 Ga0070669_1001163112 77
84 3300005355 Ga0070671_100276851 Ga0070671_1002768513 77
85 3300005356 Ga0070674_100018721 Ga0070674_1000187212 77
86 3300005356 Ga0070674_100383673 Ga0070674_1003836732 77
87 3300005356 Ga0070674_101460090 Ga0070674_1014600902 77
88 3300005356 Ga0070674_101705391 Ga0070674_1017053912 77
89 3300005364 Ga0070673_100628174 Ga0070673_1006281742 77
90 3300005364 Ga0070673_100703896 Ga0070673_1007038962 77
91 3300005364 Ga0070673_101095620 Ga0070673_1010956202 77
92 3300005365 Ga0070688_100008188 Ga0070688_1000081885 77
93 3300005365 Ga0070688_101644248 Ga0070688_1016442481 77
94 3300005366 Ga0070659_100063946 Ga0070659_1000639462 77
95 3300005367 Ga0070667_100753352 Ga0070667_1007533522 77
96 3300005406 Ga0070703_10036500 Ga0070703_100365002 77
97 3300005434 Ga0070709_10067280 Ga0070709_100672804 77
98 3300005436 Ga0070713_100278927 Ga0070713_1002789274 77
99 3300005436 Ga0070713_102195319 Ga0070713_1021953192 77
100 3300005437 Ga0070710_10009995 Ga0070710_100099953 77
101 3300005437 Ga0070710_11051265 Ga0070710_110512652 77
102 3300005438 Ga0070701_10177726 Ga0070701_101777261 77
103 3300005438 Ga0070701_10514926 Ga0070701_105149262 77
104 3300005438 Ga0070701_11357721 Ga0070701_113577212 77
105 3300005439 Ga0070711_100017725 Ga0070711_1000177255 77
106 3300005439 Ga0070711_100052554 Ga0070711_1000525544 77
107 3300005440 Ga0070705_100186589 Ga0070705_1001865891 77
108 3300005440 Ga0070705_100557331 Ga0070705_1005573312 77
109 3300005441 Ga0070700_100021254 Ga0070700_1000212544 77
110 3300005441 Ga0070700_100827844 Ga0070700_1008278441 77
111 3300005444 Ga0070694_100006011 Ga0070694_1000060116 77
112 3300005444 Ga0070694_100579264 Ga0070694_1005792642 77
113 3300005445 Ga0070708_100023029 Ga0070708_1000230295 77
114 3300005445 Ga0070708_100440174 Ga0070708_1004401742 77
115 3300005455 Ga0070663_100129955 Ga0070663_1001299553 77
116 3300005456 Ga0070678_100001665 Ga0070678_1000016653 77
117 3300005456 Ga0070678_100424304 Ga0070678_1004243042 77
118 3300005456 Ga0070678_101258248 Ga0070678_1012582482 77
119 3300005456 Ga0070678_101717593 Ga0070678_1017175932 77
120 3300005457 Ga0070662_100737896 Ga0070662_1007378962 77
121 3300005457 Ga0070662_101062150 Ga0070662_1010621501 77
122 3300005458 Ga0070681_11359076 Ga0070681_113590762 77
123 3300005459 Ga0068867_100000419 Ga0068867_10000041920 77
124 3300005459 Ga0068867_101450244 Ga0068867_1014502442 77
125 3300005466 Ga0070685_10012527 Ga0070685_100125274 77
126 3300005466 Ga0070685_11595472 Ga0070685_115954721 77
127 3300005467 Ga0070706_100007379 Ga0070706_1000073795 77
128 3300005467 Ga0070706_100085948 Ga0070706_1000859485 77
129 3300005468 Ga0070707_100000635 Ga0070707_10000063517 77
130 3300005468 Ga0070707_100042074 Ga0070707_1000420744 77
131 3300005468 Ga0070707_101772126 Ga0070707_1017721262 77
132 3300005471 Ga0070698_100074422 Ga0070698_1000744221 77
133 3300005471 Ga0070698_100362479 Ga0070698_1003624792 77
134 3300005471 Ga0070698_100664390 Ga0070698_1006643902 77
135 3300005471 Ga0070698_101922499 Ga0070698_1019224992 77
136 3300005518 Ga0070699_102035496 Ga0070699_1020354961 77
137 3300005518 Ga0070699_102132555 Ga0070699_1021325551 77
138 3300005535 Ga0070684_101012417 Ga0070684_1010124171 77
139 3300005536 Ga0070697_100827937 Ga0070697_1008279372 77
140 3300005536 Ga0070697_101151354 Ga0070697_1011513542 77
141 3300005536 Ga0070697_101999752 Ga0070697_1019997522 77
142 3300005539 Ga0068853_100012231 Ga0068853_1000122315 77
143 3300005543 Ga0070672_100029658 Ga0070672_1000296584 77
144 3300005543 Ga0070672_100620362 Ga0070672_1006203622 77
145 3300005543 Ga0070672_101682915 Ga0070672_1016829151 77
146 3300005544 Ga0070686_100755880 Ga0070686_1007558802 77
147 3300005544 Ga0070686_101158413 Ga0070686_1011584131 77
148 3300005544 Ga0070686_101213581 Ga0070686_1012135812 77
149 3300005545 Ga0070695_100727527 Ga0070695_1007275272 77
150 3300005546 Ga0070696_100189412 Ga0070696_1001894122 77
151 3300005546 Ga0070696_100414604 Ga0070696_1004146042 77
152 3300005546 Ga0070696_100632559 Ga0070696_1006325592 77
153 3300005547 Ga0070693_100436609 Ga0070693_1004366092 77
154 3300005548 Ga0070665_100349722 Ga0070665_1003497222 77
155 3300005549 Ga0070704_100011069 Ga0070704_1000110696 77
156 3300005549 Ga0070704_100883396 Ga0070704_1008833962 77
157 3300005563 Ga0068855_100492816 Ga0068855_1004928163 77
158 3300005564 Ga0070664_100563873 Ga0070664_1005638732 77
159 3300005564 Ga0070664_100591979 Ga0070664_1005919792 77
160 3300005614 Ga0068856_100501872 Ga0068856_1005018722 77
161 3300005615 Ga0070702_100004263 Ga0070702_1000042632 77
162 3300005615 Ga0070702_100192565 Ga0070702_1001925652 77
163 3300005615 Ga0070702_100963269 Ga0070702_1009632692 77
164 3300005616 Ga0068852_100040437 Ga0068852_1000404373 77
165 3300005616 Ga0068852_101497896 Ga0068852_1014978962 77
166 3300005617 Ga0068859_100709683 Ga0068859_1007096832 77
167 3300005618 Ga0068864_100167875 Ga0068864_1001678752 77
168 3300005718 Ga0068866_10001799 Ga0068866_100017995 77
169 3300005718 Ga0068866_10221062 Ga0068866_102210622 77
170 3300005718 Ga0068866_10854030 Ga0068866_108540302 77
171 3300005719 Ga0068861_100014718 Ga0068861_1000147182 77
172 3300005719 Ga0068861_102006662 Ga0068861_1020066622 77
173 3300005841 Ga0068863_100952274 Ga0068863_1009522742 77
174 3300005843 Ga0068860_100223434 Ga0068860_1002234344 77
175 3300005844 Ga0068862_100805977 Ga0068862_1008059772 77
176 3300005937 Ga0081455_10055663 Ga0081455_100556633 77
177 3300005937 Ga0081455_10081973 Ga0081455_100819735 77
178 3300005937 Ga0081455_10618089 Ga0081455_106180892 77
179 3300005937 Ga0081455_10806584 Ga0081455_108065842 77
180 3300005983 Ga0081540_1283617 Ga0081540_12836172 77
181 3300005985 Ga0081539_10044508 Ga0081539_100445082 77
182 3300005985 Ga0081539_10270896 Ga0081539_102708962 77
183 3300006028 Ga0070717_10154436 Ga0070717_101544362 77
184 3300006038 Ga0075365_10207403 Ga0075365_102074032 77
185 3300006042 Ga0075368_10027686 Ga0075368_100276861 77
186 3300006048 Ga0075363_100120444 Ga0075363_1001204442 77
187 3300006051 Ga0075364_10203298 Ga0075364_102032982 77
188 3300006058 Ga0075432_10027343 Ga0075432_100273432 77
189 3300006163 Ga0070715_10097896 Ga0070715_100978962 77
190 3300006173 Ga0070716_100113437 Ga0070716_1001134372 77
191 3300006173 Ga0070716_100810523 Ga0070716_1008105232 77
192 3300006175 Ga0070712_100011677 Ga0070712_1000116774 77
193 3300006175 Ga0070712_100349498 Ga0070712_1003494982 77
194 3300006175 Ga0070712_100396016 Ga0070712_1003960162 77
195 3300006175 Ga0070712_100726067 Ga0070712_1007260671 77
196 3300006175 Ga0070712_101877371 Ga0070712_1018773711 77
197 3300006178 Ga0075367_10300116 Ga0075367_103001162 77
198 3300006237 Ga0097621_100005304 Ga0097621_1000053046 77
199 3300006358 Ga0068871_100003722 Ga0068871_1000037224 77
200 3300006358 Ga0068871_101150220 Ga0068871_1011502202 77
201 3300006358 Ga0068871_101901279 Ga0068871_1019012792 77
202 3300006844 Ga0075428_101383876 Ga0075428_1013838762 77
203 3300006847 Ga0075431_100165543 Ga0075431_1001655432 77
204 3300006852 Ga0075433_10438138 Ga0075433_104381382 77
205 3300006852 Ga0075433_10463648 Ga0075433_104636482 77
206 3300006852 Ga0075433_10475575 Ga0075433_104755752 77
207 3300006852 Ga0075433_10697038 Ga0075433_106970382 77
208 3300006871 Ga0075434_100192329 Ga0075434_1001923294 77
209 3300006871 Ga0075434_100433538 Ga0075434_1004335382 77
210 3300006871 Ga0075434_100817970 Ga0075434_1008179701 77
211 3300006871 Ga0075434_102363588 Ga0075434_1023635882 77
212 3300006881 Ga0068865_100000269 Ga0068865_10000026928 77
213 3300006881 Ga0068865_100079561 Ga0068865_1000795613 77
214 3300006881 Ga0068865_100371598 Ga0068865_1003715982 77
215 3300006881 Ga0068865_102047531 Ga0068865_1020475312 77
216 3300006914 Ga0075436_100004039 Ga0075436_1000040398 77
217 3300006914 Ga0075436_100052705 Ga0075436_1000527052 77
218 3300006914 Ga0075436_100193893 Ga0075436_1001938932 77
219 3300006914 Ga0075436_100800624 Ga0075436_1008006242 77
220 3300006914 Ga0075436_100893725 Ga0075436_1008937252 77
221 3300006931 Ga0097620_100709648 Ga0097620_1007096482 77
222 3300007076 Ga0075435_100008556 Ga0075435_1000085567 77
223 3300007076 Ga0075435_100421232 Ga0075435_1004212322 77
224 3300007076 Ga0075435_100781117 Ga0075435_1007811171 77
225 3300007076 Ga0075435_101804005 Ga0075435_1018040052 77
226 3300007265 Ga0099794_10124121 Ga0099794_101241212 77
227 3300009094 Ga0111539_10390216 Ga0111539_103902163 77
228 3300009094 Ga0111539_10398790 Ga0111539_103987904 77
229 3300009094 Ga0111539_11004528 Ga0111539_110045282 77
230 3300009094 Ga0111539_11745516 Ga0111539_117455162 77
231 3300009098 Ga0105245_10008137 Ga0105245_100081376 77
232 3300009098 Ga0105245_10214465 Ga0105245_102144652 77
233 3300009098 Ga0105245_10304818 Ga0105245_103048183 77
234 3300009101 Ga0105247_10282546 Ga0105247_102825462 77
235 3300009101 Ga0105247_11673921 Ga0105247_116739212 77
236 3300009147 Ga0114129_10001278 Ga0114129_1000127826 77
237 3300009147 Ga0114129_10021820 Ga0114129_100218205 77
238 3300009147 Ga0114129_10233403 Ga0114129_102334032 77
239 3300009147 Ga0114129_10249409 Ga0114129_102494093 77
240 3300009147 Ga0114129_10284065 Ga0114129_102840654 77
241 3300009148 Ga0105243_10011092 Ga0105243_100110926 77
242 3300009148 Ga0105243_10844117 Ga0105243_108441172 77
243 3300009148 Ga0105243_11827459 Ga0105243_118274592 77
244 3300009174 Ga0105241_10829708 Ga0105241_108297082 77
245 3300009174 Ga0105241_11768283 Ga0105241_117682832 77
246 3300009176 Ga0105242_10012809 Ga0105242_100128096 77
247 3300009176 Ga0105242_10360670 Ga0105242_103606702 77
248 3300009176 Ga0105242_11019777 Ga0105242_110197771 77
249 3300009177 Ga0105248_10012514 Ga0105248_100125145 77
250 3300009177 Ga0105248_10868549 Ga0105248_108685492 77
251 3300009177 Ga0105248_10913093 Ga0105248_109130932 77
252 3300009177 Ga0105248_11143686 Ga0105248_111436862 77
253 3300009545 Ga0105237_10053556 Ga0105237_100535561 77
254 3300009551 Ga0105238_10368876 Ga0105238_103688762 77
255 3300009551 Ga0105238_11062898 Ga0105238_110628982 77
256 3300009553 Ga0105249_10019358 Ga0105249_100193585 77
257 3300009553 Ga0105249_10618041 Ga0105249_106180413 77
258 3300009553 Ga0105249_11072764 Ga0105249_110727642 77
259 3300010375 Ga0105239_10061619 Ga0105239_100616195 77
260 3300011119 Ga0105246_11057693 Ga0105246_110576932 77
261 3300011119 Ga0105246_11236398 Ga0105246_112363982 77
262 3300012490 Ga0157322_1036125 Ga0157322_10361251 77
263 3300012506 Ga0157324_1015704 Ga0157324_10157042 77
264 3300013100 Ga0157373_10658848 Ga0157373_106588482 77
265 3300013102 Ga0157371_10721469 Ga0157371_107214692 77
266 3300013296 Ga0157374_10346258 Ga0157374_103462582 77
267 3300013296 Ga0157374_12645259 Ga0157374_126452592 77
268 3300013297 Ga0157378_10011528 Ga0157378_100115284 77
269 3300013297 Ga0157378_10590266 Ga0157378_105902662 77
270 3300013297 Ga0157378_11147329 Ga0157378_111473292 77
271 3300013306 Ga0163162_10028626 Ga0163162_100286262 77
272 3300013306 Ga0163162_10350658 Ga0163162_103506581 77
273 3300013306 Ga0163162_12330449 Ga0163162_123304492 77
274 3300013307 Ga0157372_11275511 Ga0157372_112755112 77
275 3300013307 Ga0157372_12677215 Ga0157372_126772152 77
276 3300013308 Ga0157375_10012667 Ga0157375_100126676 77
277 3300013308 Ga0157375_10023843 Ga0157375_100238434 77
278 3300013308 Ga0157375_10064424 Ga0157375_100644242 77
279 3300013308 Ga0157375_11189805 Ga0157375_111898052 77
280 3300014325 Ga0163163_10293576 Ga0163163_102935764 77
281 3300014325 Ga0163163_11983933 Ga0163163_119839331 77
282 3300014326 Ga0157380_10031445 Ga0157380_100314455 77
283 3300014326 Ga0157380_10685253 Ga0157380_106852532 77
284 3300014326 Ga0157380_12857561 Ga0157380_128575612 77
285 3300014745 Ga0157377_10010385 Ga0157377_100103852 77
286 3300014968 Ga0157379_10630421 Ga0157379_106304212 77
287 3300014968 Ga0157379_10994500 Ga0157379_109945002 77
288 3300014969 Ga0157376_10007465 Ga0157376_100074656 77
289 3300014969 Ga0157376_10316018 Ga0157376_103160182 77
290 3300014969 Ga0157376_10832664 Ga0157376_108326642 77
291 3300017792 Ga0163161_10187100 Ga0163161_101871002 77
292 3300017792 Ga0163161_10906087 Ga0163161_109060872 77
293 3300017792 Ga0163161_11615187 Ga0163161_116151872 77
294 3300020069 Ga0197907_10819896 Ga0197907_108198962 77
295 3300020081 Ga0206354_10240647 Ga0206354_102406472 77
296 3300022467 Ga0224712_10186629 Ga0224712_101866292 77
297 3300025885 Ga0207653_10159217 Ga0207653_101592172 77
298 3300025893 Ga0207682_10287375 Ga0207682_102873752 77
299 3300025898 Ga0207692_10120397 Ga0207692_101203972 77
300 3300025898 Ga0207692_10478755 Ga0207692_104787552 77
301 3300025899 Ga0207642_10002284 Ga0207642_100022842 77
302 3300025899 Ga0207642_10280131 Ga0207642_102801313 77
303 3300025901 Ga0207688_10082129 Ga0207688_100821292 77
304 3300025903 Ga0207680_10117944 Ga0207680_101179444 77
305 3300025904 Ga0207647_10358296 Ga0207647_103582962 77
306 3300025905 Ga0207685_10051713 Ga0207685_100517132 77
307 3300025906 Ga0207699_10194661 Ga0207699_101946612 77
308 3300025910 Ga0207684_10003747 Ga0207684_100037478 77
309 3300025910 Ga0207684_10511654 Ga0207684_105116541 77
310 3300025910 Ga0207684_10783191 Ga0207684_107831912 77
311 3300025910 Ga0207684_10927556 Ga0207684_109275562 77
312 3300025912 Ga0207707_10921784 Ga0207707_109217842 77
313 3300025914 Ga0207671_10164000 Ga0207671_101640001 77
314 3300025915 Ga0207693_10001049 Ga0207693_1000104920 77
315 3300025915 Ga0207693_10033187 Ga0207693_100331872 77
316 3300025915 Ga0207693_10462767 Ga0207693_104627672 77
317 3300025916 Ga0207663_10110772 Ga0207663_101107724 77
318 3300025916 Ga0207663_11239423 Ga0207663_112394232 77
319 3300025917 Ga0207660_10252878 Ga0207660_102528782 77
320 3300025918 Ga0207662_10076125 Ga0207662_100761253 77
321 3300025919 Ga0207657_10005734 Ga0207657_100057346 77
322 3300025920 Ga0207649_11652916 Ga0207649_116529162 77
323 3300025922 Ga0207646_10002084 Ga0207646_100020846 77
324 3300025922 Ga0207646_10106219 Ga0207646_101062192 77
325 3300025922 Ga0207646_10860160 Ga0207646_108601602 77
326 3300025923 Ga0207681_10569950 Ga0207681_105699501 77
327 3300025924 Ga0207694_10236562 Ga0207694_102365622 77
328 3300025924 Ga0207694_10616994 Ga0207694_106169942 77
329 3300025925 Ga0207650_11120141 Ga0207650_111201412 77
330 3300025925 Ga0207650_11653268 Ga0207650_116532681 77
331 3300025926 Ga0207659_10725789 Ga0207659_107257892 77
332 3300025927 Ga0207687_10061086 Ga0207687_100610862 77
333 3300025927 Ga0207687_10084108 Ga0207687_100841082 77
334 3300025927 Ga0207687_10588203 Ga0207687_105882032 77
