F496170

General Info

Members Datasets Scaffolds Average Seq Length
1968 727 1760 286

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100181346|Ga0070675_1001813462
Length 320
Sequence MLYLIEQCLNGIQLGMLLFLLAAGLTLIFGIMDLVNLAHGSLYMIGAYFAATFAVVTGSFVLGAILALLATLVVGMALEVIAIRRLYGRDHLDHVLGTFGLLLFFNELVRLIWGPGGLTLPLPSQMLTAVQVLPGVYYPAFRLVIIIATLYVLVMRTRVGMLIRAGASNREMVGALGVNIKLLYTLVFGLGAALAGFAGLMQAPILTVQIGMGENILILAFVVIIIGGIGSIRGAFVAAFLPDLVRHFVSYSAGSSLGPSLSSMMIYMLMAAVLVFRPEGLFPASSKWWRSSPRVMCWWQHCWCCSRCCRSIAPSPATTS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
23 2643221621 Achromobacter sp. Root83 Isolate Unclassified
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
26 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
27 2791355199
28 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
29 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
30 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
31 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
32 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
33 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
34 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
35 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
36 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
37 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
38 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
39 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
44 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
45 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
46 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
47 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
48 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
49 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
50 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
51 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
52 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
53 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
54 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
55 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
56 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
57 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
58 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
59 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
66 2858950400 Achromobacter sp. K91 Isolate Unclassified
67 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
68 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
87 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
88 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
89 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
90 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
91 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
92 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
93 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
94 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
95 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
96 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
97 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
98 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
99 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
100 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
101 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
102 2922368715
103 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
104 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
105 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
106 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
107 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
108 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
109 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
110 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
111 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
112 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
113 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
114 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
115 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
116 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
117 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
118 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
119 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
120 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
121 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
122 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
123 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
124 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
125 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
126 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
127 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
128 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
129 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
130 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
131 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
132 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
133 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
134 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
135 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
136 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
137 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
138 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
139 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
140 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
141 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
142 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
143 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
144 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
145 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
146 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
147 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
148 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
149 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
150 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
151 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
152 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
153 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
154 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
155 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
156 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
157 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
158 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
159 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
160 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
161 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
162 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
163 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
164 2941479691
165 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
166 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
167 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
168 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
169 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
170 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
171 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
172 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
173 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
174 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
175 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
176 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
177 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
178 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
179 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
180 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
181 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
182 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
183 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
184 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
185 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
192 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
193 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
194 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
195 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
196 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
197 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
198 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
199 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
200 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
201 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
202 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
203 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
204 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
205 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
206 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
207 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
208 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
209 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
210 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
211 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
212 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
213 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
214 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
215 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
216 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
217 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
218 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
219 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
220 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
221 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
222 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
223 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
224 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
225 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
226 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
227 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
228 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
229 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
230 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
231 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
232 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
233 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
234 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
235 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
236 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
237 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
238 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
239 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
244 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
245 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
246 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
247 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
248 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
249 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
250 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
251 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
252 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
253 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
254 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
255 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
256 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
257 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
258 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
259 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
260 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
261 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
262 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
263 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
264 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
265 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
266 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
267 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
268 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
269 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
270 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
271 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
272 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
273 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
274 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
275 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
276 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
277 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
278 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
279 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
280 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
281 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
282 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
283 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
284 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
285 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
286 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
287 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
288 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
289 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
290 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
291 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
292 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
293 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
294 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
295 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
297 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
298 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
299 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
300 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
301 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
302 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
303 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
304 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
305 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
306 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
307 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
308 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
309 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
310 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
311 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
312 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
313 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
314 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
315 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
316 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
317 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
318 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
319 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
320 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
321 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
322 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
323 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
324 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
325 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
326 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
327 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
328 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
329 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
330 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
331 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
333 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
334 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
337 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
340 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
341 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
342 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
410 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
411 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
412 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
413 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
415 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
416 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
420 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
421 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
422 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
423 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
424 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
425 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
426 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
427 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
428 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
429 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
430 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
431 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
432 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
433 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
434 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
435 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
436 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
437 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
438 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
439 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
440 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
441 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
442 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
443 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
444 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
445 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
446 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
447 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
448 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
449 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
450 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
451 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
452 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
453 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
454 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
455 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
456 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
457 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
458 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
459 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
460 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
461 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
462 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
463 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
464 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
465 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
466 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
467 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
468 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
469 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
470 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
471 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
472 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
473 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
474 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
475 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
476 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
477 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
478 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
479 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
480 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
481 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
482 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
483 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
484 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
485 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
486 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
487 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
488 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
489 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
490 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
491 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
492 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
493 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
494 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
495 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
496 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
497 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
498 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
499 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
500 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
501 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
502 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
503 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
504 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
505 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
506 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
507 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
508 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
509 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
510 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
511 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
512 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
513 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
514 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
515 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
516 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
517 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
518 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
519 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
520 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
521 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
522 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
523 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
524 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
525 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
526 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
527 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
528 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
529 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
530 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
531 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
532 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
533 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
534 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
535 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
536 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
537 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
538 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
539 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
540 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
541 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
542 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
543 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
544 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
545 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
546 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
547 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
548 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
549 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
550 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
551 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
552 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
