F496151

General Info

Members Datasets Scaffolds Average Seq Length
1962 747 3924 162

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_1257352|Ga0496110_1257352_43_618
Length 191
Sequence MALFTSLNWNLLATAIGSAVSRLLPGGMCMTTVVLNRRNLVAAGGCVLAAGVSGLLLPATAQGLAPTPSMSGGSNNYRKGAPIVDRIGKGGFWMSGTVRRAGDGAPLAGQRIQIWAHTPEGQEHEPQSHGATLTDKNGVFRLEIPQIIPIFGQPHGHLAYDSGEFKTVFLRPVMRSAKETSLEAHFVLQPA

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
37 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
68 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
140 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
161 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
162 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
163 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
164 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
165 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
166 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
167 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
179 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
180 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
181 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
182 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
183 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
184 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
186 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
188 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
189 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
190 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
191 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
192 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
274 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
280 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
281 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
282 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
285 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
286 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
287 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
288 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
289 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
290 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
291 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
292 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
293 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
294 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
295 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
296 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
297 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
298 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
299 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
300 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
301 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
302 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
303 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
304 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
305 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
306 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
307 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
308 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
309 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
310 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
312 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
313 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
314 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
315 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
316 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
317 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
318 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
319 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
320 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
321 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
322 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
323 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
324 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
325 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
326 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
327 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
328 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
329 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
330 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
331 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
332 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
333 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
334 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
335 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
338 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
341 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
342 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
343 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
344 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
345 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
346 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
347 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
348 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
349 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
350 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
351 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
352 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
353 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
354 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
355 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
356 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
357 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
358 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
359 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
360 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
361 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
364 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
365 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
366 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
367 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
368 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
369 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
370 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
371 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
374 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
375 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
376 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
377 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
378 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
379 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
380 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
381 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
382 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
383 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
384 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
385 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
386 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
387 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
388 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
389 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
390 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
391 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
392 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
393 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
394 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
395 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
396 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
397 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
398 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
399 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
400 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
401 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
406 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
407 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
408 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
409 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
413 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
414 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
415 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
416 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
417 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
418 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
419 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
420 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
421 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
422 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
423 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
424 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
425 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
426 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
427 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
428 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
429 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
430 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
431 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
432 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
433 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
434 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
437 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
438 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
441 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
442 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
443 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
444 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
445 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
446 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
447 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
448 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
449 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
450 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
451 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
454 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
455 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
456 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
457 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
458 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
459 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
460 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
461 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
462 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
463 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
464 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
465 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
466 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
470 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
471 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
472 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
473 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
474 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
481 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
482 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
483 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
484 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
497 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
498 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
499 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
503 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
504 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
505 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
506 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
507 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
508 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
509 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
510 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
511 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
512 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
513 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
514 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
515 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
516 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
517 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
518 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
519 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
520 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
521 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
522 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
523 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
524 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
525 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
526 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
527 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
528 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
529 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
530 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
531 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
534 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
535 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
536 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
537 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
538 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
539 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
540 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
541 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
542 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
543 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
544 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
545 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
546 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
547 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
548 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
549 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
550 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
551 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
552 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
553 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
554 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
555 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
556 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
557 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
558 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
559 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
560 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
561 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
562 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
563 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
564 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
565 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
566 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
567 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
568 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
569 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
570 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
571 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
572 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
573 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
574 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
575 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
576 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
578 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
579 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
580 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
581 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
582 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
583 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
584 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
585 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
586 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
587 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
588 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
589 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
590 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
591 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
592 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
593 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
594 2738543012 Acidovorax sp. CF301 Isolate Unclassified
595 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
596 2791355199
597 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
598 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
599 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
600 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
601 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
602 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
603 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
604 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
605 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
606 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
607 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
608 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
609 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
610 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
611 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
612 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
613 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
614 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
615 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
616 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
617 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
618 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
619 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
620 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
621 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
622 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
623 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
624 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
625 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
626 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
627 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
628 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
629 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
630 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
631 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
632 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
633 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
634 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
635 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
636 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
637 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
638 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
639 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
640 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
641 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
642 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
643 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
644 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
645 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
646 2904699407
647 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
648 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
649 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
650 2922368715
651 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
652 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
653 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
654 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
655 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
656 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
657 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
658 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
659 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
660 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
661 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
662 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