335 3300025931 Ga0207644_10076517 Ga0207644_100765172 77
336 3300025931 Ga0207644_11371718 Ga0207644_113717182 77
337 3300025932 Ga0207690_10036657 Ga0207690_100366574 77
338 3300025933 Ga0207706_10965514 Ga0207706_109655142 77
339 3300025933 Ga0207706_11266353 Ga0207706_112663532 77
340 3300025934 Ga0207686_10018659 Ga0207686_100186594 77
341 3300025935 Ga0207709_10002279 Ga0207709_100022795 77
342 3300025935 Ga0207709_10105143 Ga0207709_101051431 77
343 3300025935 Ga0207709_10300259 Ga0207709_103002593 77
344 3300025935 Ga0207709_11690015 Ga0207709_116900152 77
345 3300025936 Ga0207670_10482394 Ga0207670_104823942 77
346 3300025937 Ga0207669_10230351 Ga0207669_102303512 77
347 3300025937 Ga0207669_10771895 Ga0207669_107718952 77
348 3300025937 Ga0207669_11264158 Ga0207669_112641581 77
349 3300025938 Ga0207704_10396629 Ga0207704_103966292 77
350 3300025938 Ga0207704_11011654 Ga0207704_110116542 77
351 3300025939 Ga0207665_11166650 Ga0207665_111666501 77
352 3300025940 Ga0207691_10089027 Ga0207691_100890272 77
353 3300025940 Ga0207691_10158656 Ga0207691_101586561 77
354 3300025941 Ga0207711_10048602 Ga0207711_100486022 77
355 3300025941 Ga0207711_11039159 Ga0207711_110391592 77
356 3300025942 Ga0207689_10143327 Ga0207689_101433272 77
357 3300025942 Ga0207689_10458659 Ga0207689_104586592 77
358 3300025944 Ga0207661_10734066 Ga0207661_107340662 77
359 3300025944 Ga0207661_10972888 Ga0207661_109728882 77
360 3300025949 Ga0207667_11837225 Ga0207667_118372251 77
361 3300025960 Ga0207651_10335363 Ga0207651_103353632 77
362 3300025960 Ga0207651_10529899 Ga0207651_105298992 77
363 3300025960 Ga0207651_10677728 Ga0207651_106777282 77
364 3300025960 Ga0207651_10789893 Ga0207651_107898931 77
365 3300025961 Ga0207712_10017012 Ga0207712_100170124 77
366 3300025961 Ga0207712_11198873 Ga0207712_111988732 77
367 3300025972 Ga0207668_11352817 Ga0207668_113528172 77
368 3300025981 Ga0207640_11673716 Ga0207640_116737162 77
369 3300025986 Ga0207658_10423210 Ga0207658_104232102 77
370 3300026023 Ga0207677_11215515 Ga0207677_112155152 77
371 3300026023 Ga0207677_12077461 Ga0207677_120774612 77
372 3300026067 Ga0207678_10040965 Ga0207678_100409654 77
373 3300026067 Ga0207678_10642799 Ga0207678_106427992 77
374 3300026075 Ga0207708_10001945 Ga0207708_1000194514 77
375 3300026078 Ga0207702_12116570 Ga0207702_121165702 77
376 3300026088 Ga0207641_11076338 Ga0207641_110763382 77
377 3300026089 Ga0207648_10000729 Ga0207648_100007296 77
378 3300026089 Ga0207648_10479189 Ga0207648_104791892 77
379 3300026095 Ga0207676_10441727 Ga0207676_104417272 77
380 3300026095 Ga0207676_10638541 Ga0207676_106385412 77
381 3300026095 Ga0207676_10980317 Ga0207676_109803172 77
382 3300026118 Ga0207675_100036337 Ga0207675_1000363372 77
383 3300026121 Ga0207683_10000371 Ga0207683_1000037112 77
384 3300026121 Ga0207683_10115021 Ga0207683_101150212 77
385 3300026121 Ga0207683_10845016 Ga0207683_108450162 77
386 3300026121 Ga0207683_11125968 Ga0207683_111259682 77
387 3300026121 Ga0207683_11514111 Ga0207683_115141112 77
388 3300027907 Ga0207428_10151321 Ga0207428_101513212 77
389 3300028379 Ga0268266_10302514 Ga0268266_103025143 77
390 3300028381 Ga0268264_10249503 Ga0268264_102495032 77
391 3300031548 Ga0307408_100211308 Ga0307408_1002113082 77
392 3300031824 Ga0307413_10973168 Ga0307413_109731682 77
393 3300031852 Ga0307410_10273843 Ga0307410_102738431 77
394 3300031901 Ga0307406_10511425 Ga0307406_105114251 77
395 3300031903 Ga0307407_11339629 Ga0307407_113396292 77
396 3300031911 Ga0307412_10277027 Ga0307412_102770272 77
397 3300031995 Ga0307409_100274520 Ga0307409_1002745202 77
398 3300032002 Ga0307416_100202071 Ga0307416_1002020712 77
399 3300032004 Ga0307414_10093969 Ga0307414_100939693 77
400 3300032005 Ga0307411_10006254 Ga0307411_100062545 77
401 3300032126 Ga0307415_100262326 Ga0307415_1002623262 77
402 3300035089 Ga0373944_0072385 Ga0373944_0072385_500_733 77
403 3300035116 Ga0373945_0317780 Ga0373945_0317780_205_438 77
404 3300035121 Ga0373960_0201523 Ga0373960_0201523_84_320 77
405 3300035170 Ga0373943_0154117 Ga0373943_0154117_908_1141 77
406 3300035171 Ga0373946_0269478 Ga0373946_0269478_63_296 77
407 3300035171 Ga0373946_0478711 Ga0373946_0478711_62_298 77
408 3300035410 Ga0373924_0245885 Ga0373924_0245885_94_327 77
409 3300035692 Ga0373935_0454210 Ga0373935_0454210_350_583 77
410 3300035692 Ga0373935_0628699 Ga0373935_0628699_403_636 77
411 3300035725 Ga0373947_0447185 Ga0373947_0447185_225_458 77
412 3300037068 Ga0373925_0787965 Ga0373925_0787965_103_336 77
413 3300037312 Ga0395899_0022531 Ga0395899_0022531_3162_3395 77
414 3300037312 Ga0395899_0033165 Ga0395899_0033165_389_622 77
415 3300037312 Ga0395899_0038343 Ga0395899_0038343_1243_1476 77
416 3300037312 Ga0395899_0088914 Ga0395899_0088914_1565_1798 77
417 3300037312 Ga0395899_0099786 Ga0395899_0099786_482_715 77
418 3300037312 Ga0395899_0190534 Ga0395899_0190534_582_815 77
419 3300037312 Ga0395899_0254580 Ga0395899_0254580_526_759 77
420 3300037312 Ga0395899_0645185 Ga0395899_0645185_51_287 77
421 3300037418 Ga0395900_0000988 Ga0395900_0000988_36609_36842 77
422 3300037418 Ga0395900_0002063 Ga0395900_0002063_4747_4980 77
423 3300037418 Ga0395900_0005985 Ga0395900_0005985_7272_7505 77
424 3300037418 Ga0395900_0053920 Ga0395900_0053920_1870_2103 77
425 3300037418 Ga0395900_0057355 Ga0395900_0057355_3375_3608 77
426 3300037418 Ga0395900_0080628 Ga0395900_0080628_275_508 77
427 3300037418 Ga0395900_0088912 Ga0395900_0088912_1007_1240 77
428 3300037418 Ga0395900_0113594 Ga0395900_0113594_386_619 77
429 3300037418 Ga0395900_0144113 Ga0395900_0144113_1656_1889 77
430 3300037418 Ga0395900_0389205 Ga0395900_0389205_844_1080 77
431 3300037418 Ga0395900_0637948 Ga0395900_0637948_224_460 77
432 3300037418 Ga0395900_1090026 Ga0395900_1090026_339_572 77
433 3300037418 Ga0395900_1498205 Ga0395900_1498205_172_405 77
434 3300037466 Ga0395898_0002378 Ga0395898_0002378_20829_21065 77
435 3300037466 Ga0395898_0008324 Ga0395898_0008324_7811_8044 77
436 3300037466 Ga0395898_0013193 Ga0395898_0013193_504_737 77
437 3300037466 Ga0395898_0013852 Ga0395898_0013852_3125_3358 77
438 3300037466 Ga0395898_0017918 Ga0395898_0017918_4070_4303 77
439 3300037466 Ga0395898_0032460 Ga0395898_0032460_3234_3467 77
440 3300037466 Ga0395898_0035150 Ga0395898_0035150_2171_2404 77
441 3300037466 Ga0395898_0106469 Ga0395898_0106469_817_1050 77
442 3300037466 Ga0395898_0409112 Ga0395898_0409112_683_916 77
443 3300037466 Ga0395898_0478844 Ga0395898_0478844_87_323 77
444 3300037466 Ga0395898_0619327 Ga0395898_0619327_42_275 77
445 3300037466 Ga0395898_0640903 Ga0395898_0640903_352_585 77
446 3300037466 Ga0395898_0743063 Ga0395898_0743063_522_755 77
447 3300037466 Ga0395898_0938463 Ga0395898_0938463_559_792 77
448 3300037466 Ga0395898_1360257 Ga0395898_1360257_14_247 77
449 3300037471 Ga0395905_0002715 Ga0395905_0002715_3219_3452 77
450 3300037471 Ga0395905_0003035 Ga0395905_0003035_12890_13123 77
451 3300037471 Ga0395905_0007299 Ga0395905_0007299_168_401 77
452 3300037471 Ga0395905_0059256 Ga0395905_0059256_2660_2893 77
453 3300037471 Ga0395905_0082063 Ga0395905_0082063_1136_1369 77
454 3300037471 Ga0395905_0097845 Ga0395905_0097845_63_296 77
455 3300037471 Ga0395905_0117956 Ga0395905_0117956_148_381 77
456 3300037471 Ga0395905_0121054 Ga0395905_0121054_190_423 77
457 3300037471 Ga0395905_0299902 Ga0395905_0299902_232_465 77
458 3300037471 Ga0395905_0301623 Ga0395905_0301623_168_401 77
459 3300037471 Ga0395905_0780304 Ga0395905_0780304_91_327 77
460 3300037471 Ga0395905_1033072 Ga0395905_1033072_376_609 77
461 3300037471 Ga0395905_1047519 Ga0395905_1047519_424_657 77
462 3300038443 Ga0395901_0001046 Ga0395901_0001046_18012_18245 77
463 3300038443 Ga0395901_0001699 Ga0395901_0001699_16784_17017 77
464 3300038443 Ga0395901_0003426 Ga0395901_0003426_14994_15230 77
465 3300038443 Ga0395901_0010485 Ga0395901_0010485_4109_4342 77
466 3300038443 Ga0395901_0018396 Ga0395901_0018396_4736_4969 77
467 3300038443 Ga0395901_0018546 Ga0395901_0018546_4238_4471 77
468 3300038443 Ga0395901_0042124 Ga0395901_0042124_3946_4179 77
469 3300038443 Ga0395901_0093900 Ga0395901_0093900_25_258 77
470 3300038443 Ga0395901_0123365 Ga0395901_0123365_904_1137 77
471 3300038443 Ga0395901_0148878 Ga0395901_0148878_1085_1321 77
472 3300038443 Ga0395901_0244233 Ga0395901_0244233_1603_1836 77
473 3300038443 Ga0395901_0255087 Ga0395901_0255087_1254_1487 77
474 3300038443 Ga0395901_0518308 Ga0395901_0518308_184_417 77
475 3300038996 Ga0242420_040922 Ga0242420_040922_592_825 77
476 3300041406 Ga0439439_0007490 Ga0439439_0007490_1889_2125 77
477 3300041407 Ga0439447_057347 Ga0439447_057347_609_854 77
478 3300041408 Ga0439453_0008494 Ga0439453_0008494_1316_1558 77
479 3300041408 Ga0439453_0016934 Ga0439453_0016934_363_596 77
480 3300041410 Ga0439461_0009675 Ga0439461_0009675_352_597 77
481 3300041410 Ga0439461_0181543 Ga0439461_0181543_11_247 77
482 3300041411 Ga0439466_0017305 Ga0439466_0017305_734_979 77
483 3300041441 Ga0451787_779493 Ga0451787_779493_123_359 77
484 3300041451 Ga0451791_0313989 Ga0451791_0313989_275_511 77
485 3300041463 Ga0451804_0468228 Ga0451804_0468228_72_308 77
486 3300041486 Ga0451807_1707017 Ga0451807_1707017_298_531 77
487 3300041486 Ga0451807_2106395 Ga0451807_2106395_43_276 77
488 3300041486 Ga0451807_2349782 Ga0451807_2349782_652_888 77
489 3300041501 Ga0451845_0055735 Ga0451845_0055735_204_437 77
490 3300041507 Ga0451851_0221635 Ga0451851_0221635_119_355 77
491 3300041512 Ga0451853_1978009 Ga0451853_1978009_357_590 77
492 3300041512 Ga0451853_3554456 Ga0451853_3554456_116_349 77
493 3300041997 Ga0439431_0056367 Ga0439431_0056367_419_655 77
494 3300041997 Ga0439431_0059363 Ga0439431_0059363_214_459 77
495 3300041999 Ga0439433_0022736 Ga0439433_0022736_968_1204 77
496 3300042002 Ga0439442_008538 Ga0439442_008538_1388_1624 77
497 3300042004 Ga0439445_0050291 Ga0439445_0050291_347_592 77
498 3300042006 Ga0439432_116182 Ga0439432_116182_152_397 77
499 3300042007 Ga0439449_0104827 Ga0439449_0104827_52_288 77
500 3300042015 Ga0439462_0170798 Ga0439462_0170798_156_392 77
501 3300042156 Ga0439446_0022934 Ga0439446_0022934_27_263 77
502 3300042435 Ga0439434_0008986 Ga0439434_0008986_1497_1733 77
503 3300042435 Ga0439434_0024871 Ga0439434_0024871_1466_1711 77
504 3300042437 Ga0439444_0071645 Ga0439444_0071645_376_609 77
505 3300042461 Ga0439460_0339529 Ga0439460_0339529_278_517 77
506 3300042530 Ga0450916_006961 Ga0450916_006961_572_811 77
507 3300044735 Ga0466968_0684648 Ga0466968_0684648_158_403 77
508 3300044901 Ga0466960_0491204 Ga0466960_0491204_333_566 77
509 3300046452 Ga0495617_090807 Ga0495617_090807_746_979 77
510 3300046455 Ga0495603_0003598 Ga0495603_0003598_1498_1731 77
511 3300046455 Ga0495603_0395392 Ga0495603_0395392_206_439 77
512 3300046455 Ga0495603_0854936 Ga0495603_0854936_153_389 77
513 3300046459 Ga0495629_0320215 Ga0495629_0320215_466_699 77
514 3300046461 Ga0495641_0051667 Ga0495641_0051667_262_495 77
515 3300046471 Ga0495650_0293912 Ga0495650_0293912_74_307 77
516 3300046472 Ga0495580_0506543 Ga0495580_0506543_165_398 77
517 3300046473 Ga0495582_0018874 Ga0495582_0018874_2928_3161 77
518 3300046474 Ga0495605_0017402 Ga0495605_0017402_60_293 77
519 3300046475 Ga0495639_0029403 Ga0495639_0029403_1443_1676 77
520 3300046476 Ga0495662_0135958 Ga0495662_0135958_219_452 77
521 3300046491 Ga0495584_0299410 Ga0495584_0299410_39_272 77
522 3300046491 Ga0495584_0366049 Ga0495584_0366049_231_464 77
523 3300046492 Ga0495585_0139613 Ga0495585_0139613_548_781 77
524 3300046492 Ga0495585_0468307 Ga0495585_0468307_10_243 77
525 3300046499 Ga0495594_0064016 Ga0495594_0064016_580_813 77
526 3300046499 Ga0495594_0262241 Ga0495594_0262241_624_860 77
527 3300046499 Ga0495594_0403188 Ga0495594_0403188_156_392 77
528 3300046500 Ga0495596_0085391 Ga0495596_0085391_147_380 77
529 3300046500 Ga0495596_0090469 Ga0495596_0090469_416_652 77
530 3300046500 Ga0495596_0098507 Ga0495596_0098507_838_1071 77
531 3300046500 Ga0495596_0213644 Ga0495596_0213644_392_628 77
532 3300046500 Ga0495596_0389189 Ga0495596_0389189_55_288 77
533 3300046501 Ga0495607_0353378 Ga0495607_0353378_294_527 77
534 3300046511 Ga0495608_0861703 Ga0495608_0861703_121_357 77
535 3300046517 Ga0495630_0012009 Ga0495630_0012009_688_921 77
536 3300046517 Ga0495630_0110219 Ga0495630_0110219_732_968 77
537 3300046517 Ga0495630_0727134 Ga0495630_0727134_284_517 77
538 3300046518 Ga0495631_0297570 Ga0495631_0297570_36_272 77
539 3300046518 Ga0495631_0315503 Ga0495631_0315503_329_562 77
540 3300046523 Ga0495644_0101181 Ga0495644_0101181_779_1012 77
541 3300046525 Ga0495663_0264362 Ga0495663_0264362_74_307 77
542 3300046526 Ga0495666_0321865 Ga0495666_0321865_331_564 77
543 3300046528 Ga0495642_0034277 Ga0495642_0034277_1505_1738 77
544 3300046528 Ga0495642_0037234 Ga0495642_0037234_242_475 77
545 3300046530 Ga0495654_0282489 Ga0495654_0282489_229_462 77
546 3300046531 Ga0495665_0044630 Ga0495665_0044630_881_1114 77
547 3300046533 Ga0495640_0142921 Ga0495640_0142921_24_260 77
548 3300046538 Ga0495609_0061570 Ga0495609_0061570_567_800 77
549 3300046538 Ga0495609_0167691 Ga0495609_0167691_625_858 77
550 3300046538 Ga0495609_0364480 Ga0495609_0364480_128_361 77
551 3300046539 Ga0495621_0437540 Ga0495621_0437540_249_482 77
552 3300046557 Ga0495622_0168160 Ga0495622_0168160_537_773 77
553 3300046559 Ga0495667_0256354 Ga0495667_0256354_235_471 77
554 3300046615 Ga0495656_0019782 Ga0495656_0019782_1679_1912 77
555 3300046615 Ga0495656_0147414 Ga0495656_0147414_541_774 77
556 3300046615 Ga0495656_0476277 Ga0495656_0476277_176_412 77
557 3300046615 Ga0495656_0830679 Ga0495656_0830679_129_362 77
558 3300046616 Ga0495668_0556497 Ga0495668_0556497_344_577 77
559 3300046616 Ga0495668_0612493 Ga0495668_0612493_270_503 77
560 3300046642 Ga0495634_0187769 Ga0495634_0187769_31_267 77
561 3300046663 Ga0495635_0182985 Ga0495635_0182985_603_839 77
562 3300046664 Ga0495659_0016908 Ga0495659_0016908_690_923 77
563 3300046664 Ga0495659_0022431 Ga0495659_0022431_123_356 77
564 3300046665 Ga0495661_0419653 Ga0495661_0419653_59_304 77
565 3300046674 Ga0495588_0184588 Ga0495588_0184588_607_840 77
566 3300046674 Ga0495588_0383476 Ga0495588_0383476_358_594 77
567 3300046681 Ga0495647_0132687 Ga0495647_0132687_614_847 77
568 3300046683 Ga0495658_0162276 Ga0495658_0162276_470_703 77
569 3300046683 Ga0495658_0649578 Ga0495658_0649578_200_436 77
570 3300046794 Ga0495589_0133469 Ga0495589_0133469_589_822 77
571 3300046794 Ga0495589_0332904 Ga0495589_0332904_450_683 77
572 3300046809 Ga0495600_0947538 Ga0495600_0947538_249_485 77
573 3300047315 Ga0495581_0023230 Ga0495581_0023230_2932_3165 77