553 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
554 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
555 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
556 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
557 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
558 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
559 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
560 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
561 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
562 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
563 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
564 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
565 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
566 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
567 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
568 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
569 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
570 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
571 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
572 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
573 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
574 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
575 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
576 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
577 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
578 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
579 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
580 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
581 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
582 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
583 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
584 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
585 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
586 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
587 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
588 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
589 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
590 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
591 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
592 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
593 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
594 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
595 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
596 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
597 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
598 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
599 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
600 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
601 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
602 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
603 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
604 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
609 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
612 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
619 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
620 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
621 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
622 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
623 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
624 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
625 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
626 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
627 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
628 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
629 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
630 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
631 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
632 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
633 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
636 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
637 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
638 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
639 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
640 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
641 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
642 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
643 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
644 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
645 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
646 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
647 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
648 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
649 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
650 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
651 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
652 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
653 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
654 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
655 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
656 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
657 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
658 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
659 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
660 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
661 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
662 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
663 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
664 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
665 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
666 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
667 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
668 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
669 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
670 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
671 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
672 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
673 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
674 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
675 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
676 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
677 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
678 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
679 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
680 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
681 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
682 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
683 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
684 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
685 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
686 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
687 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
688 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
689 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
690 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
691 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
692 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
693 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
694 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
695 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
696 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
697 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
698 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
699 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
700 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
701 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
702 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
703 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
704 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
705 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
706 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
707 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
708 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
709 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
710 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
711 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
712 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
713 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
714 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
715 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
716 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
717 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
718 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
719 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
720 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
721 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
722 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
723 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
724 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
725 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
726 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
727 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.42
Metatranscriptomes 0.1
Isolates 10.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 8.64
Rhizoplane 7.27
Rhizosphere 71.7
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000159 3300001991 Bacteria 7006
2 JGI24750J21931_1000490 3300002070 Bacteria 6209
3 JGI24744J21845_10000795 3300002077 Bacteria 5917
4 JGI25406J46586_10000793 3300003203 Bacteria 14928
5 JGI25406J46586_10005542 3300003203 Bacteria 5846
6 JGI25406J46586_10006783 3300003203 Bacteria 5260
7 JGI25165J46597_1000276 3300003214 Bacteria 66076
8 JGI25153J46596_10000546 3300003215 Bacteria 23492
9 JGI25153J46596_10006750 3300003215 Bacteria 5756
10 JGI25153J46596_10020162 3300003215 Bacteria 2528
11 JGI25160J50197_1002937 3300003354 Bacteria 7791
12 JGI25160J50197_1006400 3300003354 Bacteria 4770
13 Ga0055539_1007117 3300003752 Bacteria 1419
14 Ga0055531_10004105 3300003794 Bacteria 9003
15 JGI25405J52794_10024159 3300003911 Bacteria 1240
16 Ga0055543_1003433 3300004625 Bacteria 4682
17 Ga0065165_1001155 3300005262 Bacteria 30824
18 Ga0065707_10026480 3300005295 Bacteria 1725
19 Ga0065707_10097307 3300005295 Bacteria 3186
20 Ga0070658_10021062 3300005327 Bacteria 5223
21 Ga0070658_10037310 3300005327 Bacteria 3917
22 Ga0070676_10029492 3300005328 Bacteria 3121
23 Ga0070683_100056380 3300005329 Bacteria 3649
24 Ga0070683_100077696 3300005329 Bacteria 3104
25 Ga0070683_100142091 3300005329 Bacteria 2274
26 Ga0070683_100338565 3300005329 Bacteria 1432
27 Ga0070690_100017544 3300005330 Bacteria 4307
28 Ga0070690_100065696 3300005330 Bacteria 2346
29 Ga0070690_100177381 3300005330 Bacteria 1471
30 Ga0070670_100013972 3300005331 Bacteria 6886
31 Ga0070670_100036467 3300005331 Bacteria 4231
32 Ga0070670_100050575 3300005331 Bacteria 3570
33 Ga0070670_100454928 3300005331 Bacteria 1135
34 Ga0070677_10081323 3300005333 Bacteria 1387
35 Ga0068869_100036132 3300005334 Bacteria 3506
36 Ga0068869_100266342 3300005334 Bacteria 1373
37 Ga0070666_10011682 3300005335 Bacteria 5521
38 Ga0070680_100005003 3300005336 Bacteria 9989
39 Ga0070680_100079413 3300005336 Bacteria 2704
40 Ga0070680_100105161 3300005336 Bacteria 2346
41 Ga0070680_100129970 3300005336 Bacteria 2106
42 Ga0070680_100273423 3300005336 Bacteria 1431
43 Ga0070682_100104409 3300005337 Bacteria 1877
44 Ga0068868_100030349 3300005338 Bacteria 4145
45 Ga0068868_100033675 3300005338 Bacteria 3950
46 Ga0068868_100070828 3300005338 Bacteria 2780
47 Ga0068868_100106391 3300005338 Bacteria 2275
48 Ga0068868_100353520 3300005338 Bacteria 1259
49 Ga0070660_100131436 3300005339 Bacteria 2003
50 Ga0070660_100361986 3300005339 Bacteria 1196
51 Ga0070689_100005971 3300005340 Bacteria 8379
52 Ga0070689_100017795 3300005340 Bacteria 5226
53 Ga0070689_100092911 3300005340 Bacteria 2380
54 Ga0070691_10013696 3300005341 Bacteria 3719
55 Ga0070687_100013422 3300005343 Bacteria 3651
56 Ga0070661_100039500 3300005344 Bacteria 3438
57 Ga0070661_100046692 3300005344 Bacteria 3169
58 Ga0070661_100084335 3300005344 Bacteria 2347
59 Ga0070668_100104887 3300005347 Bacteria 2244
60 Ga0070668_100152462 3300005347 Bacteria 1870
61 Ga0070668_100178285 3300005347 Bacteria 1734
62 Ga0070669_100031811 3300005353 Bacteria 3811
63 Ga0070669_100173399 3300005353 Bacteria 1683
64 Ga0070675_100051528 3300005354 Bacteria 3382
65 Ga0070675_100181346 3300005354 Bacteria 1821
66 Ga0070675_100225412 3300005354 Bacteria 1633
67 Ga0070675_100252249 3300005354 Bacteria 1545
68 Ga0070675_100261421 3300005354 Bacteria 1517
69 Ga0070671_100013357 3300005355 Bacteria 6620
70 Ga0070673_100024611 3300005364 Bacteria 4418
71 Ga0070673_100024717 3300005364 Bacteria 4409
72 Ga0070673_100058891 3300005364 Bacteria 3039
73 Ga0070673_100065305 3300005364 Bacteria 2902
74 Ga0070688_100007645 3300005365 Bacteria 5836
75 Ga0070688_100008368 3300005365 Bacteria 5612
76 Ga0070688_100018126 3300005365 Bacteria 4056
77 Ga0070688_100147110 3300005365 Bacteria 1606
78 Ga0070659_100231957 3300005366 Bacteria 1525
79 Ga0070667_100139806 3300005367 Bacteria 2119
80 Ga0070667_100222417 3300005367 Bacteria 1681
81 Ga0070703_10000974 3300005406 Bacteria 9051
82 Ga0070709_10000161 3300005434 Bacteria 43173
83 Ga0070709_10005165 3300005434 Bacteria 7060
84 Ga0070709_10023382 3300005434 Bacteria 3627
85 Ga0070709_10068961 3300005434 Bacteria 2276
86 Ga0070709_10126906 3300005434 Bacteria 1736
87 Ga0070709_10197274 3300005434 Bacteria 1423
88 Ga0070709_10277960 3300005434 Bacteria 1216
89 Ga0070714_100015028 3300005435 Bacteria 6223
90 Ga0070714_100060740 3300005435 Bacteria 3245
91 Ga0070714_100063404 3300005435 Bacteria 3179
92 Ga0070714_100065850 3300005435 Bacteria 3122
93 Ga0070714_100099668 3300005435 Bacteria 2557
94 Ga0070714_100134077 3300005435 Bacteria 2216
95 Ga0070714_100168582 3300005435 Bacteria 1986
96 Ga0070714_100176622 3300005435 Bacteria 1941
97 Ga0070713_100001193 3300005436 Bacteria 16600
98 Ga0070713_100009411 3300005436 Bacteria 6994
99 Ga0070713_100028012 3300005436 Bacteria 4444
100 Ga0070713_100028635 3300005436 Bacteria 4400
101 Ga0070713_100034152 3300005436 Bacteria 4082
102 Ga0070713_100146915 3300005436 Bacteria 2094
103 Ga0070713_100166603 3300005436 Bacteria 1971
104 Ga0070713_100186380 3300005436 Bacteria 1867
105 Ga0070713_100290682 3300005436 Bacteria 1502
106 Ga0070713_100305893 3300005436 Bacteria 1465
107 Ga0070713_100677556 3300005436 Bacteria 983
108 Ga0070710_10005772 3300005437 Bacteria 5896
109 Ga0070710_10007707 3300005437 Bacteria 5220
110 Ga0070710_10162601 3300005437 Bacteria 1385
111 Ga0070701_10011304 3300005438 Bacteria 3985
112 Ga0070711_100002872 3300005439 Bacteria 9922
113 Ga0070711_100004937 3300005439 Bacteria 7921
114 Ga0070711_100009620 3300005439 Bacteria 5956
115 Ga0070711_100029930 3300005439 Bacteria 3599
116 Ga0070711_100066690 3300005439 Bacteria 2522
117 Ga0070711_100097686 3300005439 Bacteria 2130
118 Ga0070705_100000072 3300005440 Bacteria 54271
119 Ga0070705_100031359 3300005440 Bacteria 2943
120 Ga0070705_100056200 3300005440 Bacteria 2317
121 Ga0070705_100172834 3300005440 Bacteria 1456
122 Ga0070700_100000962 3300005441 Bacteria 14227
123 Ga0070694_100002401 3300005444 Bacteria 11074
124 Ga0070708_100095238 3300005445 Bacteria 2718
125 Ga0070708_100152897 3300005445 Bacteria 2147
126 Ga0070708_100163230 3300005445 Bacteria 2077
127 Ga0070663_100051535 3300005455 Bacteria 2932
128 Ga0070663_100066180 3300005455 Bacteria 2618
129 Ga0070663_100070001 3300005455 Bacteria 2550
130 Ga0070663_100071124 3300005455 Bacteria 2531
131 Ga0070663_100263254 3300005455 Bacteria 1368
132 Ga0070678_100040679 3300005456 Bacteria 3290
133 Ga0070662_100152495 3300005457 Bacteria 1800
134 Ga0070662_100287528 3300005457 Bacteria 1332
135 Ga0070681_10017474 3300005458 Bacteria 7170
136 Ga0070681_10036206 3300005458 Bacteria 4957
137 Ga0070681_10043334 3300005458 Bacteria 4508
138 Ga0070681_10044600 3300005458 Bacteria 4439
139 Ga0070681_10171274 3300005458 Bacteria 2093
140 Ga0070681_10183757 3300005458 Bacteria 2012
141 Ga0070681_10221347 3300005458 Bacteria 1808
142 Ga0070681_10315542 3300005458 Bacteria 1472
143 Ga0068867_100005981 3300005459 Bacteria 8627
144 Ga0070685_10002466 3300005466 Bacteria 9501
145 Ga0070685_10016722 3300005466 Bacteria 3912
146 Ga0070706_100061572 3300005467 Bacteria 3466
147 Ga0070706_100106155 3300005467 Bacteria 2613
148 Ga0070707_100225999 3300005468 Bacteria 1822
149 Ga0070698_100015504 3300005471 Bacteria 8050
150 Ga0070699_100000250 3300005518 Bacteria 52788
151 Ga0070699_100006065 3300005518 Bacteria 10567
152 Ga0070699_100321633 3300005518 Bacteria 1390
153 Ga0070679_100024333 3300005530 Bacteria 5934
154 Ga0070679_100082222 3300005530 Bacteria 3210
155 Ga0070679_100138340 3300005530 Bacteria 2416
156 Ga0070679_100206525 3300005530 Bacteria 1928
157 Ga0070684_100015420 3300005535 Bacteria 6223
158 Ga0070684_100022289 3300005535 Bacteria 5280
159 Ga0070684_100206673 3300005535 Bacteria 1789
160 Ga0070684_100243152 3300005535 Bacteria 1644
161 Ga0070697_100029834 3300005536 Bacteria 4377
162 Ga0070697_100053420 3300005536 Bacteria 3284
163 Ga0070697_100151364 3300005536 Bacteria 1955
164 Ga0068853_100020143 3300005539 Bacteria 5545
165 Ga0068853_100025687 3300005539 Bacteria 4943
166 Ga0068853_100242189 3300005539 Bacteria 1653
167 Ga0068853_100463660 3300005539 Bacteria 1193
168 Ga0070672_100084748 3300005543 Bacteria 2545
169 Ga0070686_100139277 3300005544 Bacteria 1687
170 Ga0070695_100009154 3300005545 Bacteria 5888
171 Ga0070695_100040002 3300005545 Bacteria 2966
172 Ga0070695_100099621 3300005545 Bacteria 1955
173 Ga0070696_100001222 3300005546 Bacteria 16680
174 Ga0070696_100414275 3300005546 Bacteria 1057
175 Ga0070693_100029317 3300005547 Bacteria 3001
176 Ga0070693_100167893 3300005547 Bacteria 1403
177 Ga0070665_100007752 3300005548 Bacteria 10898
178 Ga0070665_100050810 3300005548 Bacteria 4161
179 Ga0070665_100051883 3300005548 Bacteria 4113
180 Ga0070665_100066998 3300005548 Bacteria 3601
181 Ga0070665_100447989 3300005548 Bacteria 1300
182 Ga0070704_100043510 3300005549 Bacteria 3113
183 Ga0068855_100015904 3300005563 Bacteria 9051
184 Ga0068855_100057025 3300005563 Bacteria 4580
185 Ga0068855_100088921 3300005563 Bacteria 3567
186 Ga0068855_100095592 3300005563 Bacteria 3424
187 Ga0068855_100187018 3300005563 Bacteria 2339
188 Ga0068855_100316996 3300005563 Bacteria 1724
189 Ga0070664_100023695 3300005564 Bacteria 5070
190 Ga0070664_100029851 3300005564 Bacteria 4546
191 Ga0070664_100205092 3300005564 Bacteria 1760
192 Ga0070664_100303349 3300005564 Bacteria 1444
193 Ga0068857_100027291 3300005577 Bacteria 5036
194 Ga0068854_100051244 3300005578 Bacteria 2956
195 Ga0068854_100265324 3300005578 Bacteria 1376
196 Ga0068856_100001570 3300005614 Bacteria 23917
197 Ga0068856_100070913 3300005614 Bacteria 3448
198 Ga0068856_100119419 3300005614 Bacteria 2637
199 Ga0068856_100153817 3300005614 Bacteria 2310
200 Ga0068856_100159539 3300005614 Bacteria 2265
201 Ga0070702_100026211 3300005615 Bacteria 3130
202 Ga0070702_100053808 3300005615 Bacteria 2314
203 Ga0070702_100129777 3300005615 Bacteria 1590
204 Ga0070702_100131678 3300005615 Bacteria 1580
205 Ga0070702_100361019 3300005615 Bacteria 1026
206 Ga0068852_100015174 3300005616 Bacteria 5962
207 Ga0068852_100081178 3300005616 Bacteria 2877
208 Ga0068852_100160249 3300005616 Bacteria 2100
209 Ga0068852_100229642 3300005616 Bacteria 1768
210 Ga0068852_100526041 3300005616 Bacteria 1180
211 Ga0068852_100618680 3300005616 Bacteria 1088
212 Ga0068859_100014663 3300005617 Bacteria 7876
213 Ga0068859_100038786 3300005617 Bacteria 4779
214 Ga0068859_100135059 3300005617 Bacteria 2539
215 Ga0068859_100173439 3300005617 Bacteria 2238
216 Ga0068864_100015095 3300005618 Bacteria 6421
217 Ga0068864_100019069 3300005618 Bacteria 5733
218 Ga0068864_100036947 3300005618 Bacteria 4165
219 Ga0068864_100225894 3300005618 Bacteria 1729
220 Ga0068866_10004536 3300005718 Bacteria 5696
221 Ga0068866_10056645 3300005718 Bacteria 2016
222 Ga0068861_100026119 3300005719 Bacteria 4243
223 Ga0068861_100095830 3300005719 Bacteria 2351
224 Ga0068861_100255490 3300005719 Bacteria 1497
225 Ga0068861_100440282 3300005719 Bacteria 1165
226 Ga0068851_10124265 3300005834 Bacteria 1390
227 Ga0068851_10133990 3300005834 Bacteria 1342
228 Ga0068863_100037192 3300005841 Bacteria 4635
229 Ga0068863_100136723 3300005841 Bacteria 2342
230 Ga0068863_100238925 3300005841 Bacteria 1753
231 Ga0068858_100019603 3300005842 Bacteria 6324
232 Ga0068858_100041088 3300005842 Bacteria 4289
233 Ga0068858_100148745 3300005842 Bacteria 2201
234 Ga0068860_100013861 3300005843 Bacteria 7905
235 Ga0068860_100207823 3300005843 Bacteria 1898
236 Ga0068860_100300822 3300005843 Bacteria 1571
237 Ga0068862_100002889 3300005844 Bacteria 15033
238 Ga0068862_100027147 3300005844 Bacteria 4818
239 Ga0068862_100312120 3300005844 Bacteria 1449
240 Ga0068862_100501222 3300005844 Bacteria 1152
241 Ga0068862_100536303 3300005844 Bacteria 1115
242 Ga0081455_10003043 3300005937 Bacteria 19535
243 Ga0081455_10009689 3300005937 Bacteria 9880
244 Ga0081455_10017138 3300005937 Bacteria 6958
245 Ga0081455_10019160 3300005937 Bacteria 6484
246 Ga0081455_10021557 3300005937 Bacteria 6040
247 Ga0081455_10032195 3300005937 Bacteria 4729
248 Ga0081455_10045254 3300005937 Bacteria 3831
249 Ga0081455_10080017 3300005937 Bacteria 2681
250 Ga0081455_10101207 3300005937 Bacteria 2313
251 Ga0081455_10102989 3300005937 Bacteria 2287
252 Ga0081455_10106127 3300005937 Bacteria 2243
253 Ga0081538_10051717 3300005981 Bacteria 2463
254 Ga0081538_10075063 3300005981 Bacteria 1837
255 Ga0081540_1000234 3300005983 Bacteria 58203
256 Ga0081540_1002139 3300005983 Bacteria 16440
257 Ga0081540_1002476 3300005983 Bacteria 15039
258 Ga0081540_1004198 3300005983 Bacteria 11081
259 Ga0081540_1005942 3300005983 Bacteria 9008
260 Ga0081540_1005967 3300005983 Bacteria 8974
261 Ga0081540_1009497 3300005983 Bacteria 6700
262 Ga0081540_1011408 3300005983 Bacteria 5940
263 Ga0081540_1017619 3300005983 Bacteria 4414
264 Ga0081540_1020463 3300005983 Bacteria 3978
265 Ga0081540_1029692 3300005983 Bacteria 3041
266 Ga0081540_1035589 3300005983 Bacteria 2668
267 Ga0081540_1056194 3300005983 Bacteria 1912
268 Ga0081539_10000048 3300005985 Bacteria 272906
269 Ga0081539_10000210 3300005985 Bacteria 136405
270 Ga0081539_10000466 3300005985 Bacteria 85716
271 Ga0081539_10037647 3300005985 Bacteria 2879
272 Ga0081539_10051990 3300005985 Bacteria 2305
273 Ga0081539_10075794 3300005985 Bacteria 1785
274 Ga0070717_10000217 3300006028 Bacteria 39845
275 Ga0070717_10000792 3300006028 Bacteria 20764
276 Ga0070717_10010340 3300006028 Bacteria 7040
277 Ga0070717_10045238 3300006028 Bacteria 3598
278 Ga0070717_10084386 3300006028 Bacteria 2672
279 Ga0075365_10029572 3300006038 Bacteria 3504
280 Ga0075365_10029734 3300006038 Bacteria 3495
281 Ga0075365_10050203 3300006038 Bacteria 2751
282 Ga0075365_10060672 3300006038 Bacteria 2524
283 Ga0075368_10016953 3300006042 Bacteria 2720
284 Ga0075368_10053351 3300006042 Bacteria 1609
285 Ga0075363_100000546 3300006048 Bacteria 12216
286 Ga0075363_100056914 3300006048 Bacteria 2097
287 Ga0075364_10112086 3300006051 Bacteria 1821
288 Ga0075432_10004699 3300006058 Bacteria 4649
289 Ga0070715_10001366 3300006163 Bacteria 7039
290 Ga0070715_10003603 3300006163 Bacteria 4964
291 Ga0070716_100007041 3300006173 Bacteria 5518
292 Ga0070716_100083435 3300006173 Bacteria 1914
293 Ga0070712_100002166 3300006175 Bacteria 12084
294 Ga0070712_100008131 3300006175 Bacteria 6588
295 Ga0070712_100018666 3300006175 Bacteria 4510
296 Ga0070712_100079315 3300006175 Bacteria 2372
297 Ga0070712_100149165 3300006175 Bacteria 1793
298 Ga0070712_100150620 3300006175 Bacteria 1786
299 Ga0070712_100183198 3300006175 Bacteria 1633
300 Ga0075362_10026934 3300006177 Bacteria 2458
301 Ga0075367_10006175 3300006178 Bacteria 6031
302 Ga0075369_10002935 3300006186 Bacteria 6158
303 Ga0075366_10012741 3300006195 Bacteria 4777
304 Ga0075366_10106745 3300006195 Bacteria 1684
305 Ga0097621_100008062 3300006237 Bacteria 7563
306 Ga0097621_100233720 3300006237 Bacteria 1605
307 Ga0075370_10017657 3300006353 Bacteria 3858
308 Ga0075370_10070961 3300006353 Bacteria 1992