663 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
664 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
665 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
666 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
667 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
668 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
669 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
670 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
671 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
672 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
673 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
674 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
675 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
676 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
677 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
678 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
679 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
680 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
681 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
682 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
683 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
684 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
685 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
686 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
687 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
688 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
689 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
690 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
691 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
692 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
693 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
694 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
695 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
696 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
697 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
698 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
699 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
700 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
701 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
702 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
703 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
704 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
705 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
706 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
707 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
708 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
709 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
710 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
711 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
712 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
713 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
714 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
715 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
716 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
717 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
718 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
719 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
720 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
721 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
722 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
723 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
724 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
725 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
726 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
727 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
728 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
729 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
730 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
731 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
732 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
733 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
734 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
735 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
736 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
737 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
738 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
739 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
740 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
741 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
742 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
743 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
744 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
745 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
746 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
747 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0.66
Isolates 8.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.97
Nodule 6.73
Rhizoplane 9.48
Rhizosphere 64.12
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_1257352 3300048913 Bacteria 649
2 SwRhRL2b_contig_1701188 2162886007 Bacteria 1617
3 ARcpr5oldR_c000128 3300000041 Bacteria 13221
4 ARSoilYngRDRAFT_c00283 3300000042 Bacteria 7457
5 ARcpr5yngRDRAFT_c000030 3300000043 Bacteria 23301
6 ARSoilOldRDRAFT_c000033 3300000044 Bacteria 30681
7 ARCol0oldRDRAFT_c00578 3300000045 Bacteria 3261
8 JGI24752J21851_1000855 3300001976 Bacteria 4126
9 JGI24746J21847_1001099 3300001977 Bacteria 4253
10 JGI24747J21853_1000198 3300001978 Bacteria 3172
11 JGI24739J22299_10003373 3300001989 Bacteria 6093
12 JGI24737J22298_10000583 3300001990 Bacteria 12816
13 JGI24737J22298_10010676 3300001990 Bacteria 3026
14 JGI24743J22301_10002884 3300001991 Bacteria 2652
15 JGI24743J22301_10038350 3300001991 Bacteria 957
16 JGI24750J21931_1000410 3300002070 Bacteria 7125
17 JGI24750J21931_1005642 3300002070 Bacteria 1541
18 JGI24750J21931_1022371 3300002070 Bacteria 892
19 JGI24745J21846_1000037 3300002073 Bacteria 8975
20 JGI24738J21930_10000785 3300002075 Bacteria 9094
21 JGI24749J21850_1001221 3300002076 Bacteria 3652
22 JGI24749J21850_1015533 3300002076 Bacteria 1068
23 JGI24744J21845_10011293 3300002077 Bacteria 1828
24 JGI24744J21845_10042033 3300002077 Bacteria 854
25 JGI24033J26618_1000312 3300002155 Bacteria 5176
26 JGI24034J26672_10000581 3300002239 Bacteria 4668
27 JGI24034J26672_10025599 3300002239 Bacteria 944
28 JGI24742J22300_10000043 3300002244 Bacteria 18528
29 JGI24751J29686_10041706 3300002459 Bacteria 949
30 JGI25406J46586_10000068 3300003203 Bacteria 47530
31 JGI25406J46586_10008165 3300003203 Bacteria 4754
32 JGI25406J46586_10060073 3300003203 Bacteria 1231
33 JGI25165J46597_1018079 3300003214 Bacteria 934
34 JGI25153J46596_10002210 3300003215 Bacteria 11363
35 JGI25153J46596_10004811 3300003215 Bacteria 7192
36 JGI25153J46596_10004900 3300003215 Bacteria 7115
37 JGI25153J46596_10007387 3300003215 Bacteria 5415
38 JGI25160J50197_1000710 3300003354 Bacteria 18324
39 JGI25160J50197_1003584 3300003354 Bacteria 6892
40 JGI25160J50197_1010394 3300003354 Bacteria 3370
41 JGI25404J52841_10000867 3300003659 Bacteria 4886
42 JGI25404J52841_10002487 3300003659 Bacteria 3494
43 JGI25404J52841_10006015 3300003659 Bacteria 2523
44 JGI25404J52841_10022071 3300003659 Bacteria 1376
45 JGI25404J52841_10056632 3300003659 Bacteria 822
46 JGI25404J52841_10080103 3300003659 Bacteria 682
47 Ga0055539_1011872 3300003752 Bacteria 1071
48 Ga0055524_1068901 3300003775 Bacteria 691
49 Ga0055531_10053154 3300003794 Bacteria 1049
50 Ga0055543_1006712 3300004625 Bacteria 2743
51 Ga0058859_10016570 3300004798 Bacteria 624
52 Ga0058859_11699942 3300004798 Bacteria 562
53 Ga0058863_11703982 3300004799 Bacteria 576
54 Ga0058860_10024684 3300004801 Bacteria 675
55 Ga0065165_1000721 3300005262 Bacteria 46476
56 Ga0065165_1004793 3300005262 Bacteria 8077
57 Ga0065165_1033937 3300005262 Bacteria 1583
58 Ga0065717_1002062 3300005276 Bacteria 3208
59 Ga0065716_1001745 3300005277 Bacteria 3635
60 Ga0065704_10080783 3300005289 Bacteria 3877
61 Ga0065712_10031485 3300005290 Bacteria 1319
62 Ga0065712_10325449 3300005290 Bacteria 822
63 Ga0065707_10173408 3300005295 Bacteria 1440
64 Ga0065707_10286590 3300005295 Bacteria 1034
65 Ga0070658_10443019 3300005327 Bacteria 1119
66 Ga0070676_10004870 3300005328 Bacteria 7110
67 Ga0070676_10110127 3300005328 Bacteria 1714
68 Ga0070683_100000656 3300005329 Bacteria 25014
69 Ga0070683_100320620 3300005329 Bacteria 1475
70 Ga0070683_100819211 3300005329 Bacteria 892
71 Ga0070690_100001831 3300005330 Bacteria 11268
72 Ga0070690_100708144 3300005330 Bacteria 774
73 Ga0070670_100002207 3300005331 Bacteria 15999
74 Ga0070670_100120139 3300005331 Bacteria 2266
75 Ga0070670_100389657 3300005331 Bacteria 1228
76 Ga0070670_100521947 3300005331 Bacteria 1058
77 Ga0070670_100822381 3300005331 Bacteria 840
78 Ga0070677_10000076 3300005333 Bacteria 31338
79 Ga0070677_10096427 3300005333 Bacteria 1296
80 Ga0068869_100000216 3300005334 Bacteria 29999
81 Ga0068869_100106419 3300005334 Bacteria 2128
82 Ga0070666_10021987 3300005335 Bacteria 4138
83 Ga0070666_10029488 3300005335 Bacteria 3607
84 Ga0070666_10160390 3300005335 Bacteria 1572
85 Ga0070680_100002960 3300005336 Bacteria 12628
86 Ga0070680_100203154 3300005336 Bacteria 1671
87 Ga0070680_100423043 3300005336 Bacteria 1136
88 Ga0070680_100453990 3300005336 Bacteria 1095
89 Ga0070682_100000285 3300005337 Bacteria 36134
90 Ga0070682_100251333 3300005337 Bacteria 1274
91 Ga0070682_100368923 3300005337 Bacteria 1076
92 Ga0070682_100623658 3300005337 Bacteria 855
93 Ga0068868_100001772 3300005338 Bacteria 14781
94 Ga0068868_100033599 3300005338 Bacteria 3955
95 Ga0068868_100041211 3300005338 Bacteria 3597
96 Ga0068868_100165736 3300005338 Bacteria 1827
97 Ga0070660_100000874 3300005339 Bacteria 20123
98 Ga0070660_100218822 3300005339 Bacteria 1547
99 Ga0070660_100368672 3300005339 Bacteria 1184
100 Ga0070660_100770173 3300005339 Bacteria 809
101 Ga0070689_100010376 3300005340 Bacteria 6639
102 Ga0070689_100015849 3300005340 Bacteria 5505
103 Ga0070689_100753724 3300005340 Bacteria 853
104 Ga0070689_101082685 3300005340 Bacteria 716
105 Ga0070691_10001440 3300005341 Bacteria 10178
106 Ga0070691_10044360 3300005341 Bacteria 2108
107 Ga0070687_100000185 3300005343 Bacteria 21632
108 Ga0070687_100413522 3300005343 Bacteria 887
109 Ga0070687_100554386 3300005343 Bacteria 782
110 Ga0070661_100017504 3300005344 Bacteria 5086
111 Ga0070661_100073421 3300005344 Bacteria 2519
112 Ga0070661_100111757 3300005344 Bacteria 2041
113 Ga0070661_100327398 3300005344 Bacteria 1198
114 Ga0070661_100441958 3300005344 Bacteria 1034
115 Ga0070661_100733815 3300005344 Bacteria 807
116 Ga0070692_10267971 3300005345 Bacteria 1030
117 Ga0070692_10334620 3300005345 Bacteria 936
118 Ga0070668_100002051 3300005347 Bacteria 14738
119 Ga0070668_100011651 3300005347 Bacteria 6545
120 Ga0070668_100035393 3300005347 Bacteria 3807
121 Ga0070668_100050466 3300005347 Bacteria 3203
122 Ga0070668_100097988 3300005347 Bacteria 2319
123 Ga0070668_100179118 3300005347 Bacteria 1730
124 Ga0070668_100188678 3300005347 Bacteria 1687
125 Ga0070668_100437860 3300005347 Bacteria 1122
126 Ga0070668_100738349 3300005347 Bacteria 871
127 Ga0070668_102059044 3300005347 Bacteria 527
128 Ga0070669_100001956 3300005353 Bacteria 14875
129 Ga0070669_100311205 3300005353 Bacteria 1270
130 Ga0070669_100530531 3300005353 Bacteria 979
131 Ga0070669_100725776 3300005353 Bacteria 840
132 Ga0070675_100000622 3300005354 Bacteria 24525
133 Ga0070675_100153693 3300005354 Bacteria 1974
134 Ga0070675_100162301 3300005354 Bacteria 1922
135 Ga0070675_100272791 3300005354 Bacteria 1485
136 Ga0070671_100007975 3300005355 Bacteria 8472
137 Ga0070671_100008477 3300005355 Bacteria 8239
138 Ga0070671_100048982 3300005355 Bacteria 3515
139 Ga0070674_100019666 3300005356 Bacteria 4294
140 Ga0070674_100022956 3300005356 Bacteria 4028
141 Ga0070674_100038207 3300005356 Bacteria 3233
142 Ga0070674_100207223 3300005356 Bacteria 1517
143 Ga0070674_100334228 3300005356 Bacteria 1218
144 Ga0070674_101218525 3300005356 Bacteria 669
145 Ga0070674_101353810 3300005356 Unclassified 636
146 Ga0070673_100000640 3300005364 Bacteria 19217
147 Ga0070673_100079199 3300005364 Bacteria 2659
148 Ga0070673_100982260 3300005364 Bacteria 785
149 Ga0070688_100001260 3300005365 Bacteria 12627
150 Ga0070688_100014141 3300005365 Bacteria 4518
151 Ga0070688_100107787 3300005365 Bacteria 1847
152 Ga0070688_100141732 3300005365 Bacteria 1634
153 Ga0070688_100214299 3300005365 Bacteria 1354
154 Ga0070688_100420104 3300005365 Bacteria 994
155 Ga0070688_100492242 3300005365 Bacteria 923
156 Ga0070659_100001362 3300005366 Bacteria 17597
157 Ga0070659_100015110 3300005366 Bacteria 5775
158 Ga0070659_100174055 3300005366 Bacteria 1765
159 Ga0070659_100207929 3300005366 Bacteria 1612
160 Ga0070659_100352055 3300005366 Bacteria 1236
161 Ga0070659_100462404 3300005366 Bacteria 1078
162 Ga0070659_100596967 3300005366 Bacteria 948
163 Ga0070659_100865249 3300005366 Bacteria 788
164 Ga0070667_100053811 3300005367 Bacteria 3397
165 Ga0070667_100069788 3300005367 Bacteria 2991
166 Ga0070667_100095579 3300005367 Bacteria 2562
167 Ga0070667_100101080 3300005367 Bacteria 2490
168 Ga0070667_100535927 3300005367 Bacteria 1075
169 Ga0070667_100629671 3300005367 Bacteria 990
170 Ga0070703_10001617 3300005406 Bacteria 6701
171 Ga0070709_10417639 3300005434 Bacteria 1005
172 Ga0070714_100020655 3300005435 Bacteria 5381
173 Ga0070714_100231089 3300005435 Bacteria 1704
174 Ga0070713_100002997 3300005436 Bacteria 11090
175 Ga0070713_100314506 3300005436 Bacteria 1445
176 Ga0070713_101221650 3300005436 Bacteria 728
177 Ga0070710_10011255 3300005437 Bacteria 4418
178 Ga0070710_10821000 3300005437 Bacteria 665
179 Ga0070701_10000264 3300005438 Bacteria 17077
180 Ga0070701_10318259 3300005438 Bacteria 962
181 Ga0070701_10366211 3300005438 Bacteria 904
182 Ga0070711_100007247 3300005439 Bacteria 6739
183 Ga0070705_100064906 3300005440 Bacteria 2183
184 Ga0070705_100081187 3300005440 Bacteria 1992
185 Ga0070705_100241017 3300005440 Bacteria 1263
186 Ga0070700_100008659 3300005441 Bacteria 5548
187 Ga0070700_100221837 3300005441 Bacteria 1340
188 Ga0070700_100331402 3300005441 Bacteria 1122
189 Ga0070700_100514346 3300005441 Bacteria 923
190 Ga0070694_100002993 3300005444 Bacteria 10042
191 Ga0070694_100034575 3300005444 Bacteria 3334
192 Ga0070694_100094905 3300005444 Bacteria 2099
193 Ga0070708_100122026 3300005445 Bacteria 2405
194 Ga0070663_100001039 3300005455 Bacteria 15172
195 Ga0070663_100004997 3300005455 Bacteria 7832
196 Ga0070663_100067206 3300005455 Bacteria 2599
197 Ga0070663_100155316 3300005455 Bacteria 1758
198 Ga0070663_100407578 3300005455 Bacteria 1113
199 Ga0070663_100441000 3300005455 Bacteria 1071
200 Ga0070663_100458773 3300005455 Bacteria 1052
201 Ga0070663_100709599 3300005455 Bacteria 855
202 Ga0070678_100019598 3300005456 Bacteria 4417
203 Ga0070678_100036719 3300005456 Bacteria 3432
204 Ga0070678_100743663 3300005456 Bacteria 887
205 Ga0070662_100003674 3300005457 Bacteria 9589
206 Ga0070662_100052672 3300005457 Bacteria 2943
207 Ga0070662_100071888 3300005457 Bacteria 2552
208 Ga0070662_100095713 3300005457 Bacteria 2239
209 Ga0070662_100201446 3300005457 Bacteria 1580
210 Ga0070662_100860104 3300005457 Bacteria 772
211 Ga0070662_101508540 3300005457 Bacteria 580
212 Ga0070681_10031741 3300005458 Bacteria 5302
213 Ga0070681_10149428 3300005458 Bacteria 2263
214 Ga0070681_10159875 3300005458 Bacteria 2176
215 Ga0070681_10232159 3300005458 Bacteria 1759
216 Ga0068867_100013959 3300005459 Bacteria 5686
217 Ga0068867_100090819 3300005459 Bacteria 2317
218 Ga0068867_100127586 3300005459 Bacteria 1973
219 Ga0070685_10000645 3300005466 Bacteria 19015
220 Ga0070685_10133545 3300005466 Bacteria 1554
221 Ga0070685_10158762 3300005466 Bacteria 1439
222 Ga0070706_100429185 3300005467 Bacteria 1230
223 Ga0070706_100902071 3300005467 Bacteria 817
224 Ga0070679_100023549 3300005530 Bacteria 6028
225 Ga0070679_100060545 3300005530 Bacteria 3773
226 Ga0070684_100002245 3300005535 Bacteria 14207
227 Ga0070684_100477404 3300005535 Bacteria 1154
228 Ga0070684_101624976 3300005535 Bacteria 610
229 Ga0068853_100005266 3300005539 Bacteria 10126
230 Ga0068853_100016388 3300005539 Bacteria 6098
231 Ga0068853_100113450 3300005539 Bacteria 2410
232 Ga0068853_100206651 3300005539 Bacteria 1788
233 Ga0068853_100995936 3300005539 Bacteria 807
234 Ga0068853_101053730 3300005539 Bacteria 784
235 Ga0070672_100000604 3300005543 Bacteria 21079
236 Ga0070672_100302207 3300005543 Bacteria 1357
237 Ga0070686_100001137 3300005544 Bacteria 15280
238 Ga0070686_100501836 3300005544 Bacteria 942
239 Ga0070695_100015278 3300005545 Bacteria 4634
240 Ga0070695_100033553 3300005545 Bacteria 3212
241 Ga0070695_100523276 3300005545 Bacteria 920
242 Ga0070696_100025825 3300005546 Bacteria 3995
243 Ga0070693_100003447 3300005547 Bacteria 7376
244 Ga0070693_100325099 3300005547 Bacteria 1045
245 Ga0070693_100853742 3300005547 Bacteria 679
246 Ga0070665_100016911 3300005548 Bacteria 7313
247 Ga0070665_100039105 3300005548 Bacteria 4770
248 Ga0070665_100144010 3300005548 Bacteria 2386
249 Ga0070665_100147393 3300005548 Bacteria 2356
250 Ga0070665_100358179 3300005548 Bacteria 1465
251 Ga0070665_100389829 3300005548 Bacteria 1401
252 Ga0070665_100915099 3300005548 Bacteria 890
253 Ga0070665_101235720 3300005548 Bacteria 758
254 Ga0070704_100095431 3300005549 Bacteria 2227
255 Ga0070704_100235903 3300005549 Bacteria 1495
256 Ga0068855_100210900 3300005563 Bacteria 2182
257 Ga0068855_100336377 3300005563 Bacteria 1666
258 Ga0068855_100410392 3300005563 Bacteria 1483
259 Ga0068855_100475620 3300005563 Bacteria 1361
260 Ga0070664_100000973 3300005564 Bacteria 22427
261 Ga0070664_100056175 3300005564 Bacteria 3345
262 Ga0070664_100057099 3300005564 Bacteria 3317
263 Ga0070664_100140377 3300005564 Bacteria 2127
264 Ga0070664_100172624 3300005564 Bacteria 1918
265 Ga0070664_100462703 3300005564 Bacteria 1165
266 Ga0070664_100727541 3300005564 Bacteria 925
267 Ga0068857_100001725 3300005577 Bacteria 17581
268 Ga0068857_100246227 3300005577 Bacteria 1638
269 Ga0068857_100514440 3300005577 Bacteria 1124
270 Ga0068857_100564208 3300005577 Bacteria 1073
271 Ga0068854_100000146 3300005578 Bacteria 49106
272 Ga0068854_100534645 3300005578 Bacteria 992
273 Ga0068854_100615705 3300005578 Bacteria 929
274 Ga0068854_100898087 3300005578 Bacteria 778
275 Ga0068856_100006444 3300005614 Bacteria 11514
276 Ga0068856_100180269 3300005614 Bacteria 2125
277 Ga0068856_100388793 3300005614 Bacteria 1415
278 Ga0068856_100763688 3300005614 Bacteria 987
279 Ga0068856_100878241 3300005614 Bacteria 916
280 Ga0070702_100007133 3300005615 Bacteria 5337
281 Ga0070702_100017579 3300005615 Bacteria 3691
282 Ga0070702_100113284 3300005615 Bacteria 1686
283 Ga0070702_100174906 3300005615 Bacteria 1400
284 Ga0070702_100443901 3300005615 Bacteria 939
285 Ga0068852_100039916 3300005616 Bacteria 3955
286 Ga0068852_101368495 3300005616 Bacteria 730
287 Ga0068852_101673176 3300005616 Bacteria 659
288 Ga0068859_100045772 3300005617 Bacteria 4395
289 Ga0068859_100062244 3300005617 Bacteria 3761
290 Ga0068859_100134370 3300005617 Bacteria 2545
291 Ga0068859_100166832 3300005617 Unclassified 2282
292 Ga0068859_100198899 3300005617 Bacteria 2088
293 Ga0068859_100439603 3300005617 Bacteria 1401
294 Ga0068859_101436570 3300005617 Bacteria 761
295 Ga0068864_100037540 3300005618 Bacteria 4134
296 Ga0068864_100038231 3300005618 Bacteria 4097
297 Ga0068864_100140415 3300005618 Bacteria 2178
298 Ga0068864_100284468 3300005618 Bacteria 1544
299 Ga0068864_100386486 3300005618 Bacteria 1327
300 Ga0068864_100412915 3300005618 Bacteria 1285
301 Ga0068864_100502734 3300005618 Bacteria 1166
302 Ga0068864_100603061 3300005618 Bacteria 1066
303 Ga0068866_10000294 3300005718 Bacteria 23748
304 Ga0068866_10127586 3300005718 Bacteria 1442
305 Ga0068866_10308874 3300005718 Bacteria 990
306 Ga0068861_100014932 3300005719 Bacteria 5460
307 Ga0068861_100042022 3300005719 Bacteria 3425
308 Ga0068861_100109797 3300005719 Bacteria 2208
309 Ga0068861_100156090 3300005719 Bacteria 1878
310 Ga0068861_100178096 3300005719 Bacteria 1767
311 Ga0068861_100311659 3300005719 Bacteria 1367
312 Ga0068861_100544652 3300005719 Bacteria 1056
313 Ga0068861_100766575 3300005719 Bacteria 902
314 Ga0068861_101363475 3300005719 Bacteria 691
315 Ga0068851_10172632 3300005834 Bacteria 1194
316 Ga0068870_10000048 3300005840 Bacteria 37476
317 Ga0068870_10110209 3300005840 Bacteria 1570
318 Ga0068870_10137670 3300005840 Bacteria 1425
319 Ga0068870_10176923 3300005840 Bacteria 1278
320 Ga0068863_100000150 3300005841 Bacteria 72968
321 Ga0068863_100012006 3300005841 Bacteria 8369
322 Ga0068863_101549170 3300005841 Bacteria 672
323 Ga0068858_100103174 3300005842 Bacteria 2660