574 3300047318 Ga0495636_0133745 Ga0495636_0133745_790_1023 77
575 3300047318 Ga0495636_0659017 Ga0495636_0659017_202_435 77
576 3300047319 Ga0495674_0607086 Ga0495674_0607086_154_390 77
577 3300047321 Ga0495676_0031351 Ga0495676_0031351_3088_3321 77
578 3300047321 Ga0495676_0408772 Ga0495676_0408772_566_799 77
579 3300047321 Ga0495676_0637282 Ga0495676_0637282_274_510 77
580 3300047321 Ga0495676_0737285 Ga0495676_0737285_199_432 77
581 3300047322 Ga0495680_0596448 Ga0495680_0596448_15_251 77
582 3300047323 Ga0495683_0434252 Ga0495683_0434252_40_273 77
583 3300047444 Ga0495675_0260068 Ga0495675_0260068_732_968 77
584 3300047445 Ga0495677_0082340 Ga0495677_0082340_383_616 77
585 3300047445 Ga0495677_0113001 Ga0495677_0113001_677_910 77
586 3300047471 Ga0495684_0820438 Ga0495684_0820438_54_290 77
587 3300047673 Ga0495593_0576006 Ga0495593_0576006_184_420 77
588 3300048089 Ga0495614_0033172 Ga0495614_0033172_1861_2094 77
589 3300048089 Ga0495614_0154491 Ga0495614_0154491_96_332 77
590 3300048903 Ga0496100_0035339 Ga0496100_0035339_906_1139 77
591 3300048903 Ga0496100_0109827 Ga0496100_0109827_1539_1772 77
592 3300048903 Ga0496100_0529955 Ga0496100_0529955_59_292 77
593 3300048903 Ga0496100_0574888 Ga0496100_0574888_196_429 77
594 3300048903 Ga0496100_1124085 Ga0496100_1124085_369_602 77
595 3300048904 Ga0496101_0050410 Ga0496101_0050410_1823_2056 77
596 3300048904 Ga0496101_0120147 Ga0496101_0120147_521_754 77
597 3300048904 Ga0496101_0127460 Ga0496101_0127460_941_1174 77
598 3300048904 Ga0496101_0568365 Ga0496101_0568365_524_757 77
599 3300048904 Ga0496101_1318314 Ga0496101_1318314_103_336 77
600 3300048905 Ga0496102_0162996 Ga0496102_0162996_1556_1789 77
601 3300048905 Ga0496102_0300467 Ga0496102_0300467_975_1208 77
602 3300048905 Ga0496102_0309560 Ga0496102_0309560_565_798 77
603 3300048905 Ga0496102_0314392 Ga0496102_0314392_1073_1306 77
604 3300048905 Ga0496102_0708447 Ga0496102_0708447_489_722 77
605 3300048906 Ga0496103_0003329 Ga0496103_0003329_7673_7906 77
606 3300048906 Ga0496103_0170263 Ga0496103_0170263_593_826 77
607 3300048906 Ga0496103_0737572 Ga0496103_0737572_351_584 77
608 3300048907 Ga0496104_0010781 Ga0496104_0010781_6278_6511 77
609 3300048907 Ga0496104_0093973 Ga0496104_0093973_417_650 77
610 3300048907 Ga0496104_0110759 Ga0496104_0110759_307_540 77
611 3300048907 Ga0496104_0337652 Ga0496104_0337652_1046_1279 77
612 3300048907 Ga0496104_0719935 Ga0496104_0719935_167_400 77
613 3300048907 Ga0496104_0964894 Ga0496104_0964894_383_619 77
614 3300048908 Ga0496105_0035782 Ga0496105_0035782_3759_3992 77
615 3300048908 Ga0496105_0038830 Ga0496105_0038830_1232_1465 77
616 3300048908 Ga0496105_0074441 Ga0496105_0074441_312_545 77
617 3300048908 Ga0496105_0265897 Ga0496105_0265897_854_1087 77
618 3300048908 Ga0496105_0962457 Ga0496105_0962457_212_445 77
619 3300048909 Ga0496106_0341441 Ga0496106_0341441_29_262 77
620 3300048909 Ga0496106_0463972 Ga0496106_0463972_17_250 77
621 3300048909 Ga0496106_0743058 Ga0496106_0743058_253_486 77
622 3300048910 Ga0496107_0069669 Ga0496107_0069669_187_420 77
623 3300048910 Ga0496107_0164978 Ga0496107_0164978_956_1189 77
624 3300048910 Ga0496107_0217003 Ga0496107_0217003_1156_1389 77
625 3300048910 Ga0496107_0481286 Ga0496107_0481286_469_702 77
626 3300048910 Ga0496107_0790897 Ga0496107_0790897_267_500 77
627 3300048911 Ga0496108_0000888 Ga0496108_0000888_18741_18974 77
628 3300048911 Ga0496108_0029530 Ga0496108_0029530_1182_1415 77
629 3300048911 Ga0496108_0037251 Ga0496108_0037251_3237_3470 77
630 3300048911 Ga0496108_0928480 Ga0496108_0928480_100_336 77
631 3300048911 Ga0496108_1109214 Ga0496108_1109214_148_381 77
632 3300048912 Ga0496109_0000579 Ga0496109_0000579_9577_9810 77
633 3300048912 Ga0496109_0023066 Ga0496109_0023066_3072_3305 77
634 3300048912 Ga0496109_0046089 Ga0496109_0046089_1514_1747 77
635 3300048912 Ga0496109_0103298 Ga0496109_0103298_2064_2297 77
636 3300048912 Ga0496109_0252043 Ga0496109_0252043_757_990 77
637 3300048912 Ga0496109_1418749 Ga0496109_1418749_351_587 77
638 3300048912 Ga0496109_2037791 Ga0496109_2037791_134_367 77
639 3300048913 Ga0496110_0046372 Ga0496110_0046372_2524_2757 77
640 3300048913 Ga0496110_0483113 Ga0496110_0483113_124_357 77
641 3300048913 Ga0496110_0502764 Ga0496110_0502764_822_1055 77
642 3300048913 Ga0496110_1305396 Ga0496110_1305396_268_501 77
643 3300048914 Ga0496111_0000740 Ga0496111_0000740_7713_7946 77
644 3300048914 Ga0496111_0010160 Ga0496111_0010160_117_350 77
645 3300048914 Ga0496111_0132691 Ga0496111_0132691_797_1030 77
646 3300048914 Ga0496111_0173037 Ga0496111_0173037_435_668 77
647 3300048914 Ga0496111_0590572 Ga0496111_0590572_527_760 77
648 3300048915 Ga0496112_0023965 Ga0496112_0023965_2098_2331 77
649 3300048915 Ga0496112_0025847 Ga0496112_0025847_515_748 77
650 3300048915 Ga0496112_0268839 Ga0496112_0268839_764_997 77
651 3300048915 Ga0496112_0385940 Ga0496112_0385940_121_354 77
652 3300048915 Ga0496112_0543994 Ga0496112_0543994_212_445 77
653 3300048915 Ga0496112_1469871 Ga0496112_1469871_107_340 77
654 3300048916 Ga0496113_0002956 Ga0496113_0002956_677_910 77
655 3300048916 Ga0496113_0027155 Ga0496113_0027155_716_949 77
656 3300048916 Ga0496113_0601799 Ga0496113_0601799_418_651 77
657 3300048916 Ga0496113_1353574 Ga0496113_1353574_54_287 77
658 3300048917 Ga0496114_0004206 Ga0496114_0004206_3130_3363 77
659 3300048917 Ga0496114_0048630 Ga0496114_0048630_698_931 77
660 3300048917 Ga0496114_0097333 Ga0496114_0097333_1598_1831 77
661 3300048917 Ga0496114_0420997 Ga0496114_0420997_483_716 77
662 3300048917 Ga0496114_0583412 Ga0496114_0583412_522_755 77
663 3300048917 Ga0496114_1261673 Ga0496114_1261673_214_447 77
664 3300048918 Ga0496115_0025065 Ga0496115_0025065_3195_3428 77
665 3300048918 Ga0496115_0090245 Ga0496115_0090245_2248_2481 77
666 3300049460 Ga0495682_0354447 Ga0495682_0354447_229_465 77
667 3300049568 Ga0501031_0002104 Ga0501031_0002104_1055_1288 77
668 3300049568 Ga0501031_0005456 Ga0501031_0005456_4410_4646 77
669 3300049569 Ga0501032_0011530 Ga0501032_0011530_249_482 77
670 3300049569 Ga0501032_0024599 Ga0501032_0024599_1480_1716 77
671 3300049569 Ga0501032_0878570 Ga0501032_0878570_247_483 77
672 3300049570 Ga0501033_0027249 Ga0501033_0027249_280_513 77
673 3300049570 Ga0501033_0033545 Ga0501033_0033545_2517_2753 77
674 3300049571 Ga0501034_0301122 Ga0501034_0301122_977_1210 77
675 3300049571 Ga0501034_1261068 Ga0501034_1261068_151_387 77
676 3300049572 Ga0501036_0003750 Ga0501036_0003750_3707_3943 77
677 3300049572 Ga0501036_0043992 Ga0501036_0043992_2493_2726 77
678 3300049573 Ga0501037_0012070 Ga0501037_0012070_2112_2345 77
679 3300049573 Ga0501037_0169349 Ga0501037_0169349_143_379 77
680 3300049574 Ga0501038_0001738 Ga0501038_0001738_2035_2268 77
681 3300049574 Ga0501038_0075933 Ga0501038_0075933_410_646 77
682 3300049575 Ga0501039_0004321 Ga0501039_0004321_1499_1735 77
683 3300049575 Ga0501039_0219827 Ga0501039_0219827_488_721 77
684 3300049575 Ga0501039_1522167 Ga0501039_1522167_190_423 77
685 3300049576 Ga0501040_0020310 Ga0501040_0020310_3011_3247 77
686 3300049576 Ga0501040_0096298 Ga0501040_0096298_1055_1288 77
687 3300049577 Ga0501041_0007434 Ga0501041_0007434_2493_2726 77
688 3300049577 Ga0501041_0011358 Ga0501041_0011358_510_746 77
689 3300049577 Ga0501041_0465831 Ga0501041_0465831_128_364 77
690 3300049578 Ga0501042_0055945 Ga0501042_0055945_1642_1878 77
691 3300049578 Ga0501042_0355071 Ga0501042_0355071_32_265 77
692 3300049578 Ga0501042_1417282 Ga0501042_1417282_49_285 77
693 3300049579 Ga0501043_0026222 Ga0501043_0026222_322_555 77
694 3300049579 Ga0501043_0057037 Ga0501043_0057037_334_570 77
695 3300049580 Ga0501046_0007988 Ga0501046_0007988_6440_6676 77
696 3300049580 Ga0501046_0016257 Ga0501046_0016257_3941_4174 77
697 3300049581 Ga0501047_0283721 Ga0501047_0283721_647_880 77
698 3300049581 Ga0501047_0422818 Ga0501047_0422818_676_912 77
699 3300049582 Ga0501048_0014089 Ga0501048_0014089_1013_1246 77
700 3300049582 Ga0501048_0015761 Ga0501048_0015761_2259_2495 77
701 3300049583 Ga0501067_0023969 Ga0501067_0023969_906_1139 77
702 3300049583 Ga0501067_0063060 Ga0501067_0063060_889_1122 77
703 3300049583 Ga0501067_0551036 Ga0501067_0551036_243_476 77
704 3300049584 Ga0501068_0014980 Ga0501068_0014980_1927_2163 77
705 3300049584 Ga0501068_0018445 Ga0501068_0018445_3288_3521 77
706 3300049584 Ga0501068_0070302 Ga0501068_0070302_764_997 77
707 3300049585 Ga0501069_0017407 Ga0501069_0017407_597_830 77
708 3300049585 Ga0501069_0021451 Ga0501069_0021451_472_708 77
709 3300049585 Ga0501069_0093285 Ga0501069_0093285_423_656 77
710 3300049586 Ga0501070_0018595 Ga0501070_0018595_3218_3454 77
711 3300049586 Ga0501070_0040915 Ga0501070_0040915_3384_3617 77
712 3300049587 Ga0501071_0023319 Ga0501071_0023319_2095_2331 77
713 3300049588 Ga0501072_0008209 Ga0501072_0008209_2814_3050 77
714 3300049588 Ga0501072_0343949 Ga0501072_0343949_703_936 77
715 3300049589 Ga0501073_0141889 Ga0501073_0141889_1013_1246 77
716 3300049590 Ga0501074_0032754 Ga0501074_0032754_2268_2501 77
717 3300049590 Ga0501074_0602645 Ga0501074_0602645_283_516 77
718 3300049591 Ga0501075_0021058 Ga0501075_0021058_3748_3984 77
719 3300049591 Ga0501075_0074277 Ga0501075_0074277_2093_2326 77
720 3300049591 Ga0501075_0541864 Ga0501075_0541864_577_813 77
721 3300049591 Ga0501075_0796745 Ga0501075_0796745_402_635 77
722 3300049592 Ga0501076_0040309 Ga0501076_0040309_403_639 77
723 3300049592 Ga0501076_0103895 Ga0501076_0103895_2005_2241 77
724 3300049593 Ga0501077_0003160 Ga0501077_0003160_3616_3852 77
725 3300049593 Ga0501077_0010173 Ga0501077_0010173_1606_1839 77
726 3300049593 Ga0501077_0019528 Ga0501077_0019528_2010_2246 77
727 3300049593 Ga0501077_0057383 Ga0501077_0057383_2022_2258 77
728 3300049593 Ga0501077_0987687 Ga0501077_0987687_75_311 77
729 3300049652 Ga0501202_115537 Ga0501202_115537_145_384 77
730 3300049655 Ga0501208_057734 Ga0501208_057734_346_585 77
731 3300049705 Ga0501225_0194502 Ga0501225_0194502_18_257 77
732 3300049741 Ga0501079_0015725 Ga0501079_0015725_4876_5112 77
733 3300049741 Ga0501079_0108925 Ga0501079_0108925_76_312 77
734 3300049741 Ga0501079_1274959 Ga0501079_1274959_146_382 77
735 3300049741 Ga0501079_1535306 Ga0501079_1535306_44_277 77
736 3300049742 Ga0501080_0005055 Ga0501080_0005055_8988_9224 77
737 3300049742 Ga0501080_0077142 Ga0501080_0077142_522_755 77
738 3300049743 Ga0501081_0070856 Ga0501081_0070856_1558_1794 77
739 3300049743 Ga0501081_0133393 Ga0501081_0133393_1245_1481 77
740 3300049743 Ga0501081_0341546 Ga0501081_0341546_410_643 77
741 3300049743 Ga0501081_0927018 Ga0501081_0927018_390_626 77
742 3300049744 Ga0501083_0011129 Ga0501083_0011129_4696_4929 77
743 3300049744 Ga0501083_0025651 Ga0501083_0025651_2080_2316 77
744 3300049822 Ga0501035_0020546 Ga0501035_0020546_1264_1497 77
745 3300049822 Ga0501035_0062145 Ga0501035_0062145_1789_2025 77
746 3300049823 Ga0501044_0380562 Ga0501044_0380562_269_502 77
747 3300049824 Ga0501045_0028313 Ga0501045_0028313_975_1211 77
748 3300049824 Ga0501045_0262624 Ga0501045_0262624_1005_1241 77
749 3300049824 Ga0501045_1030655 Ga0501045_1030655_234_470 77
750 3300050490 nmdc:mga03n38_119650_c1 nmdc:mga03n38_119650_c1_240_473 77
751 3300050490 nmdc:mga03n38_130389_c1 nmdc:mga03n38_130389_c1_97_330 77
752 3300050491 nmdc:mga00v17_1018011_c1 nmdc:mga00v17_1018011_c1_169_408 77
753 3300050492 nmdc:mga0yw44_176692_c1 nmdc:mga0yw44_176692_c1_734_967 77
754 3300050494 nmdc:mga06z11_73231_c1 nmdc:mga06z11_73231_c1_1224_1457 77
755 3300050507 nmdc:mga05p37_1302037_c1 nmdc:mga05p37_1302037_c1_341_577 77
756 3300050507 nmdc:mga05p37_143122_c1 nmdc:mga05p37_143122_c1_2105_2338 77
757 3300050507 nmdc:mga05p37_2157702_c1 nmdc:mga05p37_2157702_c1_61_294 77
758 3300050507 nmdc:mga05p37_366184_c1 nmdc:mga05p37_366184_c1_391_633 77
759 3300050507 nmdc:mga05p37_37598_c1 nmdc:mga05p37_37598_c1_1895_2128 77
760 3300050507 nmdc:mga05p37_789549_c1 nmdc:mga05p37_789549_c1_408_647 77
761 3300050508 nmdc:mga09592_1452417_c1 nmdc:mga09592_1452417_c1_32_271 77
762 3300050510 nmdc:mga06r32_531736_c1 nmdc:mga06r32_531736_c1_369_602 77
763 3300050511 nmdc:mga08y16_230320_c1 nmdc:mga08y16_230320_c1_400_633 77
764 3300050511 nmdc:mga08y16_460968_c1 nmdc:mga08y16_460968_c1_226_465 77
765 3300050511 nmdc:mga08y16_472875_c1 nmdc:mga08y16_472875_c1_129_362 77
766 3300050512 nmdc:mga0n895_292131_c1 nmdc:mga0n895_292131_c1_53_289 77
767 3300050512 nmdc:mga0n895_320963_c1 nmdc:mga0n895_320963_c1_351_584 77
768 3300050512 nmdc:mga0n895_625350_c1 nmdc:mga0n895_625350_c1_524_757 77
769 3300050513 nmdc:mga0rr50_340238_c1 nmdc:mga0rr50_340238_c1_678_911 77
770 3300050514 nmdc:mga08x19_25564_c1 nmdc:mga08x19_25564_c1_3004_3237 77
771 3300050514 nmdc:mga08x19_285560_c1 nmdc:mga08x19_285560_c1_706_948 77
772 3300050514 nmdc:mga08x19_45484_c1 nmdc:mga08x19_45484_c1_2300_2542 77
773 3300050514 nmdc:mga08x19_455034_c1 nmdc:mga08x19_455034_c1_17_250 77
774 3300050514 nmdc:mga08x19_504073_c1 nmdc:mga08x19_504073_c1_81_317 77
775 3300050515 nmdc:mga0a205_267850_c1 nmdc:mga0a205_267850_c1_675_908 77
776 3300050515 nmdc:mga0a205_584070_c1 nmdc:mga0a205_584070_c1_693_926 77
777 3300050515 nmdc:mga0a205_723269_c1 nmdc:mga0a205_723269_c1_52_294 77
778 3300053078 Ga0495612_0098898 Ga0495612_0098898_991_1227 77
779 3300053083 Ga0495655_0064262 Ga0495655_0064262_368_601 77
780 3300053084 Ga0495595_0195537 Ga0495595_0195537_380_616 77
781 3300053085 Ga0495619_0148941 Ga0495619_0148941_670_906 77
782 3300053129 Ga0500628_116877 Ga0500628_116877_269_505 77
783 3300054114 Ga0501084_0040475 Ga0501084_0040475_3215_3451 77
784 3300054114 Ga0501084_0522325 Ga0501084_0522325_522_755 77
785 3300059477 Ga0587084_157993 Ga0587084_157993_198_431 77
786 3300059490 Ga0587066_093327 Ga0587066_093327_112_345 77
787 3300059491 Ga0587070_130812 Ga0587070_130812_210_443 77
788 3300059511 Ga0587091_125332 Ga0587091_125332_146_379 77
789 3300059512 Ga0587092_126990 Ga0587092_126990_52_288 77
790 3300059626 Ga0587115_070084 Ga0587115_070084_39_272 77
791 3300059645 Ga0587076_168735 Ga0587076_168735_251_487 77
792 3300059647 Ga0587079_235290 Ga0587079_235290_170_403 77
793 3300059655 Ga0587114_142219 Ga0587114_142219_176_409 77
794 3300060353 Ga0501082_0071463 Ga0501082_0071463_412_648 77
795 3300060353 Ga0501082_1100455 Ga0501082_1100455_272_508 77
796 3300061734 Ga0530510_0048859 Ga0530510_0048859_207_443 77
797 3300061734 Ga0530510_0059205 Ga0530510_0059205_2289_2522 77
798 3300061734 Ga0530510_0222286 Ga0530510_0222286_764_997 77
799 3300061734 Ga0530510_0564009 Ga0530510_0564009_128_364 77
800 3300002244 JGI24742J22300_10120749 JGI24742J22300_101207491 78