309 Ga0075370_10239908 3300006353 Bacteria 1073
310 Ga0068871_100002599 3300006358 Bacteria 12321
311 Ga0075428_100005179 3300006844 Bacteria 14478
312 Ga0075428_100018890 3300006844 Bacteria 7623
313 Ga0075428_100147151 3300006844 Bacteria 2560
314 Ga0075428_100163780 3300006844 Bacteria 2412
315 Ga0075428_100175581 3300006844 Bacteria 2320
316 Ga0075430_100000255 3300006846 Bacteria 37131
317 Ga0075430_100016737 3300006846 Bacteria 6245
318 Ga0075430_100020485 3300006846 Bacteria 5626
319 Ga0075431_100001781 3300006847 Bacteria 20306
320 Ga0075431_100001940 3300006847 Bacteria 19719
321 Ga0075431_100042822 3300006847 Bacteria 4670
322 Ga0075431_100049539 3300006847 Bacteria 4331
323 Ga0075431_100138652 3300006847 Bacteria 2507
324 Ga0075431_100194317 3300006847 Bacteria 2078
325 Ga0075433_10008805 3300006852 Bacteria 8053
326 Ga0075433_10017290 3300006852 Bacteria 5969
327 Ga0075434_100011014 3300006871 Bacteria 8508
328 Ga0075434_100017436 3300006871 Bacteria 6920
329 Ga0075434_100052904 3300006871 Bacteria 4035
330 Ga0075434_100058583 3300006871 Bacteria 3828
331 Ga0075434_100122839 3300006871 Bacteria 2612
332 Ga0075434_100134851 3300006871 Bacteria 2489
333 Ga0075434_100155706 3300006871 Bacteria 2304
334 Ga0075434_100232638 3300006871 Bacteria 1863
335 Ga0075434_100291203 3300006871 Bacteria 1653
336 Ga0075434_100493692 3300006871 Bacteria 1245
337 Ga0075429_100001284 3300006880 Bacteria 20443
338 Ga0075429_100013201 3300006880 Bacteria 7167
339 Ga0075429_100054884 3300006880 Bacteria 3466
340 Ga0075429_100126935 3300006880 Bacteria 2231
341 Ga0075429_100381793 3300006880 Bacteria 1234
342 Ga0075436_100011676 3300006914 Bacteria 6028
343 Ga0097620_100014663 3300006931 Bacteria 7876
344 Ga0097620_100038786 3300006931 Bacteria 4779
345 Ga0097620_100135065 3300006931 Bacteria 2539
346 Ga0097620_100173432 3300006931 Bacteria 2238
347 Ga0099824_1014898 3300006942 Bacteria 7560
348 Ga0099824_1018713 3300006942 Bacteria 5605
349 Ga0099822_1000191 3300006943 Bacteria 46107
350 Ga0099822_1054667 3300006943 Bacteria 1509
351 Ga0099823_1022581 3300006944 Bacteria 5814
352 Ga0075435_100017307 3300007076 Bacteria 5453
353 Ga0075435_100113872 3300007076 Bacteria 2251
354 Ga0075435_100141885 3300007076 Bacteria 2016
355 Ga0075435_100182020 3300007076 Bacteria 1776
356 Ga0075435_100207852 3300007076 Bacteria 1660
357 Ga0099794_10003432 3300007265 Bacteria 6043
358 Ga0099794_10010970 3300007265 Bacteria 3868
359 Ga0099794_10138100 3300007265 Bacteria 1233
360 Ga0099795_10008962 3300007788 Bacteria 2883
361 Ga0099795_10091793 3300007788 Bacteria 1178
362 Ga0099795_10136355 3300007788 Bacteria 995
363 Ga0105251_10031643 3300009011 Bacteria 2645
364 Ga0105250_10079766 3300009092 Bacteria 1326
365 Ga0105240_10003126 3300009093 Bacteria 26076
366 Ga0105240_10013607 3300009093 Bacteria 11163
367 Ga0105240_10045172 3300009093 Bacteria 5591
368 Ga0105240_10227620 3300009093 Bacteria 2169
369 Ga0105240_10316542 3300009093 Bacteria 1780
370 Ga0111539_10031617 3300009094 Bacteria 6429
371 Ga0111539_10040138 3300009094 Bacteria 5636
372 Ga0111539_10217493 3300009094 Bacteria 2225
373 Ga0111539_10380587 3300009094 Bacteria 1643
374 Ga0105245_10030663 3300009098 Bacteria 4756
375 Ga0105245_10033559 3300009098 Bacteria 4550
376 Ga0105245_10220586 3300009098 Bacteria 1829
377 Ga0114129_10000003 3300009147 Bacteria 183186
378 Ga0114129_10019015 3300009147 Bacteria 9786
379 Ga0114129_10022232 3300009147 Bacteria 9003
380 Ga0114129_10037886 3300009147 Bacteria 6804
381 Ga0114129_10040639 3300009147 Bacteria 6555
382 Ga0114129_10087403 3300009147 Bacteria 4323
383 Ga0114129_10129695 3300009147 Bacteria 3465
384 Ga0114129_10272104 3300009147 Bacteria 2266
385 Ga0105243_10017546 3300009148 Bacteria 5412
386 Ga0105241_10017827 3300009174 Bacteria 5222
387 Ga0105241_10048385 3300009174 Bacteria 3236
388 Ga0105241_10224170 3300009174 Bacteria 1582
389 Ga0105242_10029187 3300009176 Bacteria 4397
390 Ga0105242_10112558 3300009176 Bacteria 2323
391 Ga0105242_10373413 3300009176 Bacteria 1323
392 Ga0105248_10001732 3300009177 Bacteria 24242
393 Ga0105248_10055746 3300009177 Bacteria 4434
394 Ga0105248_10147884 3300009177 Bacteria 2651
395 Ga0105248_10439423 3300009177 Bacteria 1470
396 Ga0105237_10000859 3300009545 Bacteria 41301
397 Ga0105237_10074664 3300009545 Bacteria 3383
398 Ga0105237_10077431 3300009545 Bacteria 3315
399 Ga0105237_10200250 3300009545 Bacteria 1996
400 Ga0105237_10297458 3300009545 Bacteria 1617
401 Ga0105237_10306137 3300009545 Bacteria 1592
402 Ga0105238_10023216 3300009551 Bacteria 6323
403 Ga0105238_10025855 3300009551 Bacteria 5985
404 Ga0105238_10059175 3300009551 Bacteria 3839
405 Ga0105238_10085124 3300009551 Bacteria 3150
406 Ga0105238_10154597 3300009551 Bacteria 2269
407 Ga0105238_10245501 3300009551 Bacteria 1768
408 Ga0105238_10371440 3300009551 Bacteria 1421
409 Ga0105249_10006938 3300009553 Bacteria 9880
410 Ga0105249_10079338 3300009553 Bacteria 3047
411 Ga0105249_10146255 3300009553 Bacteria 2271
412 Ga0105249_10240071 3300009553 Bacteria 1791
413 Ga0105239_10032270 3300010375 Bacteria 5756
414 Ga0105239_10044186 3300010375 Bacteria 4884
415 Ga0105239_10089792 3300010375 Bacteria 3389
416 Ga0105239_10506058 3300010375 Bacteria 1373
417 Ga0105246_10026068 3300011119 Bacteria 3815
418 Ga0105246_10041501 3300011119 Bacteria 3110
419 Ga0105246_10092881 3300011119 Bacteria 2179
420 Ga0105246_10094270 3300011119 Bacteria 2165
421 Ga0105246_10141421 3300011119 Bacteria 1810
422 Ga0105246_10282165 3300011119 Bacteria 1333
423 Ga0157370_10016997 3300013104 Bacteria 7352
424 Ga0157370_10025182 3300013104 Bacteria 5890
425 Ga0157370_10030287 3300013104 Bacteria 5303
426 Ga0157370_10039138 3300013104 Bacteria 4582
427 Ga0157369_10011280 3300013105 Bacteria 10153
428 Ga0157369_10060774 3300013105 Bacteria 4074
429 Ga0157369_10087143 3300013105 Bacteria 3334
430 Ga0157369_10197367 3300013105 Bacteria 2113
431 Ga0157369_10753330 3300013105 Bacteria 1002
432 Ga0157374_10189402 3300013296 Bacteria 2012
433 Ga0157374_10307525 3300013296 Bacteria 1569
434 Ga0157378_10005515 3300013297 Bacteria 11089
435 Ga0157378_10016743 3300013297 Bacteria 6423
436 Ga0157378_10395663 3300013297 Bacteria 1360
437 Ga0157378_10663468 3300013297 Bacteria 1060
438 Ga0163162_10158069 3300013306 Bacteria 2388
439 Ga0157372_10075595 3300013307 Bacteria 3801
440 Ga0157372_10342547 3300013307 Bacteria 1741
441 Ga0157375_10036665 3300013308 Bacteria 4693
442 Ga0157375_10037116 3300013308 Bacteria 4666
443 Ga0157375_10107255 3300013308 Bacteria 2886
444 Ga0157375_10259067 3300013308 Bacteria 1901
445 Ga0157375_10332000 3300013308 Bacteria 1685
446 Ga0163163_10013076 3300014325 Bacteria 7582
447 Ga0163163_10016286 3300014325 Bacteria 6903
448 Ga0163163_10017351 3300014325 Bacteria 6713
449 Ga0163163_10020301 3300014325 Bacteria 6254
450 Ga0163163_10029786 3300014325 Bacteria 5252
451 Ga0163163_10063398 3300014325 Bacteria 3664
452 Ga0163163_10604133 3300014325 Bacteria 1160
453 Ga0157380_10069320 3300014326 Bacteria 2845
454 Ga0157380_10106049 3300014326 Bacteria 2351
455 Ga0157380_10259718 3300014326 Bacteria 1577
456 Ga0157377_10006770 3300014745 Bacteria 5491
457 Ga0157379_10005269 3300014968 Bacteria 11102
458 Ga0157379_10089161 3300014968 Bacteria 2767
459 Ga0157379_10118890 3300014968 Bacteria 2377
460 Ga0157379_10137725 3300014968 Bacteria 2200
461 Ga0157376_10122704 3300014969 Bacteria 2305
462 Ga0157376_10171813 3300014969 Bacteria 1974
463 Ga0157376_10388468 3300014969 Bacteria 1346
464 Ga0182005_1057806 3300015265 Bacteria 1058
465 Ga0163161_10050291 3300017792 Bacteria 3016
466 Ga0163161_10113394 3300017792 Bacteria 2029
467 Ga0206354_11516033 3300020081 Bacteria 1091
468 Ga0214544_1000003 3300021320 Bacteria 643752
469 Ga0214542_1000003 3300021321 Bacteria 435700
470 Ga0214542_1018727 3300021321 Bacteria 5741
471 Ga0214545_1000004 3300021324 Bacteria 453352
472 Ga0214545_1016668 3300021324 Bacteria 7477
473 Ga0214543_1000007 3300021327 Bacteria 414744
474 Ga0214543_1022834 3300021327 Bacteria 4310
475 Ga0213874_10031465 3300021377 Bacteria 1536
476 Ga0213876_10036401 3300021384 Bacteria 2595
477 Ga0213875_10000012 3300021388 Bacteria 312017
478 Ga0224572_1010868 3300024225 Bacteria 1717
479 Ga0228598_1001818 3300024227 Bacteria 4642
480 Ga0209563_103209 3300025230 Bacteria 3442
481 Ga0209437_100023 3300025233 Bacteria 614195
482 Ga0207425_1009767 3300025245 Bacteria 2370
483 Ga0209677_100635 3300025253 Bacteria 18690
484 Ga0209148_1000351 3300025254 Bacteria 59739
485 Ga0209233_1000062 3300025261 Bacteria 399685
486 Ga0209233_1007732 3300025261 Bacteria 3379
487 Ga0209455_1007119 3300025272 Bacteria 3199
488 Ga0209564_1028046 3300025295 Bacteria 1811
489 Ga0209564_1047760 3300025295 Bacteria 1075
490 Ga0209758_1000015 3300025297 Bacteria 851943
491 Ga0209758_1000244 3300025297 Bacteria 112497
492 Ga0209758_1000886 3300025297 Bacteria 41032
493 Ga0209758_1001829 3300025297 Bacteria 23439
494 Ga0209758_1005837 3300025297 Bacteria 9192
495 Ga0209758_1008080 3300025297 Bacteria 6936
496 Ga0209256_1005506 3300025299 Bacteria 7244
497 Ga0207426_1000585 3300025302 Bacteria 48529
498 Ga0207426_1000734 3300025302 Bacteria 37516
499 Ga0207426_1013187 3300025302 Bacteria 3072
500 Ga0209051_1038096 3300025303 Bacteria 1754
501 Ga0209257_1001348 3300025304 Bacteria 29776
502 Ga0207697_10032400 3300025315 Bacteria 2139
503 Ga0207697_10077424 3300025315 Bacteria 1398
504 Ga0207656_10116310 3300025321 Bacteria 1241
505 Ga0207653_10005006 3300025885 Bacteria 4140
506 Ga0207653_10019783 3300025885 Bacteria 2124
507 Ga0207682_10022226 3300025893 Bacteria 2498
508 Ga0207692_10005634 3300025898 Bacteria 5028
509 Ga0207692_10068178 3300025898 Bacteria 1864
510 Ga0207692_10073723 3300025898 Bacteria 1807
511 Ga0207692_10132223 3300025898 Bacteria 1410
512 Ga0207692_10132858 3300025898 Bacteria 1408
513 Ga0207642_10081216 3300025899 Bacteria 1575
514 Ga0207710_10031231 3300025900 Bacteria 2328
515 Ga0207688_10000274 3300025901 Bacteria 23548
516 Ga0207688_10065581 3300025901 Bacteria 2052
517 Ga0207688_10138935 3300025901 Bacteria 1429
518 Ga0207680_10009419 3300025903 Bacteria 4844
519 Ga0207680_10045002 3300025903 Bacteria 2599
520 Ga0207647_10005044 3300025904 Bacteria 9734
521 Ga0207699_10000138 3300025906 Bacteria 49255
522 Ga0207699_10005739 3300025906 Bacteria 5970
523 Ga0207699_10052302 3300025906 Bacteria 2417
524 Ga0207699_10085543 3300025906 Bacteria 1967
525 Ga0207699_10229912 3300025906 Bacteria 1270
526 Ga0207699_10238019 3300025906 Bacteria 1249
527 Ga0207645_10008125 3300025907 Bacteria 7353
528 Ga0207645_10038873 3300025907 Bacteria 3049
529 Ga0207645_10058854 3300025907 Bacteria 2453
530 Ga0207645_10153805 3300025907 Bacteria 1502
531 Ga0207645_10199679 3300025907 Bacteria 1315
532 Ga0207705_10013654 3300025909 Bacteria 5859
533 Ga0207705_10064143 3300025909 Bacteria 2655
534 Ga0207654_10008646 3300025911 Bacteria 5159
535 Ga0207654_10019435 3300025911 Bacteria 3586
536 Ga0207654_10036667 3300025911 Bacteria 2741
537 Ga0207707_10000816 3300025912 Bacteria 30547
538 Ga0207707_10005420 3300025912 Bacteria 11152
539 Ga0207707_10006010 3300025912 Bacteria 10623
540 Ga0207707_10013205 3300025912 Bacteria 7198
541 Ga0207707_10016536 3300025912 Bacteria 6432
542 Ga0207707_10045493 3300025912 Bacteria 3824
543 Ga0207707_10048026 3300025912 Bacteria 3718
544 Ga0207707_10054388 3300025912 Bacteria 3484
545 Ga0207707_10185179 3300025912 Bacteria 1817
546 Ga0207707_10270557 3300025912 Bacteria 1472
547 Ga0207695_10000065 3300025913 Bacteria 336949
548 Ga0207695_10039529 3300025913 Bacteria 5070
549 Ga0207695_10061853 3300025913 Bacteria 3868
550 Ga0207695_10121465 3300025913 Bacteria 2579
551 Ga0207695_10226543 3300025913 Bacteria 1775
552 Ga0207695_10253146 3300025913 Bacteria 1660
553 Ga0207671_10007730 3300025914 Bacteria 9263
554 Ga0207671_10127485 3300025914 Bacteria 1951
555 Ga0207671_10230254 3300025914 Bacteria 1454
556 Ga0207693_10003459 3300025915 Bacteria 13475
557 Ga0207693_10011810 3300025915 Bacteria 7058
558 Ga0207693_10015786 3300025915 Bacteria 6051
559 Ga0207693_10020936 3300025915 Bacteria 5199
560 Ga0207693_10038354 3300025915 Bacteria 3774
561 Ga0207693_10039222 3300025915 Bacteria 3729
562 Ga0207693_10155039 3300025915 Bacteria 1801
563 Ga0207693_10155930 3300025915 Bacteria 1796
564 Ga0207693_10389899 3300025915 Bacteria 1089
565 Ga0207663_10003639 3300025916 Bacteria 7569
566 Ga0207663_10016309 3300025916 Bacteria 4116
567 Ga0207663_10120386 3300025916 Bacteria 1796
568 Ga0207663_10177409 3300025916 Bacteria 1518
569 Ga0207660_10002540 3300025917 Bacteria 11980
570 Ga0207660_10054201 3300025917 Bacteria 2861
571 Ga0207660_10068382 3300025917 Bacteria 2576
572 Ga0207660_10106273 3300025917 Bacteria 2104
573 Ga0207660_10114374 3300025917 Bacteria 2035
574 Ga0207662_10007651 3300025918 Bacteria 5888
575 Ga0207657_10005739 3300025919 Bacteria 12948
576 Ga0207657_10015379 3300025919 Bacteria 7413
577 Ga0207657_10017678 3300025919 Bacteria 6831
578 Ga0207657_10029015 3300025919 Bacteria 5042
579 Ga0207657_10042135 3300025919 Bacteria 4030
580 Ga0207657_10052437 3300025919 Bacteria 3540
581 Ga0207649_10066933 3300025920 Bacteria 2279
582 Ga0207649_10121501 3300025920 Bacteria 1761
583 Ga0207652_10013963 3300025921 Bacteria 6502
584 Ga0207652_10014386 3300025921 Bacteria 6411
585 Ga0207652_10015702 3300025921 Bacteria 6168
586 Ga0207652_10027682 3300025921 Bacteria 4725
587 Ga0207652_10042711 3300025921 Bacteria 3860
588 Ga0207652_10048255 3300025921 Bacteria 3639
589 Ga0207652_10050636 3300025921 Bacteria 3559
590 Ga0207652_10099026 3300025921 Bacteria 2572
591 Ga0207646_10240581 3300025922 Bacteria 1635
592 Ga0207681_10022271 3300025923 Bacteria 4040
593 Ga0207681_10274216 3300025923 Bacteria 1325
594 Ga0207694_10032644 3300025924 Bacteria 3986
595 Ga0207694_10036268 3300025924 Bacteria 3784
596 Ga0207694_10082032 3300025924 Bacteria 2534
597 Ga0207694_10082447 3300025924 Bacteria 2528
598 Ga0207694_10129724 3300025924 Bacteria 2020
599 Ga0207650_10007377 3300025925 Bacteria 7483
600 Ga0207650_10014950 3300025925 Bacteria 5400
601 Ga0207650_10082521 3300025925 Bacteria 2440
602 Ga0207659_10021913 3300025926 Bacteria 4249
603 Ga0207659_10089851 3300025926 Bacteria 2291
604 Ga0207687_10008300 3300025927 Bacteria 6795
605 Ga0207687_10120142 3300025927 Bacteria 1964
606 Ga0207700_10005380 3300025928 Bacteria 7648
607 Ga0207700_10008212 3300025928 Bacteria 6450
608 Ga0207700_10038128 3300025928 Bacteria 3486
609 Ga0207700_10051647 3300025928 Bacteria 3069
610 Ga0207700_10080459 3300025928 Bacteria 2541
611 Ga0207700_10080495 3300025928 Bacteria 2540
612 Ga0207700_10081413 3300025928 Bacteria 2528
613 Ga0207700_10320196 3300025928 Bacteria 1344
614 Ga0207700_10321576 3300025928 Bacteria 1341
615 Ga0207700_10416894 3300025928 Bacteria 1179
616 Ga0207700_10477377 3300025928 Bacteria 1101
617 Ga0207664_10014759 3300025929 Bacteria 5653
618 Ga0207664_10026436 3300025929 Bacteria 4387
619 Ga0207664_10048111 3300025929 Bacteria 3353
620 Ga0207664_10049035 3300025929 Bacteria 3323
621 Ga0207664_10119144 3300025929 Bacteria 2207
622 Ga0207664_10211772 3300025929 Bacteria 1677
623 Ga0207664_10474617 3300025929 Bacteria 1118
624 Ga0207644_10004262 3300025931 Bacteria 9279
625 Ga0207644_10021955 3300025931 Bacteria 4354
626 Ga0207644_10088296 3300025931 Bacteria 2306
627 Ga0207644_10093566 3300025931 Bacteria 2244
628 Ga0207690_10038216 3300025932 Bacteria 3123
629 Ga0207690_10252578 3300025932 Bacteria 1363
630 Ga0207706_10004619 3300025933 Bacteria 12913
631 Ga0207706_10048059 3300025933 Bacteria 3774
632 Ga0207686_10022966 3300025934 Bacteria 3596
633 Ga0207686_10051195 3300025934 Bacteria 2572
634 Ga0207686_10075727 3300025934 Bacteria 2179
635 Ga0207686_10226177 3300025934 Bacteria 1354
636 Ga0207709_10077032 3300025935 Bacteria 2136
637 Ga0207670_10001217 3300025936 Bacteria 13596
638 Ga0207670_10006412 3300025936 Bacteria 6523
639 Ga0207670_10050336 3300025936 Bacteria 2791
640 Ga0207670_10172573 3300025936 Bacteria 1622
641 Ga0207670_10314292 3300025936 Bacteria 1231
642 Ga0207669_10004872 3300025937 Bacteria 5960
643 Ga0207669_10009349 3300025937 Bacteria 4662
644 Ga0207669_10181023 3300025937 Bacteria 1511
645 Ga0207704_10004552 3300025938 Bacteria 6345
646 Ga0207665_10002138 3300025939 Bacteria 13362
647 Ga0207665_10008609 3300025939 Bacteria 6715
648 Ga0207665_10078370 3300025939 Bacteria 2269
649 Ga0207665_10174573 3300025939 Bacteria 1554
650 Ga0207691_10001917 3300025940 Bacteria 20311
651 Ga0207691_10174662 3300025940 Bacteria 1880
652 Ga0207711_10014530 3300025941 Bacteria 6544
653 Ga0207711_10019748 3300025941 Bacteria 5613
654 Ga0207711_10023214 3300025941 Bacteria 5191
655 Ga0207711_10029268 3300025941 Bacteria 4644
656 Ga0207711_10146375 3300025941 Bacteria 2129
657 Ga0207689_10019992 3300025942 Bacteria 5640
658 Ga0207689_10080850 3300025942 Bacteria 2671
659 Ga0207689_10137231 3300025942 Bacteria 2014
660 Ga0207661_10007410 3300025944 Bacteria 7808
661 Ga0207661_10019988 3300025944 Bacteria 4999
662 Ga0207661_10057286 3300025944 Bacteria 3132
663 Ga0207661_10126696 3300025944 Bacteria 2182
664 Ga0207679_10030410 3300025945 Bacteria 3770
665 Ga0207679_10117707 3300025945 Bacteria 2109
666 Ga0207679_10283352 3300025945 Bacteria 1422
667 Ga0207667_10024097 3300025949 Bacteria 6690
668 Ga0207667_10057316 3300025949 Bacteria 4089
669 Ga0207667_10070726 3300025949 Bacteria 3631
670 Ga0207667_10189132 3300025949 Bacteria 2113
671 Ga0207651_10012605 3300025960 Bacteria 4794
672 Ga0207651_10024835 3300025960 Bacteria 3714
673 Ga0207651_10040262 3300025960 Bacteria 3089
674 Ga0207712_10005147 3300025961 Bacteria 8274
675 Ga0207712_10027706 3300025961 Bacteria 3785
676 Ga0207712_10293671 3300025961 Bacteria 1331
677 Ga0207712_10319838 3300025961 Bacteria 1280
678 Ga0207712_10351585 3300025961 Bacteria 1225
679 Ga0207668_10023269 3300025972 Bacteria 3978
680 Ga0207668_10109093 3300025972 Bacteria 2073
681 Ga0207668_10122210 3300025972 Bacteria 1973
682 Ga0207668_10123514 3300025972 Bacteria 1964
683 Ga0207668_10351600 3300025972 Bacteria 1232
684 Ga0207640_10176736 3300025981 Bacteria 1596
685 Ga0207658_10037986 3300025986 Bacteria 3465
686 Ga0207658_10176273 3300025986 Bacteria 1766
687 Ga0207658_10557680 3300025986 Bacteria 1026
688 Ga0207677_10043281 3300026023 Bacteria 2992
689 Ga0207677_10087126 3300026023 Bacteria 2259
690 Ga0207703_10004180 3300026035 Bacteria 11899
691 Ga0207703_10010048 3300026035 Bacteria 7419
692 Ga0207703_10426565 3300026035 Bacteria 1235
693 Ga0207639_10314385 3300026041 Bacteria 1389
694 Ga0207678_10004077 3300026067 Bacteria 13141
695 Ga0207678_10014823 3300026067 Bacteria 6859
696 Ga0207678_10017350 3300026067 Bacteria 6320
697 Ga0207678_10024871 3300026067 Bacteria 5229
698 Ga0207678_10195776 3300026067 Bacteria 1728
699 Ga0207708_10000770 3300026075 Bacteria 24151
700 Ga0207708_10002274 3300026075 Bacteria 14164
701 Ga0207708_10154554 3300026075 Bacteria 1808
702 Ga0207702_10001131 3300026078 Bacteria 27241
703 Ga0207702_10012149 3300026078 Bacteria 7164
704 Ga0207702_10070783 3300026078 Bacteria 3001
705 Ga0207702_10193307 3300026078 Bacteria 1882
706 Ga0207641_10006517 3300026088 Bacteria 9824
707 Ga0207641_10084754 3300026088 Bacteria 2759
708 Ga0207648_10010742 3300026089 Bacteria 8654
709 Ga0207648_10395638 3300026089 Bacteria 1251
710 Ga0207676_10003488 3300026095 Bacteria 11136
711 Ga0207676_10008505 3300026095 Bacteria 7298
712 Ga0207676_10010089 3300026095 Bacteria 6720
713 Ga0207676_10118967 3300026095 Bacteria 2224
714 Ga0207676_10265682 3300026095 Bacteria 1551
715 Ga0207676_10292679 3300026095 Bacteria 1483
716 Ga0207674_10014465 3300026116 Bacteria 8713
717 Ga0207675_100005913 3300026118 Bacteria 11677
718 Ga0207683_10001479 3300026121 Bacteria 21177
719 Ga0207683_10007199 3300026121 Bacteria 9537
720 Ga0207683_10009426 3300026121 Bacteria 8319
721 Ga0207683_10297484 3300026121 Bacteria 1476
722 Ga0207683_10583393 3300026121 Bacteria 1034
723 Ga0207698_10016401 3300026142 Bacteria 4991
724 Ga0207698_10062830 3300026142 Bacteria 2902
725 Ga0207698_10103408 3300026142 Bacteria 2367
726 Ga0209389_1000015 3300027296 Bacteria 188311
727 Ga0209389_1000029 3300027296 Bacteria 140337
728 Ga0209589_1000055 3300027357 Bacteria 111890
729 Ga0209589_1002201 3300027357 Bacteria 33478
730 Ga0209489_100072 3300027361 Bacteria 138111
731 Ga0209489_100128 3300027361 Bacteria 111890
732 Ga0209489_102968 3300027361 Bacteria 33736
733 Ga0209700_100034 3300027363 Bacteria 197276
734 Ga0209700_100137 3300027363 Bacteria 111890
735 Ga0209179_1019094 3300027512 Bacteria 1316
736 Ga0209813_10008367 3300027866 Bacteria 2611
737 Ga0209813_10013130 3300027866 Bacteria 2205
738 Ga0209813_10061168 3300027866 Bacteria 1202
739 Ga0207428_10051897 3300027907 Bacteria 3277
740 Ga0268266_10001689 3300028379 Bacteria 25367
741 Ga0268266_10008142 3300028379 Bacteria 9359
742 Ga0268266_10039407 3300028379 Bacteria 4025
743 Ga0268266_10078587 3300028379 Bacteria 2871
744 Ga0268266_10109570 3300028379 Bacteria 2445
745 Ga0268266_10382885 3300028379 Bacteria 1327
746 Ga0268266_10402911 3300028379 Bacteria 1294
747 Ga0268265_10002768 3300028380 Bacteria 12939
748 Ga0268265_10051595 3300028380 Bacteria 3105
749 Ga0268265_10076786 3300028380 Bacteria 2622
750 Ga0268265_10358773 3300028380 Bacteria 1333
751 Ga0268264_10000049 3300028381 Bacteria 329992
752 Ga0268264_10028003 3300028381 Bacteria 4608
753 Ga0268264_10049361 3300028381 Bacteria 3501
754 Ga0265326_10005717 3300028558 Bacteria 3909
755 Ga0265319_1016216 3300028563 Bacteria 2861
756 Ga0265323_10001980 3300028653 Bacteria 9661
757 Ga0265336_10000752 3300028666 Bacteria 17211
758 Ga0307517_10002374 3300028786 Bacteria 30296
759 Ga0307515_10163396 3300028794 Bacteria 2258
760 Ga0265338_10000024 3300028800 Bacteria 297778
761 Ga0265338_10026793 3300028800 Bacteria 5801
762 Ga0265338_10048070 3300028800 Bacteria 3886
763 Ga0307511_10059305 3300030521 Bacteria 2945
764 Ga0265330_10041769 3300031235 Bacteria 2032
765 Ga0265332_10010470 3300031238 Bacteria 4127
766 Ga0265325_10000172 3300031241 Bacteria 45954
767 Ga0265325_10014646 3300031241 Bacteria 4425
768 Ga0265325_10042020 3300031241 Bacteria 2393
769 Ga0265325_10056018 3300031241 Bacteria 2014
770 Ga0265325_10118455 3300031241 Bacteria 1279
771 Ga0265340_10024110 3300031247 Bacteria 3093
772 Ga0265339_10000531 3300031249 Bacteria 29760
773 Ga0265339_10000900 3300031249 Bacteria 22829
774 Ga0265339_10094334 3300031249 Bacteria 1564
775 Ga0265339_10175052 3300031249 Bacteria 1072
776 Ga0265331_10043063 3300031250 Bacteria 2188
777 Ga0265316_10322924 3300031344 Bacteria 1121
778 Ga0307509_10218313 3300031507 Bacteria 1723
779 Ga0307408_100296925 3300031548 Bacteria 1352
780 Ga0265313_10000171 3300031595 Bacteria 68612
781 Ga0265313_10078415 3300031595 Bacteria 1506
782 Ga0307508_10000046 3300031616 Bacteria 139709
783 Ga0265314_10000672 3300031711 Bacteria 41774
784 Ga0265314_10008415 3300031711 Bacteria 8841
785 Ga0265342_10000510 3300031712 Bacteria 41579
786 Ga0265342_10001860 3300031712 Bacteria 19069
787 Ga0265342_10008960 3300031712 Bacteria 7108
788 Ga0265342_10020650 3300031712 Bacteria 4219
789 Ga0316576_10004636 3300031727 Bacteria 8275
790 Ga0316578_10014387 3300031728 Bacteria 4226
791 Ga0307516_10006465 3300031730 Bacteria 13722
792 Ga0307516_10028476 3300031730 Bacteria 5652
793 Ga0307407_10171113 3300031903 Bacteria 1431
794 Ga0307412_10000103 3300031911 Bacteria 69660
795 Ga0307409_100059652 3300031995 Bacteria 2970
796 Ga0307415_100138991 3300032126 Bacteria 1852
797 Ga0316583_10005017 3300032133 Bacteria 4736
798 Ga0307507_10010582 3300033179 Bacteria 11885
799 Ga0307507_10238670 3300033179 Bacteria 1193
800 Ga0307510_10048558 3300033180 Bacteria 4527
801 Ga0307510_10164006 3300033180 Bacteria 1814
802 Ga0307510_10261843 3300033180 Bacteria 1210
803 Ga0315911_1000024 3300033442 Bacteria 97712
804 Ga0373926_0003841 3300035083 Bacteria 4904
805 Ga0373926_0004802 3300035083 Bacteria 4445
806 Ga0373926_0058940 3300035083 Bacteria 1397
807 Ga0373926_0066139 3300035083 Bacteria 1323
808 Ga0373928_0002001 3300035084 Bacteria 3971
809 Ga0373934_0004838 3300035086 Bacteria 4984
810 Ga0373934_0068065 3300035086 Bacteria 1422
811 Ga0373940_0041333 3300035088 Bacteria 1268
812 Ga0373944_0002147 3300035089 Bacteria 5014
813 Ga0373944_0015553 3300035089 Bacteria 2137
814 Ga0373944_0031029 3300035089 Bacteria 1606
815 Ga0373944_0042495 3300035089 Bacteria 1409