324 Ga0068858_100166793 3300005842 Bacteria 2075
325 Ga0068858_100250159 3300005842 Bacteria 1683
326 Ga0068858_100250449 3300005842 Bacteria 1682
327 Ga0068858_100286593 3300005842 Bacteria 1569
328 Ga0068858_100287921 3300005842 Bacteria 1565
329 Ga0068858_100566911 3300005842 Bacteria 1100
330 Ga0068858_101417126 3300005842 Bacteria 685
331 Ga0068860_100000933 3300005843 Bacteria 32339
332 Ga0068860_100035626 3300005843 Bacteria 4772
333 Ga0068860_100280044 3300005843 Bacteria 1629
334 Ga0068860_100344083 3300005843 Bacteria 1467
335 Ga0068860_100401241 3300005843 Bacteria 1356
336 Ga0068860_100416850 3300005843 Bacteria 1330
337 Ga0068860_101467814 3300005843 Bacteria 703
338 Ga0068862_100002722 3300005844 Bacteria 15513
339 Ga0068862_100010439 3300005844 Bacteria 7669
340 Ga0068862_100056101 3300005844 Bacteria 3374
341 Ga0068862_100150129 3300005844 Bacteria 2074
342 Ga0068862_100373183 3300005844 Bacteria 1329
343 Ga0068862_100555789 3300005844 Bacteria 1096
344 Ga0068862_100698396 3300005844 Bacteria 983
345 Ga0068862_100805599 3300005844 Bacteria 917
346 Ga0081455_10002969 3300005937 Bacteria 19834
347 Ga0081455_10010188 3300005937 Bacteria 9568
348 Ga0081455_10014255 3300005937 Bacteria 7802
349 Ga0081455_10027561 3300005937 Bacteria 5206
350 Ga0081455_10059791 3300005937 Bacteria 3216
351 Ga0081455_10240805 3300005937 Bacteria 1330
352 Ga0081455_10253423 3300005937 Bacteria 1286
353 Ga0081538_10024720 3300005981 Bacteria 4270
354 Ga0081538_10068179 3300005981 Bacteria 1980
355 Ga0081540_1002494 3300005983 Bacteria 14981
356 Ga0081540_1002983 3300005983 Bacteria 13562
357 Ga0081540_1005752 3300005983 Bacteria 9184
358 Ga0081540_1022495 3300005983 Bacteria 3722
359 Ga0081540_1026360 3300005983 Bacteria 3319
360 Ga0081540_1026466 3300005983 Bacteria 3310
361 Ga0081540_1027410 3300005983 Bacteria 3229
362 Ga0081540_1055573 3300005983 Bacteria 1928
363 Ga0081540_1056611 3300005983 Bacteria 1902
364 Ga0081540_1090648 3300005983 Bacteria 1346
365 Ga0081540_1224944 3300005983 Bacteria 665
366 Ga0081539_10000203 3300005985 Bacteria 138096
367 Ga0081539_10000321 3300005985 Bacteria 106887
368 Ga0081539_10003895 3300005985 Bacteria 17390
369 Ga0081539_10026056 3300005985 Bacteria 3745
370 Ga0081539_10291330 3300005985 Bacteria 706
371 Ga0070717_10018127 3300006028 Bacteria 5492
372 Ga0070717_10381577 3300006028 Bacteria 1264
373 Ga0075365_10002034 3300006038 Bacteria 9615
374 Ga0075365_10012855 3300006038 Bacteria 4988
375 Ga0075365_10054532 3300006038 Bacteria 2651
376 Ga0075365_10114046 3300006038 Bacteria 1859
377 Ga0075365_10258745 3300006038 Bacteria 1223
378 Ga0075365_10307823 3300006038 Bacteria 1115
379 Ga0075365_10341390 3300006038 Bacteria 1055
380 Ga0075365_10396719 3300006038 Bacteria 973
381 Ga0075365_10399621 3300006038 Bacteria 970
382 Ga0075365_10549834 3300006038 Bacteria 816
383 Ga0075365_10627876 3300006038 Bacteria 760
384 Ga0075365_10728507 3300006038 Bacteria 700
385 Ga0075365_11114129 3300006038 Bacteria 556
386 Ga0075368_10001061 3300006042 Bacteria 8604
387 Ga0075368_10012683 3300006042 Bacteria 3087
388 Ga0075368_10016471 3300006042 Bacteria 2755
389 Ga0075368_10028564 3300006042 Bacteria 2155
390 Ga0075368_10133971 3300006042 Bacteria 1030
391 Ga0075368_10182363 3300006042 Bacteria 885
392 Ga0075368_10223158 3300006042 Bacteria 801
393 Ga0075363_100007066 3300006048 Bacteria 5134
394 Ga0075363_100045819 3300006048 Bacteria 2319
395 Ga0075363_100055447 3300006048 Bacteria 2123
396 Ga0075363_100089786 3300006048 Bacteria 1690
397 Ga0075363_100153035 3300006048 Bacteria 1303
398 Ga0075363_100361831 3300006048 Bacteria 848
399 Ga0075363_100469892 3300006048 Bacteria 745
400 Ga0075364_10014561 3300006051 Bacteria 4861
401 Ga0075364_10065104 3300006051 Bacteria 2392
402 Ga0075364_10080118 3300006051 Bacteria 2159
403 Ga0075364_10084811 3300006051 Bacteria 2097
404 Ga0075364_10118836 3300006051 Bacteria 1768
405 Ga0075364_10194133 3300006051 Bacteria 1375
406 Ga0075364_10270248 3300006051 Bacteria 1156
407 Ga0075364_10274070 3300006051 Bacteria 1148
408 Ga0075364_10579876 3300006051 Bacteria 766
409 Ga0075432_10091524 3300006058 Bacteria 1114
410 Ga0075432_10151435 3300006058 Bacteria 891
411 Ga0070715_10298612 3300006163 Bacteria 861
412 Ga0070715_10320341 3300006163 Bacteria 836
413 Ga0070712_100072662 3300006175 Bacteria 2464
414 Ga0070712_100323546 3300006175 Bacteria 1254
415 Ga0075362_10048947 3300006177 Bacteria 1887
416 Ga0075362_10140085 3300006177 Bacteria 1155
417 Ga0075362_10153764 3300006177 Bacteria 1105
418 Ga0075367_10001220 3300006178 Bacteria 10800
419 Ga0075367_10003085 3300006178 Bacteria 7822
420 Ga0075367_10003450 3300006178 Bacteria 7542
421 Ga0075367_10008440 3300006178 Bacteria 5336
422 Ga0075367_10015513 3300006178 Bacteria 4144
423 Ga0075367_10018382 3300006178 Bacteria 3856
424 Ga0075367_10048887 3300006178 Bacteria 2493
425 Ga0075367_10069381 3300006178 Bacteria 2116
426 Ga0075367_10096732 3300006178 Bacteria 1801
427 Ga0075367_10112956 3300006178 Bacteria 1669
428 Ga0075367_10127646 3300006178 Bacteria 1570
429 Ga0075367_10227664 3300006178 Bacteria 1167
430 Ga0075367_10275792 3300006178 Bacteria 1057
431 Ga0075367_10464338 3300006178 Bacteria 802
432 Ga0075367_10480852 3300006178 Bacteria 787
433 Ga0075367_10618358 3300006178 Bacteria 688
434 Ga0075367_10665744 3300006178 Bacteria 662
435 Ga0075367_10670497 3300006178 Bacteria 659
436 Ga0075369_10004035 3300006186 Bacteria 5393
437 Ga0075369_10165750 3300006186 Bacteria 1013
438 Ga0075369_10357673 3300006186 Bacteria 685
439 Ga0075369_10410929 3300006186 Bacteria 638
440 Ga0075427_10004080 3300006194 Bacteria 2038
441 Ga0075366_10007463 3300006195 Bacteria 6043
442 Ga0075366_10047138 3300006195 Bacteria 2554
443 Ga0075366_10048556 3300006195 Bacteria 2517
444 Ga0075366_10115750 3300006195 Bacteria 1614
445 Ga0075366_10161102 3300006195 Bacteria 1359
446 Ga0075366_10248157 3300006195 Bacteria 1086
447 Ga0075366_10261880 3300006195 Bacteria 1055
448 Ga0075366_10407046 3300006195 Bacteria 837
449 Ga0097621_100000833 3300006237 Bacteria 21751
450 Ga0097621_100280418 3300006237 Bacteria 1467
451 Ga0097621_101080754 3300006237 Bacteria 752
452 Ga0075370_10044715 3300006353 Bacteria 2504
453 Ga0075370_10048966 3300006353 Bacteria 2395
454 Ga0075370_10095573 3300006353 Bacteria 1716
455 Ga0075370_10106823 3300006353 Bacteria 1623
456 Ga0075370_10180931 3300006353 Bacteria 1241
457 Ga0075370_10211935 3300006353 Bacteria 1144
458 Ga0075370_10291184 3300006353 Bacteria 970
459 Ga0075370_10317423 3300006353 Bacteria 928
460 Ga0075370_10477457 3300006353 Bacteria 751
461 Ga0075370_10791764 3300006353 Bacteria 578
462 Ga0068871_100004168 3300006358 Bacteria 10008
463 Ga0068871_100066133 3300006358 Bacteria 2962
464 Ga0068871_100151455 3300006358 Bacteria 1978
465 Ga0068871_100152017 3300006358 Bacteria 1974
466 Ga0068871_100802468 3300006358 Bacteria 868
467 Ga0068871_100992682 3300006358 Bacteria 782
468 Ga0068871_101190115 3300006358 Bacteria 715
469 Ga0068871_101923014 3300006358 Bacteria 563
470 Ga0075428_100067678 3300006844 Bacteria 3908
471 Ga0075428_100384516 3300006844 Bacteria 1504
472 Ga0075428_100459493 3300006844 Bacteria 1363
473 Ga0075428_100798221 3300006844 Bacteria 1003
474 Ga0075428_100958111 3300006844 Bacteria 907
475 Ga0075430_100000098 3300006846 Bacteria 51603
476 Ga0075430_100046267 3300006846 Bacteria 3675
477 Ga0075431_100159431 3300006847 Bacteria 2320
478 Ga0075433_10006030 3300006852 Bacteria 9547
479 Ga0075433_10172329 3300006852 Bacteria 1926
480 Ga0075433_10251381 3300006852 Bacteria 1568
481 Ga0075433_10554135 3300006852 Bacteria 1010
482 Ga0075433_10567859 3300006852 Bacteria 997
483 Ga0075433_11199784 3300006852 Bacteria 659
484 Ga0075434_100002941 3300006871 Bacteria 15148
485 Ga0075434_100068183 3300006871 Bacteria 3543
486 Ga0075434_100106965 3300006871 Bacteria 2807
487 Ga0075434_100377002 3300006871 Bacteria 1439
488 Ga0075429_100049997 3300006880 Bacteria 3637
489 Ga0075429_101107709 3300006880 Bacteria 691
490 Ga0068865_100007321 3300006881 Bacteria 6782
491 Ga0068865_100094971 3300006881 Bacteria 2171
492 Ga0068865_100097564 3300006881 Bacteria 2145
493 Ga0068865_100259767 3300006881 Bacteria 1374
494 Ga0068865_100277261 3300006881 Bacteria 1334
495 Ga0068865_101340546 3300006881 Unclassified 637
496 Ga0075436_100066857 3300006914 Bacteria 2484
497 Ga0075436_100324342 3300006914 Bacteria 1106
498 Ga0097620_100045773 3300006931 Bacteria 4395
499 Ga0097620_100062251 3300006931 Bacteria 3761
500 Ga0097620_100134369 3300006931 Bacteria 2545
501 Ga0097620_100166833 3300006931 Unclassified 2282
502 Ga0097620_100198909 3300006931 Bacteria 2088
503 Ga0097620_100439593 3300006931 Bacteria 1401
504 Ga0097620_101437140 3300006931 Bacteria 761
505 Ga0075435_100046392 3300007076 Bacteria 3485
506 Ga0075435_100131109 3300007076 Bacteria 2098
507 Ga0075435_100348888 3300007076 Bacteria 1268
508 Ga0075435_100691085 3300007076 Bacteria 886
509 Ga0075435_100807930 3300007076 Bacteria 817
510 Ga0099795_10021664 3300007788 Bacteria 2111
511 Ga0105251_10101484 3300009011 Bacteria 1315
512 Ga0105251_10321022 3300009011 Bacteria 704
513 Ga0105250_10117287 3300009092 Bacteria 1093
514 Ga0105240_10059470 3300009093 Bacteria 4769
515 Ga0105240_10128054 3300009093 Bacteria 3048
516 Ga0105240_10276011 3300009093 Bacteria 1933
517 Ga0105240_10698131 3300009093 Bacteria 1108
518 Ga0105240_11724298 3300009093 Bacteria 654
519 Ga0111539_10002792 3300009094 Bacteria 23179
520 Ga0111539_10150203 3300009094 Bacteria 2727
521 Ga0111539_10163694 3300009094 Bacteria 2602
522 Ga0111539_10391695 3300009094 Bacteria 1618
523 Ga0111539_10413854 3300009094 Bacteria 1570
524 Ga0111539_10667243 3300009094 Bacteria 1211
525 Ga0105245_10006527 3300009098 Bacteria 10246
526 Ga0105245_10086062 3300009098 Bacteria 2882
527 Ga0105245_10156321 3300009098 Bacteria 2160
528 Ga0105245_10295133 3300009098 Bacteria 1589
529 Ga0105245_10361260 3300009098 Bacteria 1441
530 Ga0105245_10499636 3300009098 Bacteria 1232
531 Ga0105245_10546557 3300009098 Bacteria 1180
532 Ga0105245_12208325 3300009098 Bacteria 604
533 Ga0105247_10000941 3300009101 Bacteria 21940
534 Ga0105247_10015657 3300009101 Bacteria 4540
535 Ga0105247_10088991 3300009101 Bacteria 1957
536 Ga0105247_10200183 3300009101 Bacteria 1341
537 Ga0105247_10260252 3300009101 Bacteria 1189
538 Ga0105247_10475670 3300009101 Bacteria 906
539 Ga0105247_10672811 3300009101 Bacteria 776
540 Ga0114129_10189869 3300009147 Bacteria 2791
541 Ga0114129_11597806 3300009147 Bacteria 798
542 Ga0105243_10047176 3300009148 Bacteria 3390
543 Ga0105243_10178871 3300009148 Bacteria 1843
544 Ga0105243_10293118 3300009148 Bacteria 1471
545 Ga0105243_10827062 3300009148 Bacteria 915
546 Ga0105243_11498605 3300009148 Bacteria 698
547 Ga0105243_11646821 3300009148 Bacteria 669
548 Ga0105241_10000934 3300009174 Bacteria 22126
549 Ga0105241_10020160 3300009174 Bacteria 4925
550 Ga0105241_10414939 3300009174 Bacteria 1184
551 Ga0105241_10417292 3300009174 Bacteria 1180
552 Ga0105241_10552583 3300009174 Bacteria 1034
553 Ga0105242_10007338 3300009176 Bacteria 8485
554 Ga0105242_10028923 3300009176 Bacteria 4416
555 Ga0105242_10850727 3300009176 Bacteria 908
556 Ga0105248_10001324 3300009177 Bacteria 27565
557 Ga0105248_10006086 3300009177 Bacteria 13239
558 Ga0105248_10032830 3300009177 Bacteria 5800
559 Ga0105248_11116511 3300009177 Bacteria 891
560 Ga0105237_10050842 3300009545 Bacteria 4164
561 Ga0105237_10072044 3300009545 Bacteria 3449
562 Ga0105237_10203423 3300009545 Bacteria 1981
563 Ga0105237_10321824 3300009545 Bacteria 1550
564 Ga0105237_10335010 3300009545 Bacteria 1518
565 Ga0105237_10526748 3300009545 Bacteria 1188
566 Ga0105237_11056307 3300009545 Bacteria 819
567 Ga0105237_11118668 3300009545 Bacteria 794
568 Ga0105238_10029609 3300009551 Bacteria 5576
569 Ga0105238_10036004 3300009551 Bacteria 5031
570 Ga0105238_10061360 3300009551 Bacteria 3763
571 Ga0105238_10066932 3300009551 Bacteria 3593
572 Ga0105238_10561414 3300009551 Bacteria 1147
573 Ga0105249_10002759 3300009553 Bacteria 15181
574 Ga0105249_10188086 3300009553 Bacteria 2013
575 Ga0105249_10290195 3300009553 Bacteria 1637
576 Ga0105249_10402120 3300009553 Bacteria 1400
577 Ga0105249_10612120 3300009553 Bacteria 1144
578 Ga0105249_11367158 3300009553 Bacteria 780
579 Ga0105249_11840743 3300009553 Bacteria 678
580 Ga0099796_10012869 3300010159 Bacteria 2375
581 Ga0105239_10022595 3300010375 Bacteria 6934
582 Ga0105239_10071375 3300010375 Bacteria 3815
583 Ga0105239_10224660 3300010375 Bacteria 2106
584 Ga0105239_10268103 3300010375 Bacteria 1920
585 Ga0105239_10292401 3300010375 Bacteria 1834
586 Ga0105246_10071787 3300011119 Bacteria 2439
587 Ga0157346_1002630 3300012480 Bacteria 948
588 Ga0157346_1003899 3300012480 Bacteria 857
589 Ga0157321_1012135 3300012487 Bacteria 683
590 Ga0157345_1018885 3300012498 Bacteria 684
591 Ga0157313_1021192 3300012503 Bacteria 665
592 Ga0157324_1008351 3300012506 Bacteria 831
593 Ga0157315_1001894 3300012508 Bacteria 1239
594 Ga0157316_1033829 3300012510 Bacteria 634
595 Ga0157338_1016023 3300012515 Bacteria 824
596 Ga0157373_10072987 3300013100 Bacteria 2422
597 Ga0157373_10745140 3300013100 Bacteria 720
598 Ga0157371_10026846 3300013102 Bacteria 4181
599 Ga0157371_10565969 3300013102 Bacteria 843
600 Ga0157369_11082685 3300013105 Bacteria 819
601 Ga0157369_11365002 3300013105 Bacteria 722
602 Ga0157374_10005822 3300013296 Bacteria 10414
603 Ga0157374_10538546 3300013296 Bacteria 1175
604 Ga0157378_10005464 3300013297 Bacteria 11135
605 Ga0157378_10008085 3300013297 Bacteria 9179
606 Ga0157378_10090355 3300013297 Bacteria 2783
607 Ga0157378_10499581 3300013297 Bacteria 1215
608 Ga0157378_11163819 3300013297 Bacteria 810
609 Ga0163162_10004345 3300013306 Bacteria 13643
610 Ga0163162_10134883 3300013306 Bacteria 2579
611 Ga0163162_10137144 3300013306 Bacteria 2558
612 Ga0163162_10426285 3300013306 Bacteria 1459
613 Ga0163162_10539877 3300013306 Bacteria 1295
614 Ga0163162_10634151 3300013306 Bacteria 1193
615 Ga0163162_11920326 3300013306 Bacteria 678
616 Ga0157372_11142801 3300013307 Bacteria 900
617 Ga0157372_11628340 3300013307 Bacteria 743
618 Ga0157375_10076850 3300013308 Bacteria 3367
619 Ga0157375_10201716 3300013308 Bacteria 2145
620 Ga0157375_10338823 3300013308 Bacteria 1669
621 Ga0157375_11051494 3300013308 Bacteria 952
622 Ga0157375_11448133 3300013308 Bacteria 810
623 Ga0157375_11567692 3300013308 Bacteria 778
624 Ga0157375_12284855 3300013308 Bacteria 645
625 Ga0163163_10039453 3300014325 Bacteria 4608
626 Ga0163163_10044021 3300014325 Bacteria 4378
627 Ga0163163_10077677 3300014325 Bacteria 3315
628 Ga0163163_10239629 3300014325 Bacteria 1863
629 Ga0157380_10204299 3300014326 Bacteria 1755
630 Ga0157380_10242343 3300014326 Bacteria 1626
631 Ga0157380_11198297 3300014326 Bacteria 803
632 Ga0157380_11302092 3300014326 Bacteria 774
633 Ga0157377_10000101 3300014745 Bacteria 60248
634 Ga0157379_10007707 3300014968 Bacteria 9323
635 Ga0157379_10084667 3300014968 Bacteria 2841
636 Ga0157379_10423054 3300014968 Bacteria 1227
637 Ga0157376_10002670 3300014969 Bacteria 12111
638 Ga0157376_10029845 3300014969 Bacteria 4347
639 Ga0157376_10032468 3300014969 Bacteria 4192
640 Ga0157376_10608224 3300014969 Bacteria 1089
641 Ga0157376_10622659 3300014969 Bacteria 1077
642 Ga0163161_10000081 3300017792 Bacteria 97213
643 Ga0163161_10056733 3300017792 Bacteria 2845
644 Ga0163161_10166002 3300017792 Bacteria 1686
645 Ga0163161_10392479 3300017792 Bacteria 1111
646 Ga0163161_10551049 3300017792 Bacteria 945
647 Ga0163161_10662436 3300017792 Bacteria 866
648 Ga0163161_11689587 3300017792 Bacteria 560
649 Ga0206356_10660642 3300020070 Bacteria 521
650 Ga0206356_11815793 3300020070 Bacteria 572
651 Ga0206355_1106855 3300020076 Bacteria 727
652 Ga0206352_11186928 3300020078 Bacteria 526
653 Ga0206352_11331387 3300020078 Bacteria 535
654 Ga0206354_10299253 3300020081 Bacteria 741
655 Ga0206353_11513600 3300020082 Bacteria 808
656 Ga0206353_11541346 3300020082 Bacteria 618
657 Ga0214544_1000007 3300021320 Bacteria 379989
658 Ga0214542_1000007 3300021321 Bacteria 291816
659 Ga0214545_1000006 3300021324 Bacteria 291693
660 Ga0214543_1000009 3300021327 Bacteria 384302
661 Ga0213876_10009964 3300021384 Bacteria 5108
662 Ga0213876_10053829 3300021384 Bacteria 2125
663 Ga0213876_10372522 3300021384 Bacteria 759
664 Ga0209677_113419 3300025253 Bacteria 1165
665 Ga0209148_1000216 3300025254 Bacteria 98209
666 Ga0209233_1002021 3300025261 Bacteria 7691
667 Ga0209233_1025698 3300025261 Bacteria 1452
668 Ga0207666_1000044 3300025271 Bacteria 24638
669 Ga0209673_1104486 3300025273 Bacteria 603
670 Ga0207673_1000003 3300025290 Bacteria 18000
671 Ga0209025_1071514 3300025294 Bacteria 1229
672 Ga0209564_1004251 3300025295 Bacteria 8896
673 Ga0209564_1011366 3300025295 Bacteria 3999
674 Ga0209758_1000015 3300025297 Bacteria 851943
675 Ga0209758_1000161 3300025297 Bacteria 154278
676 Ga0209758_1000673 3300025297 Bacteria 51032
677 Ga0209758_1002075 3300025297 Bacteria 21325
678 Ga0209758_1002448 3300025297 Bacteria 18947
679 Ga0209758_1012080 3300025297 Bacteria 4892
680 Ga0209758_1023831 3300025297 Bacteria 2751
681 Ga0209758_1042693 3300025297 Bacteria 1678
682 Ga0209758_1074355 3300025297 Bacteria 1054
683 Ga0209256_1004892 3300025299 Bacteria 8059
684 Ga0207426_1000186 3300025302 Bacteria 154130
685 Ga0207426_1001117 3300025302 Bacteria 24608
686 Ga0207426_1035943 3300025302 Bacteria 1578
687 Ga0207426_1042378 3300025302 Bacteria 1405
688 Ga0207426_1066566 3300025302 Bacteria 1018
689 Ga0207426_1079892 3300025302 Bacteria 890
690 Ga0209257_1006231 3300025304 Bacteria 7816
691 Ga0209257_1027457 3300025304 Bacteria 1894
692 Ga0207697_10000051 3300025315 Bacteria 47188
693 Ga0207697_10056538 3300025315 Bacteria 1628
694 Ga0207697_10057099 3300025315 Bacteria 1620
695 Ga0207697_10096525 3300025315 Bacteria 1257
696 Ga0207697_10104380 3300025315 Bacteria 1210
697 Ga0207697_10161477 3300025315 Bacteria 978
698 Ga0207656_10076858 3300025321 Bacteria 1494
699 Ga0207656_10081660 3300025321 Bacteria 1454
700 Ga0207656_10184248 3300025321 Bacteria 1003
701 Ga0207653_10154477 3300025885 Bacteria 846
702 Ga0207682_10000635 3300025893 Bacteria 16359
703 Ga0207682_10008859 3300025893 Bacteria 3979
704 Ga0207692_10176663 3300025898 Bacteria 1241
705 Ga0207692_10470940 3300025898 Bacteria 793
706 Ga0207642_10001582 3300025899 Bacteria 7021
707 Ga0207642_10333818 3300025899 Bacteria 889
708 Ga0207642_10419204 3300025899 Bacteria 805
709 Ga0207710_10010877 3300025900 Bacteria 3832
710 Ga0207710_10166140 3300025900 Bacteria 1077
711 Ga0207710_10437776 3300025900 Bacteria 674
712 Ga0207688_10000044 3300025901 Bacteria 43600
713 Ga0207688_10005732 3300025901 Bacteria 6756
714 Ga0207688_10053585 3300025901 Bacteria 2262
715 Ga0207688_10082160 3300025901 Bacteria 1841
716 Ga0207688_10340689 3300025901 Bacteria 922
717 Ga0207647_10061087 3300025904 Bacteria 2301
718 Ga0207647_10078241 3300025904 Bacteria 1987
719 Ga0207647_10321964 3300025904 Bacteria 878
720 Ga0207685_10033752 3300025905 Bacteria 1852
721 Ga0207699_10012123 3300025906 Bacteria 4377
722 Ga0207699_10020625 3300025906 Bacteria 3537
723 Ga0207645_10000218 3300025907 Bacteria 47372
724 Ga0207645_10075862 3300025907 Bacteria 2152
725 Ga0207645_10319509 3300025907 Bacteria 1035
726 Ga0207643_10000025 3300025908 Bacteria 101583
727 Ga0207643_10549166 3300025908 Bacteria 741
728 Ga0207684_10771678 3300025910 Bacteria 814
729 Ga0207654_10029817 3300025911 Bacteria 2990
730 Ga0207654_11156240 3300025911 Bacteria 564
731 Ga0207707_10011373 3300025912 Bacteria 7749
732 Ga0207707_10155609 3300025912 Bacteria 1999
733 Ga0207695_10000006 3300025913 Bacteria 1135309
734 Ga0207695_10080582 3300025913 Bacteria 3296
735 Ga0207695_10119888 3300025913 Bacteria 2600
736 Ga0207695_11272172 3300025913 Bacteria 616
737 Ga0207671_10001982 3300025914 Bacteria 22573
738 Ga0207671_10158942 3300025914 Bacteria 1749
739 Ga0207671_10524364 3300025914 Bacteria 945
740 Ga0207693_10010496 3300025915 Bacteria 7517
741 Ga0207693_10015879 3300025915 Bacteria 6029
742 Ga0207663_10033202 3300025916 Bacteria 3072
743 Ga0207663_10272366 3300025916 Bacteria 1254
744 Ga0207660_10000571 3300025917 Bacteria 24778
745 Ga0207660_10336298 3300025917 Bacteria 1208
746 Ga0207660_10564179 3300025917 Bacteria 926
747 Ga0207660_10583693 3300025917 Bacteria 910
748 Ga0207662_10000100 3300025918 Bacteria 40845
749 Ga0207662_10341885 3300025918 Bacteria 1003
750 Ga0207657_10047187 3300025919 Bacteria 3769
751 Ga0207657_10410740 3300025919 Bacteria 1064
752 Ga0207649_10000310 3300025920 Bacteria 37179
753 Ga0207649_10275036 3300025920 Bacteria 1222
754 Ga0207649_10857720 3300025920 Bacteria 711
755 Ga0207652_10007174 3300025921 Bacteria 8989
756 Ga0207652_10119849 3300025921 Bacteria 2340
757 Ga0207652_10129019 3300025921 Bacteria 2254
758 Ga0207652_10291722 3300025921 Bacteria 1472
759 Ga0207652_11068779 3300025921 Bacteria 707