801 3300002459 JGI24751J29686_10012957 JGI24751J29686_100129572 78
802 3300002459 JGI24751J29686_10105521 JGI24751J29686_101055211 78
803 3300005328 Ga0070676_11240665 Ga0070676_112406651 78
804 3300005329 Ga0070683_100107520 Ga0070683_1001075202 78
805 3300005330 Ga0070690_100440579 Ga0070690_1004405792 78
806 3300005331 Ga0070670_100035122 Ga0070670_1000351225 78
807 3300005334 Ga0068869_101499566 Ga0068869_1014995661 78
808 3300005335 Ga0070666_10351510 Ga0070666_103515102 78
809 3300005335 Ga0070666_10757817 Ga0070666_107578172 78
810 3300005337 Ga0070682_100146983 Ga0070682_1001469832 78
811 3300005338 Ga0068868_100004645 Ga0068868_1000046458 78
812 3300005338 Ga0068868_100411464 Ga0068868_1004114642 78
813 3300005338 Ga0068868_101332347 Ga0068868_1013323472 78
814 3300005339 Ga0070660_100212716 Ga0070660_1002127164 78
815 3300005339 Ga0070660_101639298 Ga0070660_1016392982 78
816 3300005343 Ga0070687_100231667 Ga0070687_1002316672 78
817 3300005343 Ga0070687_100400774 Ga0070687_1004007742 78
818 3300005344 Ga0070661_100127493 Ga0070661_1001274933 78
819 3300005344 Ga0070661_101165736 Ga0070661_1011657362 78
820 3300005345 Ga0070692_10525884 Ga0070692_105258842 78
821 3300005347 Ga0070668_100765461 Ga0070668_1007654612 78
822 3300005353 Ga0070669_100137167 Ga0070669_1001371672 78
823 3300005353 Ga0070669_101121927 Ga0070669_1011219272 78
824 3300005353 Ga0070669_101702887 Ga0070669_1017028871 78
825 3300005354 Ga0070675_100086477 Ga0070675_1000864775 78
826 3300005354 Ga0070675_100355596 Ga0070675_1003555962 78
827 3300005354 Ga0070675_100369674 Ga0070675_1003696742 78
828 3300005355 Ga0070671_100132893 Ga0070671_1001328932 78
829 3300005356 Ga0070674_100012612 Ga0070674_1000126126 78
830 3300005356 Ga0070674_100017188 Ga0070674_1000171882 78
831 3300005356 Ga0070674_100068919 Ga0070674_1000689195 78
832 3300005364 Ga0070673_100051568 Ga0070673_1000515684 78
833 3300005364 Ga0070673_102046588 Ga0070673_1020465882 78
834 3300005365 Ga0070688_100500419 Ga0070688_1005004192 78
835 3300005366 Ga0070659_100953356 Ga0070659_1009533562 78
836 3300005406 Ga0070703_10156817 Ga0070703_101568172 78
837 3300005438 Ga0070701_10075200 Ga0070701_100752003 78
838 3300005438 Ga0070701_10343113 Ga0070701_103431132 78
839 3300005439 Ga0070711_101542818 Ga0070711_1015428182 78
840 3300005440 Ga0070705_100128329 Ga0070705_1001283292 78
841 3300005441 Ga0070700_100015485 Ga0070700_1000154856 78
842 3300005441 Ga0070700_100332074 Ga0070700_1003320742 78
843 3300005441 Ga0070700_101834976 Ga0070700_1018349762 78
844 3300005444 Ga0070694_100072927 Ga0070694_1000729272 78
845 3300005456 Ga0070678_100004139 Ga0070678_1000041397 78
846 3300005456 Ga0070678_100099170 Ga0070678_1000991702 78
847 3300005456 Ga0070678_100571999 Ga0070678_1005719992 78
848 3300005456 Ga0070678_102226809 Ga0070678_1022268091 78
849 3300005459 Ga0068867_100082047 Ga0068867_1000820472 78
850 3300005459 Ga0068867_100863571 Ga0068867_1008635711 78
851 3300005459 Ga0068867_101211148 Ga0068867_1012111482 78
852 3300005459 Ga0068867_101822016 Ga0068867_1018220161 78
853 3300005466 Ga0070685_10009061 Ga0070685_100090616 78
854 3300005466 Ga0070685_10295037 Ga0070685_102950372 78
855 3300005467 Ga0070706_100524596 Ga0070706_1005245962 78
856 3300005468 Ga0070707_101805743 Ga0070707_1018057431 78
857 3300005471 Ga0070698_100284930 Ga0070698_1002849302 78
858 3300005518 Ga0070699_100259360 Ga0070699_1002593603 78
859 3300005518 Ga0070699_101089913 Ga0070699_1010899132 78
860 3300005535 Ga0070684_100187851 Ga0070684_1001878512 78
861 3300005535 Ga0070684_100988696 Ga0070684_1009886962 78
862 3300005543 Ga0070672_100089935 Ga0070672_1000899354 78
863 3300005543 Ga0070672_100093704 Ga0070672_1000937044 78
864 3300005544 Ga0070686_100068848 Ga0070686_1000688483 78
865 3300005544 Ga0070686_100860353 Ga0070686_1008603532 78
866 3300005546 Ga0070696_100188523 Ga0070696_1001885231 78
867 3300005548 Ga0070665_100057777 Ga0070665_1000577775 78
868 3300005564 Ga0070664_100190360 Ga0070664_1001903604 78
869 3300005564 Ga0070664_100596916 Ga0070664_1005969162 78
870 3300005577 Ga0068857_100086906 Ga0068857_1000869065 78
871 3300005578 Ga0068854_100422521 Ga0068854_1004225212 78
872 3300005578 Ga0068854_101270942 Ga0068854_1012709422 78
873 3300005615 Ga0070702_100309865 Ga0070702_1003098652 78
874 3300005615 Ga0070702_101197582 Ga0070702_1011975821 78
875 3300005618 Ga0068864_100554087 Ga0068864_1005540872 78
876 3300005618 Ga0068864_101777116 Ga0068864_1017771162 78
877 3300005718 Ga0068866_10091983 Ga0068866_100919832 78
878 3300005718 Ga0068866_10156986 Ga0068866_101569862 78
879 3300005719 Ga0068861_100485676 Ga0068861_1004856762 78
880 3300005840 Ga0068870_10002500 Ga0068870_100025006 78
881 3300005840 Ga0068870_10613563 Ga0068870_106135632 78
882 3300005841 Ga0068863_101058552 Ga0068863_1010585522 78
883 3300005844 Ga0068862_101520990 Ga0068862_1015209902 78
884 3300005937 Ga0081455_10011661 Ga0081455_100116615 78
885 3300005981 Ga0081538_10110862 Ga0081538_101108622 78
886 3300005981 Ga0081538_10238767 Ga0081538_102387672 78
887 3300006038 Ga0075365_10275801 Ga0075365_102758012 78
888 3300006038 Ga0075365_10308570 Ga0075365_103085702 78
889 3300006051 Ga0075364_10182424 Ga0075364_101824243 78
890 3300006058 Ga0075432_10197840 Ga0075432_101978402 78
891 3300006237 Ga0097621_100939578 Ga0097621_1009395782 78
892 3300006358 Ga0068871_100083298 Ga0068871_1000832982 78
893 3300006358 Ga0068871_100472532 Ga0068871_1004725322 78
894 3300006844 Ga0075428_100005557 Ga0075428_1000055577 78
895 3300006844 Ga0075428_100326752 Ga0075428_1003267524 78
896 3300006844 Ga0075428_101065516 Ga0075428_1010655161 78
897 3300006846 Ga0075430_100004112 Ga0075430_1000041127 78
898 3300006846 Ga0075430_100040721 Ga0075430_1000407214 78
899 3300006847 Ga0075431_100012539 Ga0075431_1000125397 78
900 3300006847 Ga0075431_101213341 Ga0075431_1012133411 78
901 3300006847 Ga0075431_101620792 Ga0075431_1016207922 78
902 3300006852 Ga0075433_10040442 Ga0075433_100404426 78
903 3300006852 Ga0075433_11708315 Ga0075433_117083152 78
904 3300006871 Ga0075434_100510717 Ga0075434_1005107173 78
905 3300006880 Ga0075429_100011703 Ga0075429_1000117033 78
906 3300006880 Ga0075429_100030514 Ga0075429_1000305144 78
907 3300006880 Ga0075429_100876547 Ga0075429_1008765472 78
908 3300006881 Ga0068865_100459129 Ga0068865_1004591292 78
909 3300006881 Ga0068865_101427238 Ga0068865_1014272382 78
910 3300006914 Ga0075436_100268952 Ga0075436_1002689523 78
911 3300007076 Ga0075435_100069236 Ga0075435_1000692364 78
912 3300009094 Ga0111539_10019651 Ga0111539_100196513 78
913 3300009094 Ga0111539_10056875 Ga0111539_100568751 78
914 3300009094 Ga0111539_10282038 Ga0111539_102820382 78
915 3300009094 Ga0111539_10678207 Ga0111539_106782073 78
916 3300009094 Ga0111539_12578912 Ga0111539_125789122 78
917 3300009098 Ga0105245_10027262 Ga0105245_100272621 78
918 3300009098 Ga0105245_10229027 Ga0105245_102290272 78
919 3300009098 Ga0105245_10323251 Ga0105245_103232512 78
920 3300009098 Ga0105245_12658804 Ga0105245_126588042 78
921 3300009101 Ga0105247_10963814 Ga0105247_109638142 78
922 3300009147 Ga0114129_10224614 Ga0114129_102246143 78
923 3300009147 Ga0114129_10636896 Ga0114129_106368963 78
924 3300009147 Ga0114129_11233221 Ga0114129_112332212 78
925 3300009148 Ga0105243_10016268 Ga0105243_100162686 78
926 3300009148 Ga0105243_10118512 Ga0105243_101185122 78
927 3300009148 Ga0105243_10486371 Ga0105243_104863712 78
928 3300009176 Ga0105242_10077596 Ga0105242_100775964 78
929 3300009176 Ga0105242_10168633 Ga0105242_101686333 78
930 3300009176 Ga0105242_11679693 Ga0105242_116796932 78
931 3300009551 Ga0105238_12171292 Ga0105238_121712922 78
932 3300009553 Ga0105249_11711385 Ga0105249_117113852 78
933 3300009553 Ga0105249_11843250 Ga0105249_118432502 78
934 3300009987 Ga0105030_110738 Ga0105030_1107382 78
935 3300010375 Ga0105239_10550067 Ga0105239_105500672 78
936 3300011119 Ga0105246_10022665 Ga0105246_100226656 78
937 3300011119 Ga0105246_10042946 Ga0105246_100429463 78
938 3300011119 Ga0105246_10128482 Ga0105246_101284822 78
939 3300011119 Ga0105246_10417988 Ga0105246_104179882 78
940 3300013297 Ga0157378_10049175 Ga0157378_100491752 78
941 3300013297 Ga0157378_11454375 Ga0157378_114543752 78
942 3300013308 Ga0157375_10049906 Ga0157375_100499065 78
943 3300013308 Ga0157375_10117670 Ga0157375_101176702 78
944 3300013308 Ga0157375_10423698 Ga0157375_104236982 78
945 3300013308 Ga0157375_10430803 Ga0157375_104308032 78
946 3300014325 Ga0163163_10259255 Ga0163163_102592552 78
947 3300014325 Ga0163163_10889711 Ga0163163_108897112 78
948 3300014326 Ga0157380_10088507 Ga0157380_100885074 78
949 3300014326 Ga0157380_11583899 Ga0157380_115838991 78
950 3300014326 Ga0157380_12390040 Ga0157380_123900401 78
951 3300014745 Ga0157377_10005311 Ga0157377_100053115 78
952 3300014745 Ga0157377_10290880 Ga0157377_102908802 78
953 3300014745 Ga0157377_10367977 Ga0157377_103679772 78
954 3300014968 Ga0157379_11793521 Ga0157379_117935212 78
955 3300014969 Ga0157376_11302972 Ga0157376_113029722 78
956 3300014969 Ga0157376_12777490 Ga0157376_127774901 78
957 3300025315 Ga0207697_10313437 Ga0207697_103134372 78
958 3300025899 Ga0207642_10041407 Ga0207642_100414074 78
959 3300025899 Ga0207642_10476017 Ga0207642_104760172 78
960 3300025901 Ga0207688_10004625 Ga0207688_100046252 78
961 3300025903 Ga0207680_10294909 Ga0207680_102949092 78
962 3300025907 Ga0207645_10091719 Ga0207645_100917192 78
963 3300025908 Ga0207643_10006654 Ga0207643_100066546 78
964 3300025908 Ga0207643_10830939 Ga0207643_108309392 78
965 3300025910 Ga0207684_10589783 Ga0207684_105897832 78
966 3300025918 Ga0207662_10163016 Ga0207662_101630163 78
967 3300025919 Ga0207657_10370995 Ga0207657_103709952 78
968 3300025920 Ga0207649_11148579 Ga0207649_111485792 78
969 3300025925 Ga0207650_10027425 Ga0207650_100274252 78
970 3300025926 Ga0207659_10125186 Ga0207659_101251862 78
971 3300025926 Ga0207659_10203621 Ga0207659_102036213 78
972 3300025926 Ga0207659_11454286 Ga0207659_114542862 78
973 3300025927 Ga0207687_10194515 Ga0207687_101945154 78
974 3300025927 Ga0207687_10883157 Ga0207687_108831572 78
975 3300025927 Ga0207687_11446366 Ga0207687_114463662 78
976 3300025931 Ga0207644_10113490 Ga0207644_101134902 78
977 3300025934 Ga0207686_10067059 Ga0207686_100670593 78
978 3300025934 Ga0207686_10279194 Ga0207686_102791942 78
979 3300025934 Ga0207686_11017245 Ga0207686_110172452 78
980 3300025935 Ga0207709_10073974 Ga0207709_100739742 78
981 3300025935 Ga0207709_10821738 Ga0207709_108217382 78
982 3300025937 Ga0207669_10005001 Ga0207669_100050012 78
983 3300025937 Ga0207669_10145651 Ga0207669_101456513 78
984 3300025937 Ga0207669_10147643 Ga0207669_101476433 78
985 3300025937 Ga0207669_11792750 Ga0207669_117927502 78
986 3300025938 Ga0207704_10160711 Ga0207704_101607113 78
987 3300025938 Ga0207704_10321134 Ga0207704_103211342 78
988 3300025938 Ga0207704_10411941 Ga0207704_104119412 78
989 3300025938 Ga0207704_10986741 Ga0207704_109867412 78
990 3300025940 Ga0207691_10105454 Ga0207691_101054544 78
991 3300025940 Ga0207691_10171134 Ga0207691_101711342 78
992 3300025941 Ga0207711_11612532 Ga0207711_116125322 78
993 3300025942 Ga0207689_10029711 Ga0207689_100297112 78
994 3300025944 Ga0207661_10008635 Ga0207661_100086354 78
995 3300025944 Ga0207661_11540302 Ga0207661_115403022 78
996 3300025945 Ga0207679_10317269 Ga0207679_103172692 78
997 3300025960 Ga0207651_10065590 Ga0207651_100655902 78
998 3300025972 Ga0207668_10150862 Ga0207668_101508622 78
999 3300025972 Ga0207668_10790578 Ga0207668_107905782 78
1000 3300026023 Ga0207677_10068599 Ga0207677_100685992 78
1001 3300026023 Ga0207677_10749657 Ga0207677_107496572 78
1002 3300026023 Ga0207677_11512395 Ga0207677_115123952 78
1003 3300026035 Ga0207703_11917104 Ga0207703_119171041 78
1004 3300026067 Ga0207678_10209360 Ga0207678_102093602 78
1005 3300026075 Ga0207708_10048411 Ga0207708_100484114 78
1006 3300026075 Ga0207708_10105419 Ga0207708_101054193 78
1007 3300026088 Ga0207641_11011420 Ga0207641_110114202 78
1008 3300026089 Ga0207648_10161256 Ga0207648_101612562 78
1009 3300026089 Ga0207648_10668808 Ga0207648_106688082 78
1010 3300026089 Ga0207648_11361990 Ga0207648_113619902 78
1011 3300026095 Ga0207676_11635092 Ga0207676_116350922 78
1012 3300026116 Ga0207674_10144951 Ga0207674_101449515 78
1013 3300026116 Ga0207674_10432277 Ga0207674_104322772 78
1014 3300026118 Ga0207675_100226366 Ga0207675_1002263663 78
1015 3300026118 Ga0207675_100483750 Ga0207675_1004837502 78
1016 3300026118 Ga0207675_101306771 Ga0207675_1013067712 78
1017 3300026121 Ga0207683_10003740 Ga0207683_100037404 78
1018 3300026121 Ga0207683_10034751 Ga0207683_100347512 78
1019 3300026121 Ga0207683_10142240 Ga0207683_101422402 78
1020 3300026121 Ga0207683_11113357 Ga0207683_111133572 78
1021 3300026121 Ga0207683_11165778 Ga0207683_111657782 78
1022 3300027395 Ga0209996_1059407 Ga0209996_10594072 78
1023 3300027665 Ga0209983_1139798 Ga0209983_11397982 78
1024 3300027907 Ga0207428_10137240 Ga0207428_101372402 78
1025 3300027907 Ga0207428_10153859 Ga0207428_101538592 78
1026 3300028379 Ga0268266_10083927 Ga0268266_100839275 78
1027 3300028379 Ga0268266_10088543 Ga0268266_100885434 78
1028 3300031731 Ga0307405_11357082 Ga0307405_113570822 78
1029 3300031824 Ga0307413_11804671 Ga0307413_118046712 78
1030 3300031901 Ga0307406_10494230 Ga0307406_104942301 78
1031 3300031903 Ga0307407_10218963 Ga0307407_102189632 78
1032 3300032002 Ga0307416_100002165 Ga0307416_1000021656 78
1033 3300032002 Ga0307416_103366626 Ga0307416_1033666262 78
1034 3300032005 Ga0307411_11904928 Ga0307411_119049281 78
1035 3300032126 Ga0307415_101443643 Ga0307415_1014436432 78
1036 3300037418 Ga0395900_0612616 Ga0395900_0612616_702_941 78
1037 3300038443 Ga0395901_0233990 Ga0395901_0233990_1027_1266 78
1038 3300038443 Ga0395901_2156164 Ga0395901_2156164_246_485 78
1039 3300041405 Ga0439438_050472 Ga0439438_050472_457_705 78
1040 3300041405 Ga0439438_067681 Ga0439438_067681_551_799 78
1041 3300041410 Ga0439461_0034553 Ga0439461_0034553_660_908 78
1042 3300041410 Ga0439461_0099152 Ga0439461_0099152_379_627 78
1043 3300041411 Ga0439466_0093021 Ga0439466_0093021_57_305 78
1044 3300042001 Ga0439441_001131 Ga0439441_001131_2621_2869 78
1045 3300042011 Ga0439454_018346 Ga0439454_018346_500_748 78
1046 3300042012 Ga0439455_0254983 Ga0439455_0254983_134_382 78
1047 3300042120 Ga0450917_025194 Ga0450917_025194_136_384 78
1048 3300042122 Ga0450920_031056 Ga0450920_031056_519_767 78
1049 3300042122 Ga0450920_060167 Ga0450920_060167_85_333 78
1050 3300042129 Ga0450891_006014 Ga0450891_006014_378_626 78