816 Ga0373949_0004828 3300035090 Bacteria 3054
817 Ga0373951_0004988 3300035091 Bacteria 3109
818 Ga0373923_0025274 3300035111 Bacteria 2352
819 Ga0373923_0029815 3300035111 Bacteria 2190
820 Ga0373923_0108314 3300035111 Bacteria 1231
821 Ga0373932_0009187 3300035112 Bacteria 2373
822 Ga0373936_0000512 3300035113 Bacteria 13194
823 Ga0373936_0004573 3300035113 Bacteria 5236
824 Ga0373936_0009978 3300035113 Bacteria 3585
825 Ga0373936_0048610 3300035113 Bacteria 1712
826 Ga0373941_0001456 3300035115 Bacteria 5003
827 Ga0373945_0001308 3300035116 Bacteria 7555
828 Ga0373945_0003133 3300035116 Bacteria 5192
829 Ga0373945_0012390 3300035116 Bacteria 2832
830 Ga0373945_0015826 3300035116 Bacteria 2541
831 Ga0373945_0025796 3300035116 Bacteria 2044
832 Ga0373953_0001200 3300035117 Bacteria 7382
833 Ga0373953_0007800 3300035117 Bacteria 3606
834 Ga0373953_0014947 3300035117 Bacteria 2802
835 Ga0373954_0000692 3300035118 Bacteria 12921
836 Ga0373954_0006081 3300035118 Bacteria 5251
837 Ga0373954_0085527 3300035118 Bacteria 1510
838 Ga0373954_0171162 3300035118 Bacteria 1064
839 Ga0373956_0001947 3300035119 Bacteria 8537
840 Ga0373956_0025524 3300035119 Bacteria 2555
841 Ga0373957_0040519 3300035120 Bacteria 1751
842 Ga0373957_0077178 3300035120 Bacteria 1310
843 Ga0373960_0020881 3300035121 Bacteria 1736
844 Ga0373960_0022479 3300035121 Bacteria 1689
845 Ga0373943_0003484 3300035170 Bacteria 7162
846 Ga0373943_0017879 3300035170 Bacteria 3250
847 Ga0373943_0019212 3300035170 Bacteria 3142
848 Ga0373943_0019983 3300035170 Bacteria 3085
849 Ga0373943_0045353 3300035170 Bacteria 2142
850 Ga0373943_0055809 3300035170 Bacteria 1958
851 Ga0373943_0157834 3300035170 Bacteria 1233
852 Ga0373946_0000300 3300035171 Bacteria 16023
853 Ga0373946_0003127 3300035171 Bacteria 5864
854 Ga0373946_0043170 3300035171 Bacteria 1857
855 Ga0373946_0156436 3300035171 Bacteria 1067
856 Ga0373955_0009210 3300035172 Bacteria 4618
857 Ga0373955_0011021 3300035172 Bacteria 4292
858 Ga0373955_0049200 3300035172 Bacteria 2288
859 Ga0373955_0239429 3300035172 Bacteria 1087
860 Ga0373962_0020825 3300035242 Bacteria 1725
861 Ga0316574_0034427 3300035398 Bacteria 3088
862 Ga0316574_0079157 3300035398 Bacteria 2084
863 Ga0373924_0004458 3300035410 Bacteria 4891
864 Ga0373924_0025640 3300035410 Bacteria 2331
865 Ga0373924_0041297 3300035410 Bacteria 1890
866 Ga0373924_0155297 3300035410 Bacteria 1002
867 Ga0373931_0004970 3300035691 Bacteria 6113
868 Ga0373931_0024509 3300035691 Bacteria 3057
869 Ga0373931_0085705 3300035691 Bacteria 1747
870 Ga0373931_0139545 3300035691 Bacteria 1402
871 Ga0373935_0001022 3300035692 Bacteria 15208
872 Ga0373935_0007664 3300035692 Bacteria 6468
873 Ga0373935_0011799 3300035692 Bacteria 5249
874 Ga0373935_0012686 3300035692 Bacteria 5071
875 Ga0373935_0056929 3300035692 Bacteria 2493
876 Ga0373935_0111965 3300035692 Bacteria 1813
877 Ga0373935_0224994 3300035692 Bacteria 1305
878 Ga0373935_0308137 3300035692 Bacteria 1121
879 Ga0373935_0327291 3300035692 Bacteria 1089
880 Ga0373927_0001260 3300035695 Bacteria 19213
881 Ga0373927_0002061 3300035695 Bacteria 14840
882 Ga0373927_0003112 3300035695 Bacteria 12001
883 Ga0373927_0004291 3300035695 Bacteria 10006
884 Ga0373927_0010893 3300035695 Bacteria 6055
885 Ga0373927_0026493 3300035695 Bacteria 3789
886 Ga0373927_0032472 3300035695 Bacteria 3400
887 Ga0373927_0035352 3300035695 Bacteria 3249
888 Ga0373927_0077041 3300035695 Bacteria 2159
889 Ga0373927_0078868 3300035695 Bacteria 2133
890 Ga0373927_0349914 3300035695 Bacteria 974
891 Ga0373933_0003607 3300035724 Bacteria 8584
892 Ga0373933_0024022 3300035724 Bacteria 3488
893 Ga0373933_0225413 3300035724 Bacteria 1203
894 Ga0373947_0000241 3300035725 Bacteria 30788
895 Ga0373947_0000620 3300035725 Bacteria 20963
896 Ga0373947_0003017 3300035725 Bacteria 10036
897 Ga0373947_0007492 3300035725 Bacteria 6315
898 Ga0373947_0052643 3300035725 Bacteria 2452
899 Ga0373947_0071034 3300035725 Bacteria 2134
900 Ga0373937_0001583 3300036401 Bacteria 19121
901 Ga0373937_0001983 3300036401 Bacteria 17123
902 Ga0373937_0016191 3300036401 Bacteria 6616
903 Ga0373937_0038433 3300036401 Bacteria 4360
904 Ga0373937_0045890 3300036401 Bacteria 3994
905 Ga0373937_0322313 3300036401 Bacteria 1462
906 Ga0372808_007251 3300036459 Bacteria 1513
907 Ga0316584_0001325 3300036712 Bacteria 14654
908 Ga0316584_0086273 3300036712 Bacteria 2350
909 Ga0373925_0000016 3300037068 Bacteria 176830
910 Ga0373925_0000631 3300037068 Bacteria 33279
911 Ga0373925_0001674 3300037068 Bacteria 18651
912 Ga0373925_0007864 3300037068 Bacteria 7767
913 Ga0373925_0009628 3300037068 Bacteria 7040
914 Ga0373925_0017870 3300037068 Bacteria 5146
915 Ga0373925_0053414 3300037068 Bacteria 3020
916 Ga0373925_0069115 3300037068 Bacteria 2667
917 Ga0373925_0093659 3300037068 Bacteria 2300
918 Ga0373925_0136572 3300037068 Bacteria 1916
919 Ga0373925_0206020 3300037068 Bacteria 1565
920 Ga0373925_0248833 3300037068 Bacteria 1425
921 Ga0395899_0073300 3300037312 Bacteria 2504
922 Ga0395899_0078472 3300037312 Bacteria 2407
923 Ga0395899_0078996 3300037312 Bacteria 2397
924 Ga0395900_0000833 3300037418 Bacteria 40657
925 Ga0395900_0017039 3300037418 Bacteria 7417
926 Ga0395900_0064230 3300037418 Bacteria 3773
927 Ga0395900_0125461 3300037418 Bacteria 2633
928 Ga0395900_0134840 3300037418 Bacteria 2529
929 Ga0395900_0307078 3300037418 Bacteria 1571
930 Ga0395898_0018138 3300037466 Bacteria 7183
931 Ga0395898_0024605 3300037466 Bacteria 6073
932 Ga0395898_0069008 3300037466 Bacteria 3421
933 Ga0395898_0122892 3300037466 Bacteria 2487
934 Ga0395898_0378763 3300037466 Bacteria 1349
935 Ga0395905_0005852 3300037471 Bacteria 12494
936 Ga0395905_0058561 3300037471 Bacteria 3602
937 Ga0395905_0107113 3300037471 Bacteria 2624
938 Ga0395905_0134711 3300037471 Bacteria 2324
939 Ga0395905_0193045 3300037471 Bacteria 1910
940 Ga0395905_0529498 3300037471 Bacteria 1079
941 Ga0436364_0202668 3300037853 Bacteria 35432
942 Ga0436364_1120433 3300037853 Bacteria 1396
943 Ga0395901_0004639 3300038443 Bacteria 13862
944 Ga0395901_0259486 3300038443 Bacteria 1809
945 Ga0395901_0281908 3300038443 Bacteria 1726
946 Ga0395901_0543685 3300038443 Bacteria 1178
947 Ga0395901_0700285 3300038443 Bacteria 1011
948 Ga0436365_0026354 3300039437 Bacteria 1396
949 Ga0436365_0304790 3300039437 Bacteria 3134
950 Ga0436365_0457267 3300039437 Bacteria 3060
951 Ga0436365_0565346 3300039437 Bacteria 2110
952 Ga0436365_1272384 3300039437 Bacteria 6420
953 Ga0436365_1335625 3300039437 Bacteria 8170
954 Ga0436365_1511404 3300039437 Bacteria 1877
955 Ga0436360_0377848 3300039438 Bacteria 1201
956 Ga0436360_0380016 3300039438 Bacteria 1228
957 Ga0436361_0011309 3300039447 Bacteria 2633
958 Ga0436361_0958477 3300039447 Bacteria 2095
959 Ga0436363_0233079 3300039450 Bacteria 1764
960 Ga0436363_1447658 3300039450 Bacteria 10658
961 Ga0451791_0288844 3300041451 Bacteria 1826
962 Ga0439448_0077412 3300042005 Bacteria 1114
963 Ga0466969_0014167 3300044656 Bacteria 4194
964 Ga0466972_0000258 3300044658 Bacteria 34985
965 Ga0466965_0040505 3300044683 Bacteria 2293
966 Ga0466966_0000238 3300044684 Bacteria 36401
967 Ga0466966_0150241 3300044684 Bacteria 1421
968 Ga0466966_0301424 3300044684 Bacteria 963
969 Ga0466961_0000044 3300044693 Bacteria 76071
970 Ga0466963_0045709 3300044694 Bacteria 2884
971 Ga0466963_0051507 3300044694 Bacteria 2729
972 Ga0466963_0370861 3300044694 Bacteria 1008
973 Ga0466964_0034647 3300044706 Bacteria 2015
974 Ga0466968_0009034 3300044735 Bacteria 3832
975 Ga0466957_0045562 3300044842 Bacteria 2660
976 Ga0466957_0062232 3300044842 Bacteria 2292
977 Ga0466960_0018943 3300044901 Bacteria 3024
978 Ga0466959_0006561 3300045049 Bacteria 8075
979 Ga0466959_0043859 3300045049 Bacteria 3296
980 Ga0466959_0090170 3300045049 Bacteria 2202
981 Ga0466958_0078323 3300045836 Bacteria 2031
982 Ga0466958_0122326 3300045836 Bacteria 1630
983 Ga0466967_0022056 3300045976 Bacteria 5187
984 Ga0466967_0152922 3300045976 Bacteria 2158
985 Ga0466967_0178208 3300045976 Bacteria 2003
986 Ga0495592_0000044 3300046454 Bacteria 118749
987 Ga0495592_0001227 3300046454 Bacteria 17791
988 Ga0495592_0006314 3300046454 Bacteria 8823
989 Ga0495592_0007287 3300046454 Bacteria 8273
990 Ga0495592_0008640 3300046454 Bacteria 7644
991 Ga0495592_0035154 3300046454 Bacteria 3775
992 Ga0495592_0044773 3300046454 Bacteria 3305
993 Ga0495603_0002548 3300046455 Bacteria 10734
994 Ga0495603_0009548 3300046455 Bacteria 5862
995 Ga0495603_0034957 3300046455 Bacteria 3020
996 Ga0495603_0045786 3300046455 Bacteria 2608
997 Ga0495603_0078092 3300046455 Bacteria 1941
998 Ga0495629_0000232 3300046459 Bacteria 49422
999 Ga0495629_0001570 3300046459 Bacteria 17958
1000 Ga0495629_0006223 3300046459 Bacteria 8857
1001 Ga0495629_0027659 3300046459 Bacteria 4026
1002 Ga0495629_0032196 3300046459 Bacteria 3713
1003 Ga0495629_0036482 3300046459 Bacteria 3469
1004 Ga0495629_0052248 3300046459 Bacteria 2859
1005 Ga0495629_0058236 3300046459 Bacteria 2701
1006 Ga0495629_0140456 3300046459 Bacteria 1681
1007 Ga0495629_0176481 3300046459 Bacteria 1481
1008 Ga0495638_0005325 3300046460 Bacteria 9596
1009 Ga0495638_0101959 3300046460 Bacteria 1715
1010 Ga0495641_0003226 3300046461 Bacteria 12372
1011 Ga0495641_0006762 3300046461 Bacteria 7357
1012 Ga0495641_0047786 3300046461 Bacteria 1963
1013 Ga0495641_0093958 3300046461 Bacteria 1340
1014 Ga0495651_0000253 3300046462 Bacteria 41413
1015 Ga0495651_0000661 3300046462 Bacteria 26738
1016 Ga0495651_0005257 3300046462 Bacteria 9865
1017 Ga0495651_0040236 3300046462 Bacteria 3636
1018 Ga0495651_0040822 3300046462 Bacteria 3605
1019 Ga0495651_0053810 3300046462 Bacteria 3097
1020 Ga0495651_0139210 3300046462 Bacteria 1762
1021 Ga0495651_0139918 3300046462 Bacteria 1756
1022 Ga0495653_0001029 3300046463 Bacteria 21492
1023 Ga0495653_0017101 3300046463 Bacteria 5900
1024 Ga0495653_0040843 3300046463 Bacteria 3624
1025 Ga0495653_0084922 3300046463 Bacteria 2330
1026 Ga0495650_0043166 3300046471 Bacteria 1916
1027 Ga0495580_0000435 3300046472 Bacteria 34468
1028 Ga0495580_0017620 3300046472 Bacteria 5335
1029 Ga0495580_0384622 3300046472 Bacteria 948
1030 Ga0495582_0000051 3300046473 Bacteria 59010
1031 Ga0495582_0018382 3300046473 Bacteria 3823
1032 Ga0495582_0018471 3300046473 Bacteria 3813
1033 Ga0495639_0000010 3300046475 Bacteria 93685
1034 Ga0495639_0103979 3300046475 Bacteria 1343
1035 Ga0495639_0115575 3300046475 Bacteria 1276
1036 Ga0495639_0146438 3300046475 Bacteria 1137
1037 Ga0495662_0000097 3300046476 Bacteria 31889
1038 Ga0495662_0001450 3300046476 Bacteria 11729
1039 Ga0495662_0018681 3300046476 Bacteria 3356
1040 Ga0495662_0019329 3300046476 Bacteria 3294
1041 Ga0495662_0027553 3300046476 Bacteria 2744
1042 Ga0495662_0031274 3300046476 Bacteria 2571
1043 Ga0495664_0000364 3300046477 Bacteria 21965
1044 Ga0495664_0000482 3300046477 Bacteria 19803
1045 Ga0495664_0002576 3300046477 Bacteria 9749
1046 Ga0495664_0003263 3300046477 Bacteria 8813
1047 Ga0495664_0010539 3300046477 Bacteria 5189
1048 Ga0495664_0019774 3300046477 Bacteria 3876
1049 Ga0495664_0057543 3300046477 Bacteria 2313
1050 Ga0495664_0142583 3300046477 Bacteria 1453
1051 Ga0495585_0003727 3300046492 Bacteria 10179
1052 Ga0495585_0019697 3300046492 Bacteria 3888
1053 Ga0495594_0001317 3300046499 Bacteria 12926
1054 Ga0495594_0053260 3300046499 Bacteria 2228
1055 Ga0495594_0088895 3300046499 Bacteria 1730
1056 Ga0495594_0103390 3300046499 Bacteria 1603
1057 Ga0495607_0000064 3300046501 Bacteria 104740
1058 Ga0495607_0025799 3300046501 Bacteria 3652
1059 Ga0495606_0015861 3300046507 Bacteria 5782
1060 Ga0495606_0018083 3300046507 Bacteria 5300
1061 Ga0495606_0114368 3300046507 Bacteria 1623
1062 Ga0495608_0001965 3300046511 Bacteria 14732
1063 Ga0495608_0002135 3300046511 Bacteria 14265
1064 Ga0495608_0015847 3300046511 Bacteria 5215
1065 Ga0495608_0032867 3300046511 Bacteria 3507
1066 Ga0495608_0130357 3300046511 Bacteria 1609
1067 Ga0495608_0137716 3300046511 Bacteria 1559
1068 Ga0495608_0178688 3300046511 Bacteria 1343
1069 Ga0495608_0210160 3300046511 Bacteria 1224
1070 Ga0495618_0004765 3300046514 Bacteria 8292
1071 Ga0495618_0011956 3300046514 Bacteria 5267
1072 Ga0495618_0080047 3300046514 Bacteria 2084
1073 Ga0495618_0112757 3300046514 Bacteria 1741
1074 Ga0495618_0242600 3300046514 Bacteria 1132
1075 Ga0495618_0269874 3300046514 Bacteria 1064
1076 Ga0495618_0278255 3300046514 Bacteria 1044
1077 Ga0495620_0057645 3300046515 Bacteria 1629
1078 Ga0495628_0003003 3300046516 Bacteria 15128
1079 Ga0495628_0007200 3300046516 Bacteria 9633
1080 Ga0495628_0007741 3300046516 Bacteria 9267
1081 Ga0495628_0015068 3300046516 Bacteria 6458
1082 Ga0495628_0040482 3300046516 Bacteria 3724
1083 Ga0495628_0054407 3300046516 Bacteria 3156
1084 Ga0495628_0335112 3300046516 Bacteria 1114
1085 Ga0495630_0005321 3300046517 Bacteria 9084
1086 Ga0495630_0012344 3300046517 Bacteria 6200
1087 Ga0495630_0076352 3300046517 Bacteria 2524
1088 Ga0495630_0081372 3300046517 Bacteria 2444
1089 Ga0495630_0146060 3300046517 Bacteria 1799
1090 Ga0495630_0240784 3300046517 Bacteria 1382
1091 Ga0495644_0001708 3300046523 Bacteria 8889
1092 Ga0495648_0030402 3300046524 Bacteria 3571
1093 Ga0495663_0029857 3300046525 Bacteria 1612
1094 Ga0495663_0060398 3300046525 Bacteria 1191
1095 Ga0495666_0006389 3300046526 Bacteria 5936
1096 Ga0495666_0013021 3300046526 Bacteria 4145
1097 Ga0495666_0023376 3300046526 Bacteria 3056
1098 Ga0495666_0126716 3300046526 Bacteria 1194
1099 Ga0495652_0000002 3300046529 Bacteria 946606
1100 Ga0495652_0001763 3300046529 Bacteria 23231
1101 Ga0495652_0005848 3300046529 Bacteria 11516
1102 Ga0495652_0019544 3300046529 Bacteria 6030
1103 Ga0495652_0058485 3300046529 Bacteria 3263
1104 Ga0495652_0078225 3300046529 Bacteria 2739
1105 Ga0495652_0120528 3300046529 Bacteria 2093
1106 Ga0495652_0153662 3300046529 Bacteria 1794
1107 Ga0495665_0000005 3300046531 Bacteria 86491
1108 Ga0495665_0010221 3300046531 Bacteria 5083
1109 Ga0495665_0119855 3300046531 Bacteria 1378
1110 Ga0495640_0000001 3300046533 Bacteria 853827
1111 Ga0495640_0000301 3300046533 Bacteria 33996
1112 Ga0495640_0001062 3300046533 Bacteria 21365
1113 Ga0495640_0006334 3300046533 Bacteria 9380
1114 Ga0495640_0048999 3300046533 Bacteria 2915
1115 Ga0495640_0060262 3300046533 Bacteria 2581
1116 Ga0495640_0105528 3300046533 Bacteria 1845
1117 Ga0495640_0299605 3300046533 Bacteria 999
1118 Ga0495586_0061184 3300046535 Bacteria 2049
1119 Ga0495587_0000339 3300046536 Bacteria 33290
1120 Ga0495587_0015987 3300046536 Bacteria 4670
1121 Ga0495587_0016313 3300046536 Bacteria 4622
1122 Ga0495587_0028398 3300046536 Bacteria 3401
1123 Ga0495587_0030016 3300046536 Bacteria 3298
1124 Ga0495597_0042922 3300046542 Bacteria 2015
1125 Ga0495645_0004632 3300046543 Bacteria 9384
1126 Ga0495645_0016566 3300046543 Bacteria 5266
1127 Ga0495645_0040374 3300046543 Bacteria 3404
1128 Ga0495645_0066870 3300046543 Bacteria 2596
1129 Ga0495645_0107754 3300046543 Bacteria 1974
1130 Ga0495645_0145371 3300046543 Bacteria 1652
1131 Ga0495622_0003279 3300046557 Bacteria 7659
1132 Ga0495622_0153665 3300046557 Bacteria 1040
1133 Ga0495633_0031217 3300046558 Bacteria 2585
1134 Ga0495667_0000009 3300046559 Bacteria 223329
1135 Ga0495667_0003780 3300046559 Bacteria 10164
1136 Ga0495667_0006028 3300046559 Bacteria 8202
1137 Ga0495667_0013521 3300046559 Bacteria 5522
1138 Ga0495667_0018134 3300046559 Bacteria 4755
1139 Ga0495667_0038983 3300046559 Bacteria 3162
1140 Ga0495667_0095404 3300046559 Bacteria 1926
1141 Ga0495667_0112092 3300046559 Bacteria 1763
1142 Ga0495656_0024551 3300046615 Bacteria 2382
1143 Ga0495656_0049604 3300046615 Bacteria 1788
1144 Ga0495668_0034059 3300046616 Bacteria 2860
1145 Ga0495668_0098265 3300046616 Bacteria 1602
1146 Ga0495634_0001363 3300046642 Bacteria 22160
1147 Ga0495634_0005745 3300046642 Bacteria 9474
1148 Ga0495634_0006327 3300046642 Bacteria 9011
1149 Ga0495634_0017883 3300046642 Bacteria 5053
1150 Ga0495634_0019088 3300046642 Bacteria 4873
1151 Ga0495634_0026669 3300046642 Bacteria 4030
1152 Ga0495634_0061968 3300046642 Bacteria 2485
1153 Ga0495611_0098375 3300046648 Bacteria 1357
1154 Ga0495635_0000002 3300046663 Bacteria 490490
1155 Ga0495635_0000213 3300046663 Bacteria 36809
1156 Ga0495635_0000259 3300046663 Bacteria 33960
1157 Ga0495635_0000813 3300046663 Bacteria 20461
1158 Ga0495635_0001322 3300046663 Bacteria 16499
1159 Ga0495635_0018124 3300046663 Bacteria 4916
1160 Ga0495635_0026052 3300046663 Bacteria 4072
1161 Ga0495635_0039347 3300046663 Bacteria 3271
1162 Ga0495635_0066125 3300046663 Bacteria 2479
1163 Ga0495659_0008292 3300046664 Bacteria 3308
1164 Ga0495661_0227881 3300046665 Bacteria 962
1165 Ga0495588_0007311 3300046674 Bacteria 5020
1166 Ga0495588_0020968 3300046674 Bacteria 3216
1167 Ga0495657_0001192 3300046675 Bacteria 22779
1168 Ga0495657_0003526 3300046675 Bacteria 12759
1169 Ga0495657_0010007 3300046675 Bacteria 7154
1170 Ga0495657_0018057 3300046675 Bacteria 5112
1171 Ga0495657_0032245 3300046675 Bacteria 3658
1172 Ga0495599_0001319 3300046678 Bacteria 14145
1173 Ga0495599_0012983 3300046678 Bacteria 5141
1174 Ga0495599_0014688 3300046678 Bacteria 4849
1175 Ga0495599_0022225 3300046678 Bacteria 3959
1176 Ga0495599_0032392 3300046678 Bacteria 3282
1177 Ga0495599_0078143 3300046678 Bacteria 2066
1178 Ga0495599_0088135 3300046678 Bacteria 1937
1179 Ga0495623_0004990 3300046679 Bacteria 8707
1180 Ga0495623_0011272 3300046679 Bacteria 5782
1181 Ga0495623_0014016 3300046679 Bacteria 5194
1182 Ga0495623_0019757 3300046679 Bacteria 4355
1183 Ga0495623_0030566 3300046679 Bacteria 3465
1184 Ga0495623_0035476 3300046679 Bacteria 3196
1185 Ga0495646_0007201 3300046680 Bacteria 7066
1186 Ga0495646_0016867 3300046680 Bacteria 4639
1187 Ga0495646_0018694 3300046680 Bacteria 4389
1188 Ga0495646_0027795 3300046680 Bacteria 3546
1189 Ga0495647_0001559 3300046681 Bacteria 7072
1190 Ga0495647_0009117 3300046681 Bacteria 3351
1191 Ga0495647_0035989 3300046681 Bacteria 1861
1192 Ga0495647_0070741 3300046681 Bacteria 1396
1193 Ga0495658_0000185 3300046683 Bacteria 35903
1194 Ga0495658_0000635 3300046683 Bacteria 19067
1195 Ga0495669_0026908 3300046684 Bacteria 2514
1196 Ga0495613_0003704 3300046689 Bacteria 11464
1197 Ga0495613_0004294 3300046689 Bacteria 10676
1198 Ga0495613_0167887 3300046689 Bacteria 1558
1199 Ga0495613_0300975 3300046689 Bacteria 1110
1200 Ga0495613_0320693 3300046689 Bacteria 1069
1201 Ga0495624_0000094 3300046690 Bacteria 59911
1202 Ga0495624_0025722 3300046690 Bacteria 3862
1203 Ga0495670_0018272 3300046691 Bacteria 3452
1204 Ga0495649_0020109 3300046694 Bacteria 3746
1205 Ga0495589_0048226 3300046794 Bacteria 2109
1206 Ga0495600_0000010 3300046809 Bacteria 143675
1207 Ga0495600_0000568 3300046809 Bacteria 19159
1208 Ga0495600_0003882 3300046809 Bacteria 8871
1209 Ga0495600_0005746 3300046809 Bacteria 7495
1210 Ga0495600_0016916 3300046809 Bacteria 4635
1211 Ga0495600_0028884 3300046809 Bacteria 3588
1212 Ga0495581_0000810 3300047315 Bacteria 16618
1213 Ga0495581_0001207 3300047315 Bacteria 14212
1214 Ga0495581_0056430 3300047315 Bacteria 2267
1215 Ga0495581_0058413 3300047315 Bacteria 2227
1216 Ga0495581_0118388 3300047315 Bacteria 1541
1217 Ga0495581_0152445 3300047315 Bacteria 1350
1218 Ga0495604_0001130 3300047317 Bacteria 22166
1219 Ga0495604_0005793 3300047317 Bacteria 9804
1220 Ga0495604_0025442 3300047317 Bacteria 4716
1221 Ga0495604_0029420 3300047317 Bacteria 4370
1222 Ga0495604_0042924 3300047317 Bacteria 3542
1223 Ga0495604_0078815 3300047317 Bacteria 2471
1224 Ga0495636_0045411 3300047318 Bacteria 1831
1225 Ga0495674_0000955 3300047319 Bacteria 27621
1226 Ga0495674_0002947 3300047319 Bacteria 16544
1227 Ga0495674_0011063 3300047319 Bacteria 8518
1228 Ga0495674_0013466 3300047319 Bacteria 7691
1229 Ga0495674_0054574 3300047319 Bacteria 3509
1230 Ga0495674_0072102 3300047319 Bacteria 2979
1231 Ga0495674_0115024 3300047319 Bacteria 2277
1232 Ga0495674_0129599 3300047319 Bacteria 2126
1233 Ga0495672_0051270 3300047320 Bacteria 2431
1234 Ga0495676_0023528 3300047321 Bacteria 5347
1235 Ga0495676_0040390 3300047321 Bacteria 3851
1236 Ga0495676_0040884 3300047321 Bacteria 3823
1237 Ga0495676_0119875 3300047321 Bacteria 1915
1238 Ga0495676_0161927 3300047321 Bacteria 1582
1239 Ga0495676_0179245 3300047321 Bacteria 1486
1240 Ga0495676_0254389 3300047321 Bacteria 1197
1241 Ga0495680_0006062 3300047322 Bacteria 11299
1242 Ga0495680_0023323 3300047322 Bacteria 5147
1243 Ga0495680_0033363 3300047322 Bacteria 4169
1244 Ga0495680_0040819 3300047322 Bacteria 3693
1245 Ga0495680_0044218 3300047322 Bacteria 3522
1246 Ga0495680_0047217 3300047322 Bacteria 3388
1247 Ga0495680_0085519 3300047322 Bacteria 2374
1248 Ga0495680_0186936 3300047322 Bacteria 1492
1249 Ga0495683_0084726 3300047323 Bacteria 1542
1250 Ga0495675_0005496 3300047444 Bacteria 7732
1251 Ga0495675_0017113 3300047444 Bacteria 4589
1252 Ga0495675_0029142 3300047444 Bacteria 3519
1253 Ga0495684_0000052 3300047471 Bacteria 85125
1254 Ga0495684_0000075 3300047471 Bacteria 67922
1255 Ga0495684_0000926 3300047471 Bacteria 23821
1256 Ga0495684_0003709 3300047471 Bacteria 11908
1257 Ga0495684_0006090 3300047471 Bacteria 9381
1258 Ga0495684_0012001 3300047471 Bacteria 6681
1259 Ga0495684_0017009 3300047471 Bacteria 5603
1260 Ga0495684_0019673 3300047471 Bacteria 5201
1261 Ga0495684_0025902 3300047471 Bacteria 4507
1262 Ga0495684_0027840 3300047471 Bacteria 4341
1263 Ga0495686_0073512 3300047472 Bacteria 2100
1264 Ga0495593_0000126 3300047673 Bacteria 37465
1265 Ga0495593_0001157 3300047673 Bacteria 15399
1266 Ga0495593_0051507 3300047673 Bacteria 2178
1267 Ga0495593_0061081 3300047673 Bacteria 1972
1268 Ga0495593_0063127 3300047673 Bacteria 1935
1269 Ga0495593_0093497 3300047673 Bacteria 1547
1270 Ga0495593_0127787 3300047673 Bacteria 1291
1271 Ga0495602_0000961 3300048088 Bacteria 27859
1272 Ga0495602_0029436 3300048088 Bacteria 5228
1273 Ga0495602_0095135 3300048088 Bacteria 2460
1274 Ga0495602_0229156 3300048088 Bacteria 1397
1275 Ga0496100_0005435 3300048903 Bacteria 6863
1276 Ga0496100_0006368 3300048903 Bacteria 6432
1277 Ga0496100_0006530 3300048903 Bacteria 6365
1278 Ga0496100_0010870 3300048903 Bacteria 5166
1279 Ga0496100_0021484 3300048903 Bacteria 3888
1280 Ga0496100_0079179 3300048903 Bacteria 2214
1281 Ga0496101_0001493 3300048904 Bacteria 13985
1282 Ga0496101_0002221 3300048904 Bacteria 11860
1283 Ga0496101_0020971 3300048904 Bacteria 4484
1284 Ga0496101_0062448 3300048904 Bacteria 2708
1285 Ga0496101_0204784 3300048904 Bacteria 1526
1286 Ga0496101_0385119 3300048904 Bacteria 1103
1287 Ga0496102_0001781 3300048905 Bacteria 18686
1288 Ga0496102_0008430 3300048905 Bacteria 8836
1289 Ga0496102_0028731 3300048905 Bacteria 4970
1290 Ga0496102_0029360 3300048905 Bacteria 4921
1291 Ga0496102_0045105 3300048905 Bacteria 4001
1292 Ga0496102_0071720 3300048905 Bacteria 3181
1293 Ga0496102_0203713 3300048905 Bacteria 1865
1294 Ga0496102_0226922 3300048905 Bacteria 1761
1295 Ga0496102_0718995 3300048905 Bacteria 921
1296 Ga0496103_0007075 3300048906 Bacteria 6698
1297 Ga0496103_0008195 3300048906 Bacteria 6202
1298 Ga0496103_0032222 3300048906 Bacteria 3197
1299 Ga0496103_0082399 3300048906 Bacteria 2025
1300 Ga0496103_0083500 3300048906 Bacteria 2011
1301 Ga0496103_0119195 3300048906 Bacteria 1680
1302 Ga0496103_0146710 3300048906 Bacteria 1510
1303 Ga0496103_0294031 3300048906 Bacteria 1045
1304 Ga0496104_0000061 3300048907 Bacteria 117394
1305 Ga0496104_0000609 3300048907 Bacteria 30631
1306 Ga0496104_0001668 3300048907 Bacteria 19171
1307 Ga0496104_0003575 3300048907 Bacteria 13418
1308 Ga0496104_0019358 3300048907 Bacteria 6226
1309 Ga0496104_0033146 3300048907 Bacteria 4809
1310 Ga0496104_0041734 3300048907 Bacteria 4303
1311 Ga0496104_0066397 3300048907 Bacteria 3425
1312 Ga0496104_0067695 3300048907 Bacteria 3393
1313 Ga0496104_0078472 3300048907 Bacteria 3146
1314 Ga0496104_0091551 3300048907 Bacteria 2907
1315 Ga0496104_0140930 3300048907 Bacteria 2316
1316 Ga0496104_0288235 3300048907 Bacteria 1554
1317 Ga0496104_0558394 3300048907 Bacteria 1055
1318 Ga0496105_0001465 3300048908 Bacteria 16650
1319 Ga0496105_0003662 3300048908 Bacteria 11422
1320 Ga0496105_0008016 3300048908 Bacteria 8205
1321 Ga0496105_0010336 3300048908 Bacteria 7338
1322 Ga0496105_0022841 3300048908 Bacteria 5069
1323 Ga0496105_0034713 3300048908 Bacteria 4149
1324 Ga0496105_0074763 3300048908 Bacteria 2799
1325 Ga0496105_0081035 3300048908 Bacteria 2681