760 Ga0207681_10000803 3300025923 Bacteria 20696
761 Ga0207681_10511753 3300025923 Bacteria 984
762 Ga0207681_10805985 3300025923 Bacteria 784
763 Ga0207694_10059862 3300025924 Bacteria 2963
764 Ga0207694_10101904 3300025924 Bacteria 2275
765 Ga0207694_10249064 3300025924 Bacteria 1453
766 Ga0207694_10335567 3300025924 Bacteria 1249
767 Ga0207694_10415933 3300025924 Bacteria 1119
768 Ga0207694_10468256 3300025924 Bacteria 1053
769 Ga0207694_10540511 3300025924 Bacteria 977
770 Ga0207694_10978094 3300025924 Bacteria 716
771 Ga0207694_11027008 3300025924 Bacteria 698
772 Ga0207650_10003666 3300025925 Bacteria 10506
773 Ga0207650_10206270 3300025925 Bacteria 1577
774 Ga0207650_10218153 3300025925 Bacteria 1534
775 Ga0207650_10248740 3300025925 Bacteria 1439
776 Ga0207650_10319427 3300025925 Bacteria 1271
777 Ga0207659_10000040 3300025926 Bacteria 91375
778 Ga0207659_10187256 3300025926 Bacteria 1644
779 Ga0207659_10557734 3300025926 Bacteria 974
780 Ga0207687_10001077 3300025927 Bacteria 18525
781 Ga0207687_10006935 3300025927 Bacteria 7463
782 Ga0207687_10014335 3300025927 Bacteria 5186
783 Ga0207687_10140694 3300025927 Bacteria 1830
784 Ga0207687_10175808 3300025927 Bacteria 1655
785 Ga0207687_10313425 3300025927 Bacteria 1268
786 Ga0207664_10064418 3300025929 Bacteria 2931
787 Ga0207644_10006122 3300025931 Bacteria 7847
788 Ga0207644_10022811 3300025931 Bacteria 4279
789 Ga0207644_10088223 3300025931 Bacteria 2307
790 Ga0207644_10091930 3300025931 Bacteria 2263
791 Ga0207644_10554719 3300025931 Bacteria 951
792 Ga0207644_10746564 3300025931 Bacteria 817
793 Ga0207690_10000277 3300025932 Bacteria 36311
794 Ga0207690_11278473 3300025932 Bacteria 613
795 Ga0207706_10003292 3300025933 Bacteria 15468
796 Ga0207706_10097748 3300025933 Bacteria 2582
797 Ga0207706_11148682 3300025933 Bacteria 647
798 Ga0207686_10001074 3300025934 Bacteria 16034
799 Ga0207686_10248463 3300025934 Bacteria 1298
800 Ga0207686_10584770 3300025934 Bacteria 877
801 Ga0207709_10000322 3300025935 Bacteria 51855
802 Ga0207709_10105611 3300025935 Bacteria 1872
803 Ga0207709_10105755 3300025935 Bacteria 1871
804 Ga0207709_10437281 3300025935 Bacteria 1008
805 Ga0207709_10481946 3300025935 Bacteria 965
806 Ga0207709_10675270 3300025935 Bacteria 825
807 Ga0207709_10851580 3300025935 Bacteria 739
808 Ga0207670_10000977 3300025936 Bacteria 15087
809 Ga0207670_10160713 3300025936 Bacteria 1676
810 Ga0207670_10907115 3300025936 Bacteria 738
811 Ga0207670_11363308 3300025936 Unclassified 602
812 Ga0207669_10000347 3300025937 Bacteria 21120
813 Ga0207669_10074339 3300025937 Bacteria 2148
814 Ga0207669_10502191 3300025937 Bacteria 970
815 Ga0207704_10000624 3300025938 Bacteria 15670
816 Ga0207704_10070275 3300025938 Bacteria 2216
817 Ga0207704_10497745 3300025938 Bacteria 982
818 Ga0207704_10666247 3300025938 Bacteria 858
819 Ga0207704_10994780 3300025938 Unclassified 709
820 Ga0207665_10163004 3300025939 Bacteria 1605
821 Ga0207665_10181315 3300025939 Bacteria 1525
822 Ga0207665_10688484 3300025939 Bacteria 803
823 Ga0207691_10000940 3300025940 Bacteria 28841
824 Ga0207691_10030759 3300025940 Bacteria 5015
825 Ga0207691_10263887 3300025940 Bacteria 1484
826 Ga0207691_10941360 3300025940 Bacteria 722
827 Ga0207711_10008494 3300025941 Bacteria 8592
828 Ga0207711_10014904 3300025941 Bacteria 6457
829 Ga0207711_10069004 3300025941 Bacteria 3063
830 Ga0207711_10159351 3300025941 Bacteria 2041
831 Ga0207711_10735449 3300025941 Bacteria 920
832 Ga0207711_11685852 3300025941 Bacteria 577
833 Ga0207689_10000134 3300025942 Bacteria 62937
834 Ga0207689_10012478 3300025942 Bacteria 7259
835 Ga0207689_10070987 3300025942 Bacteria 2860
836 Ga0207689_10203859 3300025942 Bacteria 1633
837 Ga0207689_10458719 3300025942 Bacteria 1065
838 Ga0207661_10000191 3300025944 Bacteria 39865
839 Ga0207661_10739141 3300025944 Bacteria 905
840 Ga0207661_11289840 3300025944 Bacteria 671
841 Ga0207679_10000099 3300025945 Bacteria 74047
842 Ga0207679_10104906 3300025945 Bacteria 2219
843 Ga0207679_10381291 3300025945 Bacteria 1236
844 Ga0207679_11736263 3300025945 Bacteria 571
845 Ga0207667_10014048 3300025949 Bacteria 9140
846 Ga0207667_10193865 3300025949 Bacteria 2085
847 Ga0207667_11053994 3300025949 Bacteria 798
848 Ga0207651_10000202 3300025960 Bacteria 26070
849 Ga0207651_10447082 3300025960 Bacteria 1108
850 Ga0207651_10507026 3300025960 Bacteria 1044
851 Ga0207712_10001297 3300025961 Bacteria 17122
852 Ga0207712_10069259 3300025961 Bacteria 2531
853 Ga0207712_10177557 3300025961 Bacteria 1670
854 Ga0207712_10252414 3300025961 Bacteria 1426
855 Ga0207712_10459303 3300025961 Bacteria 1082
856 Ga0207712_10582705 3300025961 Bacteria 966
857 Ga0207668_10001518 3300025972 Bacteria 13565
858 Ga0207668_10061822 3300025972 Bacteria 2635
859 Ga0207668_10143698 3300025972 Bacteria 1838
860 Ga0207668_10245340 3300025972 Bacteria 1451
861 Ga0207668_10398960 3300025972 Bacteria 1162
862 Ga0207668_10868597 3300025972 Bacteria 801
863 Ga0207668_10905252 3300025972 Bacteria 785
864 Ga0207640_10000425 3300025981 Bacteria 26102
865 Ga0207640_10485231 3300025981 Bacteria 1026
866 Ga0207658_10003433 3300025986 Bacteria 11216
867 Ga0207658_10046501 3300025986 Bacteria 3170
868 Ga0207658_10388244 3300025986 Bacteria 1224
869 Ga0207658_10796329 3300025986 Bacteria 858
870 Ga0207658_11204808 3300025986 Bacteria 692
871 Ga0207658_11476571 3300025986 Bacteria 622
872 Ga0207677_10001828 3300026023 Bacteria 11238
873 Ga0207677_10131161 3300026023 Bacteria 1903
874 Ga0207677_10180879 3300026023 Bacteria 1658
875 Ga0207677_10862499 3300026023 Bacteria 814
876 Ga0207703_10023646 3300026035 Bacteria 4831
877 Ga0207703_10029301 3300026035 Bacteria 4342
878 Ga0207703_10070683 3300026035 Bacteria 2881
879 Ga0207703_10347621 3300026035 Bacteria 1364
880 Ga0207703_10438437 3300026035 Bacteria 1218
881 Ga0207703_10469501 3300026035 Bacteria 1178
882 Ga0207703_11114563 3300026035 Bacteria 758
883 Ga0207639_10001207 3300026041 Bacteria 17550
884 Ga0207639_10188768 3300026041 Bacteria 1759
885 Ga0207639_10235232 3300026041 Bacteria 1590
886 Ga0207639_10261621 3300026041 Bacteria 1513
887 Ga0207639_10767624 3300026041 Bacteria 897
888 Ga0207639_11397244 3300026041 Bacteria 657
889 Ga0207678_10000131 3300026067 Bacteria 62864
890 Ga0207678_10008113 3300026067 Bacteria 9257
891 Ga0207678_10029929 3300026067 Bacteria 4754
892 Ga0207678_10101739 3300026067 Bacteria 2453
893 Ga0207678_10134798 3300026067 Bacteria 2107
894 Ga0207678_10147660 3300026067 Bacteria 2007
895 Ga0207678_10503531 3300026067 Bacteria 1056
896 Ga0207678_10732173 3300026067 Bacteria 871
897 Ga0207678_10958628 3300026067 Bacteria 757
898 Ga0207708_10000636 3300026075 Bacteria 26970
899 Ga0207708_10026762 3300026075 Bacteria 4367
900 Ga0207708_10055265 3300026075 Bacteria 3027
901 Ga0207708_10060713 3300026075 Bacteria 2886
902 Ga0207708_10206507 3300026075 Bacteria 1569
903 Ga0207708_10449017 3300026075 Bacteria 1074
904 Ga0207702_10025082 3300026078 Bacteria 4946
905 Ga0207702_11147209 3300026078 Bacteria 771
906 Ga0207702_11585173 3300026078 Bacteria 648
907 Ga0207641_10000246 3300026088 Bacteria 70235
908 Ga0207641_10354573 3300026088 Bacteria 1399
909 Ga0207641_10564241 3300026088 Bacteria 1111
910 Ga0207641_10760729 3300026088 Bacteria 957
911 Ga0207641_11359593 3300026088 Bacteria 711
912 Ga0207641_11536283 3300026088 Bacteria 667
913 Ga0207648_10000575 3300026089 Bacteria 41197
914 Ga0207648_10116363 3300026089 Bacteria 2350
915 Ga0207648_10345007 3300026089 Bacteria 1341
916 Ga0207648_10521696 3300026089 Bacteria 1088
917 Ga0207648_10673599 3300026089 Bacteria 957
918 Ga0207676_10002628 3300026095 Bacteria 12800
919 Ga0207676_10142559 3300026095 Bacteria 2053
920 Ga0207676_10193762 3300026095 Bacteria 1790
921 Ga0207676_10399841 3300026095 Bacteria 1283
922 Ga0207676_10628448 3300026095 Bacteria 1034
923 Ga0207674_10002439 3300026116 Bacteria 23481
924 Ga0207674_10122204 3300026116 Bacteria 2570
925 Ga0207674_10133266 3300026116 Bacteria 2448
926 Ga0207674_10983070 3300026116 Bacteria 813
927 Ga0207675_100010650 3300026118 Bacteria 8616
928 Ga0207675_100035146 3300026118 Bacteria 4674
929 Ga0207675_100092985 3300026118 Bacteria 2836
930 Ga0207675_100243366 3300026118 Bacteria 1739
931 Ga0207675_100259981 3300026118 Bacteria 1682
932 Ga0207675_100465188 3300026118 Bacteria 1255
933 Ga0207683_10000924 3300026121 Bacteria 26999
934 Ga0207683_10090636 3300026121 Bacteria 2723
935 Ga0207683_10252827 3300026121 Bacteria 1608
936 Ga0207698_10007113 3300026142 Bacteria 7009
937 Ga0207698_10594477 3300026142 Bacteria 1090
938 Ga0207698_10667086 3300026142 Bacteria 1032
939 Ga0207698_10688202 3300026142 Bacteria 1016
940 Ga0209179_1018650 3300027512 Bacteria 1327
941 Ga0210002_1001348 3300027617 Bacteria 3433
942 Ga0209971_1012869 3300027682 Bacteria 1982
943 Ga0209966_1012583 3300027695 Bacteria 1556
944 Ga0209998_10017998 3300027717 Bacteria 1498
945 Ga0209813_10000490 3300027866 Bacteria 9350
946 Ga0209813_10008476 3300027866 Bacteria 2600
947 Ga0209813_10027912 3300027866 Bacteria 1642
948 Ga0209813_10047043 3300027866 Bacteria 1335
949 Ga0209813_10175623 3300027866 Bacteria 781
950 Ga0209974_10000697 3300027876 Bacteria 11450
951 Ga0207428_10000736 3300027907 Bacteria 37641
952 Ga0207428_10006678 3300027907 Bacteria 10595
953 Ga0207428_10008679 3300027907 Bacteria 9178
954 Ga0207428_10107208 3300027907 Bacteria 2152
955 Ga0207428_10126160 3300027907 Bacteria 1960
956 Ga0207428_10175285 3300027907 Bacteria 1622
957 Ga0207428_10306172 3300027907 Bacteria 1175
958 Ga0207428_10477065 3300027907 Bacteria 908
959 Ga0268266_10014179 3300028379 Bacteria 6856
960 Ga0268266_10019367 3300028379 Bacteria 5794
961 Ga0268266_10025985 3300028379 Bacteria 4980
962 Ga0268266_10054473 3300028379 Bacteria 3437
963 Ga0268266_10072406 3300028379 Bacteria 2988
964 Ga0268266_10077681 3300028379 Bacteria 2887
965 Ga0268266_10269324 3300028379 Bacteria 1581
966 Ga0268266_10474061 3300028379 Bacteria 1192
967 Ga0268266_10537046 3300028379 Bacteria 1119
968 Ga0268266_11085613 3300028379 Bacteria 774
969 Ga0268265_10001326 3300028380 Bacteria 21194
970 Ga0268265_10009601 3300028380 Bacteria 6535
971 Ga0268265_10040339 3300028380 Bacteria 3447
972 Ga0268265_10142172 3300028380 Bacteria 2010
973 Ga0268265_10222528 3300028380 Bacteria 1652
974 Ga0268265_10262065 3300028380 Bacteria 1537
975 Ga0268264_10001756 3300028381 Bacteria 19870
976 Ga0268264_10034447 3300028381 Bacteria 4165
977 Ga0268264_10131983 3300028381 Bacteria 2216
978 Ga0268264_10154975 3300028381 Bacteria 2058
979 Ga0268264_10283264 3300028381 Bacteria 1553
980 Ga0268264_10403935 3300028381 Bacteria 1313
981 Ga0307517_10000196 3300028786 Bacteria 102384
982 Ga0265325_10000093 3300031241 Bacteria 63498
983 Ga0265340_10322352 3300031247 Bacteria 684
984 Ga0265339_10195243 3300031249 Bacteria 1001
985 Ga0307513_10284984 3300031456 Bacteria 1427
986 Ga0307408_100508604 3300031548 Bacteria 1056
987 Ga0307408_100557204 3300031548 Bacteria 1012
988 Ga0265313_10020348 3300031595 Bacteria 3663
989 Ga0307508_10627252 3300031616 Bacteria 678
990 Ga0265314_10185611 3300031711 Bacteria 1242
991 Ga0316576_10026863 3300031727 Bacteria 4043
992 Ga0316578_10116809 3300031728 Bacteria 1603
993 Ga0307516_10008223 3300031730 Bacteria 11850
994 Ga0307518_10283826 3300031838 Bacteria 1022
995 Ga0307411_11028220 3300032005 Bacteria 739
996 Ga0307411_11056644 3300032005 Bacteria 730
997 Ga0307415_100500006 3300032126 Bacteria 1063
998 Ga0307415_101178473 3300032126 Bacteria 721
999 Ga0307510_10002425 3300033180 Bacteria 21169
1000 Ga0307510_10032373 3300033180 Bacteria 5891
1001 Ga0307510_10048768 3300033180 Bacteria 4514
1002 Ga0307510_10265943 3300033180 Bacteria 1193
1003 Ga0315911_1000010 3300033442 Bacteria 322197
1004 Ga0373930_0000310 3300034816 Bacteria 6326
1005 Ga0373930_0077315 3300034816 Bacteria 765
1006 Ga0373948_0000143 3300034817 Bacteria 7685
1007 Ga0373948_0002604 3300034817 Bacteria 2685
1008 Ga0373948_0005132 3300034817 Bacteria 2106
1009 Ga0373950_0002414 3300034818 Bacteria 2568
1010 Ga0373950_0004460 3300034818 Bacteria 2051
1011 Ga0373950_0008207 3300034818 Bacteria 1637
1012 Ga0373950_0054076 3300034818 Bacteria 794
1013 Ga0373958_0000094 3300034819 Bacteria 9294
1014 Ga0373958_0032118 3300034819 Bacteria 1036
1015 Ga0373959_0000480 3300034820 Bacteria 7330
1016 Ga0373959_0008536 3300034820 Bacteria 1746
1017 Ga0373959_0019251 3300034820 Bacteria 1292
1018 Ga0373938_0000062 3300034957 Bacteria 13849
1019 Ga0373938_0002468 3300034957 Bacteria 2987
1020 Ga0373938_0028577 3300034957 Bacteria 1180
1021 Ga0373926_0025341 3300035083 Bacteria 2069
1022 Ga0373928_0002159 3300035084 Bacteria 3836
1023 Ga0373928_0012024 3300035084 Bacteria 1721
1024 Ga0373928_0059516 3300035084 Bacteria 921
1025 Ga0373929_0030253 3300035085 Bacteria 1153
1026 Ga0373929_0063476 3300035085 Bacteria 870
1027 Ga0373934_0282246 3300035086 Bacteria 688
1028 Ga0373940_0000026 3300035088 Bacteria 16296
1029 Ga0373940_0095757 3300035088 Bacteria 895
1030 Ga0373944_0008413 3300035089 Bacteria 2787
1031 Ga0373949_0001255 3300035090 Bacteria 7439
1032 Ga0373949_0008899 3300035090 Bacteria 2198
1033 Ga0373949_0014907 3300035090 Bacteria 1733
1034 Ga0373949_0025364 3300035090 Bacteria 1383
1035 Ga0373952_0000280 3300035092 Bacteria 8430
1036 Ga0373923_0096874 3300035111 Bacteria 1297
1037 Ga0373923_0239858 3300035111 Bacteria 846
1038 Ga0373932_0002978 3300035112 Bacteria 4162
1039 Ga0373932_0092020 3300035112 Bacteria 974
1040 Ga0373936_0052375 3300035113 Bacteria 1653
1041 Ga0373939_0000468 3300035114 Bacteria 10226
1042 Ga0373939_0041947 3300035114 Bacteria 1381
1043 Ga0373939_0193391 3300035114 Bacteria 766
1044 Ga0373941_0001191 3300035115 Bacteria 5430
1045 Ga0373941_0021986 3300035115 Bacteria 1806
1046 Ga0373941_0023394 3300035115 Bacteria 1763
1047 Ga0373941_0028036 3300035115 Bacteria 1650
1048 Ga0373941_0229881 3300035115 Bacteria 716
1049 Ga0373945_0007963 3300035116 Bacteria 3441
1050 Ga0373945_0035417 3300035116 Bacteria 1783
1051 Ga0373954_0264244 3300035118 Bacteria 848
1052 Ga0373956_0057351 3300035119 Bacteria 1759
1053 Ga0373956_0306700 3300035119 Bacteria 756
1054 Ga0373957_0059228 3300035120 Bacteria 1481
1055 Ga0373960_0000582 3300035121 Bacteria 7460
1056 Ga0373960_0018808 3300035121 Bacteria 1807
1057 Ga0373943_0044438 3300035170 Bacteria 2162
1058 Ga0373943_0181300 3300035170 Bacteria 1157
1059 Ga0373946_0071299 3300035171 Bacteria 1501
1060 Ga0373946_0199101 3300035171 Bacteria 958
1061 Ga0373955_0021994 3300035172 Bacteria 3227
1062 Ga0373942_0004957 3300035207 Bacteria 3085
1063 Ga0373942_0011407 3300035207 Bacteria 2107
1064 Ga0373942_0012396 3300035207 Bacteria 2035
1065 Ga0373942_0013572 3300035207 Bacteria 1961
1066 Ga0373961_0001833 3300035241 Bacteria 5807
1067 Ga0373961_0022358 3300035241 Bacteria 1691
1068 Ga0373961_0029404 3300035241 Bacteria 1522
1069 Ga0373961_0040899 3300035241 Bacteria 1337
1070 Ga0373961_0042962 3300035241 Bacteria 1312
1071 Ga0373961_0084723 3300035241 Bacteria 1002
1072 Ga0373962_0000098 3300035242 Bacteria 19016
1073 Ga0373962_0014820 3300035242 Bacteria 1991
1074 Ga0373931_0000485 3300035691 Bacteria 16212
1075 Ga0373931_0003732 3300035691 Bacteria 6893
1076 Ga0373931_0010001 3300035691 Bacteria 4547
1077 Ga0373931_0012449 3300035691 Bacteria 4121
1078 Ga0373931_0038137 3300035691 Bacteria 2512
1079 Ga0373931_0060263 3300035691 Bacteria 2042
1080 Ga0373931_0089332 3300035691 Bacteria 1714
1081 Ga0373931_0104989 3300035691 Bacteria 1594
1082 Ga0373935_0645005 3300035692 Bacteria 776
1083 Ga0373927_0009048 3300035695 Bacteria 6685
1084 Ga0373933_0284939 3300035724 Bacteria 1068
1085 Ga0373947_0015277 3300035725 Bacteria 4407
1086 Ga0373947_0159844 3300035725 Bacteria 1456
1087 Ga0373947_0222738 3300035725 Bacteria 1240
1088 Ga0373937_0470503 3300036401 Bacteria 1194
1089 Ga0373937_0792702 3300036401 Bacteria 895
1090 Ga0316582_0145692 3300036647 Bacteria 1599
1091 Ga0316584_0117216 3300036712 Bacteria 1991
1092 Ga0373925_0019255 3300037068 Bacteria 4964
1093 Ga0373925_0202555 3300037068 Bacteria 1578
1094 Ga0373925_0204186 3300037068 Bacteria 1572
1095 Ga0373925_0290947 3300037068 Bacteria 1317
1096 Ga0373925_0556358 3300037068 Bacteria 943
1097 Ga0395898_0163106 3300037466 Bacteria 2132
1098 Ga0395901_0998308 3300038443 Bacteria 813
1099 Ga0242419_007905 3300038698 Bacteria 789
1100 Ga0436365_0179636 3300039437 Bacteria 13442
1101 Ga0436365_0551956 3300039437 Bacteria 588
1102 Ga0436365_0944383 3300039437 Bacteria 894
1103 Ga0436365_1622770 3300039437 Bacteria 768
1104 Ga0436365_1790648 3300039437 Bacteria 2327
1105 Ga0436365_1937502 3300039437 Bacteria 3082
1106 Ga0436363_0708994 3300039450 Bacteria 533
1107 Ga0439466_0106224 3300041411 Bacteria 873
1108 Ga0439465_0068754 3300041413 Bacteria 1184
1109 Ga0451791_0845876 3300041451 Bacteria 734
1110 Ga0451797_0237554 3300041453 Bacteria 935
1111 Ga0451798_0281194 3300041458 Bacteria 884
1112 Ga0451800_0166776 3300041459 Bacteria 995
1113 Ga0451804_0754880 3300041463 Bacteria 670
1114 Ga0451807_1297891 3300041486 Bacteria 807
1115 Ga0451833_1136472 3300041491 Bacteria 568
1116 Ga0451833_1294098 3300041491 Bacteria 880
1117 Ga0451837_1850040 3300041494 Bacteria 1001
1118 Ga0451841_1424648 3300041498 Bacteria 1215
1119 Ga0451847_0636466 3300041503 Bacteria 1038
1120 Ga0451843_1204696 3300041509 Bacteria 669
1121 Ga0451853_1125928 3300041512 Bacteria 1000
1122 Ga0439443_003250 3300042003 Bacteria 2032
1123 Ga0439445_0164141 3300042004 Bacteria 650
1124 Ga0439444_0086772 3300042437 Bacteria 693
1125 Ga0439460_0037607 3300042461 Bacteria 1408
1126 Ga0439440_0244055 3300042993 Bacteria 545
1127 Ga0466965_0020139 3300044683 Bacteria 3204
1128 Ga0466961_0142027 3300044693 Bacteria 1503
1129 Ga0453684_0279370 3300044712 Bacteria 1905
1130 Ga0466957_0191723 3300044842 Bacteria 1339
1131 Ga0466960_0061702 3300044901 Bacteria 1841
1132 Ga0466959_0189997 3300045049 Bacteria 1434
1133 Ga0451576_0033253 3300045051 Bacteria 5481
1134 Ga0451576_1874224 3300045051 Bacteria 619
1135 Ga0466967_0160056 3300045976 Bacteria 2112
1136 Ga0466967_0227400 3300045976 Bacteria 1775
1137 Ga0466967_0331189 3300045976 Bacteria 1470
1138 Ga0495617_060727 3300046452 Bacteria 1251
1139 Ga0495592_0094228 3300046454 Bacteria 2143
1140 Ga0495592_0220593 3300046454 Bacteria 1268
1141 Ga0495592_0385222 3300046454 Bacteria 891
1142 Ga0495592_0515012 3300046454 Bacteria 740
1143 Ga0495603_0000910 3300046455 Bacteria 16994
1144 Ga0495603_0017908 3300046455 Bacteria 4288
1145 Ga0495603_0042817 3300046455 Bacteria 2705
1146 Ga0495603_0054971 3300046455 Bacteria 2359
1147 Ga0495603_0086345 3300046455 Bacteria 1837
1148 Ga0495603_0151582 3300046455 Bacteria 1346
1149 Ga0495603_0301343 3300046455 Bacteria 920
1150 Ga0495590_0039618 3300046457 Bacteria 1644
1151 Ga0495590_0224117 3300046457 Bacteria 695
1152 Ga0495629_0000140 3300046459 Bacteria 63496
1153 Ga0495629_0025564 3300046459 Bacteria 4195
1154 Ga0495629_0076208 3300046459 Bacteria 2342
1155 Ga0495629_0272067 3300046459 Bacteria 1163
1156 Ga0495629_0319703 3300046459 Bacteria 1061
1157 Ga0495638_0033982 3300046460 Bacteria 3257
1158 Ga0495638_0052555 3300046460 Bacteria 2537
1159 Ga0495638_0067400 3300046460 Bacteria 2198
1160 Ga0495641_0016374 3300046461 Bacteria 3909
1161 Ga0495641_0050932 3300046461 Bacteria 1892
1162 Ga0495641_0094383 3300046461 Bacteria 1336
1163 Ga0495651_0036917 3300046462 Bacteria 3805
1164 Ga0495651_0046874 3300046462 Bacteria 3344
1165 Ga0495653_0241913 3300046463 Bacteria 1202
1166 Ga0495653_0282796 3300046463 Bacteria 1088
1167 Ga0495650_0125452 3300046471 Bacteria 941
1168 Ga0495580_0124325 3300046472 Bacteria 1790
1169 Ga0495582_0003505 3300046473 Bacteria 8843
1170 Ga0495582_0125937 3300046473 Bacteria 1445
1171 Ga0495582_0319317 3300046473 Bacteria 893
1172 Ga0495605_0032566 3300046474 Bacteria 2653
1173 Ga0495605_0078279 3300046474 Bacteria 1550
1174 Ga0495639_0173087 3300046475 Bacteria 1048
1175 Ga0495639_0447225 3300046475 Bacteria 656
1176 Ga0495662_0169834 3300046476 Bacteria 1074
1177 Ga0495664_0007559 3300046477 Bacteria 6040
1178 Ga0495664_0313478 3300046477 Bacteria 946
1179 Ga0495584_0161470 3300046491 Bacteria 1139
1180 Ga0495585_0123693 3300046492 Bacteria 1366
1181 Ga0495594_0010624 3300046499 Bacteria 4773
1182 Ga0495594_0112090 3300046499 Bacteria 1538
1183 Ga0495594_0137249 3300046499 Bacteria 1386
1184 Ga0495594_0179040 3300046499 Bacteria 1207
1185 Ga0495583_0114888 3300046506 Bacteria 1138
1186 Ga0495606_0000960 3300046507 Bacteria 42272
1187 Ga0495606_0016521 3300046507 Bacteria 5621
1188 Ga0495606_0033258 3300046507 Bacteria 3559
1189 Ga0495606_0151924 3300046507 Bacteria 1358
1190 Ga0495608_0090604 3300046511 Bacteria 1978
1191 Ga0495608_0266008 3300046511 Bacteria 1067
1192 Ga0495610_0062597 3300046512 Bacteria 1764
1193 Ga0495610_0127814 3300046512 Bacteria 1107
1194 Ga0495610_0225418 3300046512 Bacteria 755
1195 Ga0495616_0046563 3300046513 Bacteria 2188