1051 3300042131 Ga0450894_065904 Ga0450894_065904_42_290 78
1052 3300042145 Ga0450906_015853 Ga0450906_015853_372_620 78
1053 3300042146 Ga0450907_012687 Ga0450907_012687_1081_1329 78
1054 3300042146 Ga0450907_027345 Ga0450907_027345_147_386 78
1055 3300042156 Ga0439446_0001134 Ga0439446_0001134_5244_5492 78
1056 3300042156 Ga0439446_0012386 Ga0439446_0012386_101_349 78
1057 3300042435 Ga0439434_0040169 Ga0439434_0040169_706_954 78
1058 3300042436 Ga0439435_0053814 Ga0439435_0053814_125_364 78
1059 3300042436 Ga0439435_0102653 Ga0439435_0102653_606_845 78
1060 3300042436 Ga0439435_0365965 Ga0439435_0365965_29_277 78
1061 3300042438 Ga0439459_0174219 Ga0439459_0174219_226_474 78
1062 3300042461 Ga0439460_0372408 Ga0439460_0372408_48_287 78
1063 3300042531 Ga0450918_014389 Ga0450918_014389_338_586 78
1064 3300042531 Ga0450918_108498 Ga0450918_108498_286_525 78
1065 3300045051 Ga0451576_1189695 Ga0451576_1189695_502_750 78
1066 3300046453 Ga0495627_175804 Ga0495627_175804_95_334 78
1067 3300046458 Ga0495591_076096 Ga0495591_076096_232_480 78
1068 3300046473 Ga0495582_0054494 Ga0495582_0054494_1621_1860 78
1069 3300046491 Ga0495584_0138465 Ga0495584_0138465_279_527 78
1070 3300046492 Ga0495585_0127681 Ga0495585_0127681_980_1228 78
1071 3300046515 Ga0495620_0071375 Ga0495620_0071375_600_848 78
1072 3300046518 Ga0495631_0190038 Ga0495631_0190038_274_522 78
1073 3300046523 Ga0495644_0052010 Ga0495644_0052010_549_797 78
1074 3300046523 Ga0495644_0262322 Ga0495644_0262322_14_262 78
1075 3300046523 Ga0495644_0346127 Ga0495644_0346127_282_521 78
1076 3300046523 Ga0495644_0442032 Ga0495644_0442032_169_417 78
1077 3300046525 Ga0495663_0036900 Ga0495663_0036900_756_1004 78
1078 3300046528 Ga0495642_0554790 Ga0495642_0554790_68_316 78
1079 3300046538 Ga0495609_0140760 Ga0495609_0140760_686_934 78
1080 3300046539 Ga0495621_0236033 Ga0495621_0236033_181_429 78
1081 3300046615 Ga0495656_0274774 Ga0495656_0274774_544_792 78
1082 3300046615 Ga0495656_0499185 Ga0495656_0499185_300_539 78
1083 3300046615 Ga0495656_0792344 Ga0495656_0792344_95_334 78
1084 3300046616 Ga0495668_0140649 Ga0495668_0140649_540_788 78
1085 3300046691 Ga0495670_0660329 Ga0495670_0660329_91_339 78
1086 3300046794 Ga0495589_0170355 Ga0495589_0170355_409_657 78
1087 3300046810 Ga0495660_0240265 Ga0495660_0240265_179_427 78
1088 3300047318 Ga0495636_0427675 Ga0495636_0427675_191_430 78
1089 3300047318 Ga0495636_0548608 Ga0495636_0548608_86_334 78
1090 3300047323 Ga0495683_0317515 Ga0495683_0317515_241_489 78
1091 3300047445 Ga0495677_0124581 Ga0495677_0124581_179_427 78
1092 3300047445 Ga0495677_0306658 Ga0495677_0306658_79_327 78
1093 3300047446 Ga0495679_215436 Ga0495679_215436_242_490 78
1094 3300048910 Ga0496107_0269462 Ga0496107_0269462_797_1036 78
1095 3300048912 Ga0496109_0255175 Ga0496109_0255175_387_626 78
1096 3300048913 Ga0496110_0146639 Ga0496110_0146639_238_477 78
1097 3300048914 Ga0496111_0110475 Ga0496111_0110475_726_965 78
1098 3300049522 Ga0501299_078376 Ga0501299_078376_31_279 78
1099 3300049568 Ga0501031_0010811 Ga0501031_0010811_1817_2056 78
1100 3300049568 Ga0501031_0032494 Ga0501031_0032494_2275_2523 78
1101 3300049568 Ga0501031_0034432 Ga0501031_0034432_2553_2801 78
1102 3300049568 Ga0501031_0172366 Ga0501031_0172366_856_1095 78
1103 3300049568 Ga0501031_0460897 Ga0501031_0460897_523_762 78
1104 3300049568 Ga0501031_0672637 Ga0501031_0672637_298_537 78
1105 3300049568 Ga0501031_0981942 Ga0501031_0981942_11_250 78
1106 3300049569 Ga0501032_0222116 Ga0501032_0222116_136_384 78
1107 3300049569 Ga0501032_0352974 Ga0501032_0352974_485_724 78
1108 3300049570 Ga0501033_0306205 Ga0501033_0306205_304_543 78
1109 3300049570 Ga0501033_0306530 Ga0501033_0306530_291_539 78
1110 3300049572 Ga0501036_0011577 Ga0501036_0011577_3010_3249 78
1111 3300049572 Ga0501036_0145198 Ga0501036_0145198_202_450 78
1112 3300049572 Ga0501036_0231544 Ga0501036_0231544_615_863 78
1113 3300049572 Ga0501036_0265039 Ga0501036_0265039_101_340 78
1114 3300049572 Ga0501036_0304279 Ga0501036_0304279_1034_1273 78
1115 3300049572 Ga0501036_0385801 Ga0501036_0385801_577_816 78
1116 3300049572 Ga0501036_0817733 Ga0501036_0817733_394_642 78
1117 3300049573 Ga0501037_0083516 Ga0501037_0083516_1854_2102 78
1118 3300049573 Ga0501037_0168864 Ga0501037_0168864_1013_1252 78
1119 3300049574 Ga0501038_0028181 Ga0501038_0028181_774_1013 78
1120 3300049574 Ga0501038_0032597 Ga0501038_0032597_364_612 78
1121 3300049574 Ga0501038_0125566 Ga0501038_0125566_667_915 78
1122 3300049574 Ga0501038_0677153 Ga0501038_0677153_418_666 78
1123 3300049575 Ga0501039_0034274 Ga0501039_0034274_3018_3266 78
1124 3300049575 Ga0501039_0080583 Ga0501039_0080583_778_1026 78
1125 3300049575 Ga0501039_0246724 Ga0501039_0246724_536_775 78
1126 3300049575 Ga0501039_0351622 Ga0501039_0351622_112_351 78
1127 3300049576 Ga0501040_0018166 Ga0501040_0018166_3760_4008 78
1128 3300049576 Ga0501040_0021388 Ga0501040_0021388_3314_3553 78
1129 3300049576 Ga0501040_0024973 Ga0501040_0024973_392_640 78
1130 3300049576 Ga0501040_0375296 Ga0501040_0375296_216_455 78
1131 3300049576 Ga0501040_0535967 Ga0501040_0535967_135_374 78
1132 3300049576 Ga0501040_0795733 Ga0501040_0795733_130_369 78
1133 3300049577 Ga0501041_0006004 Ga0501041_0006004_4377_4625 78
1134 3300049577 Ga0501041_0013965 Ga0501041_0013965_3502_3741 78
1135 3300049577 Ga0501041_0048515 Ga0501041_0048515_2025_2273 78
1136 3300049577 Ga0501041_0536590 Ga0501041_0536590_271_510 78
1137 3300049578 Ga0501042_0005142 Ga0501042_0005142_7836_8084 78
1138 3300049578 Ga0501042_0041146 Ga0501042_0041146_1667_1915 78
1139 3300049578 Ga0501042_0235768 Ga0501042_0235768_149_388 78
1140 3300049578 Ga0501042_0279042 Ga0501042_0279042_553_792 78
1141 3300049578 Ga0501042_0371099 Ga0501042_0371099_146_385 78
1142 3300049579 Ga0501043_0063719 Ga0501043_0063719_1900_2148 78
1143 3300049579 Ga0501043_0243417 Ga0501043_0243417_424_672 78
1144 3300049580 Ga0501046_0014203 Ga0501046_0014203_4800_5048 78
1145 3300049580 Ga0501046_0024687 Ga0501046_0024687_768_1016 78
1146 3300049580 Ga0501046_0431535 Ga0501046_0431535_41_280 78
1147 3300049580 Ga0501046_1231237 Ga0501046_1231237_239_478 78
1148 3300049582 Ga0501048_0012639 Ga0501048_0012639_3469_3717 78
1149 3300049582 Ga0501048_0068375 Ga0501048_0068375_1203_1451 78
1150 3300049582 Ga0501048_0097088 Ga0501048_0097088_1386_1625 78
1151 3300049583 Ga0501067_0074685 Ga0501067_0074685_500_739 78
1152 3300049583 Ga0501067_0263624 Ga0501067_0263624_283_522 78
1153 3300049583 Ga0501067_0597330 Ga0501067_0597330_348_587 78
1154 3300049584 Ga0501068_0005542 Ga0501068_0005542_5891_6130 78
1155 3300049584 Ga0501068_0085150 Ga0501068_0085150_1089_1337 78
1156 3300049584 Ga0501068_0411290 Ga0501068_0411290_122_361 78
1157 3300049584 Ga0501068_0758535 Ga0501068_0758535_270_509 78
1158 3300049584 Ga0501068_0831475 Ga0501068_0831475_349_588 78
1159 3300049585 Ga0501069_0024839 Ga0501069_0024839_1935_2174 78
1160 3300049585 Ga0501069_0059015 Ga0501069_0059015_630_869 78
1161 3300049585 Ga0501069_0328763 Ga0501069_0328763_258_506 78
1162 3300049585 Ga0501069_0506787 Ga0501069_0506787_272_520 78
1163 3300049585 Ga0501069_1008364 Ga0501069_1008364_163_402 78
1164 3300049586 Ga0501070_0304718 Ga0501070_0304718_377_616 78
1165 3300049586 Ga0501070_0703439 Ga0501070_0703439_216_455 78
1166 3300049587 Ga0501071_0002739 Ga0501071_0002739_9369_9617 78
1167 3300049587 Ga0501071_0009045 Ga0501071_0009045_1664_1903 78
1168 3300049587 Ga0501071_0012703 Ga0501071_0012703_1328_1576 78
1169 3300049587 Ga0501071_0160448 Ga0501071_0160448_323_562 78
1170 3300049587 Ga0501071_0293794 Ga0501071_0293794_638_877 78
1171 3300049587 Ga0501071_0500831 Ga0501071_0500831_519_758 78
1172 3300049587 Ga0501071_0576016 Ga0501071_0576016_438_686 78
1173 3300049587 Ga0501071_0826674 Ga0501071_0826674_209_448 78
1174 3300049587 Ga0501071_1463059 Ga0501071_1463059_176_415 78
1175 3300049588 Ga0501072_0004009 Ga0501072_0004009_947_1195 78
1176 3300049588 Ga0501072_0004983 Ga0501072_0004983_7436_7684 78
1177 3300049588 Ga0501072_0021085 Ga0501072_0021085_4319_4558 78
1178 3300049588 Ga0501072_0314259 Ga0501072_0314259_300_539 78
1179 3300049588 Ga0501072_0351204 Ga0501072_0351204_553_792 78
1180 3300049588 Ga0501072_0545975 Ga0501072_0545975_241_480 78
1181 3300049588 Ga0501072_0570350 Ga0501072_0570350_323_562 78
1182 3300049589 Ga0501073_0604705 Ga0501073_0604705_420_668 78
1183 3300049590 Ga0501074_0021751 Ga0501074_0021751_4170_4418 78
1184 3300049590 Ga0501074_0042618 Ga0501074_0042618_92_331 78
1185 3300049590 Ga0501074_0229542 Ga0501074_0229542_436_684 78
1186 3300049590 Ga0501074_0324450 Ga0501074_0324450_357_596 78
1187 3300049591 Ga0501075_0042441 Ga0501075_0042441_2543_2791 78
1188 3300049591 Ga0501075_0095151 Ga0501075_0095151_543_791 78
1189 3300049591 Ga0501075_0153829 Ga0501075_0153829_1291_1530 78
1190 3300049591 Ga0501075_0442826 Ga0501075_0442826_104_340 78
1191 3300049591 Ga0501075_0973044 Ga0501075_0973044_198_437 78
1192 3300049591 Ga0501075_1450743 Ga0501075_1450743_106_345 78
1193 3300049592 Ga0501076_0014748 Ga0501076_0014748_34_282 78
1194 3300049592 Ga0501076_0025718 Ga0501076_0025718_3690_3938 78
1195 3300049592 Ga0501076_0026424 Ga0501076_0026424_129_368 78
1196 3300049592 Ga0501076_0059183 Ga0501076_0059183_2530_2769 78
1197 3300049592 Ga0501076_0139484 Ga0501076_0139484_215_454 78
1198 3300049592 Ga0501076_0673253 Ga0501076_0673253_455_691 78
1199 3300049593 Ga0501077_0030319 Ga0501077_0030319_384_632 78
1200 3300049593 Ga0501077_0179981 Ga0501077_0179981_237_476 78
1201 3300049593 Ga0501077_0622466 Ga0501077_0622466_92_331 78
1202 3300049593 Ga0501077_1028909 Ga0501077_1028909_253_492 78
1203 3300049593 Ga0501077_1123864 Ga0501077_1123864_203_442 78
1204 3300049741 Ga0501079_0018804 Ga0501079_0018804_3655_3894 78
1205 3300049741 Ga0501079_0027741 Ga0501079_0027741_530_778 78
1206 3300049741 Ga0501079_0085473 Ga0501079_0085473_1606_1854 78
1207 3300049741 Ga0501079_0883556 Ga0501079_0883556_373_621 78
1208 3300049741 Ga0501079_1261282 Ga0501079_1261282_267_506 78
1209 3300049741 Ga0501079_1446243 Ga0501079_1446243_137_376 78
1210 3300049742 Ga0501080_0039522 Ga0501080_0039522_1514_1762 78
1211 3300049742 Ga0501080_0043767 Ga0501080_0043767_191_430 78
1212 3300049743 Ga0501081_0014398 Ga0501081_0014398_1584_1832 78
1213 3300049743 Ga0501081_0023884 Ga0501081_0023884_3550_3789 78
1214 3300049743 Ga0501081_0054513 Ga0501081_0054513_1193_1441 78
1215 3300049743 Ga0501081_0337164 Ga0501081_0337164_719_958 78
1216 3300049743 Ga0501081_0594964 Ga0501081_0594964_218_457 78
1217 3300049743 Ga0501081_0944927 Ga0501081_0944927_215_454 78
1218 3300049743 Ga0501081_1299926 Ga0501081_1299926_111_350 78
1219 3300049744 Ga0501083_0056064 Ga0501083_0056064_1787_2026 78
1220 3300049744 Ga0501083_0134995 Ga0501083_0134995_732_980 78
1221 3300049822 Ga0501035_0036250 Ga0501035_0036250_1883_2131 78
1222 3300049822 Ga0501035_0192702 Ga0501035_0192702_118_357 78
1223 3300049822 Ga0501035_0254253 Ga0501035_0254253_1003_1251 78
1224 3300049822 Ga0501035_1196984 Ga0501035_1196984_133_372 78
1225 3300049823 Ga0501044_0044590 Ga0501044_0044590_3580_3828 78
1226 3300049823 Ga0501044_0544094 Ga0501044_0544094_42_281 78
1227 3300049824 Ga0501045_0006136 Ga0501045_0006136_912_1160 78
1228 3300049824 Ga0501045_0011541 Ga0501045_0011541_2981_3220 78
1229 3300049824 Ga0501045_0013577 Ga0501045_0013577_4534_4773 78
1230 3300049824 Ga0501045_0134203 Ga0501045_0134203_729_977 78
1231 3300049824 Ga0501045_0577096 Ga0501045_0577096_248_487 78
1232 3300049824 Ga0501045_1173605 Ga0501045_1173605_62_301 78
1233 3300050492 nmdc:mga0yw44_1181603_c1 nmdc:mga0yw44_1181603_c1_159_398 78
1234 3300050492 nmdc:mga0yw44_382092_c1 nmdc:mga0yw44_382092_c1_520_759 78
1235 3300050507 nmdc:mga05p37_1597122_c1 nmdc:mga05p37_1597122_c1_71_310 78
1236 3300050507 nmdc:mga05p37_259469_c1 nmdc:mga05p37_259469_c1_210_449 78
1237 3300050507 nmdc:mga05p37_85883_c1 nmdc:mga05p37_85883_c1_2883_3122 78
1238 3300050508 nmdc:mga09592_258802_c1 nmdc:mga09592_258802_c1_840_1079 78
1239 3300050508 nmdc:mga09592_552863_c1 nmdc:mga09592_552863_c1_140_379 78
1240 3300050508 nmdc:mga09592_844670_c1 nmdc:mga09592_844670_c1_25_264 78
1241 3300050509 nmdc:mga0qj67_102436_c1 nmdc:mga0qj67_102436_c1_392_631 78
1242 3300050509 nmdc:mga0qj67_86193_c1 nmdc:mga0qj67_86193_c1_1478_1717 78
1243 3300050510 nmdc:mga06r32_157945_c1 nmdc:mga06r32_157945_c1_1479_1718 78
1244 3300050510 nmdc:mga06r32_825542_c1 nmdc:mga06r32_825542_c1_569_808 78
1245 3300050511 nmdc:mga08y16_1400235_c1 nmdc:mga08y16_1400235_c1_285_524 78
1246 3300050511 nmdc:mga08y16_662693_c1 nmdc:mga08y16_662693_c1_618_857 78
1247 3300050512 nmdc:mga0n895_321690_c1 nmdc:mga0n895_321690_c1_1218_1457 78
1248 3300050513 nmdc:mga0rr50_76680_c1 nmdc:mga0rr50_76680_c1_187_426 78
1249 3300050514 nmdc:mga08x19_79298_c1 nmdc:mga08x19_79298_c1_1866_2105 78
1250 3300050515 nmdc:mga0a205_4875_c1 nmdc:mga0a205_4875_c1_9690_9929 78
1251 3300053083 Ga0495655_0285286 Ga0495655_0285286_248_487 78
1252 3300054114 Ga0501084_0016867 Ga0501084_0016867_1491_1739 78
1253 3300054114 Ga0501084_0017787 Ga0501084_0017787_53_301 78
1254 3300054114 Ga0501084_0682486 Ga0501084_0682486_480_719 78
1255 3300054114 Ga0501084_0962482 Ga0501084_0962482_294_533 78
1256 3300054114 Ga0501084_1066294 Ga0501084_1066294_99_338 78
1257 3300054114 Ga0501084_1222884 Ga0501084_1222884_345_584 78
1258 3300054114 Ga0501084_1640131 Ga0501084_1640131_175_414 78
1259 3300059424 Ga0590075_004855 Ga0590075_004855_2431_2679 78
1260 3300059424 Ga0590075_033100 Ga0590075_033100_651_899 78
1261 3300060353 Ga0501082_0029396 Ga0501082_0029396_3498_3737 78
1262 3300060353 Ga0501082_0033584 Ga0501082_0033584_3858_4106 78
1263 3300060353 Ga0501082_0174915 Ga0501082_0174915_961_1209 78
1264 3300060353 Ga0501082_0669774 Ga0501082_0669774_557_796 78
1265 3300060353 Ga0501082_0677469 Ga0501082_0677469_69_305 78
1266 3300061734 Ga0530510_0004573 Ga0530510_0004573_2285_2533 78
1267 3300061734 Ga0530510_0092860 Ga0530510_0092860_1758_1997 78
1268 3300061734 Ga0530510_0336149 Ga0530510_0336149_282_521 78
1269 3300061734 Ga0530510_0350561 Ga0530510_0350561_357_596 78
1270 3300061734 Ga0530510_0355026 Ga0530510_0355026_102_341 78
1271 3300009176 Ga0105242_12954459 Ga0105242_129544592 79
1272 3300026089 Ga0207648_10411946 Ga0207648_104119462 79
1273 3300046523 Ga0495644_0273880 Ga0495644_0273880_230_472 79
1274 3300049568 Ga0501031_0024921 Ga0501031_0024921_1438_1695 79
1275 3300049572 Ga0501036_0305113 Ga0501036_0305113_898_1155 79
1276 3300049575 Ga0501039_1418408 Ga0501039_1418408_129_386 79