1326 Ga0496105_0109073 3300048908 Bacteria 2285
1327 Ga0496105_0131763 3300048908 Bacteria 2061
1328 Ga0496105_0148215 3300048908 Bacteria 1929
1329 Ga0496105_0197562 3300048908 Bacteria 1642
1330 Ga0496106_0001113 3300048909 Bacteria 19902
1331 Ga0496106_0001992 3300048909 Bacteria 15367
1332 Ga0496106_0006260 3300048909 Bacteria 8811
1333 Ga0496106_0040310 3300048909 Bacteria 3497
1334 Ga0496106_0054703 3300048909 Bacteria 3015
1335 Ga0496106_0075309 3300048909 Bacteria 2585
1336 Ga0496106_0159187 3300048909 Bacteria 1785
1337 Ga0496106_0312894 3300048909 Bacteria 1260
1338 Ga0496106_0387150 3300048909 Bacteria 1123
1339 Ga0496107_0002763 3300048910 Bacteria 11556
1340 Ga0496107_0003376 3300048910 Bacteria 10669
1341 Ga0496107_0007523 3300048910 Bacteria 7515
1342 Ga0496107_0050280 3300048910 Bacteria 3005
1343 Ga0496107_0140827 3300048910 Bacteria 1783
1344 Ga0496107_0154440 3300048910 Bacteria 1699
1345 Ga0496107_0199782 3300048910 Bacteria 1486
1346 Ga0496107_0255305 3300048910 Bacteria 1304
1347 Ga0496107_0326288 3300048910 Bacteria 1142
1348 Ga0496108_0005596 3300048911 Bacteria 10167
1349 Ga0496108_0013672 3300048911 Bacteria 6626
1350 Ga0496108_0021274 3300048911 Bacteria 5331
1351 Ga0496108_0030784 3300048911 Bacteria 4447
1352 Ga0496108_0053664 3300048911 Bacteria 3380
1353 Ga0496108_0076111 3300048911 Bacteria 2836
1354 Ga0496108_0172970 3300048911 Bacteria 1869
1355 Ga0496108_0180395 3300048911 Bacteria 1828
1356 Ga0496108_0201460 3300048911 Bacteria 1727
1357 Ga0496109_0003609 3300048912 Bacteria 12934
1358 Ga0496109_0007566 3300048912 Bacteria 9206
1359 Ga0496109_0008250 3300048912 Bacteria 8845
1360 Ga0496109_0014576 3300048912 Bacteria 6839
1361 Ga0496109_0022690 3300048912 Bacteria 5559
1362 Ga0496109_0074001 3300048912 Bacteria 3131
1363 Ga0496109_0091236 3300048912 Bacteria 2817
1364 Ga0496109_0179024 3300048912 Bacteria 1991
1365 Ga0496109_0351220 3300048912 Bacteria 1393
1366 Ga0496110_0013969 3300048913 Bacteria 6653
1367 Ga0496110_0019240 3300048913 Bacteria 5742
1368 Ga0496110_0022948 3300048913 Bacteria 5303
1369 Ga0496110_0023702 3300048913 Bacteria 5221
1370 Ga0496110_0145286 3300048913 Bacteria 2145
1371 Ga0496110_0156749 3300048913 Bacteria 2063
1372 Ga0496110_0272917 3300048913 Bacteria 1540
1373 Ga0496110_0414837 3300048913 Bacteria 1227
1374 Ga0496111_0001147 3300048914 Bacteria 14708
1375 Ga0496111_0005665 3300048914 Bacteria 8043
1376 Ga0496111_0007023 3300048914 Bacteria 7355
1377 Ga0496111_0021137 3300048914 Bacteria 4540
1378 Ga0496111_0048639 3300048914 Bacteria 3055
1379 Ga0496111_0082782 3300048914 Bacteria 2344
1380 Ga0496111_0101083 3300048914 Bacteria 2118
1381 Ga0496111_0227256 3300048914 Bacteria 1386
1382 Ga0496112_0000320 3300048915 Bacteria 30902
1383 Ga0496112_0003729 3300048915 Bacteria 12721
1384 Ga0496112_0010005 3300048915 Bacteria 8584
1385 Ga0496112_0014243 3300048915 Bacteria 7370
1386 Ga0496112_0017770 3300048915 Bacteria 6692
1387 Ga0496112_0029874 3300048915 Bacteria 5273
1388 Ga0496112_0130301 3300048915 Bacteria 2486
1389 Ga0496112_0283461 3300048915 Bacteria 1603
1390 Ga0496112_0305971 3300048915 Bacteria 1535
1391 Ga0496112_0385362 3300048915 Bacteria 1342
1392 Ga0496113_0001355 3300048916 Bacteria 13563
1393 Ga0496113_0015228 3300048916 Bacteria 5278
1394 Ga0496113_0025992 3300048916 Bacteria 4182
1395 Ga0496113_0135060 3300048916 Bacteria 1938
1396 Ga0496113_0152079 3300048916 Bacteria 1826
1397 Ga0496113_0162203 3300048916 Bacteria 1767
1398 Ga0496113_0285260 3300048916 Bacteria 1321
1399 Ga0496114_0004710 3300048917 Bacteria 10613
1400 Ga0496114_0089640 3300048917 Bacteria 2610
1401 Ga0496114_0093954 3300048917 Bacteria 2550
1402 Ga0496114_0102898 3300048917 Bacteria 2440
1403 Ga0496114_0353746 3300048917 Bacteria 1299
1404 Ga0496115_0013034 3300048918 Bacteria 6275
1405 Ga0496115_0014471 3300048918 Bacteria 5973
1406 Ga0496115_0019748 3300048918 Bacteria 5189
1407 Ga0496115_0026660 3300048918 Bacteria 4512
1408 Ga0496115_0051029 3300048918 Bacteria 3316
1409 Ga0496115_0059396 3300048918 Bacteria 3079
1410 Ga0496115_0123068 3300048918 Bacteria 2135
1411 Ga0496115_0154466 3300048918 Bacteria 1895
1412 Ga0496115_0159313 3300048918 Bacteria 1865
1413 Ga0496115_0160911 3300048918 Bacteria 1855
1414 Ga0496115_0264191 3300048918 Bacteria 1415
1415 Ga0496115_0306773 3300048918 Bacteria 1300
1416 Ga0496115_0312565 3300048918 Bacteria 1286
1417 Ga0496116_0010631 3300048919 Bacteria 7695
1418 Ga0496116_0100680 3300048919 Bacteria 1727
1419 Ga0496116_0123180 3300048919 Bacteria 1495
1420 Ga0496117_0020466 3300048920 Bacteria 5392
1421 Ga0496117_0037614 3300048920 Bacteria 3603
1422 Ga0496118_0006462 3300048921 Bacteria 12872
1423 Ga0496118_0009493 3300048921 Bacteria 9812
1424 Ga0496118_0012206 3300048921 Bacteria 8276
1425 Ga0496118_0023002 3300048921 Bacteria 5428
1426 Ga0496118_0024593 3300048921 Bacteria 5194
1427 Ga0496118_0190049 3300048921 Bacteria 1229
1428 Ga0496119_0024757 3300048922 Bacteria 4212
1429 Ga0496119_0062207 3300048922 Bacteria 2225
1430 Ga0496119_0097487 3300048922 Bacteria 1657
1431 Ga0496121_0000261 3300048924 Bacteria 110085
1432 Ga0496121_0000416 3300048924 Bacteria 84469
1433 Ga0496121_0000628 3300048924 Bacteria 65856
1434 Ga0496121_0006604 3300048924 Bacteria 14311
1435 Ga0496121_0029126 3300048924 Bacteria 5118
1436 Ga0496121_0081653 3300048924 Bacteria 2558
1437 Ga0496121_0149146 3300048924 Bacteria 1723
1438 Ga0496121_0194358 3300048924 Bacteria 1452
1439 Ga0496122_0000497 3300048925 Bacteria 81763
1440 Ga0496123_0029646 3300048926 Bacteria 4021
1441 Ga0496124_0163540 3300048927 Bacteria 1732
1442 Ga0496124_0267265 3300048927 Bacteria 1254
1443 Ga0496125_0000166 3300048928 Bacteria 147432
1444 Ga0496125_0027392 3300048928 Bacteria 5166
1445 Ga0496125_0070570 3300048928 Bacteria 2734
1446 Ga0496125_0123705 3300048928 Bacteria 1838
1447 Ga0496126_0010106 3300048929 Bacteria 9953
1448 Ga0496126_0011786 3300048929 Bacteria 8999
1449 Ga0496126_0084607 3300048929 Bacteria 2797
1450 Ga0496126_0119757 3300048929 Bacteria 2284
1451 Ga0496126_0149059 3300048929 Bacteria 2006
1452 Ga0496126_0177281 3300048929 Bacteria 1812
1453 Ga0496126_0178339 3300048929 Bacteria 1806
1454 Ga0496126_0236034 3300048929 Bacteria 1530
1455 Ga0496126_0352032 3300048929 Bacteria 1204
1456 Ga0501031_0000538 3300049568 Bacteria 22173
1457 Ga0501031_0174117 3300049568 Bacteria 1406
1458 Ga0501032_0000040 3300049569 Bacteria 115662
1459 Ga0501032_0230052 3300049569 Bacteria 1205
1460 Ga0501033_0000326 3300049570 Bacteria 45367
1461 Ga0501033_0024529 3300049570 Bacteria 4549
1462 Ga0501033_0125932 3300049570 Bacteria 1857
1463 Ga0501034_0000254 3300049571 Bacteria 97896
1464 Ga0501034_0000994 3300049571 Bacteria 40719
1465 Ga0501034_0009264 3300049571 Bacteria 10320
1466 Ga0501034_0028437 3300049571 Bacteria 5689
1467 Ga0501034_0078480 3300049571 Bacteria 3306
1468 Ga0501034_0084677 3300049571 Bacteria 3172
1469 Ga0501034_0143131 3300049571 Bacteria 2370
1470 Ga0501034_0266607 3300049571 Bacteria 1654
1471 Ga0501034_0397206 3300049571 Bacteria 1302
1472 Ga0501034_0442390 3300049571 Bacteria 1218
1473 Ga0501036_0002216 3300049572 Bacteria 15194
1474 Ga0501036_0006289 3300049572 Bacteria 9636
1475 Ga0501036_0011812 3300049572 Bacteria 7237
1476 Ga0501036_0018260 3300049572 Bacteria 5873
1477 Ga0501037_0000041 3300049573 Bacteria 118457
1478 Ga0501037_0024831 3300049573 Bacteria 4430
1479 Ga0501037_0118632 3300049573 Bacteria 1903
1480 Ga0501037_0188854 3300049573 Bacteria 1459
1481 Ga0501038_0000057 3300049574 Bacteria 92766
1482 Ga0501038_0004102 3300049574 Bacteria 13549
1483 Ga0501038_0106246 3300049574 Bacteria 2330
1484 Ga0501039_0000084 3300049575 Bacteria 71542
1485 Ga0501039_0081657 3300049575 Bacteria 2516
1486 Ga0501039_0106653 3300049575 Bacteria 2188
1487 Ga0501039_0256581 3300049575 Bacteria 1374
1488 Ga0501039_0423659 3300049575 Bacteria 1045
1489 Ga0501041_0154257 3300049577 Bacteria 1435
1490 Ga0501041_0177779 3300049577 Bacteria 1332
1491 Ga0501041_0203680 3300049577 Bacteria 1241
1492 Ga0501042_0184041 3300049578 Bacteria 1507
1493 Ga0501042_0245877 3300049578 Bacteria 1291
1494 Ga0501043_0006263 3300049579 Bacteria 9551
1495 Ga0501043_0012441 3300049579 Bacteria 6656
1496 Ga0501043_0032442 3300049579 Bacteria 4107
1497 Ga0501043_0087010 3300049579 Bacteria 2455
1498 Ga0501043_0090780 3300049579 Bacteria 2402
1499 Ga0501043_0098914 3300049579 Bacteria 2293
1500 Ga0501043_0212875 3300049579 Bacteria 1497
1501 Ga0501043_0344258 3300049579 Bacteria 1133
1502 Ga0501046_0000072 3300049580 Bacteria 106407
1503 Ga0501046_0008307 3300049580 Bacteria 9060
1504 Ga0501046_0109239 3300049580 Bacteria 2114
1505 Ga0501046_0157754 3300049580 Bacteria 1708
1506 Ga0501047_0000044 3300049581 Bacteria 174789
1507 Ga0501047_0000659 3300049581 Bacteria 36048
1508 Ga0501047_0006456 3300049581 Bacteria 11031
1509 Ga0501047_0100982 3300049581 Bacteria 2764
1510 Ga0501047_0114465 3300049581 Bacteria 2579
1511 Ga0501047_0240731 3300049581 Bacteria 1660
1512 Ga0501048_0008592 3300049582 Bacteria 7711
1513 Ga0501048_0019853 3300049582 Bacteria 4927
1514 Ga0501048_0105250 3300049582 Bacteria 1991
1515 Ga0501067_0000139 3300049583 Bacteria 39892
1516 Ga0501067_0051747 3300049583 Bacteria 2276
1517 Ga0501067_0093076 3300049583 Bacteria 1673
1518 Ga0501068_0000113 3300049584 Bacteria 34900
1519 Ga0501068_0004565 3300049584 Bacteria 7529
1520 Ga0501068_0027694 3300049584 Bacteria 3347
1521 Ga0501068_0294846 3300049584 Bacteria 1037
1522 Ga0501069_0001905 3300049585 Bacteria 10413
1523 Ga0501069_0004244 3300049585 Bacteria 7409
1524 Ga0501069_0012024 3300049585 Bacteria 4595
1525 Ga0501069_0020506 3300049585 Bacteria 3582
1526 Ga0501069_0043531 3300049585 Bacteria 2485
1527 Ga0501069_0131567 3300049585 Bacteria 1433
1528 Ga0501069_0259289 3300049585 Bacteria 1015
1529 Ga0501070_0013312 3300049586 Bacteria 6937
1530 Ga0501070_0028461 3300049586 Bacteria 4687
1531 Ga0501070_0039368 3300049586 Bacteria 3943
1532 Ga0501070_0092483 3300049586 Bacteria 2503
1533 Ga0501070_0099921 3300049586 Bacteria 2400
1534 Ga0501070_0139013 3300049586 Bacteria 2006
1535 Ga0501070_0167072 3300049586 Bacteria 1813
1536 Ga0501070_0168520 3300049586 Bacteria 1804
1537 Ga0501071_0000889 3300049587 Bacteria 16169
1538 Ga0501071_0322869 3300049587 Bacteria 1172
1539 Ga0501072_0000297 3300049588 Bacteria 35134
1540 Ga0501072_0036785 3300049588 Bacteria 3839
1541 Ga0501072_0082893 3300049588 Bacteria 2542
1542 Ga0501072_0299891 3300049588 Bacteria 1277
1543 Ga0501072_0451750 3300049588 Bacteria 1018
1544 Ga0501073_0000043 3300049589 Bacteria 80142
1545 Ga0501073_0009892 3300049589 Bacteria 7020
1546 Ga0501073_0012757 3300049589 Bacteria 6130
1547 Ga0501073_0047522 3300049589 Bacteria 3016
1548 Ga0501073_0069800 3300049589 Bacteria 2448
1549 Ga0501074_0000111 3300049590 Bacteria 40575
1550 Ga0501074_0001224 3300049590 Bacteria 16927
1551 Ga0501074_0009389 3300049590 Bacteria 7108
1552 Ga0501074_0027180 3300049590 Bacteria 4148
1553 Ga0501074_0085833 3300049590 Bacteria 2255
1554 Ga0501074_0114034 3300049590 Bacteria 1933
1555 Ga0501074_0505445 3300049590 Bacteria 856
1556 Ga0501075_0035666 3300049591 Bacteria 3710
1557 Ga0501075_0186854 3300049591 Bacteria 1581
1558 Ga0501075_0192175 3300049591 Bacteria 1557
1559 Ga0501075_0224924 3300049591 Bacteria 1431
1560 Ga0501076_0070557 3300049592 Bacteria 2794
1561 Ga0501076_0106424 3300049592 Bacteria 2264
1562 Ga0501076_0247850 3300049592 Bacteria 1457
1563 Ga0501076_0431917 3300049592 Bacteria 1084
1564 Ga0501076_0510504 3300049592 Bacteria 991
1565 Ga0501077_0019113 3300049593 Bacteria 4332
1566 Ga0501077_0138902 3300049593 Bacteria 1541
1567 Ga0501079_0001226 3300049741 Bacteria 17962
1568 Ga0501079_0495514 3300049741 Bacteria 960
1569 Ga0501080_0000406 3300049742 Bacteria 33113
1570 Ga0501080_0003893 3300049742 Bacteria 13215
1571 Ga0501080_0142880 3300049742 Bacteria 2213
1572 Ga0501080_0187718 3300049742 Bacteria 1900
1573 Ga0501080_0373358 3300049742 Bacteria 1286
1574 Ga0501081_0004836 3300049743 Bacteria 8656
1575 Ga0501081_0006251 3300049743 Bacteria 7723
1576 Ga0501081_0109385 3300049743 Bacteria 1961
1577 Ga0501081_0140771 3300049743 Bacteria 1729
1578 Ga0501081_0565081 3300049743 Bacteria 850
1579 Ga0501083_0000497 3300049744 Bacteria 25179
1580 Ga0501083_0000723 3300049744 Bacteria 21492
1581 Ga0501083_0026846 3300049744 Bacteria 3978
1582 Ga0501083_0045127 3300049744 Bacteria 2982
1583 Ga0501083_0079706 3300049744 Bacteria 2171
1584 Ga0501083_0105662 3300049744 Bacteria 1854
1585 Ga0501035_0000128 3300049822 Bacteria 92297
1586 Ga0501035_0005717 3300049822 Bacteria 11729
1587 Ga0501035_0012534 3300049822 Bacteria 7831
1588 Ga0501035_0087735 3300049822 Bacteria 2741
1589 Ga0501035_0169958 3300049822 Bacteria 1884
1590 Ga0501035_0179677 3300049822 Bacteria 1823
1591 Ga0501035_0411627 3300049822 Bacteria 1123
1592 Ga0501044_0000907 3300049823 Bacteria 35617
1593 Ga0501044_0118830 3300049823 Bacteria 2646
1594 Ga0501044_0140079 3300049823 Bacteria 2408
1595 Ga0501044_0324430 3300049823 Bacteria 1463
1596 Ga0501044_0405775 3300049823 Bacteria 1275
1597 Ga0501044_0408933 3300049823 Bacteria 1268
1598 Ga0501045_0046844 3300049824 Bacteria 3148
1599 Ga0501045_0067802 3300049824 Bacteria 2621
1600 Ga0501045_0240039 3300049824 Bacteria 1349
1601 nmdc:mga03683_13428_c1 3300050489 Bacteria 3014
1602 nmdc:mga03n38_31526_c1 3300050490 Bacteria 2237
1603 nmdc:mga03n38_5540_c1 3300050490 Bacteria 4306
1604 nmdc:mga03n38_56302_c1 3300050490 Bacteria 1774
1605 nmdc:mga00v17_8695_c1 3300050491 Bacteria 5469
1606 nmdc:mga0yw44_19657_c1 3300050492 Bacteria 3730
1607 nmdc:mga0yw44_22717_c1 3300050492 Bacteria 3521
1608 nmdc:mga0yw44_308755_c1 3300050492 Bacteria 1061
1609 nmdc:mga0yw44_41036_c1 3300050492 Bacteria 2753
1610 nmdc:mga0yw44_49483_c1 3300050492 Bacteria 2537
1611 nmdc:mga0yw44_6869_c1 3300050492 Bacteria 5540
1612 nmdc:mga0yw44_8268_c1 3300050492 Bacteria 5170
1613 nmdc:mga0k408_2679_c1 3300050493 Bacteria 9439
1614 nmdc:mga06z11_123147_c1 3300050494 Bacteria 1449
1615 nmdc:mga06z11_208497_c1 3300050494 Bacteria 1138
1616 nmdc:mga06z11_31552_c1 3300050494 Bacteria 2576
1617 nmdc:mga04h51_58310_c1 3300050495 Bacteria 1316
1618 nmdc:mga04h51_73231_c1 3300050495 Bacteria 1201
1619 nmdc:mga04h51_81641_c1 3300050495 Bacteria 1149
1620 nmdc:mga07m45_36008_c1 3300050496 Bacteria 2754
1621 nmdc:mga07m45_38240_c1 3300050496 Bacteria 2678
1622 nmdc:mga07m45_58146_c1 3300050496 Bacteria 2187
1623 nmdc:mga05p37_178584_c1 3300050507 Bacteria 2585
1624 nmdc:mga05p37_29092_c1 3300050507 Bacteria 6744
1625 nmdc:mga05p37_30389_c1 3300050507 Bacteria 6592
1626 nmdc:mga05p37_37850_c2 3300050507 Bacteria 2555
1627 nmdc:mga05p37_38977_c1 3300050507 Bacteria 5830
1628 nmdc:mga05p37_8357_c1 3300050507 Bacteria 12239
1629 nmdc:mga05p37_90049_c1 3300050507 Bacteria 3781
1630 nmdc:mga09592_15144_c1 3300050508 Bacteria 6300
1631 nmdc:mga09592_23614_c1 3300050508 Bacteria 5080
1632 nmdc:mga09592_249554_c1 3300050508 Bacteria 1538
1633 nmdc:mga09592_5865_c1 3300050508 Bacteria 10024
1634 nmdc:mga0qj67_16351_c1 3300050509 Bacteria 5626
1635 nmdc:mga0qj67_219_c1 3300050509 Bacteria 39116
1636 nmdc:mga0qj67_88489_c1 3300050509 Bacteria 2486
1637 nmdc:mga0qj67_9429_c1 3300050509 Bacteria 7265
1638 nmdc:mga06r32_19261_c1 3300050510 Bacteria 6263
1639 nmdc:mga06r32_271505_c1 3300050510 Bacteria 1683
1640 nmdc:mga06r32_33398_c1 3300050510 Bacteria 4845
1641 nmdc:mga06r32_3354_c1 3300050510 Bacteria 14335
1642 nmdc:mga06r32_79052_c1 3300050510 Bacteria 3199
1643 nmdc:mga06r32_8602_c1 3300050510 Bacteria 9204
1644 nmdc:mga08y16_100943_c1 3300050511 Bacteria 3004
1645 nmdc:mga08y16_111973_c1 3300050511 Bacteria 2841
1646 nmdc:mga08y16_230311_c1 3300050511 Bacteria 1916
1647 nmdc:mga08y16_496379_c1 3300050511 Bacteria 1241
1648 nmdc:mga08y16_59066_c1 3300050511 Bacteria 4007
1649 nmdc:mga08y16_608161_c1 3300050511 Bacteria 1101
1650 nmdc:mga0n895_110086_c1 3300050512 Bacteria 2770
1651 nmdc:mga0n895_14993_c1 3300050512 Bacteria 7060
1652 nmdc:mga0n895_151327_c1 3300050512 Bacteria 2351
1653 nmdc:mga0n895_15401_c1 3300050512 Bacteria 6970
1654 nmdc:mga0n895_180388_c1 3300050512 Bacteria 2143
1655 nmdc:mga0n895_467153_c1 3300050512 Bacteria 1273
1656 nmdc:mga0n895_74754_c1 3300050512 Bacteria 3367
1657 nmdc:mga0n895_82232_c1 3300050512 Bacteria 3210
1658 nmdc:mga0rr50_120223_c1 3300050513 Bacteria 2090
1659 nmdc:mga0rr50_13944_c1 3300050513 Bacteria 5252
1660 nmdc:mga0rr50_16755_c1 3300050513 Bacteria 4877
1661 nmdc:mga0rr50_21786_c1 3300050513 Bacteria 4383
1662 nmdc:mga0rr50_274315_c1 3300050513 Bacteria 1406
1663 nmdc:mga0rr50_34382_c1 3300050513 Bacteria 3629
1664 nmdc:mga0rr50_36300_c1 3300050513 Bacteria 3548
1665 nmdc:mga0a205_164095_c1 3300050515 Bacteria 2117
1666 nmdc:mga0a205_179175_c1 3300050515 Bacteria 2013
1667 nmdc:mga0a205_203985_c1 3300050515 Bacteria 1867
1668 nmdc:mga0a205_2194_c1 3300050515 Bacteria 17183
1669 nmdc:mga0a205_69021_c1 3300050515 Bacteria 3414
1670 Ga0495601_0000002 3300053077 Bacteria 528704
1671 Ga0495601_0000153 3300053077 Bacteria 38651
1672 Ga0495601_0005347 3300053077 Bacteria 7479
1673 Ga0495601_0047948 3300053077 Bacteria 2690
1674 Ga0495601_0064420 3300053077 Bacteria 2330
1675 Ga0495601_0072953 3300053077 Bacteria 2193
1676 Ga0495601_0144424 3300053077 Bacteria 1553
1677 Ga0495612_0001641 3300053078 Bacteria 9209
1678 Ga0495612_0009449 3300053078 Bacteria 3956
1679 Ga0495612_0011420 3300053078 Bacteria 3580
1680 Ga0495612_0037454 3300053078 Bacteria 1969
1681 Ga0495612_0105907 3300053078 Bacteria 1200
1682 Ga0495612_0149687 3300053078 Bacteria 1015
1683 Ga0500635_0001223 3300053080 Bacteria 6146
1684 Ga0500635_0020890 3300053080 Bacteria 2011
1685 Ga0495655_0003922 3300053083 Bacteria 2498
1686 Ga0495595_0000249 3300053084 Bacteria 21288
1687 Ga0495595_0001072 3300053084 Bacteria 10580
1688 Ga0495595_0001191 3300053084 Bacteria 10108
1689 Ga0495595_0012077 3300053084 Bacteria 3622
1690 Ga0495595_0137162 3300053084 Bacteria 1198
1691 Ga0495619_0000003 3300053085 Bacteria 515784
1692 Ga0495619_0000381 3300053085 Bacteria 30508
1693 Ga0495619_0000913 3300053085 Bacteria 19380
1694 Ga0495619_0001259 3300053085 Bacteria 16607
1695 Ga0495619_0002847 3300053085 Bacteria 11273
1696 Ga0495619_0003278 3300053085 Bacteria 10467
1697 Ga0495619_0004023 3300053085 Bacteria 9413
1698 Ga0495619_0013464 3300053085 Bacteria 5153
1699 Ga0495619_0071967 3300053085 Bacteria 2314
1700 Ga0500643_000091 3300053087 Bacteria 93825
1701 Ga0500647_0031533 3300053091 Bacteria 2522
1702 Ga0500566_0000199 3300053094 Bacteria 31473
1703 Ga0500566_0003347 3300053094 Bacteria 9577
1704 Ga0500566_0007593 3300053094 Bacteria 6426
1705 Ga0500566_0112675 3300053094 Bacteria 1477
1706 Ga0500640_018065 3300053095 Bacteria 3003
1707 Ga0500641_0005562 3300053096 Bacteria 4463
1708 Ga0500641_0113177 3300053096 Bacteria 1168
1709 Ga0500555_004861 3300053103 Bacteria 3813
1710 Ga0500556_0102104 3300053104 Bacteria 1105
1711 Ga0500557_000043 3300053105 Bacteria 63389
1712 Ga0500572_000727 3300053111 Bacteria 10647
1713 Ga0500572_003440 3300053111 Bacteria 3621
1714 Ga0500572_031892 3300053111 Bacteria 1475
1715 Ga0500595_000691 3300053119 Bacteria 20144
1716 Ga0500595_003448 3300053119 Bacteria 7372
1717 Ga0500608_039679 3300053122 Bacteria 2255
1718 Ga0500621_088309 3300053126 Bacteria 1236
1719 Ga0500642_0000582 3300053130 Bacteria 10974
1720 Ga0500642_0008382 3300053130 Bacteria 3536
1721 Ga0500658_0144157 3300053134 Bacteria 1070
1722 Ga0500559_0000287 3300053136 Bacteria 38965
1723 Ga0500559_0062279 3300053136 Bacteria 1665
1724 Ga0500559_0175209 3300053136 Bacteria 1009
1725 Ga0500577_0074621 3300053142 Bacteria 1338
1726 Ga0500588_0019610 3300053146 Bacteria 1801
1727 Ga0500590_077351 3300053148 Bacteria 1642
1728 Ga0500603_000319 3300053150 Bacteria 12617
1729 Ga0500603_003930 3300053150 Bacteria 3180
1730 Ga0500616_0003402 3300053153 Bacteria 12208
1731 Ga0500616_0023908 3300053153 Bacteria 3400
1732 Ga0500620_002333 3300053155 Bacteria 3793
1733 Ga0500622_0009281 3300053156 Bacteria 5452
1734 Ga0500630_025489 3300053159 Bacteria 2919
1735 Ga0500636_0000958 3300053177 Bacteria 15526
1736 Ga0500637_0000139 3300053178 Bacteria 26733
1737 Ga0500637_0000521 3300053178 Bacteria 14988
1738 Ga0500637_0049617 3300053178 Bacteria 2389
1739 Ga0500645_019097 3300053730 Bacteria 2135
1740 Ga0500596_000188 3300053735 Bacteria 10062
1741 Ga0500599_001712 3300053736 Bacteria 2560
1742 Ga0500601_000162 3300053737 Bacteria 13961
1743 Ga0501084_0001848 3300054114 Bacteria 16889
1744 Ga0501084_0034551 3300054114 Bacteria 4228
1745 Ga0501084_0064578 3300054114 Bacteria 3063
1746 Ga0501084_0147653 3300054114 Bacteria 1981
1747 Ga0501084_0265964 3300054114 Bacteria 1448
1748 Ga0500661_005091 3300055283 Bacteria 2461
1749 Ga0501082_0016434 3300060353 Bacteria 6369
1750 Ga0501082_0036971 3300060353 Bacteria 4206
1751 Ga0501082_0062097 3300060353 Bacteria 3215
1752 Ga0501082_0062808 3300060353 Bacteria 3198
1753 Ga0501082_0081951 3300060353 Bacteria 2784
1754 Ga0501082_0084220 3300060353 Bacteria 2743
1755 Ga0501082_0166752 3300060353 Bacteria 1914
1756 Ga0501082_0235950 3300060353 Bacteria 1592
1757 Ga0466962_0030281 3300061719 Bacteria 2592
1758 Ga0530510_0041307 3300061734 Bacteria 3330
1759 Ga0530510_0312346 3300061734 Bacteria 1177
1760 Ga0530510_0409063 3300061734 Bacteria 1023

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0199782 Ga0496107_0199782_12_749 204
2 3300049590 Ga0501074_0505445 Ga0501074_0505445_16_840 209
3 3300048907 Ga0496104_0558394 Ga0496104_0558394_11_886 226
4 3300048918 Ga0496115_0306773 Ga0496115_0306773_496_1284 236
5 3300049741 Ga0501079_0495514 Ga0501079_0495514_17_805 236
6 3300005983 Ga0081540_1004198 Ga0081540_10041986 238
7 3300006846 Ga0075430_100000255 Ga0075430_10000025518 238
8 3300048918 Ga0496115_0160911 Ga0496115_0160911_23_940 238
9 3300050509 nmdc:mga0qj67_219_c1 nmdc:mga0qj67_219_c1_7121_8038 238
10 3300050515 nmdc:mga0a205_203985_c1 nmdc:mga0a205_203985_c1_210_1127 238
11 3300035695 Ga0373927_0002061 Ga0373927_0002061_481_1398 239
12 3300037068 Ga0373925_0248833 Ga0373925_0248833_18_935 239
13 3300046475 Ga0495639_0103979 Ga0495639_0103979_221_1138 239
14 3300048929 Ga0496126_0084607 Ga0496126_0084607_1571_2488 239
15 3300060353 Ga0501082_0235950 Ga0501082_0235950_344_1261 239
16 3300005983 Ga0081540_1009497 Ga0081540_10094976 240
17 3300007265 Ga0099794_10138100 Ga0099794_101381001 240
18 3300035170 Ga0373943_0019212 Ga0373943_0019212_358_1275 240
19 3300035692 Ga0373935_0001022 Ga0373935_0001022_13967_14884 240
20 3300035695 Ga0373927_0001260 Ga0373927_0001260_8424_9341 240
21 3300035725 Ga0373947_0000241 Ga0373947_0000241_1769_2686 240
22 3300036401 Ga0373937_0045890 Ga0373937_0045890_2214_3131 240
23 3300037068 Ga0373925_0001674 Ga0373925_0001674_12877_13794 240
24 3300046454 Ga0495592_0006314 Ga0495592_0006314_537_1454 240
25 3300046455 Ga0495603_0002548 Ga0495603_0002548_9610_10527 240
26 3300046459 Ga0495629_0001570 Ga0495629_0001570_4463_5380 240
27 3300046461 Ga0495641_0003226 Ga0495641_0003226_6264_7181 240
28 3300046472 Ga0495580_0000435 Ga0495580_0000435_19811_20728 240
29 3300046473 Ga0495582_0000051 Ga0495582_0000051_13592_14509 240
30 3300046475 Ga0495639_0000010 Ga0495639_0000010_85928_86845 240
31 3300046476 Ga0495662_0000097 Ga0495662_0000097_19545_20462 240
32 3300046477 Ga0495664_0003263 Ga0495664_0003263_7852_8769 240
33 3300046499 Ga0495594_0001317 Ga0495594_0001317_3746_4663 240
34 3300046517 Ga0495630_0012344 Ga0495630_0012344_822_1739 240
35 3300046531 Ga0495665_0000005 Ga0495665_0000005_73055_73972 240
36 3300046533 Ga0495640_0000301 Ga0495640_0000301_8369_9286 240
37 3300046559 Ga0495667_0018134 Ga0495667_0018134_1405_2322 240
38 3300046663 Ga0495635_0000259 Ga0495635_0000259_19528_20445 240
39 3300046683 Ga0495658_0000635 Ga0495658_0000635_12049_12966 240
40 3300046690 Ga0495624_0000094 Ga0495624_0000094_50685_51602 240
41 3300047315 Ga0495581_0000810 Ga0495581_0000810_416_1333 240
42 3300047319 Ga0495674_0000955 Ga0495674_0000955_8584_9501 240
43 3300047321 Ga0495676_0040390 Ga0495676_0040390_2506_3423 240
44 3300047471 Ga0495684_0017009 Ga0495684_0017009_3809_4726 240
45 3300049743 Ga0501081_0109385 Ga0501081_0109385_101_1015 240
46 3300049743 Ga0501081_0140771 Ga0501081_0140771_685_1602 240
47 3300060353 Ga0501082_0062808 Ga0501082_0062808_1856_2776 240
48 3300005614 Ga0068856_100001570 Ga0068856_10000157016 241
49 3300005983 Ga0081540_1002476 Ga0081540_100247613 241