1196 Ga0495618_0142476 3300046514 Bacteria 1533
1197 Ga0495618_0153118 3300046514 Bacteria 1472
1198 Ga0495620_0182180 3300046515 Bacteria 812
1199 Ga0495628_0101678 3300046516 Bacteria 2218
1200 Ga0495628_0439034 3300046516 Bacteria 949
1201 Ga0495630_0191270 3300046517 Bacteria 1561
1202 Ga0495630_0260692 3300046517 Bacteria 1324
1203 Ga0495630_0402517 3300046517 Bacteria 1049
1204 Ga0495630_0854204 3300046517 Bacteria 694
1205 Ga0495631_0117600 3300046518 Bacteria 1143
1206 Ga0495631_0142965 3300046518 Bacteria 1027
1207 Ga0495631_0221113 3300046518 Bacteria 808
1208 Ga0495632_0250929 3300046519 Bacteria 793
1209 Ga0495637_0055949 3300046520 Bacteria 1634
1210 Ga0495643_0092691 3300046522 Bacteria 1557
1211 Ga0495643_0426775 3300046522 Bacteria 580
1212 Ga0495644_0068316 3300046523 Bacteria 1335
1213 Ga0495644_0274135 3300046523 Bacteria 657
1214 Ga0495648_0022672 3300046524 Bacteria 4316
1215 Ga0495648_0098121 3300046524 Bacteria 1623
1216 Ga0495648_0163388 3300046524 Bacteria 1148
1217 Ga0495663_0158924 3300046525 Bacteria 774
1218 Ga0495666_0482469 3300046526 Bacteria 554
1219 Ga0495642_0022177 3300046528 Bacteria 2501
1220 Ga0495642_0090339 3300046528 Bacteria 1296
1221 Ga0495652_0029695 3300046529 Bacteria 4801
1222 Ga0495652_0036238 3300046529 Bacteria 4291
1223 Ga0495652_0074957 3300046529 Bacteria 2812
1224 Ga0495652_0146080 3300046529 Bacteria 1853
1225 Ga0495652_0184247 3300046529 Bacteria 1599
1226 Ga0495652_0443573 3300046529 Bacteria 910
1227 Ga0495654_0155496 3300046530 Bacteria 1008
1228 Ga0495665_0100931 3300046531 Bacteria 1514
1229 Ga0495640_0035696 3300046533 Bacteria 3518
1230 Ga0495640_0128132 3300046533 Bacteria 1644
1231 Ga0495640_0288858 3300046533 Bacteria 1020
1232 Ga0495598_0011170 3300046537 Bacteria 2169
1233 Ga0495598_0242830 3300046537 Bacteria 664
1234 Ga0495609_0024193 3300046538 Bacteria 2788
1235 Ga0495609_0198799 3300046538 Bacteria 839
1236 Ga0495609_0200169 3300046538 Bacteria 835
1237 Ga0495609_0395521 3300046538 Bacteria 553
1238 Ga0495597_0181469 3300046542 Bacteria 850
1239 Ga0495645_0050560 3300046543 Bacteria 3026
1240 Ga0495645_0127489 3300046543 Bacteria 1787
1241 Ga0495622_0004725 3300046557 Bacteria 6309
1242 Ga0495622_0120611 3300046557 Bacteria 1197
1243 Ga0495622_0152895 3300046557 Bacteria 1043
1244 Ga0495633_0060297 3300046558 Bacteria 1778
1245 Ga0495633_0101482 3300046558 Bacteria 1335
1246 Ga0495667_0054041 3300046559 Bacteria 2644
1247 Ga0495667_0107194 3300046559 Bacteria 1806
1248 Ga0495667_0166308 3300046559 Bacteria 1418
1249 Ga0495656_0065851 3300046615 Bacteria 1594
1250 Ga0495656_0092303 3300046615 Bacteria 1386
1251 Ga0495668_0016971 3300046616 Bacteria 4228
1252 Ga0495668_0465287 3300046616 Bacteria 696
1253 Ga0495634_0000688 3300046642 Bacteria 32901
1254 Ga0495634_0258731 3300046642 Bacteria 1063
1255 Ga0495611_0209056 3300046648 Bacteria 909
1256 Ga0495625_0409110 3300046660 Bacteria 846
1257 Ga0495635_0063800 3300046663 Bacteria 2529
1258 Ga0495635_0295523 3300046663 Bacteria 1086
1259 Ga0495635_0374210 3300046663 Bacteria 948
1260 Ga0495659_0051339 3300046664 Bacteria 1501
1261 Ga0495659_0391805 3300046664 Bacteria 598
1262 Ga0495659_0479766 3300046664 Bacteria 543
1263 Ga0495661_0075070 3300046665 Bacteria 1965
1264 Ga0495588_0001834 3300046674 Bacteria 9058
1265 Ga0495588_0037671 3300046674 Bacteria 2458
1266 Ga0495588_0090031 3300046674 Bacteria 1607
1267 Ga0495657_0005774 3300046675 Bacteria 9748
1268 Ga0495657_0082524 3300046675 Bacteria 2077
1269 Ga0495599_0084122 3300046678 Bacteria 1987
1270 Ga0495599_0723025 3300046678 Bacteria 573
1271 Ga0495623_0119142 3300046679 Bacteria 1591
1272 Ga0495623_0230115 3300046679 Bacteria 1052
1273 Ga0495646_0240436 3300046680 Bacteria 973
1274 Ga0495646_0274953 3300046680 Bacteria 896
1275 Ga0495647_0000251 3300046681 Bacteria 14648
1276 Ga0495647_0115285 3300046681 Bacteria 1125
1277 Ga0495658_0003282 3300046683 Bacteria 8038
1278 Ga0495658_0083256 3300046683 Bacteria 1881
1279 Ga0495658_0116970 3300046683 Bacteria 1608
1280 Ga0495669_0006299 3300046684 Bacteria 4954
1281 Ga0495669_0015509 3300046684 Bacteria 3264
1282 Ga0495669_0096131 3300046684 Bacteria 1372
1283 Ga0495669_0263515 3300046684 Bacteria 828
1284 Ga0495613_0104852 3300046689 Bacteria 2041
1285 Ga0495613_0281358 3300046689 Bacteria 1155
1286 Ga0495613_0647483 3300046689 Bacteria 699
1287 Ga0495624_0017541 3300046690 Bacteria 4805
1288 Ga0495624_0148426 3300046690 Bacteria 1435
1289 Ga0495624_0324955 3300046690 Bacteria 926
1290 Ga0495670_0046475 3300046691 Bacteria 2168
1291 Ga0495670_0166899 3300046691 Bacteria 1158
1292 Ga0495670_0199946 3300046691 Bacteria 1058
1293 Ga0495671_0037821 3300046692 Bacteria 2440
1294 Ga0495671_0108253 3300046692 Bacteria 1357
1295 Ga0495649_0013333 3300046694 Bacteria 4744
1296 Ga0495649_0070384 3300046694 Bacteria 1876
1297 Ga0495649_0133534 3300046694 Bacteria 1309
1298 Ga0495649_0171713 3300046694 Bacteria 1134
1299 Ga0495589_0084915 3300046794 Bacteria 1538
1300 Ga0495589_0352298 3300046794 Bacteria 678
1301 Ga0495600_0048324 3300046809 Bacteria 2776
1302 Ga0495600_0132503 3300046809 Bacteria 1620
1303 Ga0495581_0043625 3300047315 Bacteria 2594
1304 Ga0495581_0100427 3300047315 Bacteria 1681
1305 Ga0495581_0149116 3300047315 Bacteria 1365
1306 Ga0495604_0069897 3300047317 Bacteria 2660
1307 Ga0495604_0161354 3300047317 Bacteria 1584
1308 Ga0495604_0300888 3300047317 Bacteria 1077
1309 Ga0495636_0100334 3300047318 Bacteria 1265
1310 Ga0495636_0147373 3300047318 Bacteria 1054
1311 Ga0495674_0015532 3300047319 Bacteria 7115
1312 Ga0495674_0136829 3300047319 Bacteria 2060
1313 Ga0495672_0276444 3300047320 Bacteria 804
1314 Ga0495676_0001862 3300047321 Bacteria 18513
1315 Ga0495676_0021500 3300047321 Bacteria 5631
1316 Ga0495676_0125102 3300047321 Bacteria 1864
1317 Ga0495676_0251141 3300047321 Bacteria 1206
1318 Ga0495680_0004754 3300047322 Bacteria 12899
1319 Ga0495680_0057462 3300047322 Bacteria 3009
1320 Ga0495675_0012857 3300047444 Bacteria 5275
1321 Ga0495677_0252773 3300047445 Bacteria 689
1322 Ga0495679_053775 3300047446 Bacteria 1201
1323 Ga0495685_080584 3300047447 Bacteria 1084
1324 Ga0495673_0169721 3300047469 Bacteria 832
1325 Ga0495673_0234848 3300047469 Bacteria 674
1326 Ga0495681_0090177 3300047470 Bacteria 1355
1327 Ga0495681_0158790 3300047470 Bacteria 943
1328 Ga0495684_0186313 3300047471 Bacteria 1536
1329 Ga0495684_0571495 3300047471 Bacteria 767
1330 Ga0495686_0166411 3300047472 Bacteria 1285
1331 Ga0495686_0307791 3300047472 Bacteria 872
1332 Ga0495593_0106163 3300047673 Bacteria 1436
1333 Ga0495593_0166596 3300047673 Bacteria 1111
1334 Ga0495602_0079779 3300048088 Bacteria 2759
1335 Ga0495602_0115533 3300048088 Bacteria 2171
1336 Ga0495614_0040857 3300048089 Bacteria 1990
1337 Ga0495614_0110492 3300048089 Bacteria 1207
1338 Ga0495615_0106359 3300048090 Bacteria 798
1339 Ga0495626_0180262 3300048091 Bacteria 876
1340 Ga0496100_0000599 3300048903 Bacteria 17022
1341 Ga0496100_0003516 3300048903 Bacteria 8181
1342 Ga0496100_0010507 3300048903 Bacteria 5242
1343 Ga0496100_0020746 3300048903 Bacteria 3945
1344 Ga0496100_0033180 3300048903 Bacteria 3228
1345 Ga0496100_0096457 3300048903 Bacteria 2029
1346 Ga0496100_0133812 3300048903 Bacteria 1749
1347 Ga0496100_0141458 3300048903 Bacteria 1706
1348 Ga0496100_0149585 3300048903 Bacteria 1663
1349 Ga0496100_0375281 3300048903 Bacteria 1079
1350 Ga0496101_0000494 3300048904 Bacteria 24861
1351 Ga0496101_0000882 3300048904 Bacteria 17656
1352 Ga0496101_0028533 3300048904 Bacteria 3896
1353 Ga0496101_0091539 3300048904 Bacteria 2263
1354 Ga0496101_0171148 3300048904 Bacteria 1669
1355 Ga0496101_0228351 3300048904 Bacteria 1446
1356 Ga0496101_0245129 3300048904 Bacteria 1395
1357 Ga0496101_0351995 3300048904 Bacteria 1157
1358 Ga0496101_0395568 3300048904 Bacteria 1088
1359 Ga0496102_0002665 3300048905 Bacteria 15185
1360 Ga0496102_0007445 3300048905 Bacteria 9354
1361 Ga0496102_0070843 3300048905 Bacteria 3201
1362 Ga0496102_0081575 3300048905 Bacteria 2982
1363 Ga0496102_0091601 3300048905 Bacteria 2814
1364 Ga0496102_0187541 3300048905 Bacteria 1949
1365 Ga0496102_0228939 3300048905 Bacteria 1752
1366 Ga0496102_0243350 3300048905 Bacteria 1696
1367 Ga0496102_0318127 3300048905 Bacteria 1466
1368 Ga0496102_0373709 3300048905 Bacteria 1341
1369 Ga0496102_0457829 3300048905 Bacteria 1196
1370 Ga0496102_0625876 3300048905 Bacteria 999
1371 Ga0496102_0826751 3300048905 Bacteria 848
1372 Ga0496102_0855861 3300048905 Bacteria 831
1373 Ga0496102_0861082 3300048905 Bacteria 828
1374 Ga0496103_0001970 3300048906 Bacteria 13275
1375 Ga0496103_0010594 3300048906 Bacteria 5456
1376 Ga0496103_0023399 3300048906 Bacteria 3725
1377 Ga0496103_0108631 3300048906 Bacteria 1760
1378 Ga0496104_0001062 3300048907 Bacteria 23439
1379 Ga0496104_0023052 3300048907 Bacteria 5720
1380 Ga0496104_0030647 3300048907 Bacteria 4999
1381 Ga0496104_0030818 3300048907 Bacteria 4986
1382 Ga0496104_0051274 3300048907 Bacteria 3894
1383 Ga0496104_0054245 3300048907 Bacteria 3788
1384 Ga0496104_0070306 3300048907 Bacteria 3327
1385 Ga0496104_0088889 3300048907 Bacteria 2951
1386 Ga0496104_0099613 3300048907 Bacteria 2782
1387 Ga0496104_0176689 3300048907 Bacteria 2045
1388 Ga0496104_0187434 3300048907 Bacteria 1979
1389 Ga0496104_0207136 3300048907 Bacteria 1873
1390 Ga0496104_0283097 3300048907 Bacteria 1571
1391 Ga0496104_0384316 3300048907 Bacteria 1316
1392 Ga0496104_0401942 3300048907 Bacteria 1282
1393 Ga0496104_0404927 3300048907 Bacteria 1276
1394 Ga0496104_0493064 3300048907 Bacteria 1136
1395 Ga0496104_0550909 3300048907 Bacteria 1064
1396 Ga0496104_0584201 3300048907 Bacteria 1027
1397 Ga0496105_0006722 3300048908 Bacteria 8849
1398 Ga0496105_0006801 3300048908 Bacteria 8796
1399 Ga0496105_0007492 3300048908 Bacteria 8453
1400 Ga0496105_0009543 3300048908 Bacteria 7595
1401 Ga0496105_0046046 3300048908 Bacteria 3601
1402 Ga0496105_0067422 3300048908 Bacteria 2954
1403 Ga0496105_0069725 3300048908 Bacteria 2905
1404 Ga0496105_0071980 3300048908 Bacteria 2857
1405 Ga0496105_0115567 3300048908 Bacteria 2213
1406 Ga0496105_0138398 3300048908 Bacteria 2005
1407 Ga0496105_0140288 3300048908 Bacteria 1989
1408 Ga0496106_0001843 3300048909 Bacteria 15866
1409 Ga0496106_0013006 3300048909 Bacteria 6139
1410 Ga0496106_0028971 3300048909 Bacteria 4126
1411 Ga0496106_0049359 3300048909 Bacteria 3170
1412 Ga0496106_0054737 3300048909 Bacteria 3014
1413 Ga0496106_0222879 3300048909 Bacteria 1504
1414 Ga0496106_0275849 3300048909 Bacteria 1346
1415 Ga0496106_0624070 3300048909 Bacteria 862
1416 Ga0496106_0875352 3300048909 Bacteria 710
1417 Ga0496107_0001078 3300048910 Bacteria 16394
1418 Ga0496107_0013019 3300048910 Bacteria 5811
1419 Ga0496107_0017527 3300048910 Bacteria 5037
1420 Ga0496107_0017988 3300048910 Bacteria 4973
1421 Ga0496107_0024048 3300048910 Bacteria 4307
1422 Ga0496107_0114119 3300048910 Bacteria 1987
1423 Ga0496107_0192282 3300048910 Bacteria 1516
1424 Ga0496107_0271825 3300048910 Bacteria 1261
1425 Ga0496107_0378173 3300048910 Bacteria 1053
1426 Ga0496107_0616153 3300048910 Bacteria 801
1427 Ga0496107_0836771 3300048910 Bacteria 673
1428 Ga0496107_1125675 3300048910 Bacteria 566
1429 Ga0496108_0004012 3300048911 Bacteria 11810
1430 Ga0496108_0020315 3300048911 Bacteria 5458
1431 Ga0496108_0042428 3300048911 Bacteria 3797
1432 Ga0496108_0045424 3300048911 Bacteria 3669
1433 Ga0496108_0060178 3300048911 Bacteria 3195
1434 Ga0496108_0078574 3300048911 Bacteria 2793
1435 Ga0496108_0090838 3300048911 Bacteria 2596
1436 Ga0496108_0135406 3300048911 Bacteria 2119
1437 Ga0496108_0151344 3300048911 Bacteria 2002
1438 Ga0496108_0366044 3300048911 Bacteria 1258
1439 Ga0496108_0857289 3300048911 Bacteria 781
1440 Ga0496109_0000150 3300048912 Bacteria 68777
1441 Ga0496109_0017855 3300048912 Bacteria 6225
1442 Ga0496109_0030984 3300048912 Bacteria 4795
1443 Ga0496109_0039278 3300048912 Bacteria 4283
1444 Ga0496109_0078635 3300048912 Bacteria 3037
1445 Ga0496109_0175799 3300048912 Bacteria 2009
1446 Ga0496109_0207238 3300048912 Bacteria 1843
1447 Ga0496109_0235616 3300048912 Bacteria 1722
1448 Ga0496109_0404183 3300048912 Bacteria 1290
1449 Ga0496109_0966341 3300048912 Bacteria 789
1450 Ga0496109_1180074 3300048912 Bacteria 702
1451 Ga0496110_0009133 3300048913 Bacteria 8004
1452 Ga0496110_0011482 3300048913 Bacteria 7250
1453 Ga0496110_0020210 3300048913 Bacteria 5619
1454 Ga0496110_0022984 3300048913 Bacteria 5300
1455 Ga0496110_0032705 3300048913 Bacteria 4495
1456 Ga0496110_0076237 3300048913 Bacteria 2981
1457 Ga0496110_0126764 3300048913 Bacteria 2303
1458 Ga0496110_0202011 3300048913 Bacteria 1806
1459 Ga0496110_0214281 3300048913 Bacteria 1751
1460 Ga0496110_0250375 3300048913 Bacteria 1612
1461 Ga0496110_0375841 3300048913 Bacteria 1295
1462 Ga0496110_0529785 3300048913 Bacteria 1071
1463 Ga0496110_0956184 3300048913 Bacteria 763
1464 Ga0496111_0005375 3300048914 Bacteria 8193
1465 Ga0496111_0055969 3300048914 Bacteria 2853
1466 Ga0496111_0056765 3300048914 Bacteria 2833
1467 Ga0496111_0059964 3300048914 Bacteria 2757
1468 Ga0496111_0090813 3300048914 Bacteria 2237
1469 Ga0496111_0091071 3300048914 Bacteria 2234
1470 Ga0496111_0101558 3300048914 Bacteria 2113
1471 Ga0496111_0323814 3300048914 Bacteria 1141
1472 Ga0496111_0634278 3300048914 Bacteria 781
1473 Ga0496112_0000037 3300048915 Bacteria 96876
1474 Ga0496112_0009699 3300048915 Bacteria 8691
1475 Ga0496112_0040986 3300048915 Bacteria 4529
1476 Ga0496112_0045028 3300048915 Bacteria 4325
1477 Ga0496112_0048717 3300048915 Bacteria 4153
1478 Ga0496112_0071611 3300048915 Bacteria 3426
1479 Ga0496112_0125186 3300048915 Bacteria 2541
1480 Ga0496112_0135551 3300048915 Bacteria 2432
1481 Ga0496112_0138604 3300048915 Bacteria 2402
1482 Ga0496112_0414338 3300048915 Bacteria 1286
1483 Ga0496112_0567043 3300048915 Bacteria 1068
1484 Ga0496112_0990894 3300048915 Bacteria 760
1485 Ga0496112_1588012 3300048915 Bacteria 567
1486 Ga0496113_0002225 3300048916 Bacteria 11196
1487 Ga0496113_0005206 3300048916 Bacteria 8093
1488 Ga0496113_0017982 3300048916 Bacteria 4916
1489 Ga0496113_0041206 3300048916 Bacteria 3406
1490 Ga0496113_0072400 3300048916 Bacteria 2623
1491 Ga0496113_0095908 3300048916 Bacteria 2292
1492 Ga0496113_0118922 3300048916 Bacteria 2064
1493 Ga0496113_0140772 3300048916 Bacteria 1898
1494 Ga0496113_0176976 3300048916 Bacteria 1690
1495 Ga0496113_0368732 3300048916 Bacteria 1152
1496 Ga0496113_0721926 3300048916 Bacteria 794
1497 Ga0496114_0003461 3300048917 Bacteria 12111
1498 Ga0496114_0009746 3300048917 Bacteria 7634
1499 Ga0496114_0016489 3300048917 Bacteria 5954
1500 Ga0496114_0035339 3300048917 Bacteria 4126
1501 Ga0496114_0036682 3300048917 Bacteria 4053
1502 Ga0496114_0059833 3300048917 Bacteria 3182
1503 Ga0496114_0095686 3300048917 Bacteria 2527
1504 Ga0496114_0145154 3300048917 Bacteria 2057
1505 Ga0496114_0161707 3300048917 Bacteria 1947
1506 Ga0496114_0389454 3300048917 Bacteria 1234
1507 Ga0496114_0500845 3300048917 Bacteria 1074
1508 Ga0496114_1117335 3300048917 Bacteria 673
1509 Ga0496115_0000999 3300048918 Bacteria 20514
1510 Ga0496115_0006582 3300048918 Bacteria 8514
1511 Ga0496115_0029316 3300048918 Bacteria 4321
1512 Ga0496115_0031361 3300048918 Bacteria 4189
1513 Ga0496115_0035947 3300048918 Bacteria 3921
1514 Ga0496115_0039629 3300048918 Bacteria 3742
1515 Ga0496115_0120132 3300048918 Bacteria 2162
1516 Ga0496115_0199612 3300048918 Bacteria 1652
1517 Ga0496115_0252539 3300048918 Bacteria 1451
1518 Ga0496115_0482887 3300048918 Bacteria 998
1519 Ga0496116_0035471 3300048919 Bacteria 3503
1520 Ga0496117_0334738 3300048920 Bacteria 788
1521 Ga0496118_0046643 3300048921 Bacteria 3368
1522 Ga0496118_0174154 3300048921 Bacteria 1310
1523 Ga0496118_0448869 3300048921 Bacteria 655
1524 Ga0496119_0015279 3300048922 Bacteria 5929
1525 Ga0496119_0142928 3300048922 Bacteria 1290
1526 Ga0496119_0287856 3300048922 Bacteria 814
1527 Ga0496120_0015837 3300048923 Bacteria 4954
1528 Ga0496120_0131305 3300048923 Bacteria 1282
1529 Ga0496121_0005976 3300048924 Bacteria 15378
1530 Ga0496121_0015099 3300048924 Bacteria 8124
1531 Ga0496121_0021977 3300048924 Bacteria 6216
1532 Ga0496121_0024040 3300048924 Bacteria 5840
1533 Ga0496121_0045061 3300048924 Bacteria 3795
1534 Ga0496121_0054526 3300048924 Bacteria 3339
1535 Ga0496121_0056132 3300048924 Bacteria 3274
1536 Ga0496121_0061352 3300048924 Bacteria 3086
1537 Ga0496121_0135456 3300048924 Bacteria 1836
1538 Ga0496121_0238636 3300048924 Bacteria 1268
1539 Ga0496121_0332334 3300048924 Bacteria 1019
1540 Ga0496122_0051914 3300048925 Bacteria 3109
1541 Ga0496122_0087737 3300048925 Bacteria 2136
1542 Ga0496123_0152762 3300048926 Bacteria 1243
1543 Ga0496123_0326685 3300048926 Bacteria 722
1544 Ga0496124_0070789 3300048927 Bacteria 2892
1545 Ga0496124_0098519 3300048927 Bacteria 2372
1546 Ga0496124_0295825 3300048927 Bacteria 1172
1547 Ga0496124_0366054 3300048927 Bacteria 1014
1548 Ga0496125_0000063 3300048928 Bacteria 250260
1549 Ga0496125_0090927 3300048928 Bacteria 2289
1550 Ga0496125_0414945 3300048928 Bacteria 782
1551 Ga0496126_0017319 3300048929 Bacteria 7181
1552 Ga0496126_0024357 3300048929 Bacteria 5844
1553 Ga0496126_0024459 3300048929 Bacteria 5831
1554 Ga0496126_0066169 3300048929 Bacteria 3232
1555 Ga0496126_0070236 3300048929 Bacteria 3120
1556 Ga0496126_0076504 3300048929 Bacteria 2969
1557 Ga0496126_0189176 3300048929 Bacteria 1744
1558 Ga0496126_0503236 3300048929 Bacteria 968
1559 Ga0496126_0642658 3300048929 Bacteria 831
1560 Ga0501031_0001347 3300049568 Bacteria 15140
1561 Ga0501032_0053609 3300049569 Bacteria 2715
1562 Ga0501033_0011898 3300049570 Bacteria 6647
1563 Ga0501034_0033206 3300049571 Bacteria 5237
1564 Ga0501036_0007122 3300049572 Bacteria 9102
1565 Ga0501036_0350970 3300049572 Bacteria 1232
1566 Ga0501036_0687753 3300049572 Bacteria 846
1567 Ga0501037_0002074 3300049573 Bacteria 14527
1568 Ga0501038_0003729 3300049574 Bacteria 14197
1569 Ga0501038_0143547 3300049574 Bacteria 1951
1570 Ga0501038_0723692 3300049574 Bacteria 744
1571 Ga0501039_0074719 3300049575 Bacteria 2634
1572 Ga0501039_0758491 3300049575 Bacteria 758
1573 Ga0501042_0533448 3300049578 Bacteria 853
1574 Ga0501043_0541973 3300049579 Bacteria 865
1575 Ga0501047_0015275 3300049581 Bacteria 7314
1576 Ga0501047_0089005 3300049581 Bacteria 2964
1577 Ga0501047_1037416 3300049581 Bacteria 633
1578 Ga0501048_0196772 3300049582 Bacteria 1429
1579 Ga0501067_0027802 3300049583 Bacteria 3134
1580 Ga0501070_0003904 3300049586 Bacteria 12863
1581 Ga0501070_0144497 3300049586 Bacteria 1964
1582 Ga0501071_0221286 3300049587 Bacteria 1425
1583 Ga0501071_0614767 3300049587 Bacteria 836
1584 Ga0501072_0005303 3300049588 Bacteria 9817
1585 Ga0501073_0106285 3300049589 Bacteria 1948
1586 Ga0501073_0177869 3300049589 Bacteria 1472
1587 Ga0501074_0213555 3300049590 Bacteria 1374
1588 Ga0501075_0850938 3300049591 Bacteria 694
1589 Ga0501076_0166672 3300049592 Bacteria 1796
1590 Ga0501076_0333947 3300049592 Bacteria 1244
1591 Ga0501076_0409764 3300049592 Bacteria 1115
1592 Ga0501080_0310862 3300049742 Bacteria 1428
1593 Ga0501083_0021564 3300049744 Bacteria 4475
1594 Ga0501083_0183169 3300049744 Bacteria 1367
1595 Ga0501083_0599512 3300049744 Bacteria 717
1596 Ga0501083_0784239 3300049744 Bacteria 620
1597 Ga0501083_0969339 3300049744 Bacteria 553
1598 Ga0501044_0010897 3300049823 Bacteria 9866
1599 Ga0501044_0239002 3300049823 Bacteria 1761
1600 Ga0501044_1224921 3300049823 Bacteria 618
1601 nmdc:mga03683_111030_c1 3300050489 Bacteria 1212
1602 nmdc:mga03683_165622_c1 3300050489 Bacteria 1003
1603 nmdc:mga03683_260458_c1 3300050489 Bacteria 807
1604 nmdc:mga03683_339272_c1 3300050489 Bacteria 710
1605 nmdc:mga03683_34314_c1 3300050489 Bacteria 2053
1606 nmdc:mga03683_610247_c1 3300050489 Bacteria 535
1607 nmdc:mga03n38_100456_c1 3300050490 Bacteria 1394
1608 nmdc:mga03n38_108421_c1 3300050490 Bacteria 1349
1609 nmdc:mga03n38_111620_c1 3300050490 Bacteria 1332
1610 nmdc:mga03n38_157279_c1 3300050490 Bacteria 1148
1611 nmdc:mga03n38_182594_c1 3300050490 Bacteria 1076
1612 nmdc:mga03n38_23581_c1 3300050490 Bacteria 2505
1613 nmdc:mga03n38_339702_c1 3300050490 Bacteria 815
1614 nmdc:mga03n38_516794_c1 3300050490 Bacteria 672
1615 nmdc:mga03n38_69082_c1 3300050490 Bacteria 1630
1616 nmdc:mga00v17_150032_c1 3300050491 Bacteria 1498
1617 nmdc:mga00v17_167313_c1 3300050491 Bacteria 1417
1618 nmdc:mga00v17_50359_c1 3300050491 Bacteria 2530
1619 nmdc:mga00v17_56718_c1 3300050491 Bacteria 2395
1620 nmdc:mga00v17_595223_c1 3300050491 Bacteria 713
1621 nmdc:mga0yw44_105347_c1 3300050492 Bacteria 1229
1622 nmdc:mga0yw44_124003_c1 3300050492 Bacteria 1667
1623 nmdc:mga0yw44_146819_c1 3300050492 Bacteria 1536
1624 nmdc:mga0yw44_17072_c1 3300050492 Bacteria 3940
1625 nmdc:mga0yw44_173941_c1 3300050492 Bacteria 1415
1626 nmdc:mga0yw44_22173_c1 3300050492 Bacteria 3556
1627 nmdc:mga0yw44_230359_c1 3300050492 Bacteria 1230
1628 nmdc:mga0yw44_287153_c1 3300050492 Bacteria 1100
1629 nmdc:mga0yw44_366876_c1 3300050492 Bacteria 971