1277 3300049576 Ga0501040_0025076 Ga0501040_0025076_2702_2959 79
1278 3300049577 Ga0501041_0015431 Ga0501041_0015431_4176_4433 79
1279 3300049578 Ga0501042_0016562 Ga0501042_0016562_4556_4813 79
1280 3300049578 Ga0501042_1176339 Ga0501042_1176339_285_542 79
1281 3300049580 Ga0501046_0053029 Ga0501046_0053029_841_1098 79
1282 3300049582 Ga0501048_0082395 Ga0501048_0082395_1913_2170 79
1283 3300049585 Ga0501069_0079231 Ga0501069_0079231_692_949 79
1284 3300049587 Ga0501071_0003010 Ga0501071_0003010_9785_10042 79
1285 3300049588 Ga0501072_0020866 Ga0501072_0020866_3028_3285 79
1286 3300049591 Ga0501075_0038960 Ga0501075_0038960_2095_2352 79
1287 3300049592 Ga0501076_0015920 Ga0501076_0015920_2197_2454 79
1288 3300049741 Ga0501079_0033485 Ga0501079_0033485_892_1149 79
1289 3300049742 Ga0501080_0226381 Ga0501080_0226381_718_975 79
1290 3300049743 Ga0501081_0348627 Ga0501081_0348627_105_362 79
1291 3300049744 Ga0501083_0173520 Ga0501083_0173520_920_1177 79
1292 3300049824 Ga0501045_0079570 Ga0501045_0079570_601_858 79
1293 3300054114 Ga0501084_0011448 Ga0501084_0011448_786_1043 79
1294 3300059421 Ga0590071_029483 Ga0590071_029483_244_498 79
1295 3300060353 Ga0501082_0107127 Ga0501082_0107127_514_771 79
1296 3300049579 Ga0501043_0406575 Ga0501043_0406575_693_947 81
1297 3300003203 JGI25406J46586_10007814 JGI25406J46586_100078144 82
1298 3300005985 Ga0081539_10001263 Ga0081539_1000126323 82
1299 3300046794 Ga0495589_0431545 Ga0495589_0431545_290_547 82
1300 3300049580 Ga0501046_1117145 Ga0501046_1117145_102_359 82
1301 3300049587 Ga0501071_0115195 Ga0501071_0115195_408_665 82
1302 3300049588 Ga0501072_0263639 Ga0501072_0263639_578_835 82
1303 3300049591 Ga0501075_0994411 Ga0501075_0994411_234_491 82
1304 3300049741 Ga0501079_0037371 Ga0501079_0037371_1434_1691 82
1305 3300049743 Ga0501081_1143204 Ga0501081_1143204_201_458 82
1306 3300049824 Ga0501045_0609276 Ga0501045_0609276_380_637 82
1307 3300053083 Ga0495655_0048842 Ga0495655_0048842_109_366 82
1308 3300060353 Ga0501082_0075961 Ga0501082_0075961_391_648 82
1309 3300061734 Ga0530510_0343790 Ga0530510_0343790_284_541 82
1310 3300009147 Ga0114129_11102219 Ga0114129_111022192 83
1311 3300013307 Ga0157372_10394584 Ga0157372_103945842 83
1312 3300020082 Ga0206353_11564503 Ga0206353_115645032 83
1313 3300025885 Ga0207653_10024307 Ga0207653_100243074 83
1314 3300047469 Ga0495673_0237768 Ga0495673_0237768_364_615 83
1315 3300049577 Ga0501041_1049155 Ga0501041_1049155_242_493 83
1316 3300049586 Ga0501070_0838242 Ga0501070_0838242_284_535 83
1317 3300049587 Ga0501071_0302394 Ga0501071_0302394_409_660 83
1318 3300049741 Ga0501079_0551937 Ga0501079_0551937_477_728 83
1319 3300050507 nmdc:mga05p37_846584_c1 nmdc:mga05p37_846584_c1_261_512 83
1320 3300054114 Ga0501084_1504912 Ga0501084_1504912_113_364 83
1321 3300005338 Ga0068868_100583503 Ga0068868_1005835032 84
1322 3300005564 Ga0070664_100201688 Ga0070664_1002016882 84
1323 3300009094 Ga0111539_10336487 Ga0111539_103364872 84
1324 3300009098 Ga0105245_10232489 Ga0105245_102324892 84
1325 3300011119 Ga0105246_10553326 Ga0105246_105533262 84
1326 3300014326 Ga0157380_10541352 Ga0157380_105413522 84
1327 3300025923 Ga0207681_11192999 Ga0207681_111929991 84
1328 3300025927 Ga0207687_10656036 Ga0207687_106560362 84
1329 3300025945 Ga0207679_10122622 Ga0207679_101226222 84
1330 3300026023 Ga0207677_11839284 Ga0207677_118392841 84
1331 3300027614 Ga0209970_1018370 Ga0209970_10183702 84
1332 3300027907 Ga0207428_10842118 Ga0207428_108421181 84
1333 3300042005 Ga0439448_0091428 Ga0439448_0091428_314_568 84
1334 3300042438 Ga0439459_0039989 Ga0439459_0039989_619_873 84
1335 3300049568 Ga0501031_0008345 Ga0501031_0008345_2826_3080 84
1336 3300049568 Ga0501031_0027308 Ga0501031_0027308_1956_2210 84
1337 3300049568 Ga0501031_0257974 Ga0501031_0257974_373_627 84
1338 3300049570 Ga0501033_0109978 Ga0501033_0109978_480_734 84
1339 3300049570 Ga0501033_0148355 Ga0501033_0148355_232_486 84
1340 3300049572 Ga0501036_0050459 Ga0501036_0050459_114_368 84
1341 3300049572 Ga0501036_0059785 Ga0501036_0059785_870_1124 84
1342 3300049572 Ga0501036_0192346 Ga0501036_0192346_71_325 84
1343 3300049573 Ga0501037_0011191 Ga0501037_0011191_3141_3395 84
1344 3300049573 Ga0501037_0310841 Ga0501037_0310841_581_835 84
1345 3300049574 Ga0501038_0043032 Ga0501038_0043032_544_798 84
1346 3300049574 Ga0501038_0094034 Ga0501038_0094034_831_1085 84
1347 3300049574 Ga0501038_1407834 Ga0501038_1407834_217_471 84
1348 3300049575 Ga0501039_0035012 Ga0501039_0035012_1917_2171 84
1349 3300049575 Ga0501039_0057186 Ga0501039_0057186_2686_2940 84
1350 3300049575 Ga0501039_1592248 Ga0501039_1592248_81_335 84
1351 3300049576 Ga0501040_0138193 Ga0501040_0138193_1392_1646 84
1352 3300049576 Ga0501040_0147011 Ga0501040_0147011_12_266 84
1353 3300049576 Ga0501040_0220096 Ga0501040_0220096_51_305 84
1354 3300049577 Ga0501041_0006678 Ga0501041_0006678_3321_3575 84
1355 3300049577 Ga0501041_0014769 Ga0501041_0014769_1121_1375 84
1356 3300049577 Ga0501041_0313020 Ga0501041_0313020_194_448 84
1357 3300049578 Ga0501042_0018322 Ga0501042_0018322_1747_2001 84
1358 3300049578 Ga0501042_0023072 Ga0501042_0023072_3762_4016 84
1359 3300049578 Ga0501042_0695148 Ga0501042_0695148_19_273 84
1360 3300049579 Ga0501043_0014994 Ga0501043_0014994_1811_2065 84
1361 3300049580 Ga0501046_0002143 Ga0501046_0002143_3550_3804 84
1362 3300049581 Ga0501047_0520766 Ga0501047_0520766_26_280 84
1363 3300049582 Ga0501048_0096929 Ga0501048_0096929_734_988 84
1364 3300049582 Ga0501048_0128811 Ga0501048_0128811_144_398 84
1365 3300049582 Ga0501048_0506957 Ga0501048_0506957_417_671 84
1366 3300049583 Ga0501067_0407371 Ga0501067_0407371_152_406 84
1367 3300049583 Ga0501067_0554346 Ga0501067_0554346_64_318 84
1368 3300049584 Ga0501068_0015318 Ga0501068_0015318_430_684 84
1369 3300049584 Ga0501068_0082801 Ga0501068_0082801_1187_1441 84
1370 3300049585 Ga0501069_0020250 Ga0501069_0020250_2373_2627 84
1371 3300049585 Ga0501069_0220381 Ga0501069_0220381_178_432 84
1372 3300049586 Ga0501070_0028099 Ga0501070_0028099_874_1128 84
1373 3300049586 Ga0501070_0088405 Ga0501070_0088405_1373_1627 84
1374 3300049587 Ga0501071_0012914 Ga0501071_0012914_2651_2905 84
1375 3300049587 Ga0501071_0021703 Ga0501071_0021703_2830_3084 84
1376 3300049587 Ga0501071_0130774 Ga0501071_0130774_1380_1634 84
1377 3300049588 Ga0501072_0024983 Ga0501072_0024983_2100_2354 84
1378 3300049588 Ga0501072_0070915 Ga0501072_0070915_979_1233 84
1379 3300049588 Ga0501072_1326914 Ga0501072_1326914_40_294 84
1380 3300049589 Ga0501073_0035084 Ga0501073_0035084_145_399 84
1381 3300049589 Ga0501073_0098919 Ga0501073_0098919_924_1178 84
1382 3300049590 Ga0501074_0007685 Ga0501074_0007685_3534_3788 84
1383 3300049591 Ga0501075_0012405 Ga0501075_0012405_3076_3330 84
1384 3300049591 Ga0501075_0240669 Ga0501075_0240669_706_960 84
1385 3300049592 Ga0501076_0014185 Ga0501076_0014185_2116_2370 84
1386 3300049592 Ga0501076_0022704 Ga0501076_0022704_959_1213 84
1387 3300049592 Ga0501076_1460587 Ga0501076_1460587_195_449 84
1388 3300049593 Ga0501077_0002968 Ga0501077_0002968_6052_6306 84
1389 3300049593 Ga0501077_0049142 Ga0501077_0049142_1353_1607 84
1390 3300049741 Ga0501079_0013520 Ga0501079_0013520_3199_3453 84
1391 3300049741 Ga0501079_0035736 Ga0501079_0035736_1210_1464 84
1392 3300049741 Ga0501079_0427680 Ga0501079_0427680_547_801 84
1393 3300049742 Ga0501080_0041910 Ga0501080_0041910_1031_1285 84
1394 3300049742 Ga0501080_0068850 Ga0501080_0068850_2017_2271 84
1395 3300049742 Ga0501080_1726736 Ga0501080_1726736_146_400 84
1396 3300049743 Ga0501081_0032432 Ga0501081_0032432_1197_1451 84
1397 3300049743 Ga0501081_0051630 Ga0501081_0051630_1975_2229 84
1398 3300049744 Ga0501083_0018799 Ga0501083_0018799_1118_1372 84
1399 3300049744 Ga0501083_0098741 Ga0501083_0098741_669_923 84
1400 3300049822 Ga0501035_0105782 Ga0501035_0105782_136_390 84
1401 3300049822 Ga0501035_0212405 Ga0501035_0212405_1121_1375 84
1402 3300049823 Ga0501044_0095048 Ga0501044_0095048_2038_2292 84
1403 3300049824 Ga0501045_0117005 Ga0501045_0117005_656_910 84
1404 3300049824 Ga0501045_0277090 Ga0501045_0277090_92_346 84
1405 3300054114 Ga0501084_0046052 Ga0501084_0046052_1132_1386 84
1406 3300054114 Ga0501084_0046697 Ga0501084_0046697_1392_1646 84
1407 3300054114 Ga0501084_0095429 Ga0501084_0095429_701_955 84
1408 3300060353 Ga0501082_0009266 Ga0501082_0009266_735_989 84
1409 3300060353 Ga0501082_0025322 Ga0501082_0025322_4439_4693 84
1410 3300060353 Ga0501082_1483412 Ga0501082_1483412_77_331 84
1411 3300061734 Ga0530510_0005299 Ga0530510_0005299_4833_5087 84
1412 3300061734 Ga0530510_0039570 Ga0530510_0039570_583_837 84
1413 3300061734 Ga0530510_0070521 Ga0530510_0070521_1462_1716 84
1414 3300061734 Ga0530510_0684747 Ga0530510_0684747_395_649 84
1415 3300000041 ARcpr5oldR_c002177 ARcpr5oldR_0021773 85
1416 3300000043 ARcpr5yngRDRAFT_c003093 ARcpr5yngRDRAFT_0030934 85
1417 3300000044 ARSoilOldRDRAFT_c029933 ARSoilOldRDRAFT_0299331 85
1418 3300000652 ARCol0yngRDRAFT_1012314 ARCol0yngRDRAFT_10123141 85
1419 3300001977 JGI24746J21847_1033644 JGI24746J21847_10336442 85
1420 3300001989 JGI24739J22299_10029318 JGI24739J22299_100293181 85
1421 3300001991 JGI24743J22301_10011312 JGI24743J22301_100113124 85
1422 3300002070 JGI24750J21931_1080031 JGI24750J21931_10800312 85
1423 3300002074 JGI24748J21848_1037401 JGI24748J21848_10374012 85
1424 3300002075 JGI24738J21930_10026763 JGI24738J21930_100267632 85
1425 3300002077 JGI24744J21845_10042346 JGI24744J21845_100423462 85
1426 3300002155 JGI24033J26618_1025498 JGI24033J26618_10254982 85
1427 3300002244 JGI24742J22300_10052558 JGI24742J22300_100525582 85
1428 3300005290 Ga0065712_10321828 Ga0065712_103218282 85
1429 3300005327 Ga0070658_10034020 Ga0070658_100340205 85
1430 3300005327 Ga0070658_10223620 Ga0070658_102236201 85
1431 3300005328 Ga0070676_10295817 Ga0070676_102958172 85
1432 3300005328 Ga0070676_10802745 Ga0070676_108027452 85
1433 3300005329 Ga0070683_100030559 Ga0070683_1000305594 85
1434 3300005329 Ga0070683_100093597 Ga0070683_1000935973 85
1435 3300005329 Ga0070683_100144441 Ga0070683_1001444413 85
1436 3300005330 Ga0070690_100088437 Ga0070690_1000884372 85
1437 3300005331 Ga0070670_100090955 Ga0070670_1000909553 85
1438 3300005334 Ga0068869_100095555 Ga0068869_1000955552 85
1439 3300005334 Ga0068869_100910443 Ga0068869_1009104432 85
1440 3300005335 Ga0070666_10187625 Ga0070666_101876252 85
1441 3300005336 Ga0070680_100280581 Ga0070680_1002805813 85
1442 3300005337 Ga0070682_100145702 Ga0070682_1001457022 85
1443 3300005337 Ga0070682_100222468 Ga0070682_1002224682 85
1444 3300005337 Ga0070682_101703143 Ga0070682_1017031431 85
1445 3300005338 Ga0068868_100036276 Ga0068868_1000362762 85
1446 3300005338 Ga0068868_100107743 Ga0068868_1001077432 85
1447 3300005338 Ga0068868_100306229 Ga0068868_1003062291 85
1448 3300005338 Ga0068868_100505075 Ga0068868_1005050752 85
1449 3300005339 Ga0070660_100216349 Ga0070660_1002163492 85
1450 3300005339 Ga0070660_100384759 Ga0070660_1003847592 85
1451 3300005339 Ga0070660_101565459 Ga0070660_1015654591 85
1452 3300005339 Ga0070660_101717161 Ga0070660_1017171612 85
1453 3300005340 Ga0070689_100075585 Ga0070689_1000755854 85
1454 3300005340 Ga0070689_100392350 Ga0070689_1003923502 85
1455 3300005341 Ga0070691_10000781 Ga0070691_100007814 85
1456 3300005343 Ga0070687_100035058 Ga0070687_1000350583 85
1457 3300005343 Ga0070687_100050997 Ga0070687_1000509973 85
1458 3300005344 Ga0070661_100291282 Ga0070661_1002912822 85
1459 3300005344 Ga0070661_100584411 Ga0070661_1005844112 85
1460 3300005345 Ga0070692_10006436 Ga0070692_100064365 85
1461 3300005345 Ga0070692_10019140 Ga0070692_100191406 85
1462 3300005347 Ga0070668_100052043 Ga0070668_1000520434 85
1463 3300005347 Ga0070668_100138126 Ga0070668_1001381264 85
1464 3300005353 Ga0070669_101461091 Ga0070669_1014610912 85
1465 3300005353 Ga0070669_101625241 Ga0070669_1016252411 85
1466 3300005354 Ga0070675_100059601 Ga0070675_1000596014 85
1467 3300005354 Ga0070675_100114149 Ga0070675_1001141491 85
1468 3300005355 Ga0070671_100377988 Ga0070671_1003779882 85
1469 3300005356 Ga0070674_100108733 Ga0070674_1001087332 85
1470 3300005356 Ga0070674_100171519 Ga0070674_1001715192 85
1471 3300005356 Ga0070674_100331376 Ga0070674_1003313762 85
1472 3300005356 Ga0070674_100539557 Ga0070674_1005395572 85
1473 3300005364 Ga0070673_101784467 Ga0070673_1017844671 85
1474 3300005365 Ga0070688_100034129 Ga0070688_1000341295 85
1475 3300005365 Ga0070688_100951268 Ga0070688_1009512682 85
1476 3300005366 Ga0070659_100039369 Ga0070659_1000393692 85
1477 3300005366 Ga0070659_100597798 Ga0070659_1005977982 85
1478 3300005366 Ga0070659_101014896 Ga0070659_1010148962 85
1479 3300005366 Ga0070659_101801151 Ga0070659_1018011512 85
1480 3300005367 Ga0070667_100957960 Ga0070667_1009579602 85
1481 3300005406 Ga0070703_10016151 Ga0070703_100161514 85
1482 3300005438 Ga0070701_10011271 Ga0070701_100112714 85
1483 3300005438 Ga0070701_10227411 Ga0070701_102274112 85
1484 3300005438 Ga0070701_10690002 Ga0070701_106900022 85
1485 3300005440 Ga0070705_100273433 Ga0070705_1002734332 85
1486 3300005441 Ga0070700_100008857 Ga0070700_1000088572 85
1487 3300005441 Ga0070700_100078357 Ga0070700_1000783572 85
1488 3300005441 Ga0070700_100241941 Ga0070700_1002419411 85
1489 3300005444 Ga0070694_100469242 Ga0070694_1004692422 85
1490 3300005455 Ga0070663_100131454 Ga0070663_1001314542 85
1491 3300005455 Ga0070663_101422877 Ga0070663_1014228772 85
1492 3300005456 Ga0070678_100862365 Ga0070678_1008623652 85
1493 3300005457 Ga0070662_100022184 Ga0070662_1000221846 85
1494 3300005457 Ga0070662_100164014 Ga0070662_1001640141 85
1495 3300005457 Ga0070662_100431495 Ga0070662_1004314952 85
1496 3300005458 Ga0070681_10086083 Ga0070681_100860835 85
1497 3300005458 Ga0070681_10538165 Ga0070681_105381652 85
1498 3300005458 Ga0070681_10776921 Ga0070681_107769212 85
1499 3300005458 Ga0070681_10825285 Ga0070681_108252852 85
1500 3300005459 Ga0068867_100226075 Ga0068867_1002260752 85
1501 3300005459 Ga0068867_100411630 Ga0068867_1004116302 85
1502 3300005459 Ga0068867_100431975 Ga0068867_1004319752 85
1503 3300005459 Ga0068867_101351710 Ga0068867_1013517102 85
1504 3300005466 Ga0070685_10003141 Ga0070685_100031418 85
1505 3300005466 Ga0070685_10024284 Ga0070685_100242843 85
1506 3300005466 Ga0070685_10115620 Ga0070685_101156202 85
1507 3300005468 Ga0070707_101431018 Ga0070707_1014310182 85
1508 3300005471 Ga0070698_100294761 Ga0070698_1002947612 85
1509 3300005518 Ga0070699_100146449 Ga0070699_1001464492 85
1510 3300005530 Ga0070679_100001403 Ga0070679_1000014036 85
1511 3300005530 Ga0070679_100116411 Ga0070679_1001164114 85