50 3300026078 Ga0207702_10001131 Ga0207702_100011319 241
51 3300046681 Ga0495647_0035989 Ga0495647_0035989_899_1816 241
52 3300047322 Ga0495680_0186936 Ga0495680_0186936_261_1178 241
53 3300047673 Ga0495593_0001157 Ga0495593_0001157_10020_10937 241
54 3300009545 Ga0105237_10200250 Ga0105237_102002503 243
55 3300013308 Ga0157375_10259067 Ga0157375_102590672 243
56 3300014325 Ga0163163_10017351 Ga0163163_100173512 243
57 3300014969 Ga0157376_10171813 Ga0157376_101718132 243
58 3300026095 Ga0207676_10118967 Ga0207676_101189672 243
59 3300048907 Ga0496104_0091551 Ga0496104_0091551_127_1044 243
60 3300048909 Ga0496106_0040310 Ga0496106_0040310_1805_2722 243
61 3300048913 Ga0496110_0414837 Ga0496110_0414837_45_962 243
62 3300048915 Ga0496112_0010005 Ga0496112_0010005_5923_6840 243
63 3300048916 Ga0496113_0015228 Ga0496113_0015228_4250_5167 243
64 3300048918 Ga0496115_0014471 Ga0496115_0014471_3412_4221 243
65 3300048918 Ga0496115_0123068 Ga0496115_0123068_56_973 243
66 3300031249 Ga0265339_10175052 Ga0265339_101750521 244
67 3300031238 Ga0265332_10010470 Ga0265332_100104703 245
68 3300007788 Ga0099795_10091793 Ga0099795_100917931 246
69 3300027512 Ga0209179_1019094 Ga0209179_10190942 246
70 3300028379 Ga0268266_10402911 Ga0268266_104029112 246
71 3300048924 Ga0496121_0149146 Ga0496121_0149146_754_1671 246
72 3300005616 Ga0068852_100081178 Ga0068852_1000811782 247
73 3300025945 Ga0207679_10283352 Ga0207679_102833521 247
74 3300035120 Ga0373957_0040519 Ga0373957_0040519_262_1179 247
75 3300035410 Ga0373924_0025640 Ga0373924_0025640_1180_2097 247
76 3300046454 Ga0495592_0035154 Ga0495592_0035154_2533_3450 247
77 3300046459 Ga0495629_0027659 Ga0495629_0027659_2273_3190 247
78 3300046462 Ga0495651_0040236 Ga0495651_0040236_2166_3083 247
79 3300046463 Ga0495653_0084922 Ga0495653_0084922_779_1696 247
80 3300046476 Ga0495662_0018681 Ga0495662_0018681_231_1148 247
81 3300046477 Ga0495664_0019774 Ga0495664_0019774_603_1520 247
82 3300046511 Ga0495608_0032867 Ga0495608_0032867_351_1268 247
83 3300046514 Ga0495618_0080047 Ga0495618_0080047_291_1208 247
84 3300046516 Ga0495628_0015068 Ga0495628_0015068_3184_4101 247
85 3300046517 Ga0495630_0081372 Ga0495630_0081372_766_1683 247
86 3300046529 Ga0495652_0153662 Ga0495652_0153662_324_1241 247
87 3300046533 Ga0495640_0048999 Ga0495640_0048999_769_1686 247
88 3300046559 Ga0495667_0038983 Ga0495667_0038983_1916_2833 247
89 3300046642 Ga0495634_0019088 Ga0495634_0019088_1733_2650 247
90 3300046663 Ga0495635_0018124 Ga0495635_0018124_3115_4032 247
91 3300046675 Ga0495657_0010007 Ga0495657_0010007_2857_3774 247
92 3300046678 Ga0495599_0078143 Ga0495599_0078143_169_1086 247
93 3300046679 Ga0495623_0019757 Ga0495623_0019757_547_1464 247
94 3300046680 Ga0495646_0018694 Ga0495646_0018694_651_1568 247
95 3300046809 Ga0495600_0028884 Ga0495600_0028884_311_1228 247
96 3300047315 Ga0495581_0118388 Ga0495581_0118388_205_1122 247
97 3300047317 Ga0495604_0078815 Ga0495604_0078815_331_1248 247
98 3300047319 Ga0495674_0115024 Ga0495674_0115024_599_1516 247
99 3300047322 Ga0495680_0047217 Ga0495680_0047217_763_1680 247
100 3300047444 Ga0495675_0017113 Ga0495675_0017113_3141_4058 247
101 3300047471 Ga0495684_0027840 Ga0495684_0027840_1333_2250 247
102 3300048915 Ga0496112_0130301 Ga0496112_0130301_1493_2410 247
103 3300053077 Ga0495601_0064420 Ga0495601_0064420_779_1696 247
104 3300053084 Ga0495595_0137162 Ga0495595_0137162_85_1002 247
105 3300053085 Ga0495619_0071967 Ga0495619_0071967_763_1680 247
106 3300005834 Ga0068851_10133990 Ga0068851_101339902 248
107 3300009094 Ga0111539_10217493 Ga0111539_102174933 248
108 3300025917 Ga0207660_10106273 Ga0207660_101062732 248
109 3300026142 Ga0207698_10062830 Ga0207698_100628302 248
110 3300048905 Ga0496102_0718995 Ga0496102_0718995_83_907 248
111 3300049743 Ga0501081_0565081 Ga0501081_0565081_13_840 248
112 3300003203 JGI25406J46586_10000793 JGI25406J46586_100007937 249
113 3300005338 Ga0068868_100106391 Ga0068868_1001063912 249
114 3300005365 Ga0070688_100147110 Ga0070688_1001471102 249
115 3300005539 Ga0068853_100242189 Ga0068853_1002421892 249
116 3300005564 Ga0070664_100205092 Ga0070664_1002050922 249
117 3300005614 Ga0068856_100119419 Ga0068856_1001194192 249
118 3300005615 Ga0070702_100361019 Ga0070702_1003610191 249
119 3300005719 Ga0068861_100440282 Ga0068861_1004402822 249
120 3300005841 Ga0068863_100238925 Ga0068863_1002389252 249
121 3300005844 Ga0068862_100312120 Ga0068862_1003121202 249
122 3300005985 Ga0081539_10000048 Ga0081539_100000488 249
123 3300006871 Ga0075434_100155706 Ga0075434_1001557062 249
124 3300009551 Ga0105238_10371440 Ga0105238_103714402 249
125 3300011119 Ga0105246_10094270 Ga0105246_100942702 249
126 3300014969 Ga0157376_10388468 Ga0157376_103884682 249
127 3300025315 Ga0207697_10032400 Ga0207697_100324002 249
128 3300025893 Ga0207682_10022226 Ga0207682_100222262 249
129 3300025911 Ga0207654_10008646 Ga0207654_100086465 249
130 3300025936 Ga0207670_10050336 Ga0207670_100503362 249
131 3300025941 Ga0207711_10014530 Ga0207711_100145306 249
132 3300025945 Ga0207679_10117707 Ga0207679_101177072 249
133 3300026023 Ga0207677_10087126 Ga0207677_100871262 249
134 3300035172 Ga0373955_0239429 Ga0373955_0239429_36_953 249
135 3300046455 Ga0495603_0034957 Ga0495603_0034957_1164_2081 249
136 3300046460 Ga0495638_0101959 Ga0495638_0101959_700_1617 249
137 3300046616 Ga0495668_0034059 Ga0495668_0034059_1126_2043 249
138 3300048904 Ga0496101_0385119 Ga0496101_0385119_132_1049 249
139 3300048907 Ga0496104_0288235 Ga0496104_0288235_466_1383 249
140 3300048910 Ga0496107_0154440 Ga0496107_0154440_757_1674 249
141 3300048912 Ga0496109_0074001 Ga0496109_0074001_59_976 249
142 3300048915 Ga0496112_0029874 Ga0496112_0029874_3300_4217 249
143 3300048916 Ga0496113_0135060 Ga0496113_0135060_224_1141 249
144 3300050494 nmdc:mga06z11_123147_c1 nmdc:mga06z11_123147_c1_246_1163 249
145 3300050515 nmdc:mga0a205_179175_c1 nmdc:mga0a205_179175_c1_700_1617 249
146 3300005436 Ga0070713_100290682 Ga0070713_1002906821 250
147 3300005614 Ga0068856_100153817 Ga0068856_1001538171 250
148 3300005615 Ga0070702_100129777 Ga0070702_1001297772 250
149 3300021384 Ga0213876_10036401 Ga0213876_100364013 250
150 3300021388 Ga0213875_10000012 Ga0213875_10000012287 250
151 3300025928 Ga0207700_10320196 Ga0207700_103201961 250
152 3300031241 Ga0265325_10000172 Ga0265325_1000017239 250
153 3300037853 Ga0436364_0202668 Ga0436364_0202668_19972_20889 250
154 3300039437 Ga0436365_0026354 Ga0436365_0026354_57_974 250
155 3300048903 Ga0496100_0005435 Ga0496100_0005435_1234_2151 250
156 3300048904 Ga0496101_0062448 Ga0496101_0062448_972_1889 250
157 3300048905 Ga0496102_0008430 Ga0496102_0008430_6143_7060 250
158 3300048906 Ga0496103_0083500 Ga0496103_0083500_1074_1991 250
159 3300048907 Ga0496104_0078472 Ga0496104_0078472_466_1383 250
160 3300048908 Ga0496105_0034713 Ga0496105_0034713_1456_2373 250
161 3300048909 Ga0496106_0006260 Ga0496106_0006260_7479_8396 250
162 3300048910 Ga0496107_0003376 Ga0496107_0003376_5440_6357 250
163 3300048911 Ga0496108_0053664 Ga0496108_0053664_156_1073 250
164 3300048912 Ga0496109_0014576 Ga0496109_0014576_375_1292 250
165 3300048913 Ga0496110_0019240 Ga0496110_0019240_4426_5343 250
166 3300048914 Ga0496111_0005665 Ga0496111_0005665_156_1073 250
167 3300048915 Ga0496112_0003729 Ga0496112_0003729_8696_9613 250
168 3300048916 Ga0496113_0152079 Ga0496113_0152079_650_1567 250
169 3300005295 Ga0065707_10026480 Ga0065707_100264802 251
170 3300005530 Ga0070679_100206525 Ga0070679_1002065252 251
171 3300005543 Ga0070672_100084748 Ga0070672_1000847482 251
172 3300005563 Ga0068855_100187018 Ga0068855_1001870183 251
173 3300005719 Ga0068861_100255490 Ga0068861_1002554902 251
174 3300025885 Ga0207653_10019783 Ga0207653_100197832 251
175 3300025907 Ga0207645_10058854 Ga0207645_100588542 251
176 3300025941 Ga0207711_10029268 Ga0207711_100292682 251
177 3300028786 Ga0307517_10002374 Ga0307517_1000237410 251
178 3300028794 Ga0307515_10163396 Ga0307515_101633962 251
179 3300046515 Ga0495620_0057645 Ga0495620_0057645_14_928 251
180 3300047318 Ga0495636_0045411 Ga0495636_0045411_807_1721 251
181 3300047320 Ga0495672_0051270 Ga0495672_0051270_477_1391 251
182 3300047321 Ga0495676_0254389 Ga0495676_0254389_133_1047 251
183 3300048922 Ga0496119_0097487 Ga0496119_0097487_101_1018 251
184 3300048924 Ga0496121_0029126 Ga0496121_0029126_2596_3513 251
185 3300048929 Ga0496126_0011786 Ga0496126_0011786_317_1231 251
186 3300050492 nmdc:mga0yw44_19657_c1 nmdc:mga0yw44_19657_c1_975_1889 251
187 3300050494 nmdc:mga06z11_208497_c1 nmdc:mga06z11_208497_c1_18_932 251
188 3300053111 Ga0500572_031892 Ga0500572_031892_33_950 251
189 3300053119 Ga0500595_003448 Ga0500595_003448_4425_5339 251
190 3300053136 Ga0500559_0062279 Ga0500559_0062279_328_1245 251
191 3300053155 Ga0500620_002333 Ga0500620_002333_2284_3201 251
192 3300053177 Ga0500636_0000958 Ga0500636_0000958_14074_14991 251
193 3300053178 Ga0500637_0049617 Ga0500637_0049617_1350_2264 251
194 3300003215 JGI25153J46596_10020162 JGI25153J46596_100201622 252
195 3300005334 Ga0068869_100036132 Ga0068869_1000361323 252
196 3300005336 Ga0070680_100129970 Ga0070680_1001299702 252
197 3300005338 Ga0068868_100030349 Ga0068868_1000303493 252
198 3300005340 Ga0070689_100092911 Ga0070689_1000929112 252
199 3300005347 Ga0070668_100178285 Ga0070668_1001782852 252
200 3300005367 Ga0070667_100139806 Ga0070667_1001398062 252
201 3300005434 Ga0070709_10197274 Ga0070709_101972742 252
202 3300005436 Ga0070713_100146915 Ga0070713_1001469151 252
203 3300005455 Ga0070663_100051535 Ga0070663_1000515352 252
204 3300005455 Ga0070663_100070001 Ga0070663_1000700012 252
205 3300005457 Ga0070662_100152495 Ga0070662_1001524952 252
206 3300005530 Ga0070679_100082222 Ga0070679_1000822222 252
207 3300005539 Ga0068853_100463660 Ga0068853_1004636602 252
208 3300005548 Ga0070665_100051883 Ga0070665_1000518834 252
209 3300005548 Ga0070665_100447989 Ga0070665_1004479892 252
210 3300005563 Ga0068855_100015904 Ga0068855_1000159043 252
211 3300005614 Ga0068856_100159539 Ga0068856_1001595392 252
212 3300005615 Ga0070702_100131678 Ga0070702_1001316781 252
213 3300005617 Ga0068859_100135059 Ga0068859_1001350592 252
214 3300005718 Ga0068866_10056645 Ga0068866_100566452 252
215 3300005719 Ga0068861_100026119 Ga0068861_1000261192 252
216 3300005843 Ga0068860_100300822 Ga0068860_1003008222 252
217 3300005844 Ga0068862_100501222 Ga0068862_1005012221 252
218 3300005844 Ga0068862_100536303 Ga0068862_1005363032 252
219 3300005937 Ga0081455_10009689 Ga0081455_100096898 252
220 3300005981 Ga0081538_10051717 Ga0081538_100517173 252
221 3300005983 Ga0081540_1005967 Ga0081540_10059675 252
222 3300005983 Ga0081540_1011408 Ga0081540_10114082 252
223 3300005983 Ga0081540_1020463 Ga0081540_10204632 252
224 3300005985 Ga0081539_10037647 Ga0081539_100376472 252
225 3300006048 Ga0075363_100000546 Ga0075363_1000005463 252
226 3300006178 Ga0075367_10006175 Ga0075367_100061756 252
227 3300006931 Ga0097620_100135065 Ga0097620_1001350652 252
228 3300009098 Ga0105245_10220586 Ga0105245_102205862 252
229 3300009177 Ga0105248_10147884 Ga0105248_101478843 252
230 3300009553 Ga0105249_10240071 Ga0105249_102400712 252
231 3300010375 Ga0105239_10506058 Ga0105239_105060582 252
232 3300011119 Ga0105246_10092881 Ga0105246_100928812 252
233 3300013104 Ga0157370_10016997 Ga0157370_100169976 252
234 3300013297 Ga0157378_10005515 Ga0157378_100055153 252
235 3300013297 Ga0157378_10395663 Ga0157378_103956632 252
236 3300013308 Ga0157375_10332000 Ga0157375_103320002 252
237 3300014325 Ga0163163_10063398 Ga0163163_100633984 252
238 3300014968 Ga0157379_10137725 Ga0157379_101377252 252
239 3300014969 Ga0157376_10122704 Ga0157376_101227042 252
240 3300025297 Ga0209758_1008080 Ga0209758_10080806 252
241 3300025901 Ga0207688_10065581 Ga0207688_100655812 252
242 3300025921 Ga0207652_10042711 Ga0207652_100427113 252
243 3300025927 Ga0207687_10120142 Ga0207687_101201422 252
244 3300025931 Ga0207644_10088296 Ga0207644_100882962 252
245 3300025935 Ga0207709_10077032 Ga0207709_100770322 252
246 3300025936 Ga0207670_10172573 Ga0207670_101725731 252
247 3300025944 Ga0207661_10126696 Ga0207661_101266962 252
248 3300025961 Ga0207712_10351585 Ga0207712_103515852 252
249 3300025972 Ga0207668_10122210 Ga0207668_101222102 252
250 3300025972 Ga0207668_10351600 Ga0207668_103516002 252
251 3300026041 Ga0207639_10314385 Ga0207639_103143851 252
252 3300026067 Ga0207678_10024871 Ga0207678_100248713 252
253 3300026067 Ga0207678_10195776 Ga0207678_101957762 252
254 3300026075 Ga0207708_10154554 Ga0207708_101545542 252
255 3300026095 Ga0207676_10292679 Ga0207676_102926792 252
256 3300027866 Ga0209813_10061168 Ga0209813_100611681 252
257 3300028379 Ga0268266_10001689 Ga0268266_1000168921 252
258 3300028379 Ga0268266_10008142 Ga0268266_100081422 252
259 3300028379 Ga0268266_10109570 Ga0268266_101095702 252
260 3300028379 Ga0268266_10382885 Ga0268266_103828852 252
261 3300028380 Ga0268265_10358773 Ga0268265_103587732 252
262 3300031249 Ga0265339_10000531 Ga0265339_1000053129 252
263 3300031616 Ga0307508_10000046 Ga0307508_1000004697 252
264 3300031730 Ga0307516_10006465 Ga0307516_100064659 252
265 3300031730 Ga0307516_10028476 Ga0307516_100284763 252
266 3300031903 Ga0307407_10171113 Ga0307407_101711132 252
267 3300031995 Ga0307409_100059652 Ga0307409_1000596522 252
268 3300035086 Ga0373934_0004838 Ga0373934_0004838_1925_2842 252
269 3300035111 Ga0373923_0029815 Ga0373923_0029815_104_1021 252
270 3300035117 Ga0373953_0001200 Ga0373953_0001200_3547_4464 252
271 3300035118 Ga0373954_0000692 Ga0373954_0000692_8120_9037 252
272 3300035119 Ga0373956_0001947 Ga0373956_0001947_6286_7203 252
273 3300035692 Ga0373935_0111965 Ga0373935_0111965_849_1766 252
274 3300038443 Ga0395901_0700285 Ga0395901_0700285_45_962 252
275 3300041451 Ga0451791_0288844 Ga0451791_0288844_329_1246 252
276 3300046459 Ga0495629_0000232 Ga0495629_0000232_4190_5107 252
277 3300046459 Ga0495629_0140456 Ga0495629_0140456_192_1109 252
278 3300046461 Ga0495641_0093958 Ga0495641_0093958_377_1294 252
279 3300046511 Ga0495608_0001965 Ga0495608_0001965_9498_10415 252
280 3300046511 Ga0495608_0178688 Ga0495608_0178688_17_901 252
281 3300046514 Ga0495618_0269874 Ga0495618_0269874_83_1000 252
282 3300046516 Ga0495628_0007200 Ga0495628_0007200_8447_9364 252
283 3300046529 Ga0495652_0019544 Ga0495652_0019544_924_1841 252
284 3300046536 Ga0495587_0015987 Ga0495587_0015987_1341_2258 252
285 3300046543 Ga0495645_0066870 Ga0495645_0066870_1330_2247 252
286 3300046559 Ga0495667_0003780 Ga0495667_0003780_3418_4335 252
287 3300046615 Ga0495656_0049604 Ga0495656_0049604_586_1503 252
288 3300046616 Ga0495668_0098265 Ga0495668_0098265_285_1202 252
289 3300046642 Ga0495634_0005745 Ga0495634_0005745_2140_3057 252
290 3300046663 Ga0495635_0000213 Ga0495635_0000213_27571_28488 252
291 3300046675 Ga0495657_0001192 Ga0495657_0001192_8849_9766 252
292 3300046678 Ga0495599_0001319 Ga0495599_0001319_10647_11564 252
293 3300046689 Ga0495613_0004294 Ga0495613_0004294_8929_9846 252
294 3300047317 Ga0495604_0025442 Ga0495604_0025442_382_1299 252
295 3300047322 Ga0495680_0023323 Ga0495680_0023323_2964_3881 252
296 3300047471 Ga0495684_0000052 Ga0495684_0000052_35335_36252 252
297 3300047673 Ga0495593_0000126 Ga0495593_0000126_25653_26570 252
298 3300048903 Ga0496100_0006530 Ga0496100_0006530_4725_5642 252
299 3300048905 Ga0496102_0028731 Ga0496102_0028731_686_1603 252
300 3300048906 Ga0496103_0082399 Ga0496103_0082399_80_997 252
301 3300048908 Ga0496105_0022841 Ga0496105_0022841_3160_4077 252
302 3300048908 Ga0496105_0081035 Ga0496105_0081035_256_1173 252
303 3300048909 Ga0496106_0159187 Ga0496106_0159187_35_973 252
304 3300048910 Ga0496107_0140827 Ga0496107_0140827_629_1546 252
305 3300048910 Ga0496107_0326288 Ga0496107_0326288_160_1077 252
306 3300048911 Ga0496108_0021274 Ga0496108_0021274_4330_5247 252
307 3300048911 Ga0496108_0030784 Ga0496108_0030784_1011_1928 252
308 3300048912 Ga0496109_0091236 Ga0496109_0091236_225_1142 252
309 3300048912 Ga0496109_0179024 Ga0496109_0179024_155_1072 252
310 3300048913 Ga0496110_0145286 Ga0496110_0145286_275_1192 252
311 3300048914 Ga0496111_0082782 Ga0496111_0082782_370_1287 252
312 3300048914 Ga0496111_0227256 Ga0496111_0227256_293_1231 252
313 3300048915 Ga0496112_0283461 Ga0496112_0283461_617_1534 252
314 3300048915 Ga0496112_0385362 Ga0496112_0385362_125_1063 252
315 3300048916 Ga0496113_0025992 Ga0496113_0025992_2696_3613 252
316 3300048917 Ga0496114_0353746 Ga0496114_0353746_48_965 252
317 3300048918 Ga0496115_0051029 Ga0496115_0051029_783_1700 252
318 3300048918 Ga0496115_0264191 Ga0496115_0264191_409_1326 252
319 3300049584 Ga0501068_0000113 Ga0501068_0000113_34046_34882 252
320 3300049585 Ga0501069_0131567 Ga0501069_0131567_43_960 252
321 3300050490 nmdc:mga03n38_5540_c1 nmdc:mga03n38_5540_c1_1747_2664 252
322 3300050491 nmdc:mga00v17_8695_c1 nmdc:mga00v17_8695_c1_2358_3275 252
323 3300050494 nmdc:mga06z11_31552_c1 nmdc:mga06z11_31552_c1_919_1836 252
324 3300050495 nmdc:mga04h51_73231_c1 nmdc:mga04h51_73231_c1_125_1042 252
325 3300050511 nmdc:mga08y16_608161_c1 nmdc:mga08y16_608161_c1_136_1053 252
326 3300053084 Ga0495595_0001191 Ga0495595_0001191_476_1393 252
327 3300053085 Ga0495619_0000913 Ga0495619_0000913_17543_18460 252
328 3300053094 Ga0500566_0007593 Ga0500566_0007593_5138_6055 252
329 3300053096 Ga0500641_0113177 Ga0500641_0113177_117_1091 252
330 3300053119 Ga0500595_000691 Ga0500595_000691_6956_7873 252
331 3300053136 Ga0500559_0175209 Ga0500559_0175209_15_932 252
332 3300053178 Ga0500637_0000139 Ga0500637_0000139_6929_7846 252
333 3300003203 JGI25406J46586_10005542 JGI25406J46586_100055426 253
334 3300003752 Ga0055539_1007117 Ga0055539_10071171 253
335 3300005329 Ga0070683_100077696 Ga0070683_1000776962 253
336 3300005336 Ga0070680_100079413 Ga0070680_1000794131 253
337 3300005339 Ga0070660_100131436 Ga0070660_1001314362 253
338 3300005344 Ga0070661_100046692 Ga0070661_1000466922 253
339 3300005366 Ga0070659_100231957 Ga0070659_1002319572 253
340 3300005434 Ga0070709_10000161 Ga0070709_100001614 253
341 3300005435 Ga0070714_100065850 Ga0070714_1000658503 253
342 3300005436 Ga0070713_100028012 Ga0070713_1000280122 253
343 3300005436 Ga0070713_100166603 Ga0070713_1001666032 253
344 3300005437 Ga0070710_10007707 Ga0070710_100077072 253
345 3300005439 Ga0070711_100004937 Ga0070711_1000049377 253
346 3300005535 Ga0070684_100015420 Ga0070684_1000154202 253
347 3300005539 Ga0068853_100020143 Ga0068853_1000201434 253
348 3300005563 Ga0068855_100316996 Ga0068855_1003169962 253
349 3300005577 Ga0068857_100027291 Ga0068857_1000272914 253
350 3300005834 Ga0068851_10124265 Ga0068851_101242652 253
351 3300005937 Ga0081455_10021557 Ga0081455_100215572 253
352 3300005937 Ga0081455_10080017 Ga0081455_100800172 253
353 3300005981 Ga0081538_10075063 Ga0081538_100750632 253
354 3300005983 Ga0081540_1035589 Ga0081540_10355892 253
355 3300005985 Ga0081539_10000466 Ga0081539_1000046652 253
356 3300006028 Ga0070717_10000792 Ga0070717_1000079217 253
357 3300006175 Ga0070712_100018666 Ga0070712_1000186661 253
358 3300006844 Ga0075428_100175581 Ga0075428_1001755813 253
359 3300006871 Ga0075434_100011014 Ga0075434_1000110141 253
360 3300007076 Ga0075435_100207852 Ga0075435_1002078521 253
361 3300009093 Ga0105240_10045172 Ga0105240_100451723 253
362 3300009545 Ga0105237_10074664 Ga0105237_100746642 253
363 3300009551 Ga0105238_10025855 Ga0105238_100258555 253
364 3300010375 Ga0105239_10089792 Ga0105239_100897922 253
365 3300013104 Ga0157370_10025182 Ga0157370_100251826 253
366 3300013105 Ga0157369_10060774 Ga0157369_100607744 253
367 3300021377 Ga0213874_10031465 Ga0213874_100314651 253
368 3300025253 Ga0209677_100635 Ga0209677_1006357 253
369 3300025272 Ga0209455_1007119 Ga0209455_10071191 253
370 3300025321 Ga0207656_10116310 Ga0207656_101163101 253
371 3300025898 Ga0207692_10005634 Ga0207692_100056342 253
372 3300025906 Ga0207699_10005739 Ga0207699_100057392 253
373 3300025912 Ga0207707_10185179 Ga0207707_101851792 253
374 3300025913 Ga0207695_10253146 Ga0207695_102531461 253
375 3300025914 Ga0207671_10127485 Ga0207671_101274852 253
376 3300025915 Ga0207693_10038354 Ga0207693_100383542 253
377 3300025916 Ga0207663_10003639 Ga0207663_100036394 253
378 3300025917 Ga0207660_10114374 Ga0207660_101143742 253
379 3300025919 Ga0207657_10015379 Ga0207657_100153794 253
380 3300025920 Ga0207649_10066933 Ga0207649_100669332 253
381 3300025921 Ga0207652_10013963 Ga0207652_100139633 253
382 3300025924 Ga0207694_10032644 Ga0207694_100326442 253
383 3300025928 Ga0207700_10051647 Ga0207700_100516472 253
384 3300025929 Ga0207664_10048111 Ga0207664_100481113 253
385 3300025932 Ga0207690_10252578 Ga0207690_102525782 253
386 3300025944 Ga0207661_10019988 Ga0207661_100199882 253
387 3300025949 Ga0207667_10070726 Ga0207667_100707262 253
388 3300025986 Ga0207658_10557680 Ga0207658_105576801 253
389 3300031507 Ga0307509_10218313 Ga0307509_102183131 253
390 3300031712 Ga0265342_10001860 Ga0265342_1000186018 253
391 3300033180 Ga0307510_10261843 Ga0307510_102618431 253
392 3300035691 Ga0373931_0139545 Ga0373931_0139545_242_1159 253
393 3300035695 Ga0373927_0003112 Ga0373927_0003112_9614_10531 253
394 3300039437 Ga0436365_1272384 Ga0436365_1272384_1765_2682 253
395 3300039450 Ga0436363_1447658 Ga0436363_1447658_1840_2757 253
396 3300046455 Ga0495603_0009548 Ga0495603_0009548_49_966 253
397 3300046499 Ga0495594_0088895 Ga0495594_0088895_13_930 253
398 3300046507 Ga0495606_0018083 Ga0495606_0018083_4147_5064 253
399 3300047315 Ga0495581_0056430 Ga0495581_0056430_1309_2226 253
400 3300048908 Ga0496105_0131763 Ga0496105_0131763_970_1887 253
401 3300048924 Ga0496121_0000416 Ga0496121_0000416_75202_76119 253
402 3300048929 Ga0496126_0236034 Ga0496126_0236034_349_1266 253
403 3300050512 nmdc:mga0n895_15401_c1 nmdc:mga0n895_15401_c1_5817_6734 253
404 3300050513 nmdc:mga0rr50_34382_c1 nmdc:mga0rr50_34382_c1_662_1579 253
405 3300053080 Ga0500635_0001223 Ga0500635_0001223_3607_4524 253
406 3300053150 Ga0500603_000319 Ga0500603_000319_9526_10443 253
407 3300053178 Ga0500637_0000521 Ga0500637_0000521_7914_8831 253
408 3300005437 Ga0070710_10005772 Ga0070710_100057722 254
409 3300005983 Ga0081540_1056194 Ga0081540_10561941 254
410 3300007788 Ga0099795_10136355 Ga0099795_101363551 254
411 3300009147 Ga0114129_10022232 Ga0114129_100222324 254
412 3300025916 Ga0207663_10016309 Ga0207663_100163093 254
413 3300025928 Ga0207700_10081413 Ga0207700_100814132 254
414 3300025939 Ga0207665_10174573 Ga0207665_101745732 254
415 3300028800 Ga0265338_10026793 Ga0265338_100267934 254
416 3300031241 Ga0265325_10014646 Ga0265325_100146463 254
417 3300031249 Ga0265339_10000900 Ga0265339_100009004 254
418 3300031595 Ga0265313_10000171 Ga0265313_100001714 254
419 3300031712 Ga0265342_10020650 Ga0265342_100206503 254
420 3300044735 Ga0466968_0009034 Ga0466968_0009034_138_1055 254
421 3300044901 Ga0466960_0018943 Ga0466960_0018943_2016_2933 254
422 3300045976 Ga0466967_0178208 Ga0466967_0178208_273_1190 254
423 3300046543 Ga0495645_0040374 Ga0495645_0040374_347_1264 254
424 3300048929 Ga0496126_0149059 Ga0496126_0149059_488_1405 254
425 3300050507 nmdc:mga05p37_90049_c1 nmdc:mga05p37_90049_c1_473_1390 254
426 3300005439 Ga0070711_100066690 Ga0070711_1000666902 255
427 3300005455 Ga0070663_100263254 Ga0070663_1002632542 255
428 3300006038 Ga0075365_10050203 Ga0075365_100502032 255
429 3300006175 Ga0070712_100183198 Ga0070712_1001831982 255
430 3300006844 Ga0075428_100163780 Ga0075428_1001637802 255
431 3300009176 Ga0105242_10112558 Ga0105242_101125582 255
432 3300025912 Ga0207707_10054388 Ga0207707_100543884 255
433 3300025934 Ga0207686_10051195 Ga0207686_100511952 255
434 3300035692 Ga0373935_0224994 Ga0373935_0224994_70_987 255
435 3300037312 Ga0395899_0078996 Ga0395899_0078996_410_1327 255
436 3300037418 Ga0395900_0017039 Ga0395900_0017039_967_1884 255
437 3300037466 Ga0395898_0122892 Ga0395898_0122892_1429_2346 255
438 3300038443 Ga0395901_0004639 Ga0395901_0004639_1259_2176 255
439 3300039438 Ga0436360_0377848 Ga0436360_0377848_75_992 255
440 3300046663 Ga0495635_0026052 Ga0495635_0026052_3166_4059 255
441 3300048905 Ga0496102_0226922 Ga0496102_0226922_199_1116 255
442 3300048921 Ga0496118_0190049 Ga0496118_0190049_31_948 255
443 3300049593 Ga0501077_0019113 Ga0501077_0019113_1576_2490 255
444 3300049743 Ga0501081_0004836 Ga0501081_0004836_419_1333 255
445 3300050489 nmdc:mga03683_13428_c1 nmdc:mga03683_13428_c1_875_1792 255
446 3300050492 nmdc:mga0yw44_6869_c1 nmdc:mga0yw44_6869_c1_2600_3517 255