1630 nmdc:mga0yw44_6362_c1 3300050492 Bacteria 5700
1631 nmdc:mga0yw44_723491_c1 3300050492 Bacteria 676
1632 nmdc:mga0yw44_897761_c1 3300050492 Bacteria 601
1633 nmdc:mga0yw44_973524_c1 3300050492 Bacteria 575
1634 nmdc:mga0k408_2401_c1 3300050493 Bacteria 9965
1635 nmdc:mga0k408_300630_c1 3300050493 Bacteria 958
1636 nmdc:mga0k408_491424_c1 3300050493 Bacteria 728
1637 nmdc:mga0k408_50813_c1 3300050493 Bacteria 2400
1638 nmdc:mga06z11_119686_c1 3300050494 Bacteria 1468
1639 nmdc:mga06z11_1670_c1 3300050494 Bacteria 8317
1640 nmdc:mga06z11_197559_c1 3300050494 Bacteria 1167
1641 nmdc:mga06z11_22402_c1 3300050494 Bacteria 2950
1642 nmdc:mga06z11_228572_c1 3300050494 Bacteria 1089
1643 nmdc:mga06z11_243594_c1 3300050494 Bacteria 1057
1644 nmdc:mga06z11_245351_c1 3300050494 Bacteria 1053
1645 nmdc:mga06z11_282264_c1 3300050494 Bacteria 984
1646 nmdc:mga06z11_319671_c1 3300050494 Bacteria 926
1647 nmdc:mga06z11_3575_c1 3300050494 Bacteria 6023
1648 nmdc:mga06z11_526629_c1 3300050494 Bacteria 717
1649 nmdc:mga06z11_58571_c1 3300050494 Bacteria 1999
1650 nmdc:mga06z11_602447_c1 3300050494 Bacteria 668
1651 nmdc:mga06z11_63118_c1 3300050494 Bacteria 1937
1652 nmdc:mga04h51_16475_c1 3300050495 Bacteria 2146
1653 nmdc:mga04h51_194208_c1 3300050495 Bacteria 795
1654 nmdc:mga04h51_203393_c1 3300050495 Bacteria 779
1655 nmdc:mga07m45_182155_c1 3300050496 Bacteria 1221
1656 nmdc:mga07m45_192304_c1 3300050496 Bacteria 1187
1657 nmdc:mga07m45_219378_c1 3300050496 Bacteria 1106
1658 nmdc:mga07m45_230392_c1 3300050496 Bacteria 1078
1659 nmdc:mga07m45_264820_c1 3300050496 Bacteria 1000
1660 nmdc:mga07m45_289565_c1 3300050496 Bacteria 953
1661 nmdc:mga05p37_19935_c1 3300050507 Bacteria 8114
1662 nmdc:mga09592_38018_c1 3300050508 Bacteria 4039
1663 nmdc:mga0qj67_41_c1 3300050509 Bacteria 89688
1664 nmdc:mga0qj67_6284_c1 3300050509 Bacteria 8714
1665 nmdc:mga0qj67_72919_c1 3300050509 Bacteria 2742
1666 nmdc:mga06r32_363318_c1 3300050510 Bacteria 1431
1667 nmdc:mga06r32_52230_c1 3300050510 Bacteria 3915
1668 nmdc:mga08y16_1035_c1 3300050511 Bacteria 27236
1669 nmdc:mga08y16_175085_c1 3300050511 Bacteria 2228
1670 nmdc:mga08y16_185069_c1 3300050511 Bacteria 2162
1671 nmdc:mga08y16_373034_c1 3300050511 Bacteria 1463
1672 nmdc:mga08y16_403931_c1 3300050511 Bacteria 1398
1673 nmdc:mga08y16_56355_c1 3300050511 Bacteria 4108
1674 nmdc:mga08y16_5774_c1 3300050511 Bacteria 12961
1675 nmdc:mga08y16_61526_c1 3300050511 Bacteria 3921
1676 nmdc:mga0n895_174078_c1 3300050512 Bacteria 2184
1677 nmdc:mga0n895_5998_c1 3300050512 Bacteria 10235
1678 nmdc:mga0n895_688260_c1 3300050512 Bacteria 1019
1679 nmdc:mga0n895_732684_c1 3300050512 Bacteria 983
1680 nmdc:mga0rr50_1280834_c1 3300050513 Bacteria 622
1681 nmdc:mga0rr50_557582_c1 3300050513 Bacteria 976
1682 nmdc:mga0rr50_837402_c1 3300050513 Bacteria 785
1683 nmdc:mga08x19_116428_c1 3300050514 Bacteria 1787
1684 nmdc:mga08x19_174592_c1 3300050514 Bacteria 1465
1685 nmdc:mga0a205_154956_c1 3300050515 Bacteria 2190
1686 nmdc:mga0a205_2866_c1 3300050515 Bacteria 15258
1687 nmdc:mga0a205_6029_c1 3300050515 Bacteria 10935
1688 nmdc:mga0sz30_145630_c1 3300050516 Bacteria 1047
1689 nmdc:mga0sz30_38629_c1 3300050516 Bacteria 2001
1690 nmdc:mga0sz30_71058_c1 3300050516 Bacteria 1498
1691 Ga0495601_0007494 3300053077 Bacteria 6405
1692 Ga0495612_0001901 3300053078 Bacteria 8588
1693 Ga0495612_0330969 3300053078 Bacteria 686
1694 Ga0500610_0016776 3300053079 Bacteria 3502
1695 Ga0500610_0130548 3300053079 Bacteria 1278
1696 Ga0500635_0019581 3300053080 Bacteria 2060
1697 Ga0495655_0107820 3300053083 Bacteria 833
1698 Ga0495655_0216272 3300053083 Bacteria 632
1699 Ga0495595_0212634 3300053084 Bacteria 964
1700 Ga0495619_0001142 3300053085 Bacteria 17435
1701 Ga0495619_0001642 3300053085 Bacteria 14741
1702 Ga0495619_0254033 3300053085 Bacteria 1218
1703 Ga0495619_0340709 3300053085 Bacteria 1037
1704 Ga0495619_0464194 3300053085 Bacteria 872
1705 Ga0500578_0010313 3300053086 Bacteria 6058
1706 Ga0500578_0173493 3300053086 Bacteria 1332
1707 Ga0500578_0462561 3300053086 Bacteria 720
1708 Ga0500643_000210 3300053087 Bacteria 55059
1709 Ga0500643_011021 3300053087 Bacteria 3326
1710 Ga0500643_038610 3300053087 Bacteria 1415
1711 Ga0500643_071035 3300053087 Bacteria 966
1712 Ga0500644_0000769 3300053088 Bacteria 10967
1713 Ga0500647_0049964 3300053091 Bacteria 2011
1714 Ga0500651_0000936 3300053093 Bacteria 14319
1715 Ga0500651_0256182 3300053093 Bacteria 1016
1716 Ga0500651_0637071 3300053093 Bacteria 575
1717 Ga0500566_0000120 3300053094 Bacteria 40616
1718 Ga0500566_0008320 3300053094 Bacteria 6135
1719 Ga0500566_0071322 3300053094 Bacteria 1949
1720 Ga0500640_071955 3300053095 Bacteria 1482
1721 Ga0500641_0008369 3300053096 Bacteria 3689
1722 Ga0500641_0018167 3300053096 Bacteria 2641
1723 Ga0500641_0074804 3300053096 Bacteria 1431
1724 Ga0500654_163350 3300053099 Bacteria 750
1725 Ga0500554_005119 3300053102 Bacteria 2833
1726 Ga0500554_085852 3300053102 Bacteria 1041
1727 Ga0500555_002453 3300053103 Bacteria 5364
1728 Ga0500555_046994 3300053103 Bacteria 1189
1729 Ga0500556_0023928 3300053104 Bacteria 2000
1730 Ga0500556_0102404 3300053104 Bacteria 1104
1731 Ga0500557_000034 3300053105 Bacteria 71225
1732 Ga0500558_278384 3300053106 Bacteria 534
1733 Ga0500569_146876 3300053109 Bacteria 795
1734 Ga0500594_0301085 3300053118 Bacteria 537
1735 Ga0500595_000056 3300053119 Bacteria 83521
1736 Ga0500595_005054 3300053119 Bacteria 5794
1737 Ga0500595_022005 3300053119 Bacteria 2266
1738 Ga0500595_061630 3300053119 Bacteria 1131
1739 Ga0500614_064059 3300053123 Bacteria 994
1740 Ga0500626_161670 3300053128 Bacteria 920
1741 Ga0500642_0000053 3300053130 Bacteria 71632
1742 Ga0500642_0083917 3300053130 Bacteria 1466
1743 Ga0500652_000030 3300053131 Bacteria 90754
1744 Ga0500652_052504 3300053131 Bacteria 1667
1745 Ga0500652_264844 3300053131 Bacteria 676
1746 Ga0500658_0014766 3300053134 Bacteria 2893
1747 Ga0500658_0025149 3300053134 Bacteria 2287
1748 Ga0500658_0192501 3300053134 Bacteria 931
1749 Ga0500559_0056547 3300053136 Bacteria 1741
1750 Ga0500559_0193815 3300053136 Bacteria 957
1751 Ga0500568_0012017 3300053139 Bacteria 3993
1752 Ga0500568_0037016 3300053139 Bacteria 1982
1753 Ga0500568_0076237 3300053139 Bacteria 1277
1754 Ga0500577_0001802 3300053142 Bacteria 5466
1755 Ga0500577_0009470 3300053142 Bacteria 2829
1756 Ga0500577_0020678 3300053142 Bacteria 2158
1757 Ga0500588_0158454 3300053146 Bacteria 823
1758 Ga0500588_0199052 3300053146 Bacteria 742
1759 Ga0500588_0245673 3300053146 Bacteria 671
1760 Ga0500603_002845 3300053150 Bacteria 3755
1761 Ga0500604_0186595 3300053151 Bacteria 712
1762 Ga0500616_0000006 3300053153 Bacteria 944738
1763 Ga0500616_0000045 3300053153 Bacteria 339292
1764 Ga0500616_0028356 3300053153 Bacteria 3085
1765 Ga0500616_0097266 3300053153 Bacteria 1446
1766 Ga0500620_000534 3300053155 Bacteria 6642
1767 Ga0500622_0077360 3300053156 Bacteria 1671
1768 Ga0500622_0287029 3300053156 Bacteria 707
1769 Ga0500633_0286051 3300053160 Bacteria 609
1770 Ga0500634_0192534 3300053161 Bacteria 905
1771 Ga0500638_010829 3300053162 Bacteria 4015
1772 Ga0500638_087755 3300053162 Bacteria 1469
1773 Ga0500639_100769 3300053163 Bacteria 1422
1774 Ga0500639_294217 3300053163 Bacteria 615
1775 Ga0500636_0000033 3300053177 Bacteria 72990
1776 Ga0500636_0099701 3300053177 Bacteria 1653
1777 Ga0500636_0218495 3300053177 Bacteria 995
1778 Ga0500637_0000132 3300053178 Bacteria 27236
1779 Ga0500637_0001768 3300053178 Bacteria 9332
1780 Ga0500611_040313 3300053727 Bacteria 1022
1781 Ga0500625_103690 3300053729 Bacteria 1185
1782 Ga0500645_014280 3300053730 Bacteria 2533
1783 Ga0500645_038055 3300053730 Bacteria 1428
1784 Ga0500609_009849 3300053731 Bacteria 1286
1785 Ga0500601_000010 3300053737 Bacteria 45442
1786 Ga0501084_0606737 3300054114 Bacteria 925
1787 Ga0500661_000757 3300055283 Bacteria 6057
1788 Ga0500661_003493 3300055283 Bacteria 2947
1789 Ga0587088_115797 3300059508 Bacteria 615
1790 Ga0501082_0000038 3300060353 Bacteria 94168
1791 Ga0501082_0252857 3300060353 Bacteria 1533
1792 Ga0501082_0997005 3300060353 Bacteria 732
1793 2507504579 2507262055 Bacteria 8048963
1794 2508546007 2508501009 Bacteria 7784016
1795 2508694855 2508501042 Bacteria 8719808
1796 2511401284 2511231028 Bacteria 8046582
1797 2513626555 2513237092 Bacteria 8341956
1798 2513649358 2513237095 Bacteria 8976980
1799 2513699376 2513237102 Bacteria 7703324
1800 2513861076 2513237137 Bacteria 9558895
1801 2513875557 2513237139 Bacteria 8737671
1802 2514011053 2513237161 Bacteria 8871253
1803 2515624213 2515154112 Bacteria 8294334
1804 2517102920 2517093001 Bacteria 9002274
1805 2524534525 2524023228 Bacteria 10118060
1806 2528854454 2528768022 Bacteria 10457665
1807 2617347597 2617270735 Bacteria 9163226
1808 2617376992 2617270741 Bacteria 8201522
1809 2739244915 2738543012 Bacteria 7115078
1810 2793063578 2791355196 Bacteria 7323613
1811 2793076876
1812 2805921088 2802429603 Bacteria 8777136
1813 2818237038 2816332527 Bacteria 8933356
1814 2824606350 2824600985 Bacteria 8488197
1815 2824612087 2824609381 Bacteria 8672835
1816 2824619214 2824617872 Bacteria 8814715
1817 2824628137 2824626560 Bacteria 8813858
1818 2824636901 2824635225 Bacteria 8785348
1819 2824645715 2824644064 Bacteria 8743947
1820 2824658474 2824653114 Bacteria 8493680
1821 2824668045 2824661429 Bacteria 9877870
1822 2824676757 2824671348 Bacteria 8369588
1823 2824683252 2824679649 Bacteria 8248951
1824 2824694037 2824687955 Bacteria 8360029
1825 2824701603 2824696289 Bacteria 8335049
1826 2824710301 2824704595 Bacteria 9667483
1827 2824715894 2824714736 Bacteria 8717648
1828 2824725364 2824723954 Bacteria 8758240
1829 2824736872 2824732956 Bacteria 7810675
1830 2824747599 2824746037 Bacteria 7911610
1831 2824760905 2824753945 Bacteria 9787441
1832 2824767670 2824763712 Bacteria 9792355
1833 2824777061 2824773399 Bacteria 8360218
1834 2838129189 2838122688 Bacteria 8803140
1835 2841944183 2841941048 Bacteria 8688029
1836 2841954642 2841949485 Bacteria 8680857
1837 2841968965 2841966195 Bacteria 8673214
1838 2841979739 2841974524 Bacteria 8931498
1839 2841989665 2841983080 Bacteria 8395090
1840 2842044181 2842038055 Bacteria 8002051
1841 2842051830 2842045827 Bacteria 8006841
1842 2847941477 2847939898 Bacteria 8606328
1843 2849082393 2849076700 Bacteria 7039503
1844 2857516527 2857509624 Bacteria 7472071
1845 2874595501 2874590934 Bacteria 8299676
1846 2874629460 2874628541 Bacteria 8630250
1847 2874647046 2874645413 Bacteria 8214782
1848 2876775695 2876771140 Bacteria 8287509
1849 2876823687 2876818435 Bacteria 8274608
1850 2879079786 2879074833 Bacteria 8279565
1851 2879103082 2879099564 Bacteria 10442239
1852 2879131135 2879127579 Bacteria 8294491
1853 2879150341 2879142872 Bacteria 8267021
1854 2881369799 2881364244 Bacteria 7710352
1855 2885368271 2885366525 Bacteria 8326213
1856 2888380254 2888378607 Bacteria 9652610
1857 2888388366 2888388044 Bacteria 7304136
1858 2888427153 2888419890 Bacteria 7857137
1859 2889040316 2889033259 Bacteria 9099371
1860 2904691453 2904690495 Bacteria 9412302
1861 2904705912
1862 2904719979 2904711408 Bacteria 9771557
1863 2908761739 2908756301 Bacteria 8864324
1864 2908782898 2908775508 Bacteria 8092255
1865 2922369824
1866 2922398751 2922393267 Bacteria 8285685
1867 2929622817 2929615660 Bacteria 9193770
1868 2929632079 2929624759 Bacteria 9339455
1869 2932789862 2932784394 Bacteria 9704911
1870 2932796186 2932794094 Bacteria 7915132
1871 2932807760 2932801729 Bacteria 7987968
1872 2932815419 2932809354 Bacteria 9135765
1873 2932825142 2932818245 Bacteria 9955613
1874 2932829310 2932828146 Bacteria 9745859
1875 2933584551 2933577622 Bacteria 9116884
1876 2935614223 2935608549 Bacteria 8203142
1877 2935617743 2935616580 Bacteria 9032984
1878 2935643788 2935638405 Bacteria 10015038
1879 2935651410 2935648319 Bacteria 8801166
1880 2935659822 2935656913 Bacteria 8965014
1881 2935670902 2935665750 Bacteria 9571747
1882 2935681522 2935675223 Bacteria 9928132
1883 2935692522 2935684952 Bacteria 9590419
1884 2935699263 2935694250 Bacteria 9291695
1885 2935710070 2935703347 Bacteria 10242284
1886 2935721140 2935713505 Bacteria 9608509
1887 2935730867 2935722832 Bacteria 9608746
1888 2935739829 2935732158 Bacteria 9706831
1889 2935748867 2935741537 Bacteria 9707219
1890 2935758737 2935750917 Bacteria 9590372
1891 2935767800 2935760218 Bacteria 9817913
1892 2935775591 2935769743 Bacteria 7878163
1893 2935790119 2935785616 Bacteria 7962367
1894 2935798554 2935793552 Bacteria 8012592
1895 2935806766 2935801545 Bacteria 9301974
1896 2935817929 2935810662 Bacteria 9401221
1897 2935826474 2935819856 Bacteria 8261050
1898 2935834473 2935827899 Bacteria 10038562
1899 2935843802 2935837841 Bacteria 9454360
1900 2935851331 2935847175 Bacteria 8228321
1901 2935856758 2935855204 Bacteria 9035059
1902 2935868237 2935864058 Bacteria 9784707
1903 2935879595 2935873716 Bacteria 9632195
1904 2935887468 2935883170 Bacteria 7964738
1905 2935913295 2935908558 Bacteria 8568796
1906 2935922699 2935916978 Bacteria 9113783
1907 2935930780 2935926038 Bacteria 8601059
1908 2935939886 2935934488 Bacteria 8602579
1909 2935946835 2935942939 Bacteria 8599779
1910 2935955964 2935951376 Bacteria 8602333
1911 2935966264 2935959822 Bacteria 7869783
1912 2935972757 2935967501 Bacteria 8603075
1913 2935982547 2935975950 Bacteria 8347125
1914 2935984512 2935984226 Bacteria 8302647
1915 2935997101 2935992306 Bacteria 9802711
1916 2936009787 2936002035 Bacteria 9362176
1917 2936014238 2936011229 Bacteria 8801034
1918 2936022853 2936019824 Bacteria 8804134
1919 2936030990 2936028420 Bacteria 8965941
1920 2936044673 2936037263 Bacteria 9446081
1921 2936049111 2936046547 Bacteria 8903709
1922 2936055556 2936055302 Bacteria 8785755
1923 2940564673 2940556831 Bacteria 9590747
1924 2941534852 2941531003 Bacteria 7653939
1925 2941545050 2941538514 Bacteria 9402094
1926 3005490383 3005483717 Bacteria 7877331
1927 3005509812 3005506211 Bacteria 6943378
1928 3005591216 3005587118 Bacteria 7794411
1929 3005595725 3005594810 Bacteria 8716512
1930 3005711697 3005710791 Bacteria 7622528
1931 3005718957 3005718088 Bacteria 8283608
1932 8006933355 8006926726 Bacteria 6749210
1933 8006933652 8006933436 Bacteria 10410654
1934 8006983324 8006973647 Bacteria 10679141
1935 8006985655 8006984368 Bacteria 9651211
1936 8016518939 8016511872 Bacteria 9921665
1937 8016525529 8016522445 Bacteria 8156687
1938 8016539122 8016530956 Bacteria 8155261
1939 8016543409 8016539877 Bacteria 8155419
1940 8016558299 8016557553 Bacteria 8154380
1941 8016568812 8016566248 Bacteria 8158151
1942 8016581456 8016575299 Bacteria 8154085
1943 8016587201 8016583857 Bacteria 10421953
1944 8016596296 8016595262 Bacteria 8149947
1945 8016630481 8016622563 Bacteria 7999408
1946 8016636601 8016630954 Bacteria 9217207
1947 8017057752 8017057580 Bacteria 10023680
1948 8019538790 8019530166 Bacteria 8155624
1949 8019549427 8019547302 Bacteria 7996444
1950 8019578029 8019576017 Bacteria 10049540
1951 8019596086 8019586578 Bacteria 10212056
1952 8019605630 8019597564 Bacteria 10041141
1953 8019612904 8019608314 Bacteria 10042931
1954 8019638567 8019629233 Bacteria 8687553
1955 8019641178 8019638758 Bacteria 9062356
1956 8019653309 8019648815 Bacteria 10014479
1957 8019676030 8019668869 Bacteria 8791617
1958 8019680115 8019678201 Bacteria 8863603
1959 8019693407 8019687851 Bacteria 8712826
1960 8055750720 8055742211 Bacteria 9226248
1961 8056690103 8056689827 Bacteria 6712655
1962 8056970554 8056967851 Bacteria 9038162
1963 Ga0496110_1257352
1964 SwRhRL2b_contig_1701188
1965 ARcpr5oldR_c000128
1966 ARSoilYngRDRAFT_c00283
1967 ARcpr5yngRDRAFT_c000030
1968 ARSoilOldRDRAFT_c000033
1969 ARCol0oldRDRAFT_c00578
1970 JGI24752J21851_1000855
1971 JGI24746J21847_1001099
1972 JGI24747J21853_1000198
1973 JGI24739J22299_10003373
1974 JGI24737J22298_10000583
1975 JGI24737J22298_10010676
1976 JGI24743J22301_10002884
1977 JGI24743J22301_10038350
1978 JGI24750J21931_1000410
1979 JGI24750J21931_1005642
1980 JGI24750J21931_1022371
1981 JGI24745J21846_1000037
1982 JGI24738J21930_10000785
1983 JGI24749J21850_1001221
1984 JGI24749J21850_1015533
1985 JGI24744J21845_10011293
1986 JGI24744J21845_10042033
1987 JGI24033J26618_1000312
1988 JGI24034J26672_10000581
1989 JGI24034J26672_10025599
1990 JGI24742J22300_10000043
1991 JGI24751J29686_10041706
1992 JGI25406J46586_10000068
1993 JGI25406J46586_10008165
1994 JGI25406J46586_10060073
1995 JGI25165J46597_1018079
1996 JGI25153J46596_10002210
1997 JGI25153J46596_10004811
1998 JGI25153J46596_10004900
1999 JGI25153J46596_10007387
2000 JGI25160J50197_1000710
2001 JGI25160J50197_1003584
2002 JGI25160J50197_1010394
2003 JGI25404J52841_10000867
2004 JGI25404J52841_10002487
2005 JGI25404J52841_10006015
2006 JGI25404J52841_10022071
2007 JGI25404J52841_10056632
2008 JGI25404J52841_10080103
2009 Ga0055539_1011872
2010 Ga0055524_1068901
2011 Ga0055531_10053154
2012 Ga0055543_1006712
2013 Ga0058859_10016570
2014 Ga0058859_11699942
2015 Ga0058863_11703982
2016 Ga0058860_10024684
2017 Ga0065165_1000721
2018 Ga0065165_1004793
2019 Ga0065165_1033937
2020 Ga0065717_1002062
2021 Ga0065716_1001745
2022 Ga0065704_10080783
2023 Ga0065712_10031485
2024 Ga0065712_10325449
2025 Ga0065707_10173408
2026 Ga0065707_10286590
2027 Ga0070658_10443019
2028 Ga0070676_10004870
2029 Ga0070676_10110127
2030 Ga0070683_100000656
2031 Ga0070683_100320620
2032 Ga0070683_100819211
2033 Ga0070690_100001831
2034 Ga0070690_100708144
2035 Ga0070670_100002207
2036 Ga0070670_100120139
2037 Ga0070670_100389657
2038 Ga0070670_100521947
2039 Ga0070670_100822381
2040 Ga0070677_10000076
2041 Ga0070677_10096427
2042 Ga0068869_100000216
2043 Ga0068869_100106419
2044 Ga0070666_10021987
2045 Ga0070666_10029488
2046 Ga0070666_10160390
2047 Ga0070680_100002960
2048 Ga0070680_100203154
2049 Ga0070680_100423043
2050 Ga0070680_100453990
2051 Ga0070682_100000285
2052 Ga0070682_100251333
2053 Ga0070682_100368923
2054 Ga0070682_100623658
2055 Ga0068868_100001772
2056 Ga0068868_100033599
2057 Ga0068868_100041211
2058 Ga0068868_100165736
2059 Ga0070660_100000874
2060 Ga0070660_100218822
2061 Ga0070660_100368672
2062 Ga0070660_100770173
2063 Ga0070689_100010376
2064 Ga0070689_100015849
2065 Ga0070689_100753724
2066 Ga0070689_101082685
2067 Ga0070691_10001440
2068 Ga0070691_10044360
2069 Ga0070687_100000185
2070 Ga0070687_100413522
2071 Ga0070687_100554386
2072 Ga0070661_100017504
2073 Ga0070661_100073421
2074 Ga0070661_100111757
2075 Ga0070661_100327398
2076 Ga0070661_100441958
2077 Ga0070661_100733815
2078 Ga0070692_10267971
2079 Ga0070692_10334620
2080 Ga0070668_100002051
2081 Ga0070668_100011651
2082 Ga0070668_100035393
2083 Ga0070668_100050466
2084 Ga0070668_100097988
2085 Ga0070668_100179118
2086 Ga0070668_100188678
2087 Ga0070668_100437860
2088 Ga0070668_100738349
2089 Ga0070668_102059044
2090 Ga0070669_100001956
2091 Ga0070669_100311205
2092 Ga0070669_100530531
2093 Ga0070669_100725776
2094 Ga0070675_100000622
2095 Ga0070675_100153693
2096 Ga0070675_100162301
2097 Ga0070675_100272791
2098 Ga0070671_100007975
2099 Ga0070671_100008477
2100 Ga0070671_100048982
2101 Ga0070674_100019666
2102 Ga0070674_100022956
2103 Ga0070674_100038207
2104 Ga0070674_100207223
2105 Ga0070674_100334228
2106 Ga0070674_101218525
2107 Ga0070674_101353810
2108 Ga0070673_100000640
2109 Ga0070673_100079199
2110 Ga0070673_100982260
2111 Ga0070688_100001260
2112 Ga0070688_100014141
2113 Ga0070688_100107787
2114 Ga0070688_100141732
2115 Ga0070688_100214299
2116 Ga0070688_100420104
2117 Ga0070688_100492242
2118 Ga0070659_100001362
2119 Ga0070659_100015110
2120 Ga0070659_100174055
2121 Ga0070659_100207929
2122 Ga0070659_100352055
2123 Ga0070659_100462404
2124 Ga0070659_100596967
2125 Ga0070659_100865249
2126 Ga0070667_100053811
2127 Ga0070667_100069788
2128 Ga0070667_100095579
2129 Ga0070667_100101080
2130 Ga0070667_100535927
2131 Ga0070667_100629671
2132 Ga0070703_10001617
2133 Ga0070709_10417639
2134 Ga0070714_100020655
2135 Ga0070714_100231089
2136 Ga0070713_100002997
2137 Ga0070713_100314506
2138 Ga0070713_101221650
2139 Ga0070710_10011255
2140 Ga0070710_10821000
2141 Ga0070701_10000264
2142 Ga0070701_10318259
2143 Ga0070701_10366211
2144 Ga0070711_100007247
2145 Ga0070705_100064906
2146 Ga0070705_100081187
2147 Ga0070705_100241017
2148 Ga0070700_100008659
2149 Ga0070700_100221837
2150 Ga0070700_100331402
2151 Ga0070700_100514346
2152 Ga0070694_100002993
2153 Ga0070694_100034575
2154 Ga0070694_100094905
2155 Ga0070708_100122026
2156 Ga0070663_100001039
2157 Ga0070663_100004997
2158 Ga0070663_100067206
2159 Ga0070663_100155316
2160 Ga0070663_100407578
2161 Ga0070663_100441000
2162 Ga0070663_100458773
2163 Ga0070663_100709599
2164 Ga0070678_100019598
2165 Ga0070678_100036719
2166 Ga0070678_100743663
2167 Ga0070662_100003674
2168 Ga0070662_100052672
2169 Ga0070662_100071888
2170 Ga0070662_100095713
2171 Ga0070662_100201446
2172 Ga0070662_100860104