1512 3300005530 Ga0070679_100329864 Ga0070679_1003298642 85
1513 3300005535 Ga0070684_100068309 Ga0070684_1000683094 85
1514 3300005535 Ga0070684_100092820 Ga0070684_1000928203 85
1515 3300005535 Ga0070684_100132652 Ga0070684_1001326523 85
1516 3300005535 Ga0070684_100196608 Ga0070684_1001966082 85
1517 3300005535 Ga0070684_100202774 Ga0070684_1002027742 85
1518 3300005535 Ga0070684_100216839 Ga0070684_1002168393 85
1519 3300005535 Ga0070684_100268161 Ga0070684_1002681612 85
1520 3300005539 Ga0068853_100002053 Ga0068853_1000020538 85
1521 3300005539 Ga0068853_100165074 Ga0068853_1001650744 85
1522 3300005539 Ga0068853_101477199 Ga0068853_1014771992 85
1523 3300005543 Ga0070672_100090127 Ga0070672_1000901272 85
1524 3300005544 Ga0070686_100013865 Ga0070686_1000138655 85
1525 3300005544 Ga0070686_101360329 Ga0070686_1013603292 85
1526 3300005545 Ga0070695_101252121 Ga0070695_1012521211 85
1527 3300005545 Ga0070695_101425125 Ga0070695_1014251251 85
1528 3300005546 Ga0070696_100052553 Ga0070696_1000525534 85
1529 3300005546 Ga0070696_100505644 Ga0070696_1005056442 85
1530 3300005547 Ga0070693_100037999 Ga0070693_1000379991 85
1531 3300005547 Ga0070693_100455653 Ga0070693_1004556532 85
1532 3300005548 Ga0070665_100195649 Ga0070665_1001956492 85
1533 3300005548 Ga0070665_101975877 Ga0070665_1019758772 85
1534 3300005549 Ga0070704_100041763 Ga0070704_1000417632 85
1535 3300005549 Ga0070704_100130883 Ga0070704_1001308831 85
1536 3300005563 Ga0068855_100070836 Ga0068855_1000708366 85
1537 3300005563 Ga0068855_101277448 Ga0068855_1012774481 85
1538 3300005564 Ga0070664_100015680 Ga0070664_1000156805 85
1539 3300005564 Ga0070664_100040958 Ga0070664_1000409585 85
1540 3300005564 Ga0070664_100450391 Ga0070664_1004503912 85
1541 3300005577 Ga0068857_100302560 Ga0068857_1003025602 85
1542 3300005577 Ga0068857_100347802 Ga0068857_1003478023 85
1543 3300005577 Ga0068857_100776531 Ga0068857_1007765312 85
1544 3300005578 Ga0068854_100163424 Ga0068854_1001634242 85
1545 3300005614 Ga0068856_100095770 Ga0068856_1000957703 85
1546 3300005614 Ga0068856_100548110 Ga0068856_1005481102 85
1547 3300005615 Ga0070702_100004258 Ga0070702_1000042587 85
1548 3300005615 Ga0070702_100133479 Ga0070702_1001334791 85
1549 3300005616 Ga0068852_100002371 Ga0068852_10000237114 85
1550 3300005616 Ga0068852_100718449 Ga0068852_1007184491 85
1551 3300005616 Ga0068852_100807019 Ga0068852_1008070192 85
1552 3300005616 Ga0068852_100943671 Ga0068852_1009436712 85
1553 3300005617 Ga0068859_100588919 Ga0068859_1005889192 85
1554 3300005618 Ga0068864_100027376 Ga0068864_1000273763 85
1555 3300005618 Ga0068864_100143287 Ga0068864_1001432874 85
1556 3300005618 Ga0068864_100820924 Ga0068864_1008209242 85
1557 3300005718 Ga0068866_10093140 Ga0068866_100931402 85
1558 3300005719 Ga0068861_100372807 Ga0068861_1003728072 85
1559 3300005719 Ga0068861_100435971 Ga0068861_1004359711 85
1560 3300005719 Ga0068861_101848275 Ga0068861_1018482752 85
1561 3300005834 Ga0068851_10024007 Ga0068851_100240074 85
1562 3300005840 Ga0068870_10003552 Ga0068870_100035526 85
1563 3300005840 Ga0068870_11222169 Ga0068870_112221692 85
1564 3300005841 Ga0068863_100138507 Ga0068863_1001385072 85
1565 3300005842 Ga0068858_100015199 Ga0068858_1000151996 85
1566 3300005843 Ga0068860_100129535 Ga0068860_1001295354 85
1567 3300005843 Ga0068860_100457186 Ga0068860_1004571862 85
1568 3300005844 Ga0068862_100245095 Ga0068862_1002450952 85
1569 3300005844 Ga0068862_100787121 Ga0068862_1007871212 85
1570 3300005844 Ga0068862_100961371 Ga0068862_1009613712 85
1571 3300005937 Ga0081455_10024025 Ga0081455_100240256 85
1572 3300005937 Ga0081455_10041491 Ga0081455_100414916 85
1573 3300006038 Ga0075365_10164734 Ga0075365_101647342 85
1574 3300006038 Ga0075365_10312402 Ga0075365_103124022 85
1575 3300006048 Ga0075363_100946299 Ga0075363_1009462992 85
1576 3300006058 Ga0075432_10006412 Ga0075432_100064122 85
1577 3300006058 Ga0075432_10215153 Ga0075432_102151532 85
1578 3300006058 Ga0075432_10225096 Ga0075432_102250962 85
1579 3300006177 Ga0075362_10420044 Ga0075362_104200441 85
1580 3300006178 Ga0075367_10733676 Ga0075367_107336761 85
1581 3300006178 Ga0075367_10795318 Ga0075367_107953182 85
1582 3300006237 Ga0097621_100091151 Ga0097621_1000911512 85
1583 3300006353 Ga0075370_10231634 Ga0075370_102316342 85
1584 3300006358 Ga0068871_100035544 Ga0068871_1000355444 85
1585 3300006358 Ga0068871_100488067 Ga0068871_1004880673 85
1586 3300006844 Ga0075428_100000369 Ga0075428_10000036941 85
1587 3300006844 Ga0075428_101036234 Ga0075428_1010362342 85
1588 3300006847 Ga0075431_100132018 Ga0075431_1001320181 85
1589 3300006880 Ga0075429_100399516 Ga0075429_1003995163 85
1590 3300006881 Ga0068865_100180865 Ga0068865_1001808653 85
1591 3300006881 Ga0068865_100218127 Ga0068865_1002181272 85
1592 3300006914 Ga0075436_101354552 Ga0075436_1013545521 85
1593 3300006931 Ga0097620_100588925 Ga0097620_1005889252 85
1594 3300009011 Ga0105251_10545624 Ga0105251_105456242 85
1595 3300009036 Ga0105244_10446431 Ga0105244_104464312 85
1596 3300009094 Ga0111539_10001582 Ga0111539_1000158211 85
1597 3300009094 Ga0111539_10034653 Ga0111539_100346536 85
1598 3300009094 Ga0111539_10886383 Ga0111539_108863832 85
1599 3300009094 Ga0111539_11560908 Ga0111539_115609082 85
1600 3300009098 Ga0105245_10007978 Ga0105245_100079786 85
1601 3300009098 Ga0105245_10145927 Ga0105245_101459274 85
1602 3300009098 Ga0105245_10360111 Ga0105245_103601111 85
1603 3300009098 Ga0105245_11451147 Ga0105245_114511472 85
1604 3300009101 Ga0105247_10022080 Ga0105247_100220802 85
1605 3300009147 Ga0114129_10029357 Ga0114129_100293576 85
1606 3300009147 Ga0114129_10153264 Ga0114129_101532642 85
1607 3300009147 Ga0114129_11275508 Ga0114129_112755082 85
1608 3300009148 Ga0105243_10002162 Ga0105243_1000216213 85
1609 3300009148 Ga0105243_10007875 Ga0105243_100078752 85
1610 3300009148 Ga0105243_10021934 Ga0105243_100219342 85
1611 3300009148 Ga0105243_10040153 Ga0105243_100401533 85
1612 3300009148 Ga0105243_10264560 Ga0105243_102645602 85
1613 3300009148 Ga0105243_10299862 Ga0105243_102998622 85
1614 3300009174 Ga0105241_10708564 Ga0105241_107085642 85
1615 3300009174 Ga0105241_11635600 Ga0105241_116356002 85
1616 3300009176 Ga0105242_10216289 Ga0105242_102162892 85
1617 3300009176 Ga0105242_10267767 Ga0105242_102677672 85
1618 3300009177 Ga0105248_10045934 Ga0105248_100459344 85
1619 3300009177 Ga0105248_10523449 Ga0105248_105234492 85
1620 3300009177 Ga0105248_10752253 Ga0105248_107522532 85
1621 3300009545 Ga0105237_10424321 Ga0105237_104243211 85
1622 3300009545 Ga0105237_11500405 Ga0105237_115004052 85
1623 3300009551 Ga0105238_10022048 Ga0105238_100220485 85
1624 3300009551 Ga0105238_10337223 Ga0105238_103372232 85
1625 3300009551 Ga0105238_10377674 Ga0105238_103776741 85
1626 3300009553 Ga0105249_10112581 Ga0105249_101125812 85
1627 3300009553 Ga0105249_10254474 Ga0105249_102544741 85
1628 3300010375 Ga0105239_10040773 Ga0105239_100407731 85
1629 3300010375 Ga0105239_10073297 Ga0105239_100732976 85
1630 3300010375 Ga0105239_10095144 Ga0105239_100951441 85
1631 3300010375 Ga0105239_10630896 Ga0105239_106308962 85
1632 3300010375 Ga0105239_10941223 Ga0105239_109412232 85
1633 3300011119 Ga0105246_10004161 Ga0105246_100041615 85
1634 3300011119 Ga0105246_10116600 Ga0105246_101166002 85
1635 3300011119 Ga0105246_10319343 Ga0105246_103193432 85
1636 3300011119 Ga0105246_10324430 Ga0105246_103244302 85
1637 3300011119 Ga0105246_10871806 Ga0105246_108718062 85
1638 3300012503 Ga0157313_1013634 Ga0157313_10136342 85
1639 3300013100 Ga0157373_10074264 Ga0157373_100742641 85
1640 3300013100 Ga0157373_10863033 Ga0157373_108630332 85
1641 3300013102 Ga0157371_10003237 Ga0157371_1000323714 85
1642 3300013102 Ga0157371_10182684 Ga0157371_101826842 85
1643 3300013102 Ga0157371_10373942 Ga0157371_103739422 85
1644 3300013102 Ga0157371_10696651 Ga0157371_106966512 85
1645 3300013104 Ga0157370_10123060 Ga0157370_101230601 85
1646 3300013104 Ga0157370_10965341 Ga0157370_109653412 85
1647 3300013105 Ga0157369_11533620 Ga0157369_115336202 85
1648 3300013296 Ga0157374_10059544 Ga0157374_100595444 85
1649 3300013297 Ga0157378_10865412 Ga0157378_108654122 85
1650 3300013297 Ga0157378_12521010 Ga0157378_125210102 85
1651 3300013306 Ga0163162_10136725 Ga0163162_101367252 85
1652 3300013306 Ga0163162_10815397 Ga0163162_108153971 85
1653 3300013306 Ga0163162_11559461 Ga0163162_115594612 85
1654 3300013307 Ga0157372_10008369 Ga0157372_100083692 85
1655 3300013307 Ga0157372_10651077 Ga0157372_106510771 85
1656 3300013307 Ga0157372_11239548 Ga0157372_112395482 85
1657 3300013308 Ga0157375_10028457 Ga0157375_100284576 85
1658 3300013308 Ga0157375_10043940 Ga0157375_100439405 85
1659 3300013308 Ga0157375_11280285 Ga0157375_112802852 85
1660 3300014325 Ga0163163_10052644 Ga0163163_100526443 85
1661 3300014325 Ga0163163_10216277 Ga0163163_102162773 85
1662 3300014325 Ga0163163_11042362 Ga0163163_110423622 85
1663 3300014325 Ga0163163_11517716 Ga0163163_115177162 85
1664 3300014326 Ga0157380_10044826 Ga0157380_100448263 85
1665 3300014326 Ga0157380_10045856 Ga0157380_100458565 85
1666 3300014326 Ga0157380_10118482 Ga0157380_101184824 85
1667 3300014745 Ga0157377_10021987 Ga0157377_100219871 85
1668 3300014745 Ga0157377_10074303 Ga0157377_100743032 85
1669 3300014745 Ga0157377_10155151 Ga0157377_101551512 85
1670 3300014745 Ga0157377_10958061 Ga0157377_109580612 85
1671 3300014968 Ga0157379_10216341 Ga0157379_102163412 85
1672 3300014969 Ga0157376_10026686 Ga0157376_100266862 85
1673 3300014969 Ga0157376_10134689 Ga0157376_101346892 85
1674 3300017792 Ga0163161_10141290 Ga0163161_101412903 85
1675 3300017792 Ga0163161_10294954 Ga0163161_102949541 85
1676 3300017792 Ga0163161_11037735 Ga0163161_110377351 85
1677 3300017792 Ga0163161_11167827 Ga0163161_111678272 85
1678 3300020070 Ga0206356_10492736 Ga0206356_104927363 85
1679 3300020082 Ga0206353_11939242 Ga0206353_119392423 85
1680 3300025893 Ga0207682_10485370 Ga0207682_104853702 85
1681 3300025899 Ga0207642_10420466 Ga0207642_104204662 85
1682 3300025900 Ga0207710_10011778 Ga0207710_100117783 85
1683 3300025901 Ga0207688_10036367 Ga0207688_100363673 85
1684 3300025901 Ga0207688_10138723 Ga0207688_101387232 85
1685 3300025901 Ga0207688_10210054 Ga0207688_102100541 85
1686 3300025903 Ga0207680_10121380 Ga0207680_101213804 85
1687 3300025904 Ga0207647_10118869 Ga0207647_101188693 85
1688 3300025907 Ga0207645_10194195 Ga0207645_101941952 85
1689 3300025908 Ga0207643_10015663 Ga0207643_100156632 85
1690 3300025908 Ga0207643_10158217 Ga0207643_101582172 85
1691 3300025908 Ga0207643_10212126 Ga0207643_102121262 85
1692 3300025909 Ga0207705_10184648 Ga0207705_101846482 85
1693 3300025909 Ga0207705_10766480 Ga0207705_107664801 85
1694 3300025911 Ga0207654_10950918 Ga0207654_109509181 85
1695 3300025912 Ga0207707_10061685 Ga0207707_100616854 85
1696 3300025912 Ga0207707_10261499 Ga0207707_102614992 85
1697 3300025914 Ga0207671_10202555 Ga0207671_102025552 85
1698 3300025914 Ga0207671_10643754 Ga0207671_106437542 85
1699 3300025917 Ga0207660_10218270 Ga0207660_102182702 85
1700 3300025917 Ga0207660_10535079 Ga0207660_105350792 85
1701 3300025918 Ga0207662_10007345 Ga0207662_100073453 85
1702 3300025918 Ga0207662_10026650 Ga0207662_100266502 85
1703 3300025919 Ga0207657_10125198 Ga0207657_101251982 85
1704 3300025919 Ga0207657_10143227 Ga0207657_101432271 85
1705 3300025919 Ga0207657_10155186 Ga0207657_101551864 85
1706 3300025920 Ga0207649_10023736 Ga0207649_100237365 85
1707 3300025920 Ga0207649_10058793 Ga0207649_100587932 85
1708 3300025921 Ga0207652_10014907 Ga0207652_100149075 85
1709 3300025921 Ga0207652_10190678 Ga0207652_101906783 85
1710 3300025922 Ga0207646_10878439 Ga0207646_108784392 85
1711 3300025923 Ga0207681_11313569 Ga0207681_113135691 85
1712 3300025924 Ga0207694_10033429 Ga0207694_100334294 85
1713 3300025925 Ga0207650_10512245 Ga0207650_105122452 85
1714 3300025925 Ga0207650_11697645 Ga0207650_116976451 85
1715 3300025926 Ga0207659_10185936 Ga0207659_101859362 85
1716 3300025926 Ga0207659_11240047 Ga0207659_112400471 85
1717 3300025927 Ga0207687_10082800 Ga0207687_100828003 85
1718 3300025927 Ga0207687_10127390 Ga0207687_101273901 85
1719 3300025927 Ga0207687_11181756 Ga0207687_111817561 85
1720 3300025931 Ga0207644_10303626 Ga0207644_103036262 85
1721 3300025932 Ga0207690_10047809 Ga0207690_100478092 85
1722 3300025932 Ga0207690_10553397 Ga0207690_105533971 85
1723 3300025932 Ga0207690_11117598 Ga0207690_111175981 85
1724 3300025933 Ga0207706_10029290 Ga0207706_100292903 85
1725 3300025933 Ga0207706_10083534 Ga0207706_100835341 85
1726 3300025933 Ga0207706_10253951 Ga0207706_102539512 85
1727 3300025934 Ga0207686_10074148 Ga0207686_100741484 85
1728 3300025934 Ga0207686_10306238 Ga0207686_103062382 85
1729 3300025935 Ga0207709_10005971 Ga0207709_100059715 85
1730 3300025935 Ga0207709_10080848 Ga0207709_100808483 85
1731 3300025935 Ga0207709_10351343 Ga0207709_103513432 85
1732 3300025935 Ga0207709_10407980 Ga0207709_104079802 85
1733 3300025936 Ga0207670_10069263 Ga0207670_100692632 85
1734 3300025936 Ga0207670_11230475 Ga0207670_112304752 85
1735 3300025937 Ga0207669_10163500 Ga0207669_101635002 85
1736 3300025937 Ga0207669_10171463 Ga0207669_101714633 85
1737 3300025938 Ga0207704_10037206 Ga0207704_100372062 85
1738 3300025938 Ga0207704_10115558 Ga0207704_101155582 85
1739 3300025938 Ga0207704_10302720 Ga0207704_103027202 85
1740 3300025938 Ga0207704_11490942 Ga0207704_114909422 85
1741 3300025940 Ga0207691_10006369 Ga0207691_1000636912 85
1742 3300025940 Ga0207691_10010651 Ga0207691_100106514 85
1743 3300025941 Ga0207711_10148242 Ga0207711_101482423 85
1744 3300025941 Ga0207711_10931916 Ga0207711_109319162 85
1745 3300025942 Ga0207689_10046032 Ga0207689_100460322 85
1746 3300025942 Ga0207689_10620642 Ga0207689_106206422 85
1747 3300025944 Ga0207661_10046214 Ga0207661_100462141 85
1748 3300025944 Ga0207661_10074976 Ga0207661_100749763 85
1749 3300025944 Ga0207661_10147981 Ga0207661_101479813 85
1750 3300025944 Ga0207661_10168050 Ga0207661_101680501 85
1751 3300025944 Ga0207661_10309104 Ga0207661_103091042 85
1752 3300025944 Ga0207661_11715096 Ga0207661_117150962 85
1753 3300025945 Ga0207679_10713477 Ga0207679_107134772 85
1754 3300025945 Ga0207679_11142184 Ga0207679_111421842 85
1755 3300025949 Ga0207667_10073767 Ga0207667_100737672 85
1756 3300025949 Ga0207667_10801378 Ga0207667_108013782 85
1757 3300025960 Ga0207651_10013495 Ga0207651_100134955 85
1758 3300025960 Ga0207651_10051927 Ga0207651_100519271 85
1759 3300025961 Ga0207712_10086834 Ga0207712_100868342 85