447 3300050508 nmdc:mga09592_249554_c1 nmdc:mga09592_249554_c1_545_1462 255
448 3300061734 Ga0530510_0041307 Ga0530510_0041307_1343_2257 255
449 3300003215 JGI25153J46596_10000546 JGI25153J46596_1000054610 256
450 3300003794 Ga0055531_10004105 Ga0055531_100041056 256
451 3300005471 Ga0070698_100015504 Ga0070698_1000155045 256
452 3300006028 Ga0070717_10010340 Ga0070717_100103402 256
453 3300006173 Ga0070716_100083435 Ga0070716_1000834352 256
454 3300009093 Ga0105240_10013607 Ga0105240_100136074 256
455 3300024225 Ga0224572_1010868 Ga0224572_10108682 256
456 3300025245 Ga0207425_1009767 Ga0207425_10097671 256
457 3300025295 Ga0209564_1028046 Ga0209564_10280461 256
458 3300025297 Ga0209758_1000015 Ga0209758_1000015230 256
459 3300025299 Ga0209256_1005506 Ga0209256_10055063 256
460 3300025304 Ga0209257_1001348 Ga0209257_100134823 256
461 3300025913 Ga0207695_10061853 Ga0207695_100618534 256
462 3300036459 Ga0372808_007251 Ga0372808_007251_326_1243 256
463 3300044684 Ga0466966_0150241 Ga0466966_0150241_78_995 256
464 3300044694 Ga0466963_0051507 Ga0466963_0051507_1731_2648 256
465 3300045049 Ga0466959_0043859 Ga0466959_0043859_1080_1997 256
466 3300045836 Ga0466958_0078323 Ga0466958_0078323_290_1207 256
467 3300046462 Ga0495651_0139210 Ga0495651_0139210_270_1187 256
468 3300047472 Ga0495686_0073512 Ga0495686_0073512_1085_2002 256
469 3300048929 Ga0496126_0177281 Ga0496126_0177281_861_1778 256
470 3300053111 Ga0500572_000727 Ga0500572_000727_9629_10546 256
471 3300053126 Ga0500621_088309 Ga0500621_088309_76_993 256
472 3300053136 Ga0500559_0000287 Ga0500559_0000287_26051_26968 256
473 3300005983 Ga0081540_1017619 Ga0081540_10176192 257
474 3300005985 Ga0081539_10000210 Ga0081539_10000210116 257
475 3300035724 Ga0373933_0003607 Ga0373933_0003607_6568_7485 257
476 3300048913 Ga0496110_0272917 Ga0496110_0272917_609_1526 257
477 3300048915 Ga0496112_0305971 Ga0496112_0305971_19_936 257
478 3300049570 Ga0501033_0024529 Ga0501033_0024529_456_1373 257
479 3300049571 Ga0501034_0442390 Ga0501034_0442390_65_982 257
480 3300049572 Ga0501036_0018260 Ga0501036_0018260_4785_5702 257
481 3300049573 Ga0501037_0024831 Ga0501037_0024831_2925_3842 257
482 3300049574 Ga0501038_0106246 Ga0501038_0106246_1321_2238 257
483 3300049575 Ga0501039_0256581 Ga0501039_0256581_253_1170 257
484 3300049579 Ga0501043_0087010 Ga0501043_0087010_624_1541 257
485 3300049580 Ga0501046_0109239 Ga0501046_0109239_209_1126 257
486 3300049582 Ga0501048_0105250 Ga0501048_0105250_487_1404 257
487 3300049585 Ga0501069_0012024 Ga0501069_0012024_3443_4360 257
488 3300049590 Ga0501074_0114034 Ga0501074_0114034_672_1589 257
489 3300049592 Ga0501076_0070557 Ga0501076_0070557_1789_2706 257
490 3300049744 Ga0501083_0026846 Ga0501083_0026846_130_1047 257
491 3300049822 Ga0501035_0087735 Ga0501035_0087735_1593_2510 257
492 3300049822 Ga0501035_0179677 Ga0501035_0179677_233_1150 257
493 3300049823 Ga0501044_0324430 Ga0501044_0324430_310_1227 257
494 3300049824 Ga0501045_0067802 Ga0501045_0067802_1141_2058 257
495 3300060353 Ga0501082_0036971 Ga0501082_0036971_2708_3625 257
496 3300005937 Ga0081455_10003043 Ga0081455_1000304317 258
497 3300048907 Ga0496104_0140930 Ga0496104_0140930_1198_2115 258
498 3300035113 Ga0373936_0048610 Ga0373936_0048610_75_992 259
499 3300035118 Ga0373954_0171162 Ga0373954_0171162_91_1008 259
500 3300036401 Ga0373937_0322313 Ga0373937_0322313_142_1059 259
501 3300042005 Ga0439448_0077412 Ga0439448_0077412_26_943 259
502 3300048905 Ga0496102_0071720 Ga0496102_0071720_1813_2730 259
503 3300049583 Ga0501067_0051747 Ga0501067_0051747_1278_2195 259
504 3300053091 Ga0500647_0031533 Ga0500647_0031533_737_1654 259
505 3300053094 Ga0500566_0003347 Ga0500566_0003347_2120_3037 259
506 3300053095 Ga0500640_018065 Ga0500640_018065_728_1645 259
507 3300053111 Ga0500572_003440 Ga0500572_003440_676_1593 259
508 3300053122 Ga0500608_039679 Ga0500608_039679_597_1514 259
509 3300053148 Ga0500590_077351 Ga0500590_077351_544_1461 259
510 3300053150 Ga0500603_003930 Ga0500603_003930_1703_2620 259
511 3300053159 Ga0500630_025489 Ga0500630_025489_1714_2631 259
512 3300053735 Ga0500596_000188 Ga0500596_000188_5486_6403 259
513 3300003911 JGI25405J52794_10024159 JGI25405J52794_100241591 260
514 3300005435 Ga0070714_100099668 Ga0070714_1000996682 260
515 3300005458 Ga0070681_10043334 Ga0070681_100433343 260
516 3300005518 Ga0070699_100321633 Ga0070699_1003216332 260
517 3300005530 Ga0070679_100024333 Ga0070679_1000243334 260
518 3300005937 Ga0081455_10019160 Ga0081455_100191605 260
519 3300005937 Ga0081455_10045254 Ga0081455_100452544 260
520 3300005983 Ga0081540_1005942 Ga0081540_10059427 260
521 3300006038 Ga0075365_10029734 Ga0075365_100297343 260
522 3300006175 Ga0070712_100079315 Ga0070712_1000793152 260
523 3300007265 Ga0099794_10003432 Ga0099794_100034324 260
524 3300009147 Ga0114129_10129695 Ga0114129_101296952 260
525 3300025912 Ga0207707_10016536 Ga0207707_100165364 260
526 3300025915 Ga0207693_10011810 Ga0207693_100118103 260
527 3300025919 Ga0207657_10005739 Ga0207657_100057393 260
528 3300025921 Ga0207652_10015702 Ga0207652_100157024 260
529 3300025922 Ga0207646_10240581 Ga0207646_102405812 260
530 3300033442 Ga0315911_1000024 Ga0315911_100002469 260
531 3300039447 Ga0436361_0011309 Ga0436361_0011309_309_1226 260
532 3300049571 Ga0501034_0078480 Ga0501034_0078480_139_1056 260
533 3300050492 nmdc:mga0yw44_22717_c1 nmdc:mga0yw44_22717_c1_1297_2214 260
534 3300050512 nmdc:mga0n895_151327_c1 nmdc:mga0n895_151327_c1_772_1689 260
535 3300003354 JGI25160J50197_1006400 JGI25160J50197_10064007 261
536 3300005341 Ga0070691_10013696 Ga0070691_100136963 261
537 3300005347 Ga0070668_100104887 Ga0070668_1001048872 261
538 3300005354 Ga0070675_100181346 Ga0070675_1001813462 261
539 3300005406 Ga0070703_10000974 Ga0070703_100009748 261
540 3300005440 Ga0070705_100000072 Ga0070705_10000007251 261
541 3300005441 Ga0070700_100000962 Ga0070700_1000009625 261
542 3300005444 Ga0070694_100002401 Ga0070694_1000024015 261
543 3300005455 Ga0070663_100066180 Ga0070663_1000661802 261
544 3300005457 Ga0070662_100287528 Ga0070662_1002875281 261
545 3300005458 Ga0070681_10017474 Ga0070681_100174745 261
546 3300005467 Ga0070706_100061572 Ga0070706_1000615723 261
547 3300005467 Ga0070706_100106155 Ga0070706_1001061551 261
548 3300005518 Ga0070699_100000250 Ga0070699_1000002505 261
549 3300005530 Ga0070679_100138340 Ga0070679_1001383402 261
550 3300005536 Ga0070697_100029834 Ga0070697_1000298346 261
551 3300005536 Ga0070697_100053420 Ga0070697_1000534202 261
552 3300005544 Ga0070686_100139277 Ga0070686_1001392772 261
553 3300005545 Ga0070695_100009154 Ga0070695_1000091545 261
554 3300005546 Ga0070696_100001222 Ga0070696_1000012225 261
555 3300005547 Ga0070693_100167893 Ga0070693_1001678932 261
556 3300005549 Ga0070704_100043510 Ga0070704_1000435102 261
557 3300005615 Ga0070702_100026211 Ga0070702_1000262112 261
558 3300005617 Ga0068859_100014663 Ga0068859_1000146636 261
559 3300005618 Ga0068864_100015095 Ga0068864_1000150952 261
560 3300005842 Ga0068858_100148745 Ga0068858_1001487452 261
561 3300005843 Ga0068860_100013861 Ga0068860_1000138616 261
562 3300005844 Ga0068862_100002889 Ga0068862_10000288910 261
563 3300006931 Ga0097620_100014663 Ga0097620_1000146636 261
564 3300009553 Ga0105249_10006938 Ga0105249_100069383 261
565 3300011119 Ga0105246_10041501 Ga0105246_100415013 261
566 3300025885 Ga0207653_10005006 Ga0207653_100050065 261
567 3300025901 Ga0207688_10138935 Ga0207688_101389351 261
568 3300025912 Ga0207707_10013205 Ga0207707_100132055 261
569 3300025917 Ga0207660_10002540 Ga0207660_100025408 261
570 3300025921 Ga0207652_10099026 Ga0207652_100990263 261
571 3300025926 Ga0207659_10089851 Ga0207659_100898511 261
572 3300025933 Ga0207706_10048059 Ga0207706_100480591 261
573 3300025936 Ga0207670_10314292 Ga0207670_103142922 261
574 3300025942 Ga0207689_10080850 Ga0207689_100808501 261
575 3300025961 Ga0207712_10005147 Ga0207712_100051475 261
576 3300026035 Ga0207703_10426565 Ga0207703_104265652 261
577 3300026067 Ga0207678_10017350 Ga0207678_100173506 261
578 3300026075 Ga0207708_10000770 Ga0207708_100007705 261
579 3300026095 Ga0207676_10265682 Ga0207676_102656822 261
580 3300026116 Ga0207674_10014465 Ga0207674_100144654 261
581 3300026121 Ga0207683_10297484 Ga0207683_102974841 261
582 3300028380 Ga0268265_10002768 Ga0268265_100027686 261
583 3300028381 Ga0268264_10028003 Ga0268264_100280033 261
584 3300031241 Ga0265325_10056018 Ga0265325_100560182 261
585 3300037471 Ga0395905_0107113 Ga0395905_0107113_1246_2163 261
586 3300038443 Ga0395901_0259486 Ga0395901_0259486_429_1346 261
587 3300048905 Ga0496102_0001781 Ga0496102_0001781_1059_1973 261
588 3300048906 Ga0496103_0119195 Ga0496103_0119195_137_1051 261
589 3300048907 Ga0496104_0067695 Ga0496104_0067695_138_1052 261
590 3300048909 Ga0496106_0001113 Ga0496106_0001113_16688_17602 261
591 3300048910 Ga0496107_0007523 Ga0496107_0007523_5362_6276 261
592 3300048911 Ga0496108_0180395 Ga0496108_0180395_692_1564 261
593 3300048911 Ga0496108_0201460 Ga0496108_0201460_461_1378 261
594 3300048913 Ga0496110_0013969 Ga0496110_0013969_400_1317 261
595 3300048914 Ga0496111_0007023 Ga0496111_0007023_5967_6884 261
596 3300048918 Ga0496115_0019748 Ga0496115_0019748_2329_3243 261
597 3300049585 Ga0501069_0259289 Ga0501069_0259289_19_936 261
598 3300049592 Ga0501076_0510504 Ga0501076_0510504_47_964 261
599 3300003215 JGI25153J46596_10006750 JGI25153J46596_100067502 262
600 3300004625 Ga0055543_1003433 Ga0055543_10034335 262
601 3300005434 Ga0070709_10126906 Ga0070709_101269062 262
602 3300005535 Ga0070684_100243152 Ga0070684_1002431522 262
603 3300005564 Ga0070664_100303349 Ga0070664_1003033492 262
604 3300005618 Ga0068864_100225894 Ga0068864_1002258942 262
605 3300006186 Ga0075369_10002935 Ga0075369_100029353 262
606 3300006942 Ga0099824_1014898 Ga0099824_10148987 262
607 3300006944 Ga0099823_1022581 Ga0099823_10225814 262
608 3300010375 Ga0105239_10032270 Ga0105239_100322707 262
609 3300025230 Ga0209563_103209 Ga0209563_1032091 262
610 3300025254 Ga0209148_1000351 Ga0209148_100035123 262
611 3300025261 Ga0209233_1007732 Ga0209233_10077324 262
612 3300025295 Ga0209564_1047760 Ga0209564_10477601 262
613 3300025297 Ga0209758_1005837 Ga0209758_10058379 262
614 3300025302 Ga0207426_1000585 Ga0207426_100058514 262
615 3300025302 Ga0207426_1013187 Ga0207426_10131873 262
616 3300025303 Ga0209051_1038096 Ga0209051_10380962 262
617 3300025906 Ga0207699_10229912 Ga0207699_102299122 262
618 3300025919 Ga0207657_10042135 Ga0207657_100421353 262
619 3300025928 Ga0207700_10416894 Ga0207700_104168941 262
620 3300026121 Ga0207683_10583393 Ga0207683_105833931 262
621 3300027296 Ga0209389_1000015 Ga0209389_1000015151 262
622 3300027357 Ga0209589_1000055 Ga0209589_100005516 262
623 3300027361 Ga0209489_100072 Ga0209489_100072112 262
624 3300027361 Ga0209489_100128 Ga0209489_10012816 262
625 3300027363 Ga0209700_100034 Ga0209700_10003432 262
626 3300027363 Ga0209700_100137 Ga0209700_10013716 262
627 3300033180 Ga0307510_10048558 Ga0307510_100485586 262
628 3300037853 Ga0436364_1120433 Ga0436364_1120433_214_1131 262
629 3300039437 Ga0436365_0565346 Ga0436365_0565346_1125_2042 262
630 3300039438 Ga0436360_0380016 Ga0436360_0380016_255_1172 262
631 3300044684 Ga0466966_0000238 Ga0466966_0000238_3605_4522 262
632 3300044693 Ga0466961_0000044 Ga0466961_0000044_46530_47447 262
633 3300044694 Ga0466963_0370861 Ga0466963_0370861_68_985 262
634 3300045049 Ga0466959_0006561 Ga0466959_0006561_4241_5158 262
635 3300045836 Ga0466958_0122326 Ga0466958_0122326_364_1281 262
636 3300045976 Ga0466967_0152922 Ga0466967_0152922_362_1279 262
637 3300046507 Ga0495606_0015861 Ga0495606_0015861_2443_3360 262
638 3300046524 Ga0495648_0030402 Ga0495648_0030402_2494_3411 262
639 3300046525 Ga0495663_0060398 Ga0495663_0060398_244_1164 262
640 3300046648 Ga0495611_0098375 Ga0495611_0098375_279_1196 262
641 3300048905 Ga0496102_0203713 Ga0496102_0203713_501_1418 262
642 3300048909 Ga0496106_0387150 Ga0496106_0387150_47_964 262
643 3300048918 Ga0496115_0154466 Ga0496115_0154466_312_1229 262
644 3300048919 Ga0496116_0100680 Ga0496116_0100680_744_1661 262
645 3300048921 Ga0496118_0024593 Ga0496118_0024593_2966_3883 262
646 3300048924 Ga0496121_0006604 Ga0496121_0006604_755_1672 262
647 3300049577 Ga0501041_0177779 Ga0501041_0177779_98_1015 262
648 3300049578 Ga0501042_0184041 Ga0501042_0184041_57_974 262
649 3300049743 Ga0501081_0006251 Ga0501081_0006251_3586_4503 262
650 3300049824 Ga0501045_0240039 Ga0501045_0240039_312_1229 262
651 3300050510 nmdc:mga06r32_271505_c1 nmdc:mga06r32_271505_c1_432_1349 262
652 3300053105 Ga0500557_000043 Ga0500557_000043_2586_3503 262
653 3300053130 Ga0500642_0000582 Ga0500642_0000582_5983_6900 262
654 3300053134 Ga0500658_0144157 Ga0500658_0144157_132_1049 262
655 3300053146 Ga0500588_0019610 Ga0500588_0019610_862_1779 262
656 3300054114 Ga0501084_0034551 Ga0501084_0034551_58_975 262
657 3300005262 Ga0065165_1001155 Ga0065165_100115510 263
658 3300005331 Ga0070670_100050575 Ga0070670_1000505752 263
659 3300005354 Ga0070675_100252249 Ga0070675_1002522491 263
660 3300005435 Ga0070714_100134077 Ga0070714_1001340772 263
661 3300005436 Ga0070713_100009411 Ga0070713_1000094113 263
662 3300005616 Ga0068852_100526041 Ga0068852_1005260411 263
663 3300005616 Ga0068852_100618680 Ga0068852_1006186801 263
664 3300005843 Ga0068860_100207823 Ga0068860_1002078232 263
665 3300005937 Ga0081455_10106127 Ga0081455_101061272 263
666 3300005985 Ga0081539_10051990 Ga0081539_100519902 263
667 3300006042 Ga0075368_10053351 Ga0075368_100533512 263
668 3300006353 Ga0075370_10070961 Ga0075370_100709612 263
669 3300006353 Ga0075370_10239908 Ga0075370_102399081 263
670 3300006942 Ga0099824_1018713 Ga0099824_10187131 263
671 3300006943 Ga0099822_1054667 Ga0099822_10546671 263
672 3300009176 Ga0105242_10029187 Ga0105242_100291872 263
673 3300009177 Ga0105248_10001732 Ga0105248_100017322 263
674 3300013296 Ga0157374_10189402 Ga0157374_101894022 263
675 3300013306 Ga0163162_10158069 Ga0163162_101580693 263
676 3300021320 Ga0214544_1000003 Ga0214544_1000003186 263
677 3300021321 Ga0214542_1000003 Ga0214542_1000003176 263
678 3300021321 Ga0214542_1018727 Ga0214542_10187272 263
679 3300021324 Ga0214545_1000004 Ga0214545_1000004189 263
680 3300021324 Ga0214545_1016668 Ga0214545_10166688 263
681 3300021327 Ga0214543_1000007 Ga0214543_1000007228 263
682 3300021327 Ga0214543_1022834 Ga0214543_10228346 263
683 3300025297 Ga0209758_1000886 Ga0209758_100088615 263
684 3300025302 Ga0207426_1000734 Ga0207426_100073427 263
685 3300025903 Ga0207680_10045002 Ga0207680_100450022 263
686 3300025904 Ga0207647_10005044 Ga0207647_100050447 263
687 3300025928 Ga0207700_10008212 Ga0207700_100082123 263
688 3300025929 Ga0207664_10119144 Ga0207664_101191442 263
689 3300025934 Ga0207686_10226177 Ga0207686_102261772 263
690 3300025941 Ga0207711_10023214 Ga0207711_100232143 263
691 3300025941 Ga0207711_10146375 Ga0207711_101463751 263
692 3300025949 Ga0207667_10189132 Ga0207667_101891322 263
693 3300025972 Ga0207668_10123514 Ga0207668_101235142 263
694 3300026078 Ga0207702_10193307 Ga0207702_101933071 263
695 3300027296 Ga0209389_1000029 Ga0209389_100002923 263
696 3300027357 Ga0209589_1002201 Ga0209589_10022011 263
697 3300027361 Ga0209489_102968 Ga0209489_10296832 263
698 3300027866 Ga0209813_10008367 Ga0209813_100083673 263
699 3300028558 Ga0265326_10005717 Ga0265326_100057173 263
700 3300028563 Ga0265319_1016216 Ga0265319_10162162 263
701 3300028653 Ga0265323_10001980 Ga0265323_100019807 263
702 3300028666 Ga0265336_10000752 Ga0265336_100007525 263
703 3300028800 Ga0265338_10000024 Ga0265338_10000024134 263
704 3300033179 Ga0307507_10238670 Ga0307507_102386701 263
705 3300035088 Ga0373940_0041333 Ga0373940_0041333_222_1139 263
706 3300035121 Ga0373960_0022479 Ga0373960_0022479_342_1259 263
707 3300037471 Ga0395905_0005852 Ga0395905_0005852_6128_7045 263
708 3300044658 Ga0466972_0000258 Ga0466972_0000258_16980_17897 263
709 3300044683 Ga0466965_0040505 Ga0466965_0040505_829_1746 263
710 3300044706 Ga0466964_0034647 Ga0466964_0034647_235_1152 263
711 3300046454 Ga0495592_0008640 Ga0495592_0008640_6708_7625 263
712 3300046462 Ga0495651_0005257 Ga0495651_0005257_2625_3542 263
713 3300046477 Ga0495664_0002576 Ga0495664_0002576_8048_8965 263
714 3300046507 Ga0495606_0114368 Ga0495606_0114368_688_1605 263
715 3300046514 Ga0495618_0242600 Ga0495618_0242600_64_981 263
716 3300046536 Ga0495587_0030016 Ga0495587_0030016_1798_2715 263
717 3300046542 Ga0495597_0042922 Ga0495597_0042922_1006_1923 263
718 3300046675 Ga0495657_0032245 Ga0495657_0032245_694_1611 263
719 3300046678 Ga0495599_0014688 Ga0495599_0014688_2912_3829 263
720 3300046679 Ga0495623_0035476 Ga0495623_0035476_1739_2656 263
721 3300046809 Ga0495600_0016916 Ga0495600_0016916_2444_3361 263
722 3300047317 Ga0495604_0005793 Ga0495604_0005793_1333_2250 263
723 3300047319 Ga0495674_0013466 Ga0495674_0013466_706_1623 263
724 3300047321 Ga0495676_0023528 Ga0495676_0023528_1714_2631 263
725 3300047322 Ga0495680_0040819 Ga0495680_0040819_1150_2067 263
726 3300047444 Ga0495675_0005496 Ga0495675_0005496_6155_7072 263
727 3300047673 Ga0495593_0063127 Ga0495593_0063127_22_939 263
728 3300048088 Ga0495602_0095135 Ga0495602_0095135_1503_2420 263
729 3300048903 Ga0496100_0010870 Ga0496100_0010870_1427_2344 263
730 3300048904 Ga0496101_0001493 Ga0496101_0001493_6935_7852 263
731 3300048906 Ga0496103_0007075 Ga0496103_0007075_1411_2328 263
732 3300048908 Ga0496105_0109073 Ga0496105_0109073_605_1522 263
733 3300048911 Ga0496108_0076111 Ga0496108_0076111_1577_2494 263
734 3300048912 Ga0496109_0351220 Ga0496109_0351220_299_1216 263
735 3300048914 Ga0496111_0048639 Ga0496111_0048639_1792_2709 263
736 3300048917 Ga0496114_0093954 Ga0496114_0093954_871_1788 263
737 3300048918 Ga0496115_0026660 Ga0496115_0026660_605_1522 263
738 3300048920 Ga0496117_0020466 Ga0496117_0020466_1087_2004 263
739 3300048921 Ga0496118_0023002 Ga0496118_0023002_3636_4553 263
740 3300050512 nmdc:mga0n895_180388_c1 nmdc:mga0n895_180388_c1_965_1882 263
741 3300053077 Ga0495601_0144424 Ga0495601_0144424_578_1495 263
742 3300053078 Ga0495612_0009449 Ga0495612_0009449_2054_2971 263
743 3300005434 Ga0070709_10277960 Ga0070709_102779601 264
744 3300005435 Ga0070714_100168582 Ga0070714_1001685822 264
745 3300013297 Ga0157378_10663468 Ga0157378_106634681 264
746 3300025297 Ga0209758_1001829 Ga0209758_10018296 264
747 3300025906 Ga0207699_10238019 Ga0207699_102380192 264
748 3300025929 Ga0207664_10211772 Ga0207664_102117722 264
749 3300039437 Ga0436365_1511404 Ga0436365_1511404_94_1011 264
750 3300046533 Ga0495640_0299605 Ga0495640_0299605_109_981 264
751 3300046681 Ga0495647_0070741 Ga0495647_0070741_506_1378 264
752 3300046689 Ga0495613_0320693 Ga0495613_0320693_164_1036 264
753 3300050492 nmdc:mga0yw44_308755_c1 nmdc:mga0yw44_308755_c1_154_1026 264
754 3300005435 Ga0070714_100015028 Ga0070714_1000150282 265
755 3300005436 Ga0070713_100034152 Ga0070713_1000341522 265
756 3300005439 Ga0070711_100097686 Ga0070711_1000976862 265
757 3300005985 Ga0081539_10075794 Ga0081539_100757942 265
758 3300006028 Ga0070717_10045238 Ga0070717_100452382 265
759 3300006042 Ga0075368_10016953 Ga0075368_100169533 265
760 3300006048 Ga0075363_100056914 Ga0075363_1000569142 265
761 3300006163 Ga0070715_10003603 Ga0070715_100036032 265
762 3300006871 Ga0075434_100052904 Ga0075434_1000529042 265
763 3300007788 Ga0099795_10008962 Ga0099795_100089622 265
764 3300025906 Ga0207699_10052302 Ga0207699_100523022 265
765 3300025914 Ga0207671_10230254 Ga0207671_102302541 265
766 3300025915 Ga0207693_10020936 Ga0207693_100209363 265
767 3300025928 Ga0207700_10080495 Ga0207700_100804952 265
768 3300025939 Ga0207665_10002138 Ga0207665_100021388 265
769 3300027866 Ga0209813_10013130 Ga0209813_100131301 265
770 3300035170 Ga0373943_0055809 Ga0373943_0055809_209_1126 265
771 3300035692 Ga0373935_0308137 Ga0373935_0308137_193_1110 265
772 3300048903 Ga0496100_0021484 Ga0496100_0021484_502_1419 265
773 3300048907 Ga0496104_0019358 Ga0496104_0019358_560_1477 265
774 3300048910 Ga0496107_0050280 Ga0496107_0050280_713_1630 265
775 3300049571 Ga0501034_0143131 Ga0501034_0143131_1159_2076 265
776 3300049573 Ga0501037_0188854 Ga0501037_0188854_469_1386 265
777 3300049578 Ga0501042_0245877 Ga0501042_0245877_153_1070 265
778 3300049579 Ga0501043_0212875 Ga0501043_0212875_15_932 265
779 3300049580 Ga0501046_0008307 Ga0501046_0008307_299_1216 265
780 3300049584 Ga0501068_0004565 Ga0501068_0004565_191_1108 265
781 3300049585 Ga0501069_0001905 Ga0501069_0001905_824_1741 265
782 3300049587 Ga0501071_0000889 Ga0501071_0000889_8666_9583 265
783 3300049592 Ga0501076_0431917 Ga0501076_0431917_107_1024 265
784 3300049822 Ga0501035_0411627 Ga0501035_0411627_74_991 265
785 3300050495 nmdc:mga04h51_58310_c1 nmdc:mga04h51_58310_c1_178_1095 265
786 3300050495 nmdc:mga04h51_81641_c1 nmdc:mga04h51_81641_c1_46_963 265
787 3300050496 nmdc:mga07m45_38240_c1 nmdc:mga07m45_38240_c1_247_1164 265
788 3300005440 Ga0070705_100172834 Ga0070705_1001728342 266
789 3300005518 Ga0070699_100006065 Ga0070699_1000060653 266
790 3300005983 Ga0081540_1002139 Ga0081540_100213910 266
791 3300006871 Ga0075434_100058583 Ga0075434_1000585834 266
792 3300025928 Ga0207700_10321576 Ga0207700_103215762 266
793 3300048916 Ga0496113_0285260 Ga0496113_0285260_102_1019 266
794 3300005445 Ga0070708_100163230 Ga0070708_1001632302 267
795 3300005719 Ga0068861_100095830 Ga0068861_1000958302 267
796 3300013308 Ga0157375_10037116 Ga0157375_100371162 267
797 3300025315 Ga0207697_10077424 Ga0207697_100774242 267
798 3300025937 Ga0207669_10009349 Ga0207669_100093492 267
799 3300025939 Ga0207665_10078370 Ga0207665_100783702 267
800 3300046477 Ga0495664_0142583 Ga0495664_0142583_194_1111 267
801 3300046516 Ga0495628_0335112 Ga0495628_0335112_24_941 267
802 3300048911 Ga0496108_0172970 Ga0496108_0172970_25_942 267
803 3300053077 Ga0495601_0047948 Ga0495601_0047948_608_1525 267
804 3300005437 Ga0070710_10162601 Ga0070710_101626011 268
805 3300025898 Ga0207692_10073723 Ga0207692_100737232 268
806 3300031548 Ga0307408_100296925 Ga0307408_1002969251 268
807 3300037418 Ga0395900_0307078 Ga0395900_0307078_274_1191 268
808 3300037471 Ga0395905_0058561 Ga0395905_0058561_494_1411 268
809 3300037471 Ga0395905_0529498 Ga0395905_0529498_24_941 268
810 3300049575 Ga0501039_0106653 Ga0501039_0106653_282_1199 268
811 3300049577 Ga0501041_0203680 Ga0501041_0203680_133_1050 268
812 3300049588 Ga0501072_0036785 Ga0501072_0036785_401_1318 268
813 3300049591 Ga0501075_0224924 Ga0501075_0224924_313_1230 268
814 3300049593 Ga0501077_0138902 Ga0501077_0138902_139_1056 268
815 3300060353 Ga0501082_0081951 Ga0501082_0081951_1343_2260 268
816 3300005841 Ga0068863_100136723 Ga0068863_1001367232 269
817 3300005983 Ga0081540_1000234 Ga0081540_100023429 269
818 3300009551 Ga0105238_10085124 Ga0105238_100851242 269
819 3300009553 Ga0105249_10146255 Ga0105249_101462552 269
820 3300014326 Ga0157380_10069320 Ga0157380_100693202 269
821 3300025961 Ga0207712_10293671 Ga0207712_102936712 269
822 3300028380 Ga0268265_10076786 Ga0268265_100767862 269
823 3300028381 Ga0268264_10000049 Ga0268264_10000049172 269
824 3300030521 Ga0307511_10059305 Ga0307511_100593052 269
825 3300033179 Ga0307507_10010582 Ga0307507_100105828 269
826 3300033180 Ga0307510_10164006 Ga0307510_101640062 269
827 3300035083 Ga0373926_0066139 Ga0373926_0066139_29_946 269
828 3300035692 Ga0373935_0012686 Ga0373935_0012686_1944_2861 269
829 3300037068 Ga0373925_0093659 Ga0373925_0093659_949_1866 269
830 3300039450 Ga0436363_0233079 Ga0436363_0233079_733_1692 269
831 3300046557 Ga0495622_0003279 Ga0495622_0003279_4948_5865 269
832 3300048920 Ga0496117_0037614 Ga0496117_0037614_536_1453 269
833 3300048921 Ga0496118_0009493 Ga0496118_0009493_1964_2881 269
834 3300048924 Ga0496121_0000261 Ga0496121_0000261_17287_18204 269
835 3300048927 Ga0496124_0163540 Ga0496124_0163540_609_1526 269
836 3300048928 Ga0496125_0123705 Ga0496125_0123705_89_1006 269
837 3300048929 Ga0496126_0010106 Ga0496126_0010106_5401_6318 269
838 3300053080 Ga0500635_0020890 Ga0500635_0020890_231_1148 269
839 3300053094 Ga0500566_0112675 Ga0500566_0112675_243_1160 269
840 3300005983 Ga0081540_1029692 Ga0081540_10296923 270
841 3300048924 Ga0496121_0194358 Ga0496121_0194358_484_1401 270
842 3300049571 Ga0501034_0266607 Ga0501034_0266607_236_1153 270
843 3300049572 Ga0501036_0006289 Ga0501036_0006289_1273_2190 270
844 3300049579 Ga0501043_0032442 Ga0501043_0032442_1091_2008 270