2173 Ga0070662_101508540
2174 Ga0070681_10031741
2175 Ga0070681_10149428
2176 Ga0070681_10159875
2177 Ga0070681_10232159
2178 Ga0068867_100013959
2179 Ga0068867_100090819
2180 Ga0068867_100127586
2181 Ga0070685_10000645
2182 Ga0070685_10133545
2183 Ga0070685_10158762
2184 Ga0070706_100429185
2185 Ga0070706_100902071
2186 Ga0070679_100023549
2187 Ga0070679_100060545
2188 Ga0070684_100002245
2189 Ga0070684_100477404
2190 Ga0070684_101624976
2191 Ga0068853_100005266
2192 Ga0068853_100016388
2193 Ga0068853_100113450
2194 Ga0068853_100206651
2195 Ga0068853_100995936
2196 Ga0068853_101053730
2197 Ga0070672_100000604
2198 Ga0070672_100302207
2199 Ga0070686_100001137
2200 Ga0070686_100501836
2201 Ga0070695_100015278
2202 Ga0070695_100033553
2203 Ga0070695_100523276
2204 Ga0070696_100025825
2205 Ga0070693_100003447
2206 Ga0070693_100325099
2207 Ga0070693_100853742
2208 Ga0070665_100016911
2209 Ga0070665_100039105
2210 Ga0070665_100144010
2211 Ga0070665_100147393
2212 Ga0070665_100358179
2213 Ga0070665_100389829
2214 Ga0070665_100915099
2215 Ga0070665_101235720
2216 Ga0070704_100095431
2217 Ga0070704_100235903
2218 Ga0068855_100210900
2219 Ga0068855_100336377
2220 Ga0068855_100410392
2221 Ga0068855_100475620
2222 Ga0070664_100000973
2223 Ga0070664_100056175
2224 Ga0070664_100057099
2225 Ga0070664_100140377
2226 Ga0070664_100172624
2227 Ga0070664_100462703
2228 Ga0070664_100727541
2229 Ga0068857_100001725
2230 Ga0068857_100246227
2231 Ga0068857_100514440
2232 Ga0068857_100564208
2233 Ga0068854_100000146
2234 Ga0068854_100534645
2235 Ga0068854_100615705
2236 Ga0068854_100898087
2237 Ga0068856_100006444
2238 Ga0068856_100180269
2239 Ga0068856_100388793
2240 Ga0068856_100763688
2241 Ga0068856_100878241
2242 Ga0070702_100007133
2243 Ga0070702_100017579
2244 Ga0070702_100113284
2245 Ga0070702_100174906
2246 Ga0070702_100443901
2247 Ga0068852_100039916
2248 Ga0068852_101368495
2249 Ga0068852_101673176
2250 Ga0068859_100045772
2251 Ga0068859_100062244
2252 Ga0068859_100134370
2253 Ga0068859_100166832
2254 Ga0068859_100198899
2255 Ga0068859_100439603
2256 Ga0068859_101436570
2257 Ga0068864_100037540
2258 Ga0068864_100038231
2259 Ga0068864_100140415
2260 Ga0068864_100284468
2261 Ga0068864_100386486
2262 Ga0068864_100412915
2263 Ga0068864_100502734
2264 Ga0068864_100603061
2265 Ga0068866_10000294
2266 Ga0068866_10127586
2267 Ga0068866_10308874
2268 Ga0068861_100014932
2269 Ga0068861_100042022
2270 Ga0068861_100109797
2271 Ga0068861_100156090
2272 Ga0068861_100178096
2273 Ga0068861_100311659
2274 Ga0068861_100544652
2275 Ga0068861_100766575
2276 Ga0068861_101363475
2277 Ga0068851_10172632
2278 Ga0068870_10000048
2279 Ga0068870_10110209
2280 Ga0068870_10137670
2281 Ga0068870_10176923
2282 Ga0068863_100000150
2283 Ga0068863_100012006
2284 Ga0068863_101549170
2285 Ga0068858_100103174
2286 Ga0068858_100166793
2287 Ga0068858_100250159
2288 Ga0068858_100250449
2289 Ga0068858_100286593
2290 Ga0068858_100287921
2291 Ga0068858_100566911
2292 Ga0068858_101417126
2293 Ga0068860_100000933
2294 Ga0068860_100035626
2295 Ga0068860_100280044
2296 Ga0068860_100344083
2297 Ga0068860_100401241
2298 Ga0068860_100416850
2299 Ga0068860_101467814
2300 Ga0068862_100002722
2301 Ga0068862_100010439
2302 Ga0068862_100056101
2303 Ga0068862_100150129
2304 Ga0068862_100373183
2305 Ga0068862_100555789
2306 Ga0068862_100698396
2307 Ga0068862_100805599
2308 Ga0081455_10002969
2309 Ga0081455_10010188
2310 Ga0081455_10014255
2311 Ga0081455_10027561
2312 Ga0081455_10059791
2313 Ga0081455_10240805
2314 Ga0081455_10253423
2315 Ga0081538_10024720
2316 Ga0081538_10068179
2317 Ga0081540_1002494
2318 Ga0081540_1002983
2319 Ga0081540_1005752
2320 Ga0081540_1022495
2321 Ga0081540_1026360
2322 Ga0081540_1026466
2323 Ga0081540_1027410
2324 Ga0081540_1055573
2325 Ga0081540_1056611
2326 Ga0081540_1090648
2327 Ga0081540_1224944
2328 Ga0081539_10000203
2329 Ga0081539_10000321
2330 Ga0081539_10003895
2331 Ga0081539_10026056
2332 Ga0081539_10291330
2333 Ga0070717_10018127
2334 Ga0070717_10381577
2335 Ga0075365_10002034
2336 Ga0075365_10012855
2337 Ga0075365_10054532
2338 Ga0075365_10114046
2339 Ga0075365_10258745
2340 Ga0075365_10307823
2341 Ga0075365_10341390
2342 Ga0075365_10396719
2343 Ga0075365_10399621
2344 Ga0075365_10549834
2345 Ga0075365_10627876
2346 Ga0075365_10728507
2347 Ga0075365_11114129
2348 Ga0075368_10001061
2349 Ga0075368_10012683
2350 Ga0075368_10016471
2351 Ga0075368_10028564
2352 Ga0075368_10133971
2353 Ga0075368_10182363
2354 Ga0075368_10223158
2355 Ga0075363_100007066
2356 Ga0075363_100045819
2357 Ga0075363_100055447
2358 Ga0075363_100089786
2359 Ga0075363_100153035
2360 Ga0075363_100361831
2361 Ga0075363_100469892
2362 Ga0075364_10014561
2363 Ga0075364_10065104
2364 Ga0075364_10080118
2365 Ga0075364_10084811
2366 Ga0075364_10118836
2367 Ga0075364_10194133
2368 Ga0075364_10270248
2369 Ga0075364_10274070
2370 Ga0075364_10579876
2371 Ga0075432_10091524
2372 Ga0075432_10151435
2373 Ga0070715_10298612
2374 Ga0070715_10320341
2375 Ga0070712_100072662
2376 Ga0070712_100323546
2377 Ga0075362_10048947
2378 Ga0075362_10140085
2379 Ga0075362_10153764
2380 Ga0075367_10001220
2381 Ga0075367_10003085
2382 Ga0075367_10003450
2383 Ga0075367_10008440
2384 Ga0075367_10015513
2385 Ga0075367_10018382
2386 Ga0075367_10048887
2387 Ga0075367_10069381
2388 Ga0075367_10096732
2389 Ga0075367_10112956
2390 Ga0075367_10127646
2391 Ga0075367_10227664
2392 Ga0075367_10275792
2393 Ga0075367_10464338
2394 Ga0075367_10480852
2395 Ga0075367_10618358
2396 Ga0075367_10665744
2397 Ga0075367_10670497
2398 Ga0075369_10004035
2399 Ga0075369_10165750
2400 Ga0075369_10357673
2401 Ga0075369_10410929
2402 Ga0075427_10004080
2403 Ga0075366_10007463
2404 Ga0075366_10047138
2405 Ga0075366_10048556
2406 Ga0075366_10115750
2407 Ga0075366_10161102
2408 Ga0075366_10248157
2409 Ga0075366_10261880
2410 Ga0075366_10407046
2411 Ga0097621_100000833
2412 Ga0097621_100280418
2413 Ga0097621_101080754
2414 Ga0075370_10044715
2415 Ga0075370_10048966
2416 Ga0075370_10095573
2417 Ga0075370_10106823
2418 Ga0075370_10180931
2419 Ga0075370_10211935
2420 Ga0075370_10291184
2421 Ga0075370_10317423
2422 Ga0075370_10477457
2423 Ga0075370_10791764
2424 Ga0068871_100004168
2425 Ga0068871_100066133
2426 Ga0068871_100151455
2427 Ga0068871_100152017
2428 Ga0068871_100802468
2429 Ga0068871_100992682
2430 Ga0068871_101190115
2431 Ga0068871_101923014
2432 Ga0075428_100067678
2433 Ga0075428_100384516
2434 Ga0075428_100459493
2435 Ga0075428_100798221
2436 Ga0075428_100958111
2437 Ga0075430_100000098
2438 Ga0075430_100046267
2439 Ga0075431_100159431
2440 Ga0075433_10006030
2441 Ga0075433_10172329
2442 Ga0075433_10251381
2443 Ga0075433_10554135
2444 Ga0075433_10567859
2445 Ga0075433_11199784
2446 Ga0075434_100002941
2447 Ga0075434_100068183
2448 Ga0075434_100106965
2449 Ga0075434_100377002
2450 Ga0075429_100049997
2451 Ga0075429_101107709
2452 Ga0068865_100007321
2453 Ga0068865_100094971
2454 Ga0068865_100097564
2455 Ga0068865_100259767
2456 Ga0068865_100277261
2457 Ga0068865_101340546
2458 Ga0075436_100066857
2459 Ga0075436_100324342
2460 Ga0097620_100045773
2461 Ga0097620_100062251
2462 Ga0097620_100134369
2463 Ga0097620_100166833
2464 Ga0097620_100198909
2465 Ga0097620_100439593
2466 Ga0097620_101437140
2467 Ga0075435_100046392
2468 Ga0075435_100131109
2469 Ga0075435_100348888
2470 Ga0075435_100691085
2471 Ga0075435_100807930
2472 Ga0099795_10021664
2473 Ga0105251_10101484
2474 Ga0105251_10321022
2475 Ga0105250_10117287
2476 Ga0105240_10059470
2477 Ga0105240_10128054
2478 Ga0105240_10276011
2479 Ga0105240_10698131
2480 Ga0105240_11724298
2481 Ga0111539_10002792
2482 Ga0111539_10150203
2483 Ga0111539_10163694
2484 Ga0111539_10391695
2485 Ga0111539_10413854
2486 Ga0111539_10667243
2487 Ga0105245_10006527
2488 Ga0105245_10086062
2489 Ga0105245_10156321
2490 Ga0105245_10295133
2491 Ga0105245_10361260
2492 Ga0105245_10499636
2493 Ga0105245_10546557
2494 Ga0105245_12208325
2495 Ga0105247_10000941
2496 Ga0105247_10015657
2497 Ga0105247_10088991
2498 Ga0105247_10200183
2499 Ga0105247_10260252
2500 Ga0105247_10475670
2501 Ga0105247_10672811
2502 Ga0114129_10189869
2503 Ga0114129_11597806
2504 Ga0105243_10047176
2505 Ga0105243_10178871
2506 Ga0105243_10293118
2507 Ga0105243_10827062
2508 Ga0105243_11498605
2509 Ga0105243_11646821
2510 Ga0105241_10000934
2511 Ga0105241_10020160
2512 Ga0105241_10414939
2513 Ga0105241_10417292
2514 Ga0105241_10552583
2515 Ga0105242_10007338
2516 Ga0105242_10028923
2517 Ga0105242_10850727
2518 Ga0105248_10001324
2519 Ga0105248_10006086
2520 Ga0105248_10032830
2521 Ga0105248_11116511
2522 Ga0105237_10050842
2523 Ga0105237_10072044
2524 Ga0105237_10203423
2525 Ga0105237_10321824
2526 Ga0105237_10335010
2527 Ga0105237_10526748
2528 Ga0105237_11056307
2529 Ga0105237_11118668
2530 Ga0105238_10029609
2531 Ga0105238_10036004
2532 Ga0105238_10061360
2533 Ga0105238_10066932
2534 Ga0105238_10561414
2535 Ga0105249_10002759
2536 Ga0105249_10188086
2537 Ga0105249_10290195
2538 Ga0105249_10402120
2539 Ga0105249_10612120
2540 Ga0105249_11367158
2541 Ga0105249_11840743
2542 Ga0099796_10012869
2543 Ga0105239_10022595
2544 Ga0105239_10071375
2545 Ga0105239_10224660
2546 Ga0105239_10268103
2547 Ga0105239_10292401
2548 Ga0105246_10071787
2549 Ga0157346_1002630
2550 Ga0157346_1003899
2551 Ga0157321_1012135
2552 Ga0157345_1018885
2553 Ga0157313_1021192
2554 Ga0157324_1008351
2555 Ga0157315_1001894
2556 Ga0157316_1033829
2557 Ga0157338_1016023
2558 Ga0157373_10072987
2559 Ga0157373_10745140
2560 Ga0157371_10026846
2561 Ga0157371_10565969
2562 Ga0157369_11082685
2563 Ga0157369_11365002
2564 Ga0157374_10005822
2565 Ga0157374_10538546
2566 Ga0157378_10005464
2567 Ga0157378_10008085
2568 Ga0157378_10090355
2569 Ga0157378_10499581
2570 Ga0157378_11163819
2571 Ga0163162_10004345
2572 Ga0163162_10134883
2573 Ga0163162_10137144
2574 Ga0163162_10426285
2575 Ga0163162_10539877
2576 Ga0163162_10634151
2577 Ga0163162_11920326
2578 Ga0157372_11142801
2579 Ga0157372_11628340
2580 Ga0157375_10076850
2581 Ga0157375_10201716
2582 Ga0157375_10338823
2583 Ga0157375_11051494
2584 Ga0157375_11448133
2585 Ga0157375_11567692
2586 Ga0157375_12284855
2587 Ga0163163_10039453
2588 Ga0163163_10044021
2589 Ga0163163_10077677
2590 Ga0163163_10239629
2591 Ga0157380_10204299
2592 Ga0157380_10242343
2593 Ga0157380_11198297
2594 Ga0157380_11302092
2595 Ga0157377_10000101
2596 Ga0157379_10007707
2597 Ga0157379_10084667
2598 Ga0157379_10423054
2599 Ga0157376_10002670
2600 Ga0157376_10029845
2601 Ga0157376_10032468
2602 Ga0157376_10608224
2603 Ga0157376_10622659
2604 Ga0163161_10000081
2605 Ga0163161_10056733
2606 Ga0163161_10166002
2607 Ga0163161_10392479
2608 Ga0163161_10551049
2609 Ga0163161_10662436
2610 Ga0163161_11689587
2611 Ga0206356_10660642
2612 Ga0206356_11815793
2613 Ga0206355_1106855
2614 Ga0206352_11186928
2615 Ga0206352_11331387
2616 Ga0206354_10299253
2617 Ga0206353_11513600
2618 Ga0206353_11541346
2619 Ga0214544_1000007
2620 Ga0214542_1000007
2621 Ga0214545_1000006
2622 Ga0214543_1000009
2623 Ga0213876_10009964
2624 Ga0213876_10053829
2625 Ga0213876_10372522
2626 Ga0209677_113419
2627 Ga0209148_1000216
2628 Ga0209233_1002021
2629 Ga0209233_1025698
2630 Ga0207666_1000044
2631 Ga0209673_1104486
2632 Ga0207673_1000003
2633 Ga0209025_1071514
2634 Ga0209564_1004251
2635 Ga0209564_1011366
2636 Ga0209758_1000015
2637 Ga0209758_1000161
2638 Ga0209758_1000673
2639 Ga0209758_1002075
2640 Ga0209758_1002448
2641 Ga0209758_1012080
2642 Ga0209758_1023831
2643 Ga0209758_1042693
2644 Ga0209758_1074355
2645 Ga0209256_1004892
2646 Ga0207426_1000186
2647 Ga0207426_1001117
2648 Ga0207426_1035943
2649 Ga0207426_1042378
2650 Ga0207426_1066566
2651 Ga0207426_1079892
2652 Ga0209257_1006231
2653 Ga0209257_1027457
2654 Ga0207697_10000051
2655 Ga0207697_10056538
2656 Ga0207697_10057099
2657 Ga0207697_10096525
2658 Ga0207697_10104380
2659 Ga0207697_10161477
2660 Ga0207656_10076858
2661 Ga0207656_10081660
2662 Ga0207656_10184248
2663 Ga0207653_10154477
2664 Ga0207682_10000635
2665 Ga0207682_10008859
2666 Ga0207692_10176663
2667 Ga0207692_10470940
2668 Ga0207642_10001582
2669 Ga0207642_10333818
2670 Ga0207642_10419204
2671 Ga0207710_10010877
2672 Ga0207710_10166140
2673 Ga0207710_10437776
2674 Ga0207688_10000044
2675 Ga0207688_10005732
2676 Ga0207688_10053585
2677 Ga0207688_10082160
2678 Ga0207688_10340689
2679 Ga0207647_10061087
2680 Ga0207647_10078241
2681 Ga0207647_10321964
2682 Ga0207685_10033752
2683 Ga0207699_10012123
2684 Ga0207699_10020625
2685 Ga0207645_10000218
2686 Ga0207645_10075862
2687 Ga0207645_10319509
2688 Ga0207643_10000025
2689 Ga0207643_10549166
2690 Ga0207684_10771678
2691 Ga0207654_10029817
2692 Ga0207654_11156240
2693 Ga0207707_10011373
2694 Ga0207707_10155609
2695 Ga0207695_10000006
2696 Ga0207695_10080582
2697 Ga0207695_10119888
2698 Ga0207695_11272172
2699 Ga0207671_10001982
2700 Ga0207671_10158942
2701 Ga0207671_10524364
2702 Ga0207693_10010496
2703 Ga0207693_10015879
2704 Ga0207663_10033202
2705 Ga0207663_10272366
2706 Ga0207660_10000571
2707 Ga0207660_10336298
2708 Ga0207660_10564179
2709 Ga0207660_10583693
2710 Ga0207662_10000100
2711 Ga0207662_10341885
2712 Ga0207657_10047187
2713 Ga0207657_10410740
2714 Ga0207649_10000310
2715 Ga0207649_10275036
2716 Ga0207649_10857720
2717 Ga0207652_10007174
2718 Ga0207652_10119849
2719 Ga0207652_10129019
2720 Ga0207652_10291722
2721 Ga0207652_11068779
2722 Ga0207681_10000803
2723 Ga0207681_10511753
2724 Ga0207681_10805985
2725 Ga0207694_10059862
2726 Ga0207694_10101904
2727 Ga0207694_10249064
2728 Ga0207694_10335567
2729 Ga0207694_10415933
2730 Ga0207694_10468256
2731 Ga0207694_10540511
2732 Ga0207694_10978094
2733 Ga0207694_11027008
2734 Ga0207650_10003666
2735 Ga0207650_10206270
2736 Ga0207650_10218153
2737 Ga0207650_10248740
2738 Ga0207650_10319427
2739 Ga0207659_10000040
2740 Ga0207659_10187256
2741 Ga0207659_10557734
2742 Ga0207687_10001077
2743 Ga0207687_10006935
2744 Ga0207687_10014335
2745 Ga0207687_10140694
2746 Ga0207687_10175808
2747 Ga0207687_10313425
2748 Ga0207664_10064418
2749 Ga0207644_10006122
2750 Ga0207644_10022811
2751 Ga0207644_10088223
2752 Ga0207644_10091930
2753 Ga0207644_10554719
2754 Ga0207644_10746564
2755 Ga0207690_10000277
2756 Ga0207690_11278473
2757 Ga0207706_10003292
2758 Ga0207706_10097748
2759 Ga0207706_11148682
2760 Ga0207686_10001074
2761 Ga0207686_10248463
2762 Ga0207686_10584770
2763 Ga0207709_10000322
2764 Ga0207709_10105611
2765 Ga0207709_10105755
2766 Ga0207709_10437281
2767 Ga0207709_10481946
2768 Ga0207709_10675270
2769 Ga0207709_10851580
2770 Ga0207670_10000977
2771 Ga0207670_10160713
2772 Ga0207670_10907115
2773 Ga0207670_11363308
2774 Ga0207669_10000347
2775 Ga0207669_10074339
2776 Ga0207669_10502191
2777 Ga0207704_10000624
2778 Ga0207704_10070275
2779 Ga0207704_10497745
2780 Ga0207704_10666247
2781 Ga0207704_10994780
2782 Ga0207665_10163004
2783 Ga0207665_10181315
2784 Ga0207665_10688484
2785 Ga0207691_10000940
2786 Ga0207691_10030759
2787 Ga0207691_10263887
2788 Ga0207691_10941360
2789 Ga0207711_10008494
2790 Ga0207711_10014904
2791 Ga0207711_10069004
2792 Ga0207711_10159351
2793 Ga0207711_10735449
2794 Ga0207711_11685852
2795 Ga0207689_10000134
2796 Ga0207689_10012478
2797 Ga0207689_10070987
2798 Ga0207689_10203859
2799 Ga0207689_10458719
2800 Ga0207661_10000191
2801 Ga0207661_10739141
2802 Ga0207661_11289840
2803 Ga0207679_10000099
2804 Ga0207679_10104906
2805 Ga0207679_10381291
2806 Ga0207679_11736263
2807 Ga0207667_10014048
2808 Ga0207667_10193865
2809 Ga0207667_11053994
2810 Ga0207651_10000202
2811 Ga0207651_10447082
2812 Ga0207651_10507026
2813 Ga0207712_10001297
2814 Ga0207712_10069259
2815 Ga0207712_10177557
2816 Ga0207712_10252414
2817 Ga0207712_10459303
2818 Ga0207712_10582705
2819 Ga0207668_10001518
2820 Ga0207668_10061822
2821 Ga0207668_10143698
2822 Ga0207668_10245340
2823 Ga0207668_10398960
2824 Ga0207668_10868597
2825 Ga0207668_10905252
2826 Ga0207640_10000425
2827 Ga0207640_10485231
2828 Ga0207658_10003433
2829 Ga0207658_10046501
2830 Ga0207658_10388244
2831 Ga0207658_10796329
2832 Ga0207658_11204808
2833 Ga0207658_11476571
2834 Ga0207677_10001828
2835 Ga0207677_10131161
2836 Ga0207677_10180879
2837 Ga0207677_10862499
2838 Ga0207703_10023646
2839 Ga0207703_10029301
2840 Ga0207703_10070683
2841 Ga0207703_10347621
2842 Ga0207703_10438437
2843 Ga0207703_10469501
2844 Ga0207703_11114563
2845 Ga0207639_10001207
2846 Ga0207639_10188768
2847 Ga0207639_10235232
2848 Ga0207639_10261621
2849 Ga0207639_10767624
2850 Ga0207639_11397244
2851 Ga0207678_10000131
2852 Ga0207678_10008113
2853 Ga0207678_10029929
2854 Ga0207678_10101739
2855 Ga0207678_10134798
2856 Ga0207678_10147660
2857 Ga0207678_10503531
2858 Ga0207678_10732173
2859 Ga0207678_10958628
2860 Ga0207708_10000636
2861 Ga0207708_10026762
2862 Ga0207708_10055265
2863 Ga0207708_10060713
2864 Ga0207708_10206507
2865 Ga0207708_10449017
2866 Ga0207702_10025082
2867 Ga0207702_11147209
2868 Ga0207702_11585173
2869 Ga0207641_10000246
2870 Ga0207641_10354573
2871 Ga0207641_10564241
2872 Ga0207641_10760729
2873 Ga0207641_11359593
2874 Ga0207641_11536283
2875 Ga0207648_10000575
2876 Ga0207648_10116363
2877 Ga0207648_10345007
2878 Ga0207648_10521696
2879 Ga0207648_10673599
2880 Ga0207676_10002628
2881 Ga0207676_10142559
2882 Ga0207676_10193762
2883 Ga0207676_10399841
2884 Ga0207676_10628448
2885 Ga0207674_10002439
2886 Ga0207674_10122204
2887 Ga0207674_10133266
2888 Ga0207674_10983070
2889 Ga0207675_100010650
2890 Ga0207675_100035146
2891 Ga0207675_100092985
2892 Ga0207675_100243366
2893 Ga0207675_100259981
2894 Ga0207675_100465188
2895 Ga0207683_10000924
2896 Ga0207683_10090636
2897 Ga0207683_10252827
2898 Ga0207698_10007113
2899 Ga0207698_10594477
2900 Ga0207698_10667086
2901 Ga0207698_10688202
2902 Ga0209179_1018650
2903 Ga0210002_1001348
2904 Ga0209971_1012869
2905 Ga0209966_1012583
2906 Ga0209998_10017998
2907 Ga0209813_10000490
2908 Ga0209813_10008476
2909 Ga0209813_10027912
2910 Ga0209813_10047043
2911 Ga0209813_10175623
2912 Ga0209974_10000697
2913 Ga0207428_10000736
2914 Ga0207428_10006678
2915 Ga0207428_10008679
2916 Ga0207428_10107208
2917 Ga0207428_10126160
2918 Ga0207428_10175285
2919 Ga0207428_10306172
2920 Ga0207428_10477065
2921 Ga0268266_10014179
2922 Ga0268266_10019367
2923 Ga0268266_10025985
2924 Ga0268266_10054473
2925 Ga0268266_10072406
2926 Ga0268266_10077681
2927 Ga0268266_10269324
2928 Ga0268266_10474061
2929 Ga0268266_10537046
2930 Ga0268266_11085613
2931 Ga0268265_10001326
2932 Ga0268265_10009601
2933 Ga0268265_10040339
2934 Ga0268265_10142172
2935 Ga0268265_10222528
2936 Ga0268265_10262065
2937 Ga0268264_10001756
2938 Ga0268264_10034447
2939 Ga0268264_10131983
2940 Ga0268264_10154975
2941 Ga0268264_10283264
2942 Ga0268264_10403935
2943 Ga0307517_10000196
2944 Ga0265325_10000093
2945 Ga0265340_10322352
2946 Ga0265339_10195243
2947 Ga0307513_10284984
2948 Ga0307408_100508604
2949 Ga0307408_100557204
2950 Ga0265313_10020348
2951 Ga0307508_10627252
2952 Ga0265314_10185611
2953 Ga0316576_10026863
2954 Ga0316578_10116809
2955 Ga0307516_10008223
2956 Ga0307518_10283826
2957 Ga0307411_11028220
2958 Ga0307411_11056644
2959 Ga0307415_100500006
2960 Ga0307415_101178473
2961 Ga0307510_10002425
2962 Ga0307510_10032373
2963 Ga0307510_10048768
2964 Ga0307510_10265943
2965 Ga0315911_1000010
2966 Ga0373930_0000310
2967 Ga0373930_0077315
2968 Ga0373948_0000143
2969 Ga0373948_0002604
2970 Ga0373948_0005132
2971 Ga0373950_0002414
2972 Ga0373950_0004460
2973 Ga0373950_0008207
2974 Ga0373950_0054076
2975 Ga0373958_0000094
2976 Ga0373958_0032118
2977 Ga0373959_0000480
2978 Ga0373959_0008536
2979 Ga0373959_0019251
2980 Ga0373938_0000062
2981 Ga0373938_0002468
2982 Ga0373938_0028577
2983 Ga0373926_0025341
2984 Ga0373928_0002159
2985 Ga0373928_0012024
2986 Ga0373928_0059516
2987 Ga0373929_0030253
2988 Ga0373929_0063476
2989 Ga0373934_0282246
2990 Ga0373940_0000026
2991 Ga0373940_0095757
2992 Ga0373944_0008413
2993 Ga0373949_0001255
2994 Ga0373949_0008899
2995 Ga0373949_0014907
2996 Ga0373949_0025364
2997 Ga0373952_0000280
2998 Ga0373923_0096874
2999 Ga0373923_0239858
3000 Ga0373932_0002978
3001 Ga0373932_0092020
3002 Ga0373936_0052375
3003 Ga0373939_0000468
3004 Ga0373939_0041947
3005 Ga0373939_0193391
3006 Ga0373941_0001191
3007 Ga0373941_0021986
3008 Ga0373941_0023394
3009 Ga0373941_0028036
3010 Ga0373941_0229881
3011 Ga0373945_0007963
3012 Ga0373945_0035417
3013 Ga0373954_0264244
3014 Ga0373956_0057351
3015 Ga0373956_0306700
3016 Ga0373957_0059228
3017 Ga0373960_0000582
3018 Ga0373960_0018808
3019 Ga0373943_0044438
3020 Ga0373943_0181300
3021 Ga0373946_0071299
3022 Ga0373946_0199101
3023 Ga0373955_0021994
3024 Ga0373942_0004957
3025 Ga0373942_0011407
3026 Ga0373942_0012396
3027 Ga0373942_0013572
3028 Ga0373961_0001833
3029 Ga0373961_0022358
3030 Ga0373961_0029404
3031 Ga0373961_0040899
3032 Ga0373961_0042962
3033 Ga0373961_0084723
3034 Ga0373962_0000098
3035 Ga0373962_0014820
3036 Ga0373931_0000485
3037 Ga0373931_0003732
3038 Ga0373931_0010001
3039 Ga0373931_0012449
3040 Ga0373931_0038137
3041 Ga0373931_0060263