1760 3300025961 Ga0207712_12111238 Ga0207712_121112381 85
1761 3300025972 Ga0207668_10241453 Ga0207668_102414532 85
1762 3300025972 Ga0207668_10665446 Ga0207668_106654462 85
1763 3300025981 Ga0207640_10060700 Ga0207640_100607002 85
1764 3300025981 Ga0207640_10511279 Ga0207640_105112792 85
1765 3300026023 Ga0207677_10032872 Ga0207677_100328724 85
1766 3300026023 Ga0207677_10146194 Ga0207677_101461942 85
1767 3300026023 Ga0207677_10236874 Ga0207677_102368741 85
1768 3300026035 Ga0207703_10073898 Ga0207703_100738983 85
1769 3300026041 Ga0207639_10036381 Ga0207639_100363812 85
1770 3300026041 Ga0207639_10133405 Ga0207639_101334051 85
1771 3300026041 Ga0207639_10771859 Ga0207639_107718592 85
1772 3300026067 Ga0207678_10095360 Ga0207678_100953605 85
1773 3300026067 Ga0207678_12020859 Ga0207678_120208591 85
1774 3300026075 Ga0207708_10012405 Ga0207708_100124056 85
1775 3300026075 Ga0207708_10472967 Ga0207708_104729671 85
1776 3300026078 Ga0207702_10155856 Ga0207702_101558562 85
1777 3300026088 Ga0207641_10935159 Ga0207641_109351592 85
1778 3300026089 Ga0207648_10116194 Ga0207648_101161942 85
1779 3300026089 Ga0207648_12141692 Ga0207648_121416921 85
1780 3300026095 Ga0207676_10038407 Ga0207676_100384073 85
1781 3300026095 Ga0207676_10752460 Ga0207676_107524602 85
1782 3300026095 Ga0207676_11041551 Ga0207676_110415512 85
1783 3300026116 Ga0207674_10110289 Ga0207674_101102892 85
1784 3300026116 Ga0207674_10192944 Ga0207674_101929442 85
1785 3300026116 Ga0207674_10671347 Ga0207674_106713472 85
1786 3300026116 Ga0207674_10731466 Ga0207674_107314662 85
1787 3300026118 Ga0207675_100034654 Ga0207675_1000346542 85
1788 3300026118 Ga0207675_100265151 Ga0207675_1002651511 85
1789 3300026118 Ga0207675_100876561 Ga0207675_1008765612 85
1790 3300026121 Ga0207683_10110959 Ga0207683_101109592 85
1791 3300026121 Ga0207683_10323703 Ga0207683_103237032 85
1792 3300026142 Ga0207698_10018342 Ga0207698_100183424 85
1793 3300026142 Ga0207698_11044906 Ga0207698_110449062 85
1794 3300026142 Ga0207698_11426113 Ga0207698_114261132 85
1795 3300026142 Ga0207698_12493590 Ga0207698_124935901 85
1796 3300027695 Ga0209966_1074024 Ga0209966_10740242 85
1797 3300027907 Ga0207428_10000281 Ga0207428_1000028162 85
1798 3300027907 Ga0207428_10036308 Ga0207428_100363082 85
1799 3300027907 Ga0207428_10123837 Ga0207428_101238374 85
1800 3300027907 Ga0207428_10734482 Ga0207428_107344822 85
1801 3300028379 Ga0268266_10084202 Ga0268266_100842025 85
1802 3300028379 Ga0268266_11319796 Ga0268266_113197962 85
1803 3300028380 Ga0268265_10627911 Ga0268265_106279112 85
1804 3300028380 Ga0268265_10944260 Ga0268265_109442602 85
1805 3300028380 Ga0268265_12318961 Ga0268265_123189611 85
1806 3300028381 Ga0268264_10939491 Ga0268264_109394912 85
1807 3300028381 Ga0268264_11170057 Ga0268264_111700572 85
1808 3300031548 Ga0307408_100329000 Ga0307408_1003290003 85
1809 3300031901 Ga0307406_10419448 Ga0307406_104194482 85
1810 3300032126 Ga0307415_102336213 Ga0307415_1023362132 85
1811 3300034817 Ga0373948_0075426 Ga0373948_0075426_164_424 85
1812 3300034819 Ga0373958_0117564 Ga0373958_0117564_224_484 85
1813 3300034820 Ga0373959_0009124 Ga0373959_0009124_1035_1295 85
1814 3300034820 Ga0373959_0189772 Ga0373959_0189772_213_476 85
1815 3300034957 Ga0373938_0254501 Ga0373938_0254501_78_338 85
1816 3300035088 Ga0373940_0083358 Ga0373940_0083358_244_504 85
1817 3300035091 Ga0373951_0083106 Ga0373951_0083106_361_621 85
1818 3300035092 Ga0373952_0054182 Ga0373952_0054182_548_808 85
1819 3300035112 Ga0373932_0016563 Ga0373932_0016563_654_914 85
1820 3300035114 Ga0373939_0094004 Ga0373939_0094004_182_442 85
1821 3300035115 Ga0373941_0059146 Ga0373941_0059146_574_834 85
1822 3300035121 Ga0373960_0181143 Ga0373960_0181143_372_632 85
1823 3300035121 Ga0373960_0281106 Ga0373960_0281106_271_528 85
1824 3300035207 Ga0373942_0077560 Ga0373942_0077560_616_876 85
1825 3300035241 Ga0373961_0058706 Ga0373961_0058706_740_1000 85
1826 3300035242 Ga0373962_0018881 Ga0373962_0018881_713_973 85
1827 3300035242 Ga0373962_0146758 Ga0373962_0146758_226_489 85
1828 3300035691 Ga0373931_0117198 Ga0373931_0117198_831_1088 85
1829 3300035691 Ga0373931_0121665 Ga0373931_0121665_496_756 85
1830 3300041458 Ga0451798_1038471 Ga0451798_1038471_118_378 85
1831 3300041501 Ga0451845_0678149 Ga0451845_0678149_256_516 85
1832 3300041507 Ga0451851_0813741 Ga0451851_0813741_390_650 85
1833 3300042005 Ga0439448_0265233 Ga0439448_0265233_222_485 85
1834 3300042008 Ga0439450_209476 Ga0439450_209476_143_403 85
1835 3300042122 Ga0450920_014363 Ga0450920_014363_80_343 85
1836 3300042145 Ga0450906_027676 Ga0450906_027676_208_471 85
1837 3300042145 Ga0450906_085820 Ga0450906_085820_13_270 85
1838 3300042146 Ga0450907_013736 Ga0450907_013736_657_914 85
1839 3300042147 Ga0450910_035784 Ga0450910_035784_321_584 85
1840 3300042530 Ga0450916_039231 Ga0450916_039231_59_322 85
1841 3300045051 Ga0451576_1770628 Ga0451576_1770628_182_442 85
1842 3300046455 Ga0495603_0029698 Ga0495603_0029698_184_444 85
1843 3300046500 Ga0495596_0111120 Ga0495596_0111120_578_838 85
1844 3300046501 Ga0495607_0378449 Ga0495607_0378449_195_455 85
1845 3300046513 Ga0495616_0247401 Ga0495616_0247401_115_375 85
1846 3300046520 Ga0495637_0184951 Ga0495637_0184951_115_375 85
1847 3300046674 Ga0495588_0157446 Ga0495588_0157446_829_1089 85
1848 3300046681 Ga0495647_0478649 Ga0495647_0478649_216_476 85
1849 3300046794 Ga0495589_0025438 Ga0495589_0025438_257_517 85
1850 3300046810 Ga0495660_0211417 Ga0495660_0211417_172_432 85
1851 3300047315 Ga0495581_0313574 Ga0495581_0313574_394_654 85
1852 3300047445 Ga0495677_0169645 Ga0495677_0169645_161_421 85
1853 3300047470 Ga0495681_0380779 Ga0495681_0380779_156_416 85
1854 3300048090 Ga0495615_0184064 Ga0495615_0184064_144_404 85
1855 3300048903 Ga0496100_0105983 Ga0496100_0105983_382_642 85
1856 3300048903 Ga0496100_0826823 Ga0496100_0826823_420_680 85
1857 3300048903 Ga0496100_1607404 Ga0496100_1607404_11_271 85
1858 3300048904 Ga0496101_0274161 Ga0496101_0274161_41_301 85
1859 3300048904 Ga0496101_0365087 Ga0496101_0365087_460_720 85
1860 3300048904 Ga0496101_0727362 Ga0496101_0727362_369_629 85
1861 3300048905 Ga0496102_0847462 Ga0496102_0847462_432_692 85
1862 3300048907 Ga0496104_0056192 Ga0496104_0056192_366_626 85
1863 3300048907 Ga0496104_0707269 Ga0496104_0707269_544_801 85
1864 3300048908 Ga0496105_0262070 Ga0496105_0262070_595_855 85
1865 3300048909 Ga0496106_0131870 Ga0496106_0131870_1322_1582 85
1866 3300048909 Ga0496106_1454037 Ga0496106_1454037_194_454 85
1867 3300048910 Ga0496107_0025226 Ga0496107_0025226_573_833 85
1868 3300048910 Ga0496107_0985240 Ga0496107_0985240_154_414 85
1869 3300048911 Ga0496108_0021551 Ga0496108_0021551_1898_2155 85
1870 3300048911 Ga0496108_0023356 Ga0496108_0023356_1642_1902 85
1871 3300048911 Ga0496108_0079703 Ga0496108_0079703_1498_1758 85
1872 3300048911 Ga0496108_0361643 Ga0496108_0361643_504_767 85
1873 3300048911 Ga0496108_0556450 Ga0496108_0556450_40_300 85
1874 3300048912 Ga0496109_0035147 Ga0496109_0035147_446_706 85
1875 3300048912 Ga0496109_0077378 Ga0496109_0077378_338_598 85
1876 3300048912 Ga0496109_0304372 Ga0496109_0304372_244_501 85
1877 3300048912 Ga0496109_0368509 Ga0496109_0368509_1011_1274 85
1878 3300048913 Ga0496110_0082414 Ga0496110_0082414_2543_2803 85
1879 3300048913 Ga0496110_0128156 Ga0496110_0128156_169_429 85
1880 3300048913 Ga0496110_0149457 Ga0496110_0149457_1842_2102 85
1881 3300048913 Ga0496110_0254499 Ga0496110_0254499_33_293 85
1882 3300048914 Ga0496111_0104052 Ga0496111_0104052_1795_2055 85
1883 3300048914 Ga0496111_0147176 Ga0496111_0147176_460_720 85
1884 3300048914 Ga0496111_0300235 Ga0496111_0300235_376_636 85
1885 3300048914 Ga0496111_0511390 Ga0496111_0511390_64_327 85
1886 3300048915 Ga0496112_0559544 Ga0496112_0559544_626_883 85
1887 3300048915 Ga0496112_0730463 Ga0496112_0730463_394_654 85
1888 3300048916 Ga0496113_0109168 Ga0496113_0109168_1470_1730 85
1889 3300048917 Ga0496114_0083542 Ga0496114_0083542_590_850 85
1890 3300048917 Ga0496114_0120337 Ga0496114_0120337_1610_1870 85
1891 3300048917 Ga0496114_0141106 Ga0496114_0141106_1695_1955 85
1892 3300049568 Ga0501031_0356701 Ga0501031_0356701_33_290 85
1893 3300049570 Ga0501033_0760350 Ga0501033_0760350_53_310 85
1894 3300049572 Ga0501036_0085508 Ga0501036_0085508_1733_1990 85
1895 3300049572 Ga0501036_0510267 Ga0501036_0510267_153_413 85
1896 3300049572 Ga0501036_0710736 Ga0501036_0710736_509_769 85
1897 3300049575 Ga0501039_0048604 Ga0501039_0048604_2129_2386 85
1898 3300049575 Ga0501039_0770413 Ga0501039_0770413_200_460 85
1899 3300049576 Ga0501040_0161758 Ga0501040_0161758_1144_1401 85
1900 3300049576 Ga0501040_0199231 Ga0501040_0199231_1061_1321 85
1901 3300049576 Ga0501040_1047482 Ga0501040_1047482_267_524 85
1902 3300049577 Ga0501041_0151877 Ga0501041_0151877_291_551 85
1903 3300049578 Ga0501042_0660595 Ga0501042_0660595_116_376 85
1904 3300049578 Ga0501042_0742441 Ga0501042_0742441_430_687 85
1905 3300049578 Ga0501042_1370096 Ga0501042_1370096_133_393 85
1906 3300049579 Ga0501043_0245300 Ga0501043_0245300_384_644 85
1907 3300049582 Ga0501048_0650410 Ga0501048_0650410_77_334 85
1908 3300049585 Ga0501069_0865369 Ga0501069_0865369_251_508 85
1909 3300049585 Ga0501069_1006694 Ga0501069_1006694_219_479 85
1910 3300049586 Ga0501070_0032622 Ga0501070_0032622_1000_1257 85
1911 3300049587 Ga0501071_0727753 Ga0501071_0727753_70_330 85
1912 3300049589 Ga0501073_0509781 Ga0501073_0509781_537_794 85
1913 3300049589 Ga0501073_0535392 Ga0501073_0535392_529_789 85
1914 3300049591 Ga0501075_0006741 Ga0501075_0006741_5549_5806 85
1915 3300049592 Ga0501076_0063359 Ga0501076_0063359_2034_2291 85
1916 3300049592 Ga0501076_0148384 Ga0501076_0148384_162_422 85
1917 3300049592 Ga0501076_0181848 Ga0501076_0181848_70_330 85
1918 3300049592 Ga0501076_0199490 Ga0501076_0199490_796_1056 85
1919 3300049593 Ga0501077_0081340 Ga0501077_0081340_344_604 85
1920 3300049593 Ga0501077_0081643 Ga0501077_0081643_376_636 85
1921 3300049593 Ga0501077_0391937 Ga0501077_0391937_75_332 85
1922 3300049741 Ga0501079_0052322 Ga0501079_0052322_1878_2135 85
1923 3300049741 Ga0501079_0220433 Ga0501079_0220433_400_660 85
1924 3300049741 Ga0501079_0317583 Ga0501079_0317583_806_1066 85
1925 3300049741 Ga0501079_0916933 Ga0501079_0916933_10_270 85
1926 3300049742 Ga0501080_0049915 Ga0501080_0049915_3531_3788 85
1927 3300049742 Ga0501080_0144233 Ga0501080_0144233_582_842 85
1928 3300049742 Ga0501080_1549596 Ga0501080_1549596_145_405 85
1929 3300049743 Ga0501081_0005337 Ga0501081_0005337_6728_6985 85
1930 3300049743 Ga0501081_0153578 Ga0501081_0153578_1169_1429 85
1931 3300049743 Ga0501081_0358947 Ga0501081_0358947_583_843 85
1932 3300049824 Ga0501045_0101768 Ga0501045_0101768_867_1127 85
1933 3300049824 Ga0501045_0199348 Ga0501045_0199348_14_271 85
1934 3300049824 Ga0501045_0577597 Ga0501045_0577597_217_477 85
1935 3300049824 Ga0501045_1200583 Ga0501045_1200583_19_279 85
1936 3300050491 nmdc:mga00v17_1067420_c1 nmdc:mga00v17_1067420_c1_57_317 85
1937 3300050492 nmdc:mga0yw44_254684_c1 nmdc:mga0yw44_254684_c1_869_1129 85
1938 3300050492 nmdc:mga0yw44_30486_c1 nmdc:mga0yw44_30486_c1_1513_1776 85
1939 3300050494 nmdc:mga06z11_953579_c1 nmdc:mga06z11_953579_c1_161_424 85
1940 3300050496 nmdc:mga07m45_327816_c1 nmdc:mga07m45_327816_c1_118_381 85
1941 3300050507 nmdc:mga05p37_6099_c1 nmdc:mga05p37_6099_c1_11082_11339 85
1942 3300050508 nmdc:mga09592_17464_c1 nmdc:mga09592_17464_c1_1447_1704 85
1943 3300050510 nmdc:mga06r32_264597_c1 nmdc:mga06r32_264597_c1_1429_1686 85
1944 3300050511 nmdc:mga08y16_10863_c1 nmdc:mga08y16_10863_c1_2490_2747 85
1945 3300050511 nmdc:mga08y16_1240142_c1 nmdc:mga08y16_1240142_c1_24_284 85
1946 3300050511 nmdc:mga08y16_192677_c1 nmdc:mga08y16_192677_c1_621_881 85
1947 3300050511 nmdc:mga08y16_59955_c1 nmdc:mga08y16_59955_c1_2474_2734 85
1948 3300050511 nmdc:mga08y16_994674_c1 nmdc:mga08y16_994674_c1_475_735 85
1949 3300050515 nmdc:mga0a205_1008824_c1 nmdc:mga0a205_1008824_c1_284_544 85
1950 3300050515 nmdc:mga0a205_108520_c1 nmdc:mga0a205_108520_c1_92_349 85
1951 3300054114 Ga0501084_0006937 Ga0501084_0006937_2170_2427 85
1952 3300054114 Ga0501084_0177475 Ga0501084_0177475_130_390 85
1953 3300054114 Ga0501084_0329999 Ga0501084_0329999_979_1239 85
1954 3300060353 Ga0501082_0030784 Ga0501082_0030784_4355_4612 85
1955 3300060353 Ga0501082_0217365 Ga0501082_0217365_1039_1299 85
1956 3300060353 Ga0501082_1144842 Ga0501082_1144842_173_433 85
1957 3300060353 Ga0501082_1369625 Ga0501082_1369625_166_426 85
1958 3300061734 Ga0530510_0995624 Ga0530510_0995624_136_393 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

20

79

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yxu-assembly1.cif.gz_E structure of mycobacterium smegmatis held protein in complex with rna polymerase core - state i, primary channel engaged 0.8739 3 82
5zx3-assembly1.cif.gz_E mycobacterium tuberculosis rna polymerase holoenzyme with ecf sigma factor sigma h 0.8692 1 80
8dy9-assembly1.cif.gz_E streptomyces venezuelae rnap unconstrained open promoter complex with whia and whib transcription factors 0.8526 1 80
6cce-assembly1.cif.gz_E crystal structure of a mycobacterium smegmatis rna polymerase transcription initiation complex with inhibitor kanglemycin a 0.8514 1 82
8dy7-assembly1.cif.gz_E streptomyces venezuelae rnap transcription open promoter complex with whia and whib transcription factors 0.849 1 80
ID Description Score Start End Superfamily
4llgK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.825 5 79 3.90.940.10
5nwtE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.81 5 78 3.90.940.10
4ljzE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8097 4 79 3.90.940.10
6gfwE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.804 3 77 3.90.940.10
6algK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.7996 5 75 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A349B4J6-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8804 1 83 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A1V5IRP6-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8714 1 80 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A0M4GC47-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8706 1 82 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A6I3B900-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8697 1 84 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A538G1Q5-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.8678 7 82 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677

Feature Viewer

pLDDT pTM Quality
75.63 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map