3042 Ga0373931_0089332
3043 Ga0373931_0104989
3044 Ga0373935_0645005
3045 Ga0373927_0009048
3046 Ga0373933_0284939
3047 Ga0373947_0015277
3048 Ga0373947_0159844
3049 Ga0373947_0222738
3050 Ga0373937_0470503
3051 Ga0373937_0792702
3052 Ga0316582_0145692
3053 Ga0316584_0117216
3054 Ga0373925_0019255
3055 Ga0373925_0202555
3056 Ga0373925_0204186
3057 Ga0373925_0290947
3058 Ga0373925_0556358
3059 Ga0395898_0163106
3060 Ga0395901_0998308
3061 Ga0242419_007905
3062 Ga0436365_0179636
3063 Ga0436365_0551956
3064 Ga0436365_0944383
3065 Ga0436365_1622770
3066 Ga0436365_1790648
3067 Ga0436365_1937502
3068 Ga0436363_0708994
3069 Ga0439466_0106224
3070 Ga0439465_0068754
3071 Ga0451791_0845876
3072 Ga0451797_0237554
3073 Ga0451798_0281194
3074 Ga0451800_0166776
3075 Ga0451804_0754880
3076 Ga0451807_1297891
3077 Ga0451833_1136472
3078 Ga0451833_1294098
3079 Ga0451837_1850040
3080 Ga0451841_1424648
3081 Ga0451847_0636466
3082 Ga0451843_1204696
3083 Ga0451853_1125928
3084 Ga0439443_003250
3085 Ga0439445_0164141
3086 Ga0439444_0086772
3087 Ga0439460_0037607
3088 Ga0439440_0244055
3089 Ga0466965_0020139
3090 Ga0466961_0142027
3091 Ga0453684_0279370
3092 Ga0466957_0191723
3093 Ga0466960_0061702
3094 Ga0466959_0189997
3095 Ga0451576_0033253
3096 Ga0451576_1874224
3097 Ga0466967_0160056
3098 Ga0466967_0227400
3099 Ga0466967_0331189
3100 Ga0495617_060727
3101 Ga0495592_0094228
3102 Ga0495592_0220593
3103 Ga0495592_0385222
3104 Ga0495592_0515012
3105 Ga0495603_0000910
3106 Ga0495603_0017908
3107 Ga0495603_0042817
3108 Ga0495603_0054971
3109 Ga0495603_0086345
3110 Ga0495603_0151582
3111 Ga0495603_0301343
3112 Ga0495590_0039618
3113 Ga0495590_0224117
3114 Ga0495629_0000140
3115 Ga0495629_0025564
3116 Ga0495629_0076208
3117 Ga0495629_0272067
3118 Ga0495629_0319703
3119 Ga0495638_0033982
3120 Ga0495638_0052555
3121 Ga0495638_0067400
3122 Ga0495641_0016374
3123 Ga0495641_0050932
3124 Ga0495641_0094383
3125 Ga0495651_0036917
3126 Ga0495651_0046874
3127 Ga0495653_0241913
3128 Ga0495653_0282796
3129 Ga0495650_0125452
3130 Ga0495580_0124325
3131 Ga0495582_0003505
3132 Ga0495582_0125937
3133 Ga0495582_0319317
3134 Ga0495605_0032566
3135 Ga0495605_0078279
3136 Ga0495639_0173087
3137 Ga0495639_0447225
3138 Ga0495662_0169834
3139 Ga0495664_0007559
3140 Ga0495664_0313478
3141 Ga0495584_0161470
3142 Ga0495585_0123693
3143 Ga0495594_0010624
3144 Ga0495594_0112090
3145 Ga0495594_0137249
3146 Ga0495594_0179040
3147 Ga0495583_0114888
3148 Ga0495606_0000960
3149 Ga0495606_0016521
3150 Ga0495606_0033258
3151 Ga0495606_0151924
3152 Ga0495608_0090604
3153 Ga0495608_0266008
3154 Ga0495610_0062597
3155 Ga0495610_0127814
3156 Ga0495610_0225418
3157 Ga0495616_0046563
3158 Ga0495618_0142476
3159 Ga0495618_0153118
3160 Ga0495620_0182180
3161 Ga0495628_0101678
3162 Ga0495628_0439034
3163 Ga0495630_0191270
3164 Ga0495630_0260692
3165 Ga0495630_0402517
3166 Ga0495630_0854204
3167 Ga0495631_0117600
3168 Ga0495631_0142965
3169 Ga0495631_0221113
3170 Ga0495632_0250929
3171 Ga0495637_0055949
3172 Ga0495643_0092691
3173 Ga0495643_0426775
3174 Ga0495644_0068316
3175 Ga0495644_0274135
3176 Ga0495648_0022672
3177 Ga0495648_0098121
3178 Ga0495648_0163388
3179 Ga0495663_0158924
3180 Ga0495666_0482469
3181 Ga0495642_0022177
3182 Ga0495642_0090339
3183 Ga0495652_0029695
3184 Ga0495652_0036238
3185 Ga0495652_0074957
3186 Ga0495652_0146080
3187 Ga0495652_0184247
3188 Ga0495652_0443573
3189 Ga0495654_0155496
3190 Ga0495665_0100931
3191 Ga0495640_0035696
3192 Ga0495640_0128132
3193 Ga0495640_0288858
3194 Ga0495598_0011170
3195 Ga0495598_0242830
3196 Ga0495609_0024193
3197 Ga0495609_0198799
3198 Ga0495609_0200169
3199 Ga0495609_0395521
3200 Ga0495597_0181469
3201 Ga0495645_0050560
3202 Ga0495645_0127489
3203 Ga0495622_0004725
3204 Ga0495622_0120611
3205 Ga0495622_0152895
3206 Ga0495633_0060297
3207 Ga0495633_0101482
3208 Ga0495667_0054041
3209 Ga0495667_0107194
3210 Ga0495667_0166308
3211 Ga0495656_0065851
3212 Ga0495656_0092303
3213 Ga0495668_0016971
3214 Ga0495668_0465287
3215 Ga0495634_0000688
3216 Ga0495634_0258731
3217 Ga0495611_0209056
3218 Ga0495625_0409110
3219 Ga0495635_0063800
3220 Ga0495635_0295523
3221 Ga0495635_0374210
3222 Ga0495659_0051339
3223 Ga0495659_0391805
3224 Ga0495659_0479766
3225 Ga0495661_0075070
3226 Ga0495588_0001834
3227 Ga0495588_0037671
3228 Ga0495588_0090031
3229 Ga0495657_0005774
3230 Ga0495657_0082524
3231 Ga0495599_0084122
3232 Ga0495599_0723025
3233 Ga0495623_0119142
3234 Ga0495623_0230115
3235 Ga0495646_0240436
3236 Ga0495646_0274953
3237 Ga0495647_0000251
3238 Ga0495647_0115285
3239 Ga0495658_0003282
3240 Ga0495658_0083256
3241 Ga0495658_0116970
3242 Ga0495669_0006299
3243 Ga0495669_0015509
3244 Ga0495669_0096131
3245 Ga0495669_0263515
3246 Ga0495613_0104852
3247 Ga0495613_0281358
3248 Ga0495613_0647483
3249 Ga0495624_0017541
3250 Ga0495624_0148426
3251 Ga0495624_0324955
3252 Ga0495670_0046475
3253 Ga0495670_0166899
3254 Ga0495670_0199946
3255 Ga0495671_0037821
3256 Ga0495671_0108253
3257 Ga0495649_0013333
3258 Ga0495649_0070384
3259 Ga0495649_0133534
3260 Ga0495649_0171713
3261 Ga0495589_0084915
3262 Ga0495589_0352298
3263 Ga0495600_0048324
3264 Ga0495600_0132503
3265 Ga0495581_0043625
3266 Ga0495581_0100427
3267 Ga0495581_0149116
3268 Ga0495604_0069897
3269 Ga0495604_0161354
3270 Ga0495604_0300888
3271 Ga0495636_0100334
3272 Ga0495636_0147373
3273 Ga0495674_0015532
3274 Ga0495674_0136829
3275 Ga0495672_0276444
3276 Ga0495676_0001862
3277 Ga0495676_0021500
3278 Ga0495676_0125102
3279 Ga0495676_0251141
3280 Ga0495680_0004754
3281 Ga0495680_0057462
3282 Ga0495675_0012857
3283 Ga0495677_0252773
3284 Ga0495679_053775
3285 Ga0495685_080584
3286 Ga0495673_0169721
3287 Ga0495673_0234848
3288 Ga0495681_0090177
3289 Ga0495681_0158790
3290 Ga0495684_0186313
3291 Ga0495684_0571495
3292 Ga0495686_0166411
3293 Ga0495686_0307791
3294 Ga0495593_0106163
3295 Ga0495593_0166596
3296 Ga0495602_0079779
3297 Ga0495602_0115533
3298 Ga0495614_0040857
3299 Ga0495614_0110492
3300 Ga0495615_0106359
3301 Ga0495626_0180262
3302 Ga0496100_0000599
3303 Ga0496100_0003516
3304 Ga0496100_0010507
3305 Ga0496100_0020746
3306 Ga0496100_0033180
3307 Ga0496100_0096457
3308 Ga0496100_0133812
3309 Ga0496100_0141458
3310 Ga0496100_0149585
3311 Ga0496100_0375281
3312 Ga0496101_0000494
3313 Ga0496101_0000882
3314 Ga0496101_0028533
3315 Ga0496101_0091539
3316 Ga0496101_0171148
3317 Ga0496101_0228351
3318 Ga0496101_0245129
3319 Ga0496101_0351995
3320 Ga0496101_0395568
3321 Ga0496102_0002665
3322 Ga0496102_0007445
3323 Ga0496102_0070843
3324 Ga0496102_0081575
3325 Ga0496102_0091601
3326 Ga0496102_0187541
3327 Ga0496102_0228939
3328 Ga0496102_0243350
3329 Ga0496102_0318127
3330 Ga0496102_0373709
3331 Ga0496102_0457829
3332 Ga0496102_0625876
3333 Ga0496102_0826751
3334 Ga0496102_0855861
3335 Ga0496102_0861082
3336 Ga0496103_0001970
3337 Ga0496103_0010594
3338 Ga0496103_0023399
3339 Ga0496103_0108631
3340 Ga0496104_0001062
3341 Ga0496104_0023052
3342 Ga0496104_0030647
3343 Ga0496104_0030818
3344 Ga0496104_0051274
3345 Ga0496104_0054245
3346 Ga0496104_0070306
3347 Ga0496104_0088889
3348 Ga0496104_0099613
3349 Ga0496104_0176689
3350 Ga0496104_0187434
3351 Ga0496104_0207136
3352 Ga0496104_0283097
3353 Ga0496104_0384316
3354 Ga0496104_0401942
3355 Ga0496104_0404927
3356 Ga0496104_0493064
3357 Ga0496104_0550909
3358 Ga0496104_0584201
3359 Ga0496105_0006722
3360 Ga0496105_0006801
3361 Ga0496105_0007492
3362 Ga0496105_0009543
3363 Ga0496105_0046046
3364 Ga0496105_0067422
3365 Ga0496105_0069725
3366 Ga0496105_0071980
3367 Ga0496105_0115567
3368 Ga0496105_0138398
3369 Ga0496105_0140288
3370 Ga0496106_0001843
3371 Ga0496106_0013006
3372 Ga0496106_0028971
3373 Ga0496106_0049359
3374 Ga0496106_0054737
3375 Ga0496106_0222879
3376 Ga0496106_0275849
3377 Ga0496106_0624070
3378 Ga0496106_0875352
3379 Ga0496107_0001078
3380 Ga0496107_0013019
3381 Ga0496107_0017527
3382 Ga0496107_0017988
3383 Ga0496107_0024048
3384 Ga0496107_0114119
3385 Ga0496107_0192282
3386 Ga0496107_0271825
3387 Ga0496107_0378173
3388 Ga0496107_0616153
3389 Ga0496107_0836771
3390 Ga0496107_1125675
3391 Ga0496108_0004012
3392 Ga0496108_0020315
3393 Ga0496108_0042428
3394 Ga0496108_0045424
3395 Ga0496108_0060178
3396 Ga0496108_0078574
3397 Ga0496108_0090838
3398 Ga0496108_0135406
3399 Ga0496108_0151344
3400 Ga0496108_0366044
3401 Ga0496108_0857289
3402 Ga0496109_0000150
3403 Ga0496109_0017855
3404 Ga0496109_0030984
3405 Ga0496109_0039278
3406 Ga0496109_0078635
3407 Ga0496109_0175799
3408 Ga0496109_0207238
3409 Ga0496109_0235616
3410 Ga0496109_0404183
3411 Ga0496109_0966341
3412 Ga0496109_1180074
3413 Ga0496110_0009133
3414 Ga0496110_0011482
3415 Ga0496110_0020210
3416 Ga0496110_0022984
3417 Ga0496110_0032705
3418 Ga0496110_0076237
3419 Ga0496110_0126764
3420 Ga0496110_0202011
3421 Ga0496110_0214281
3422 Ga0496110_0250375
3423 Ga0496110_0375841
3424 Ga0496110_0529785
3425 Ga0496110_0956184
3426 Ga0496111_0005375
3427 Ga0496111_0055969
3428 Ga0496111_0056765
3429 Ga0496111_0059964
3430 Ga0496111_0090813
3431 Ga0496111_0091071
3432 Ga0496111_0101558
3433 Ga0496111_0323814
3434 Ga0496111_0634278
3435 Ga0496112_0000037
3436 Ga0496112_0009699
3437 Ga0496112_0040986
3438 Ga0496112_0045028
3439 Ga0496112_0048717
3440 Ga0496112_0071611
3441 Ga0496112_0125186
3442 Ga0496112_0135551
3443 Ga0496112_0138604
3444 Ga0496112_0414338
3445 Ga0496112_0567043
3446 Ga0496112_0990894
3447 Ga0496112_1588012
3448 Ga0496113_0002225
3449 Ga0496113_0005206
3450 Ga0496113_0017982
3451 Ga0496113_0041206
3452 Ga0496113_0072400
3453 Ga0496113_0095908
3454 Ga0496113_0118922
3455 Ga0496113_0140772
3456 Ga0496113_0176976
3457 Ga0496113_0368732
3458 Ga0496113_0721926
3459 Ga0496114_0003461
3460 Ga0496114_0009746
3461 Ga0496114_0016489
3462 Ga0496114_0035339
3463 Ga0496114_0036682
3464 Ga0496114_0059833
3465 Ga0496114_0095686
3466 Ga0496114_0145154
3467 Ga0496114_0161707
3468 Ga0496114_0389454
3469 Ga0496114_0500845
3470 Ga0496114_1117335
3471 Ga0496115_0000999
3472 Ga0496115_0006582
3473 Ga0496115_0029316
3474 Ga0496115_0031361
3475 Ga0496115_0035947
3476 Ga0496115_0039629
3477 Ga0496115_0120132
3478 Ga0496115_0199612
3479 Ga0496115_0252539
3480 Ga0496115_0482887
3481 Ga0496116_0035471
3482 Ga0496117_0334738
3483 Ga0496118_0046643
3484 Ga0496118_0174154
3485 Ga0496118_0448869
3486 Ga0496119_0015279
3487 Ga0496119_0142928
3488 Ga0496119_0287856
3489 Ga0496120_0015837
3490 Ga0496120_0131305
3491 Ga0496121_0005976
3492 Ga0496121_0015099
3493 Ga0496121_0021977
3494 Ga0496121_0024040
3495 Ga0496121_0045061
3496 Ga0496121_0054526
3497 Ga0496121_0056132
3498 Ga0496121_0061352
3499 Ga0496121_0135456
3500 Ga0496121_0238636
3501 Ga0496121_0332334
3502 Ga0496122_0051914
3503 Ga0496122_0087737
3504 Ga0496123_0152762
3505 Ga0496123_0326685
3506 Ga0496124_0070789
3507 Ga0496124_0098519
3508 Ga0496124_0295825
3509 Ga0496124_0366054
3510 Ga0496125_0000063
3511 Ga0496125_0090927
3512 Ga0496125_0414945
3513 Ga0496126_0017319
3514 Ga0496126_0024357
3515 Ga0496126_0024459
3516 Ga0496126_0066169
3517 Ga0496126_0070236
3518 Ga0496126_0076504
3519 Ga0496126_0189176
3520 Ga0496126_0503236
3521 Ga0496126_0642658
3522 Ga0501031_0001347
3523 Ga0501032_0053609
3524 Ga0501033_0011898
3525 Ga0501034_0033206
3526 Ga0501036_0007122
3527 Ga0501036_0350970
3528 Ga0501036_0687753
3529 Ga0501037_0002074
3530 Ga0501038_0003729
3531 Ga0501038_0143547
3532 Ga0501038_0723692
3533 Ga0501039_0074719
3534 Ga0501039_0758491
3535 Ga0501042_0533448
3536 Ga0501043_0541973
3537 Ga0501047_0015275
3538 Ga0501047_0089005
3539 Ga0501047_1037416
3540 Ga0501048_0196772
3541 Ga0501067_0027802
3542 Ga0501070_0003904
3543 Ga0501070_0144497
3544 Ga0501071_0221286
3545 Ga0501071_0614767
3546 Ga0501072_0005303
3547 Ga0501073_0106285
3548 Ga0501073_0177869
3549 Ga0501074_0213555
3550 Ga0501075_0850938
3551 Ga0501076_0166672
3552 Ga0501076_0333947
3553 Ga0501076_0409764
3554 Ga0501080_0310862
3555 Ga0501083_0021564
3556 Ga0501083_0183169
3557 Ga0501083_0599512
3558 Ga0501083_0784239
3559 Ga0501083_0969339
3560 Ga0501044_0010897
3561 Ga0501044_0239002
3562 Ga0501044_1224921
3563 nmdc:mga03683_111030_c1
3564 nmdc:mga03683_165622_c1
3565 nmdc:mga03683_260458_c1
3566 nmdc:mga03683_339272_c1
3567 nmdc:mga03683_34314_c1
3568 nmdc:mga03683_610247_c1
3569 nmdc:mga03n38_100456_c1
3570 nmdc:mga03n38_108421_c1
3571 nmdc:mga03n38_111620_c1
3572 nmdc:mga03n38_157279_c1
3573 nmdc:mga03n38_182594_c1
3574 nmdc:mga03n38_23581_c1
3575 nmdc:mga03n38_339702_c1
3576 nmdc:mga03n38_516794_c1
3577 nmdc:mga03n38_69082_c1
3578 nmdc:mga00v17_150032_c1
3579 nmdc:mga00v17_167313_c1
3580 nmdc:mga00v17_50359_c1
3581 nmdc:mga00v17_56718_c1
3582 nmdc:mga00v17_595223_c1
3583 nmdc:mga0yw44_105347_c1
3584 nmdc:mga0yw44_124003_c1
3585 nmdc:mga0yw44_146819_c1
3586 nmdc:mga0yw44_17072_c1
3587 nmdc:mga0yw44_173941_c1
3588 nmdc:mga0yw44_22173_c1
3589 nmdc:mga0yw44_230359_c1
3590 nmdc:mga0yw44_287153_c1
3591 nmdc:mga0yw44_366876_c1
3592 nmdc:mga0yw44_6362_c1
3593 nmdc:mga0yw44_723491_c1
3594 nmdc:mga0yw44_897761_c1
3595 nmdc:mga0yw44_973524_c1
3596 nmdc:mga0k408_2401_c1
3597 nmdc:mga0k408_300630_c1
3598 nmdc:mga0k408_491424_c1
3599 nmdc:mga0k408_50813_c1
3600 nmdc:mga06z11_119686_c1
3601 nmdc:mga06z11_1670_c1
3602 nmdc:mga06z11_197559_c1
3603 nmdc:mga06z11_22402_c1
3604 nmdc:mga06z11_228572_c1
3605 nmdc:mga06z11_243594_c1
3606 nmdc:mga06z11_245351_c1
3607 nmdc:mga06z11_282264_c1
3608 nmdc:mga06z11_319671_c1
3609 nmdc:mga06z11_3575_c1
3610 nmdc:mga06z11_526629_c1
3611 nmdc:mga06z11_58571_c1
3612 nmdc:mga06z11_602447_c1
3613 nmdc:mga06z11_63118_c1
3614 nmdc:mga04h51_16475_c1
3615 nmdc:mga04h51_194208_c1
3616 nmdc:mga04h51_203393_c1
3617 nmdc:mga07m45_182155_c1
3618 nmdc:mga07m45_192304_c1
3619 nmdc:mga07m45_219378_c1
3620 nmdc:mga07m45_230392_c1
3621 nmdc:mga07m45_264820_c1
3622 nmdc:mga07m45_289565_c1
3623 nmdc:mga05p37_19935_c1
3624 nmdc:mga09592_38018_c1
3625 nmdc:mga0qj67_41_c1
3626 nmdc:mga0qj67_6284_c1
3627 nmdc:mga0qj67_72919_c1
3628 nmdc:mga06r32_363318_c1
3629 nmdc:mga06r32_52230_c1
3630 nmdc:mga08y16_1035_c1
3631 nmdc:mga08y16_175085_c1
3632 nmdc:mga08y16_185069_c1
3633 nmdc:mga08y16_373034_c1
3634 nmdc:mga08y16_403931_c1
3635 nmdc:mga08y16_56355_c1
3636 nmdc:mga08y16_5774_c1
3637 nmdc:mga08y16_61526_c1
3638 nmdc:mga0n895_174078_c1
3639 nmdc:mga0n895_5998_c1
3640 nmdc:mga0n895_688260_c1
3641 nmdc:mga0n895_732684_c1
3642 nmdc:mga0rr50_1280834_c1
3643 nmdc:mga0rr50_557582_c1
3644 nmdc:mga0rr50_837402_c1
3645 nmdc:mga08x19_116428_c1
3646 nmdc:mga08x19_174592_c1
3647 nmdc:mga0a205_154956_c1
3648 nmdc:mga0a205_2866_c1
3649 nmdc:mga0a205_6029_c1
3650 nmdc:mga0sz30_145630_c1
3651 nmdc:mga0sz30_38629_c1
3652 nmdc:mga0sz30_71058_c1
3653 Ga0495601_0007494
3654 Ga0495612_0001901
3655 Ga0495612_0330969
3656 Ga0500610_0016776
3657 Ga0500610_0130548
3658 Ga0500635_0019581
3659 Ga0495655_0107820
3660 Ga0495655_0216272
3661 Ga0495595_0212634
3662 Ga0495619_0001142
3663 Ga0495619_0001642
3664 Ga0495619_0254033
3665 Ga0495619_0340709
3666 Ga0495619_0464194
3667 Ga0500578_0010313
3668 Ga0500578_0173493
3669 Ga0500578_0462561
3670 Ga0500643_000210
3671 Ga0500643_011021
3672 Ga0500643_038610
3673 Ga0500643_071035
3674 Ga0500644_0000769
3675 Ga0500647_0049964
3676 Ga0500651_0000936
3677 Ga0500651_0256182
3678 Ga0500651_0637071
3679 Ga0500566_0000120
3680 Ga0500566_0008320
3681 Ga0500566_0071322
3682 Ga0500640_071955
3683 Ga0500641_0008369
3684 Ga0500641_0018167
3685 Ga0500641_0074804
3686 Ga0500654_163350
3687 Ga0500554_005119
3688 Ga0500554_085852
3689 Ga0500555_002453
3690 Ga0500555_046994
3691 Ga0500556_0023928
3692 Ga0500556_0102404
3693 Ga0500557_000034
3694 Ga0500558_278384
3695 Ga0500569_146876
3696 Ga0500594_0301085
3697 Ga0500595_000056
3698 Ga0500595_005054
3699 Ga0500595_022005
3700 Ga0500595_061630
3701 Ga0500614_064059
3702 Ga0500626_161670
3703 Ga0500642_0000053
3704 Ga0500642_0083917
3705 Ga0500652_000030
3706 Ga0500652_052504
3707 Ga0500652_264844
3708 Ga0500658_0014766
3709 Ga0500658_0025149
3710 Ga0500658_0192501
3711 Ga0500559_0056547
3712 Ga0500559_0193815
3713 Ga0500568_0012017
3714 Ga0500568_0037016
3715 Ga0500568_0076237
3716 Ga0500577_0001802
3717 Ga0500577_0009470
3718 Ga0500577_0020678
3719 Ga0500588_0158454
3720 Ga0500588_0199052
3721 Ga0500588_0245673
3722 Ga0500603_002845
3723 Ga0500604_0186595
3724 Ga0500616_0000006
3725 Ga0500616_0000045
3726 Ga0500616_0028356
3727 Ga0500616_0097266
3728 Ga0500620_000534
3729 Ga0500622_0077360
3730 Ga0500622_0287029
3731 Ga0500633_0286051
3732 Ga0500634_0192534
3733 Ga0500638_010829
3734 Ga0500638_087755
3735 Ga0500639_100769
3736 Ga0500639_294217
3737 Ga0500636_0000033
3738 Ga0500636_0099701
3739 Ga0500636_0218495
3740 Ga0500637_0000132
3741 Ga0500637_0001768
3742 Ga0500611_040313
3743 Ga0500625_103690
3744 Ga0500645_014280
3745 Ga0500645_038055
3746 Ga0500609_009849
3747 Ga0500601_000010
3748 Ga0501084_0606737
3749 Ga0500661_000757
3750 Ga0500661_003493
3751 Ga0587088_115797
3752 Ga0501082_0000038
3753 Ga0501082_0252857
3754 Ga0501082_0997005
3755 2507504579
3756 2508546007
3757 2508694855
3758 2511401284
3759 2513626555
3760 2513649358
3761 2513699376
3762 2513861076
3763 2513875557
3764 2514011053
3765 2515624213
3766 2517102920
3767 2524534525
3768 2528854454
3769 2617347597
3770 2617376992
3771 2739244915
3772 2793063578
3773 2793076876
3774 2805921088
3775 2818237038
3776 2824606350
3777 2824612087
3778 2824619214
3779 2824628137
3780 2824636901
3781 2824645715
3782 2824658474
3783 2824668045
3784 2824676757
3785 2824683252
3786 2824694037
3787 2824701603
3788 2824710301
3789 2824715894
3790 2824725364
3791 2824736872
3792 2824747599
3793 2824760905
3794 2824767670
3795 2824777061
3796 2838129189
3797 2841944183
3798 2841954642
3799 2841968965
3800 2841979739
3801 2841989665
3802 2842044181
3803 2842051830
3804 2847941477
3805 2849082393
3806 2857516527
3807 2874595501
3808 2874629460
3809 2874647046
3810 2876775695
3811 2876823687
3812 2879079786
3813 2879103082
3814 2879131135
3815 2879150341
3816 2881369799
3817 2885368271
3818 2888380254
3819 2888388366
3820 2888427153
3821 2889040316
3822 2904691453
3823 2904705912
3824 2904719979
3825 2908761739
3826 2908782898
3827 2922369824
3828 2922398751
3829 2929622817
3830 2929632079
3831 2932789862
3832 2932796186
3833 2932807760
3834 2932815419
3835 2932825142
3836 2932829310
3837 2933584551
3838 2935614223
3839 2935617743
3840 2935643788
3841 2935651410
3842 2935659822
3843 2935670902
3844 2935681522
3845 2935692522
3846 2935699263
3847 2935710070
3848 2935721140
3849 2935730867
3850 2935739829
3851 2935748867
3852 2935758737
3853 2935767800
3854 2935775591
3855 2935790119
3856 2935798554
3857 2935806766
3858 2935817929
3859 2935826474
3860 2935834473
3861 2935843802
3862 2935851331
3863 2935856758
3864 2935868237
3865 2935879595
3866 2935887468
3867 2935913295
3868 2935922699
3869 2935930780
3870 2935939886
3871 2935946835
3872 2935955964
3873 2935966264
3874 2935972757
3875 2935982547
3876 2935984512
3877 2935997101
3878 2936009787
3879 2936014238
3880 2936022853
3881 2936030990
3882 2936044673
3883 2936049111
3884 2936055556
3885 2940564673
3886 2941534852
3887 2941545050
3888 3005490383
3889 3005509812
3890 3005591216
3891 3005595725
3892 3005711697
3893 3005718957
3894 8006933355
3895 8006933652
3896 8006983324
3897 8006985655
3898 8016518939
3899 8016525529
3900 8016539122
3901 8016543409
3902 8016558299
3903 8016568812
3904 8016581456
3905 8016587201
3906 8016596296
3907 8016630481
3908 8016636601
3909 8017057752
3910 8019538790
3911 8019549427
3912 8019578029
3913 8019596086
3914 8019605630
3915 8019612904
3916 8019638567
3917 8019641178
3918 8019653309
3919 8019676030
3920 8019680115
3921 8019693407
3922 8055750720
3923 8056690103
3924 8056970554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.7903 65 162
6hif-assembly1.cif.gz_Y kuenenia stuttgartiensis hydrazine dehydrogenase complex 0.7763 61 160
5vxt-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria 0.7446 48 162
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.7365 62 145
2azq-assembly1.cif.gz_A-2 crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 0.7272 48 162
ID Description Score Start End Superfamily
af_I1N4R4_32_125_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7984 77 116 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.787 65 162 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7801 65 161 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7672 65 162 2.60.40.1120
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7602 65 161 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A2E2JFS8-F1-model_v4 Twin-arginine translocation pathway signal 0.8817 41 162 GO:0005506
GO:0016702
AF-A0A1G8WCE0-F1-model_v4 Uncharacterized protein 0.8816 65 162 GO:0005506
GO:0016702
AF-A0A7S7QT54-F1-model_v4 Twin-arginine translocation pathway signal 0.8789 26 162 GO:0005506
GO:0016702
AF-A0A2E2JFS8-F1-model_v4 Twin-arginine translocation pathway signal 0.875 41 162 GO:0005506
GO:0016702
AF-A0A1G8WCE0-F1-model_v4 Uncharacterized protein 0.8732 65 162 GO:0005506
GO:0016702

Map