845 3300049581 Ga0501047_0000659 Ga0501047_0000659_12673_13590 270
846 3300049582 Ga0501048_0019853 Ga0501048_0019853_3376_4293 270
847 3300049586 Ga0501070_0013312 Ga0501070_0013312_3857_4774 270
848 3300049590 Ga0501074_0001224 Ga0501074_0001224_9789_10706 270
849 3300049742 Ga0501080_0000406 Ga0501080_0000406_22434_23351 270
850 3300049744 Ga0501083_0000497 Ga0501083_0000497_22259_23176 270
851 3300006175 Ga0070712_100149165 Ga0070712_1001491652 271
852 3300035117 Ga0373953_0007800 Ga0373953_0007800_2637_3554 271
853 3300035120 Ga0373957_0077178 Ga0373957_0077178_318_1235 271
854 3300035172 Ga0373955_0009210 Ga0373955_0009210_598_1515 271
855 3300037068 Ga0373925_0007864 Ga0373925_0007864_2679_3596 271
856 3300046462 Ga0495651_0040822 Ga0495651_0040822_135_1052 271
857 3300046514 Ga0495618_0112757 Ga0495618_0112757_690_1607 271
858 3300046516 Ga0495628_0003003 Ga0495628_0003003_6231_7148 271
859 3300046529 Ga0495652_0005848 Ga0495652_0005848_7939_8856 271
860 3300046536 Ga0495587_0016313 Ga0495587_0016313_1391_2308 271
861 3300046543 Ga0495645_0107754 Ga0495645_0107754_118_1035 271
862 3300046663 Ga0495635_0039347 Ga0495635_0039347_1309_2226 271
863 3300046678 Ga0495599_0022225 Ga0495599_0022225_2068_2985 271
864 3300046679 Ga0495623_0004990 Ga0495623_0004990_839_1756 271
865 3300046809 Ga0495600_0005746 Ga0495600_0005746_639_1556 271
866 3300047317 Ga0495604_0029420 Ga0495604_0029420_907_1824 271
867 3300047471 Ga0495684_0025902 Ga0495684_0025902_1034_1951 271
868 3300048088 Ga0495602_0000961 Ga0495602_0000961_7375_8292 271
869 3300048907 Ga0496104_0000061 Ga0496104_0000061_90417_91334 271
870 3300048908 Ga0496105_0001465 Ga0496105_0001465_6033_6950 271
871 3300053077 Ga0495601_0000153 Ga0495601_0000153_2162_3079 271
872 3300053084 Ga0495595_0000249 Ga0495595_0000249_20146_21063 271
873 3300053085 Ga0495619_0001259 Ga0495619_0001259_5400_6317 271
874 3300006195 Ga0075366_10012741 Ga0075366_100127413 272
875 3300006353 Ga0075370_10017657 Ga0075370_100176573 272
876 3300006847 Ga0075431_100194317 Ga0075431_1001943172 272
877 3300006880 Ga0075429_100126935 Ga0075429_1001269352 272
878 3300015265 Ga0182005_1057806 Ga0182005_10578061 272
879 3300024227 Ga0228598_1001818 Ga0228598_10018183 272
880 3300026121 Ga0207683_10009426 Ga0207683_100094265 272
881 3300035695 Ga0373927_0078868 Ga0373927_0078868_771_1688 272
882 3300037471 Ga0395905_0193045 Ga0395905_0193045_283_1206 272
883 3300046455 Ga0495603_0045786 Ga0495603_0045786_269_1186 272
884 3300049571 Ga0501034_0397206 Ga0501034_0397206_279_1196 272
885 3300050490 nmdc:mga03n38_31526_c1 nmdc:mga03n38_31526_c1_285_1202 272
886 3300050493 nmdc:mga0k408_2679_c1 nmdc:mga0k408_2679_c1_4786_5703 272
887 3300050496 nmdc:mga07m45_36008_c1 nmdc:mga07m45_36008_c1_567_1484 272
888 3300050507 nmdc:mga05p37_30389_c1 nmdc:mga05p37_30389_c1_2589_3506 272
889 3300050510 nmdc:mga06r32_33398_c1 nmdc:mga06r32_33398_c1_2760_3677 272
890 3300053094 Ga0500566_0000199 Ga0500566_0000199_29371_30288 272
891 3300003203 JGI25406J46586_10006783 JGI25406J46586_100067833 273
892 3300005353 Ga0070669_100173399 Ga0070669_1001733991 273
893 3300005546 Ga0070696_100414275 Ga0070696_1004142751 273
894 3300005937 Ga0081455_10032195 Ga0081455_100321952 273
895 3300006844 Ga0075428_100147151 Ga0075428_1001471512 273
896 3300006846 Ga0075430_100020485 Ga0075430_1000204854 273
897 3300006847 Ga0075431_100042822 Ga0075431_1000428225 273
898 3300006880 Ga0075429_100013201 Ga0075429_1000132015 273
899 3300006880 Ga0075429_100381793 Ga0075429_1003817932 273
900 3300009147 Ga0114129_10037886 Ga0114129_100378866 273
901 3300009147 Ga0114129_10272104 Ga0114129_102721042 273
902 3300025297 Ga0209758_1000244 Ga0209758_100024464 273
903 3300035119 Ga0373956_0025524 Ga0373956_0025524_149_1066 273
904 3300035695 Ga0373927_0032472 Ga0373927_0032472_2143_3060 273
905 3300036401 Ga0373937_0001983 Ga0373937_0001983_15223_16140 273
906 3300037068 Ga0373925_0009628 Ga0373925_0009628_5694_6611 273
907 3300037471 Ga0395905_0134711 Ga0395905_0134711_1210_2127 273
908 3300046454 Ga0495592_0001227 Ga0495592_0001227_9722_10639 273
909 3300046459 Ga0495629_0006223 Ga0495629_0006223_7520_8437 273
910 3300046462 Ga0495651_0000661 Ga0495651_0000661_10519_11436 273
911 3300046462 Ga0495651_0139918 Ga0495651_0139918_43_960 273
912 3300046463 Ga0495653_0001029 Ga0495653_0001029_13494_14411 273
913 3300046471 Ga0495650_0043166 Ga0495650_0043166_704_1621 273
914 3300046477 Ga0495664_0057543 Ga0495664_0057543_247_1164 273
915 3300046511 Ga0495608_0002135 Ga0495608_0002135_8063_8980 273
916 3300046511 Ga0495608_0130357 Ga0495608_0130357_463_1380 273
917 3300046514 Ga0495618_0278255 Ga0495618_0278255_48_965 273
918 3300046516 Ga0495628_0007741 Ga0495628_0007741_7269_8186 273
919 3300046517 Ga0495630_0146060 Ga0495630_0146060_550_1467 273
920 3300046529 Ga0495652_0001763 Ga0495652_0001763_9737_10654 273
921 3300046529 Ga0495652_0120528 Ga0495652_0120528_475_1392 273
922 3300046533 Ga0495640_0006334 Ga0495640_0006334_4512_5429 273
923 3300046536 Ga0495587_0000339 Ga0495587_0000339_18329_19246 273
924 3300046543 Ga0495645_0004632 Ga0495645_0004632_405_1322 273
925 3300046559 Ga0495667_0006028 Ga0495667_0006028_7158_8075 273
926 3300046642 Ga0495634_0006327 Ga0495634_0006327_2549_3466 273
927 3300046663 Ga0495635_0001322 Ga0495635_0001322_6576_7493 273
928 3300046675 Ga0495657_0003526 Ga0495657_0003526_6078_6995 273
929 3300046678 Ga0495599_0032392 Ga0495599_0032392_626_1543 273
930 3300046679 Ga0495623_0011272 Ga0495623_0011272_1243_2160 273
931 3300046679 Ga0495623_0030566 Ga0495623_0030566_701_1618 273
932 3300046680 Ga0495646_0007201 Ga0495646_0007201_5755_6672 273
933 3300046809 Ga0495600_0003882 Ga0495600_0003882_5283_6200 273
934 3300047317 Ga0495604_0001130 Ga0495604_0001130_14173_15090 273
935 3300047319 Ga0495674_0002947 Ga0495674_0002947_11901_12818 273
936 3300047321 Ga0495676_0179245 Ga0495676_0179245_291_1208 273
937 3300047322 Ga0495680_0006062 Ga0495680_0006062_5620_6537 273
938 3300047471 Ga0495684_0003709 Ga0495684_0003709_984_1901 273
939 3300047673 Ga0495593_0061081 Ga0495593_0061081_25_942 273
940 3300049585 Ga0501069_0043531 Ga0501069_0043531_1462_2382 273
941 3300049586 Ga0501070_0092483 Ga0501070_0092483_546_1466 273
942 3300049742 Ga0501080_0187718 Ga0501080_0187718_268_1188 273
943 3300049822 Ga0501035_0005717 Ga0501035_0005717_7987_8907 273
944 3300050507 nmdc:mga05p37_178584_c1 nmdc:mga05p37_178584_c1_1168_2091 273
945 3300050507 nmdc:mga05p37_37850_c2 nmdc:mga05p37_37850_c2_596_1513 273
946 3300050508 nmdc:mga09592_15144_c1 nmdc:mga09592_15144_c1_2903_3820 273
947 3300050509 nmdc:mga0qj67_9429_c1 nmdc:mga0qj67_9429_c1_3451_4368 273
948 3300050510 nmdc:mga06r32_79052_c1 nmdc:mga06r32_79052_c1_1648_2565 273
949 3300053077 Ga0495601_0072953 Ga0495601_0072953_292_1209 273
950 3300053078 Ga0495612_0001641 Ga0495612_0001641_2959_3876 273
951 3300053084 Ga0495595_0001072 Ga0495595_0001072_1677_2594 273
952 3300053085 Ga0495619_0003278 Ga0495619_0003278_7052_7969 273
953 3300053730 Ga0500645_019097 Ga0500645_019097_955_1872 273
954 3300025907 Ga0207645_10199679 Ga0207645_101996792 274
955 3300049823 Ga0501044_0405775 Ga0501044_0405775_341_1258 274
956 3300053153 Ga0500616_0003402 Ga0500616_0003402_142_1059 274
957 iso_pu_bacteria 2643221547 2643758436 274
958 iso_pu_bacteria 2643221621 2644120558 274
959 iso_pu_bacteria 2842482326 2842486486 274
960 iso_pu_bacteria 2857576091 2857579262 274
961 iso_pu_bacteria 2858950400 2858956294 274
962 iso_pu_bacteria 2939631187 2939631630 274
963 iso_pu_bacteria 2941479691 2941482901 274
964 iso_pu_bacteria 2507262055 2507504788 275
965 iso_pu_bacteria 2508501009 2508546142 275
966 iso_pu_bacteria 2508501042 2508695078 275
967 iso_pu_bacteria 2508501128 2509149761 275
968 iso_pu_bacteria 2511231028 2511400470 275
969 iso_pu_bacteria 2513237092 2513626187 275
970 iso_pu_bacteria 2513237094 2513641858 275
971 iso_pu_bacteria 2513237095 2513648017 275
972 iso_pu_bacteria 2513237098 2513673019 275
973 iso_pu_bacteria 2513237101 2513694869 275
974 iso_pu_bacteria 2513237102 2513702864 275
975 iso_pu_bacteria 2513237139 2513873969 275
976 iso_pu_bacteria 2513237141 2513890443 275
977 iso_pu_bacteria 2513237161 2514012942 275
978 iso_pu_bacteria 2515154112 2515625919 275
979 iso_pu_bacteria 2517093001 2517102444 275
980 iso_pu_bacteria 2524023205 2524435688 275
981 iso_pu_bacteria 2524023210 2524466494 275
982 iso_pu_bacteria 2528768022 2528850345 275
983 iso_pu_bacteria 2617270735 2617353001 275
984 iso_pu_bacteria 2617270741 2617374186 275
985 iso_pu_bacteria 2721755755 2723842075 275
986 iso_pu_bacteria 2744054633 2745078984 275
987 iso_pu_bacteria 2791355196 2793063157 275
988 iso_pu_bacteria 2791355199 2793077373 275
989 iso_pu_bacteria 2802429603 2805919444 275
990 iso_pu_bacteria 2816332527 2818237224 275
991 iso_pu_bacteria 2824600985 2824602519 275
992 iso_pu_bacteria 2824609381 2824612701 275
993 iso_pu_bacteria 2824617872 2824624081 275
994 iso_pu_bacteria 2824626560 2824632671 275
995 iso_pu_bacteria 2824635225 2824639559 275
996 iso_pu_bacteria 2824644064 2824648538 275
997 iso_pu_bacteria 2824653114 2824659828 275
998 iso_pu_bacteria 2824661429 2824663609 275
999 iso_pu_bacteria 2824671348 2824675402 275
1000 iso_pu_bacteria 2824679649 2824683746 275
1001 iso_pu_bacteria 2824687955 2824691620 275
1002 iso_pu_bacteria 2824696289 2824701239 275
1003 iso_pu_bacteria 2824704595 2824709458 275
1004 iso_pu_bacteria 2824714736 2824718413 275
1005 iso_pu_bacteria 2824723954 2824728765 275
1006 iso_pu_bacteria 2824732956 2824739387 275
1007 iso_pu_bacteria 2824746037 2824748182 275
1008 iso_pu_bacteria 2824753945 2824758437 275
1009 iso_pu_bacteria 2824763712 2824768861 275
1010 iso_pu_bacteria 2824773399 2824774998 275
1011 iso_pu_bacteria 2838122688 2838129502 275
1012 iso_pu_bacteria 2841941048 2841944403 275
1013 iso_pu_bacteria 2841949485 2841954419 275
1014 iso_pu_bacteria 2841957949 2841964668 275
1015 iso_pu_bacteria 2841966195 2841969180 275
1016 iso_pu_bacteria 2841974524 2841982981 275
1017 iso_pu_bacteria 2841983080 2841990865 275
1018 iso_pu_bacteria 2842038055 2842043938 275
1019 iso_pu_bacteria 2842045827 2842052072 275
1020 iso_pu_bacteria 2844315083 2844321772 275
1021 iso_pu_bacteria 2847930680 2847939738 275
1022 iso_pu_bacteria 2847939898 2847941699 275
1023 iso_pu_bacteria 2849076700 2849082620 275
1024 iso_pu_bacteria 2857509624 2857511513 275
1025 iso_pu_bacteria 2874590934 2874594249 275
1026 iso_pu_bacteria 2874604998 2874610307 275
1027 iso_pu_bacteria 2874612657 2874615510 275
1028 iso_pu_bacteria 2874620515 2874624366 275
1029 iso_pu_bacteria 2874628541 2874636653 275
1030 iso_pu_bacteria 2874645413 2874647675 275
1031 iso_pu_bacteria 2876761206 2876764986 275
1032 iso_pu_bacteria 2876771140 2876771897 275
1033 iso_pu_bacteria 2876808645 2876812778 275
1034 iso_pu_bacteria 2876818435 2876819203 275
1035 iso_pu_bacteria 2879074833 2879075748 275
1036 iso_pu_bacteria 2879083081 2879090002 275
1037 iso_pu_bacteria 2879099564 2879101302 275
1038 iso_pu_bacteria 2879110137 2879111626 275
1039 iso_pu_bacteria 2879127579 2879130721 275
1040 iso_pu_bacteria 2879142872 2879146119 275
1041 iso_pu_bacteria 2881364244 2881369831 275
1042 iso_pu_bacteria 2881665667 2881672347 275
1043 iso_pu_bacteria 2885366525 2885371451 275
1044 iso_pu_bacteria 2885409591 2885410847 275
1045 iso_pu_bacteria 2888378607 2888380023 275
1046 iso_pu_bacteria 2888388044 2888391090 275
1047 iso_pu_bacteria 2888419890 2888420828 275
1048 iso_pu_bacteria 2889033259 2889035018 275
1049 iso_pu_bacteria 2903727486 2903727681 275
1050 iso_pu_bacteria 2903768456 2903772282 275
1051 iso_pu_bacteria 2904666416 2904672295 275
1052 iso_pu_bacteria 2904690495 2904692111 275
1053 iso_pu_bacteria 2904711408 2904716024 275
1054 iso_pu_bacteria 2906602504 2906602832 275
1055 iso_pu_bacteria 2906626472 2906634439 275
1056 iso_pu_bacteria 2906643746 2906644998 275
1057 iso_pu_bacteria 2908756301 2908757392 275
1058 iso_pu_bacteria 2908775508 2908776661 275
1059 iso_pu_bacteria 2922361189 2922366906 275
1060 iso_pu_bacteria 2922368715 2922378405 275
1061 iso_pu_bacteria 2922386360 2922391956 275
1062 iso_pu_bacteria 2922393267 2922400309 275
1063 iso_pu_bacteria 2929615660 2929622495 275
1064 iso_pu_bacteria 2929624759 2929631287 275
1065 iso_pu_bacteria 2932784394 2932786292 275
1066 iso_pu_bacteria 2932794094 2932794739 275
1067 iso_pu_bacteria 2932801729 2932805451 275
1068 iso_pu_bacteria 2932809354 2932812634 275
1069 iso_pu_bacteria 2932818245 2932822996 275
1070 iso_pu_bacteria 2932828146 2932829530 275
1071 iso_pu_bacteria 2933577622 2933584426 275
1072 iso_pu_bacteria 2935608549 2935615011 275
1073 iso_pu_bacteria 2935616580 2935618048 275
1074 iso_pu_bacteria 2935638405 2935641554 275
1075 iso_pu_bacteria 2935648319 2935651641 275
1076 iso_pu_bacteria 2935656913 2935659591 275
1077 iso_pu_bacteria 2935665750 2935669388 275
1078 iso_pu_bacteria 2935675223 2935678014 275
1079 iso_pu_bacteria 2935684952 2935693665 275
1080 iso_pu_bacteria 2935694250 2935701747 275
1081 iso_pu_bacteria 2935703347 2935707212 275
1082 iso_pu_bacteria 2935713505 2935717054 275
1083 iso_pu_bacteria 2935722832 2935730112 275
1084 iso_pu_bacteria 2935732158 2935738468 275
1085 iso_pu_bacteria 2935741537 2935750256 275
1086 iso_pu_bacteria 2935750917 2935759850 275
1087 iso_pu_bacteria 2935760218 2935764499 275
1088 iso_pu_bacteria 2935769743 2935772828 275
1089 iso_pu_bacteria 2935777560 2935778036 275
1090 iso_pu_bacteria 2935785616 2935787263 275
1091 iso_pu_bacteria 2935793552 2935795949 275
1092 iso_pu_bacteria 2935801545 2935804408 275
1093 iso_pu_bacteria 2935810662 2935817269 275
1094 iso_pu_bacteria 2935819856 2935825951 275
1095 iso_pu_bacteria 2935827899 2935831285 275
1096 iso_pu_bacteria 2935837841 2935841894 275
1097 iso_pu_bacteria 2935847175 2935851570 275
1098 iso_pu_bacteria 2935855204 2935856453 275
1099 iso_pu_bacteria 2935864058 2935871005 275
1100 iso_pu_bacteria 2935873716 2935874521 275
1101 iso_pu_bacteria 2935883170 2935888952 275
1102 iso_pu_bacteria 2935908558 2935910407 275
1103 iso_pu_bacteria 2935916978 2935918307 275
1104 iso_pu_bacteria 2935926038 2935927682 275
1105 iso_pu_bacteria 2935934488 2935936446 275
1106 iso_pu_bacteria 2935942939 2935944001 275
1107 iso_pu_bacteria 2935951376 2935952438 275
1108 iso_pu_bacteria 2935959822 2935964199 275
1109 iso_pu_bacteria 2935967501 2935969278 275
1110 iso_pu_bacteria 2935975950 2935977961 275
1111 iso_pu_bacteria 2935984226 2935984739 275
1112 iso_pu_bacteria 2935992306 2935993982 275
1113 iso_pu_bacteria 2936002035 2936005007 275
1114 iso_pu_bacteria 2936011229 2936014007 275
1115 iso_pu_bacteria 2936019824 2936023084 275
1116 iso_pu_bacteria 2936028420 2936031220 275
1117 iso_pu_bacteria 2936037263 2936044065 275
1118 iso_pu_bacteria 2936046547 2936049342 275
1119 iso_pu_bacteria 2936055302 2936055909 275
1120 iso_pu_bacteria 2940556831 2940565696 275
1121 iso_pu_bacteria 2941531003 2941532300 275
1122 iso_pu_bacteria 2941538514 2941543967 275
1123 iso_pu_bacteria 3005483717 3005491041 275
1124 iso_pu_bacteria 3005506211 3005509598 275
1125 iso_pu_bacteria 3005587118 3005594196 275
1126 iso_pu_bacteria 3005594810 3005602118 275
1127 iso_pu_bacteria 3005710791 3005717874 275
1128 iso_pu_bacteria 3005718088 3005724906 275
1129 iso_pu_bacteria 8006926726 8006930541 275
1130 iso_pu_bacteria 8006964411 8006971538 275
1131 iso_pu_bacteria 8006984368 8006985880 275
1132 iso_pu_bacteria 8006994254 8007000304 275
1133 iso_pu_bacteria 8016511872 8016518699 275
1134 iso_pu_bacteria 8016522445 8016526659 275
1135 iso_pu_bacteria 8016530956 8016531744 275
1136 iso_pu_bacteria 8016539877 8016544944 275
1137 iso_pu_bacteria 8016548790 8016557125 275
1138 iso_pu_bacteria 8016557553 8016565477 275
1139 iso_pu_bacteria 8016566248 8016570021 275
1140 iso_pu_bacteria 8016575299 8016582593 275
1141 iso_pu_bacteria 8016583857 8016586903 275
1142 iso_pu_bacteria 8016595262 8016603108 275
1143 iso_pu_bacteria 8016603502 8016606015 275
1144 iso_pu_bacteria 8016622563 8016623669 275
1145 iso_pu_bacteria 8016630954 8016636141 275
1146 iso_pu_bacteria 8017057580 8017057975 275
1147 iso_pu_bacteria 8019530166 8019531570 275
1148 iso_pu_bacteria 8019538911 8019539963 275
1149 iso_pu_bacteria 8019547302 8019550691 275
1150 iso_pu_bacteria 8019576017 8019577745 275
1151 iso_pu_bacteria 8019586578 8019595846 275
1152 iso_pu_bacteria 8019597564 8019605914 275
1153 iso_pu_bacteria 8019608314 8019612621 275
1154 iso_pu_bacteria 8019619141 8019622496 275
1155 iso_pu_bacteria 8019629233 8019630622 275
1156 iso_pu_bacteria 8019638758 8019639994 275
1157 iso_pu_bacteria 8019648815 8019652025 275
1158 iso_pu_bacteria 8019668869 8019677216 275
1159 iso_pu_bacteria 8019678201 8019678769 275
1160 iso_pu_bacteria 8019687851 8019696756 275
1161 iso_pu_bacteria 8055742211 8055750946 275
1162 iso_pu_bacteria 8056673599 8056677780 275
1163 iso_pu_bacteria 8056681323 8056688423 275
1164 iso_pu_bacteria 8056967851 8056970860 275
1165 3300035724 Ga0373933_0225413 Ga0373933_0225413_270_1187 276
1166 3300048907 Ga0496104_0000609 Ga0496104_0000609_15230_16147 276
1167 3300048907 Ga0496104_0003575 Ga0496104_0003575_10536_11453 276
1168 3300048908 Ga0496105_0010336 Ga0496105_0010336_2818_3735 276
1169 3300048909 Ga0496106_0075309 Ga0496106_0075309_692_1609 276
1170 3300048909 Ga0496106_0312894 Ga0496106_0312894_29_946 276
1171 3300048917 Ga0496114_0089640 Ga0496114_0089640_1200_2117 276
1172 3300053096 Ga0500641_0005562 Ga0500641_0005562_3473_4381 276
1173 3300006914 Ga0075436_100011676 Ga0075436_1000116763 277
1174 3300031727 Ga0316576_10004636 Ga0316576_100046364 277
1175 3300031728 Ga0316578_10014387 Ga0316578_100143875 277
1176 3300035115 Ga0373941_0001456 Ga0373941_0001456_53_967 277
1177 3300035398 Ga0316574_0034427 Ga0316574_0034427_1202_2113 277
1178 3300036712 Ga0316584_0001325 Ga0316584_0001325_13237_14148 277
1179 3300049569 Ga0501032_0230052 Ga0501032_0230052_43_957 277
1180 3300049570 Ga0501033_0125932 Ga0501033_0125932_156_1070 277
1181 3300049575 Ga0501039_0081657 Ga0501039_0081657_910_1824 277
1182 3300049579 Ga0501043_0344258 Ga0501043_0344258_82_996 277
1183 3300049580 Ga0501046_0157754 Ga0501046_0157754_364_1278 277
1184 3300049581 Ga0501047_0100982 Ga0501047_0100982_1138_2052 277
1185 3300049584 Ga0501068_0027694 Ga0501068_0027694_263_1177 277
1186 3300049590 Ga0501074_0009389 Ga0501074_0009389_1077_1991 277
1187 3300049822 Ga0501035_0012534 Ga0501035_0012534_2244_3158 277
1188 3300049822 Ga0501035_0169958 Ga0501035_0169958_348_1262 277
1189 3300049823 Ga0501044_0408933 Ga0501044_0408933_321_1235 277
1190 3300003214 JGI25165J46597_1000276 JGI25165J46597_100027634 278
1191 3300003354 JGI25160J50197_1002937 JGI25160J50197_10029372 278
1192 3300005436 Ga0070713_100677556 Ga0070713_1006775561 278
1193 3300005445 Ga0070708_100095238 Ga0070708_1000952382 278
1194 3300005468 Ga0070707_100225999 Ga0070707_1002259991 278
1195 3300005536 Ga0070697_100151364 Ga0070697_1001513642 278
1196 3300005616 Ga0068852_100015174 Ga0068852_1000151747 278
1197 3300005937 Ga0081455_10102989 Ga0081455_101029892 278
1198 3300007265 Ga0099794_10010970 Ga0099794_100109702 278
1199 3300009093 Ga0105240_10003126 Ga0105240_1000312624 278
1200 3300009094 Ga0111539_10031617 Ga0111539_100316172 278
1201 3300009545 Ga0105237_10000859 Ga0105237_1000085920 278
1202 3300009551 Ga0105238_10059175 Ga0105238_100591754 278
1203 3300025233 Ga0209437_100023 Ga0209437_100023442 278
1204 3300025261 Ga0209233_1000062 Ga0209233_100006233 278
1205 3300025911 Ga0207654_10019435 Ga0207654_100194356 278
1206 3300025913 Ga0207695_10000065 Ga0207695_10000065128 278
1207 3300025914 Ga0207671_10007730 Ga0207671_100077306 278
1208 3300025924 Ga0207694_10036268 Ga0207694_100362684 278
1209 3300026142 Ga0207698_10103408 Ga0207698_101034082 278
1210 3300031911 Ga0307412_10000103 Ga0307412_100001038 278
1211 3300035089 Ga0373944_0042495 Ga0373944_0042495_53_970 278
1212 3300035113 Ga0373936_0000512 Ga0373936_0000512_2873_3790 278
1213 3300035116 Ga0373945_0001308 Ga0373945_0001308_2245_3162 278
1214 3300035116 Ga0373945_0012390 Ga0373945_0012390_1828_2745 278
1215 3300035117 Ga0373953_0014947 Ga0373953_0014947_1771_2688 278
1216 3300035118 Ga0373954_0006081 Ga0373954_0006081_216_1133 278
1217 3300035170 Ga0373943_0019983 Ga0373943_0019983_1449_2366 278
1218 3300035172 Ga0373955_0011021 Ga0373955_0011021_3192_4109 278
1219 3300035410 Ga0373924_0004458 Ga0373924_0004458_126_1043 278
1220 3300035692 Ga0373935_0011799 Ga0373935_0011799_179_1096 278
1221 3300035695 Ga0373927_0010893 Ga0373927_0010893_25_942 278
1222 3300035724 Ga0373933_0024022 Ga0373933_0024022_2371_3288 278
1223 3300035725 Ga0373947_0003017 Ga0373947_0003017_8920_9837 278
1224 3300035725 Ga0373947_0007492 Ga0373947_0007492_302_1219 278
1225 3300036401 Ga0373937_0001583 Ga0373937_0001583_18008_18925 278
1226 3300036401 Ga0373937_0016191 Ga0373937_0016191_2608_3528 278
1227 3300036712 Ga0316584_0086273 Ga0316584_0086273_73_993 278
1228 3300037068 Ga0373925_0000016 Ga0373925_0000016_31677_32594 278
1229 3300037068 Ga0373925_0136572 Ga0373925_0136572_641_1558 278
1230 3300046454 Ga0495592_0000044 Ga0495592_0000044_76_993 278
1231 3300046459 Ga0495629_0176481 Ga0495629_0176481_91_1008 278
1232 3300046461 Ga0495641_0006762 Ga0495641_0006762_252_1169 278
1233 3300046462 Ga0495651_0000253 Ga0495651_0000253_37998_38915 278
1234 3300046463 Ga0495653_0040843 Ga0495653_0040843_196_1113 278
1235 3300046472 Ga0495580_0384622 Ga0495580_0384622_14_931 278
1236 3300046475 Ga0495639_0115575 Ga0495639_0115575_173_1090 278
1237 3300046476 Ga0495662_0031274 Ga0495662_0031274_118_1035 278
1238 3300046477 Ga0495664_0010539 Ga0495664_0010539_4095_5012 278
1239 3300046501 Ga0495607_0000064 Ga0495607_0000064_55855_56769 278
1240 3300046511 Ga0495608_0015847 Ga0495608_0015847_4137_5054 278
1241 3300046514 Ga0495618_0011956 Ga0495618_0011956_4152_5069 278
1242 3300046516 Ga0495628_0040482 Ga0495628_0040482_2642_3559 278
1243 3300046526 Ga0495666_0006389 Ga0495666_0006389_2087_3004 278
1244 3300046529 Ga0495652_0000002 Ga0495652_0000002_213439_214356 278
1245 3300046533 Ga0495640_0000001 Ga0495640_0000001_307443_308360 278
1246 3300046535 Ga0495586_0061184 Ga0495586_0061184_22_939 278
1247 3300046536 Ga0495587_0028398 Ga0495587_0028398_37_954 278
1248 3300046543 Ga0495645_0016566 Ga0495645_0016566_4158_5075 278
1249 3300046559 Ga0495667_0000009 Ga0495667_0000009_183_1100 278
1250 3300046642 Ga0495634_0017883 Ga0495634_0017883_31_948 278
1251 3300046663 Ga0495635_0000002 Ga0495635_0000002_487102_488019 278
1252 3300046674 Ga0495588_0007311 Ga0495588_0007311_3840_4757 278
1253 3300046675 Ga0495657_0018057 Ga0495657_0018057_4029_4946 278
1254 3300046678 Ga0495599_0012983 Ga0495599_0012983_4117_5034 278
1255 3300046679 Ga0495623_0014016 Ga0495623_0014016_165_1082 278
1256 3300046680 Ga0495646_0027795 Ga0495646_0027795_2538_3455 278
1257 3300046809 Ga0495600_0000010 Ga0495600_0000010_4154_5071 278
1258 3300047317 Ga0495604_0042924 Ga0495604_0042924_2480_3397 278
1259 3300047319 Ga0495674_0054574 Ga0495674_0054574_2473_3390 278
1260 3300047321 Ga0495676_0161927 Ga0495676_0161927_504_1421 278
1261 3300047322 Ga0495680_0044218 Ga0495680_0044218_2537_3454 278
1262 3300047444 Ga0495675_0029142 Ga0495675_0029142_91_1008 278
1263 3300047471 Ga0495684_0019673 Ga0495684_0019673_4106_5023 278
1264 3300048088 Ga0495602_0029436 Ga0495602_0029436_141_1058 278
1265 3300048913 Ga0496110_0156749 Ga0496110_0156749_35_952 278
1266 3300048919 Ga0496116_0010631 Ga0496116_0010631_2563_3477 278
1267 3300048919 Ga0496116_0123180 Ga0496116_0123180_92_1006 278
1268 3300048921 Ga0496118_0006462 Ga0496118_0006462_9744_10658 278
1269 3300048921 Ga0496118_0012206 Ga0496118_0012206_6003_6917 278
1270 3300048922 Ga0496119_0024757 Ga0496119_0024757_2827_3741 278
1271 3300048924 Ga0496121_0000628 Ga0496121_0000628_3856_4770 278
1272 3300048924 Ga0496121_0081653 Ga0496121_0081653_451_1365 278
1273 3300048925 Ga0496122_0000497 Ga0496122_0000497_39452_40366 278
1274 3300048926 Ga0496123_0029646 Ga0496123_0029646_1931_2845 278
1275 3300048927 Ga0496124_0267265 Ga0496124_0267265_228_1142 278
1276 3300048928 Ga0496125_0000166 Ga0496125_0000166_41924_42838 278
1277 3300048928 Ga0496125_0027392 Ga0496125_0027392_45_959 278
1278 3300048928 Ga0496125_0070570 Ga0496125_0070570_888_1802 278
1279 3300048929 Ga0496126_0119757 Ga0496126_0119757_1021_1935 278
1280 3300048929 Ga0496126_0178339 Ga0496126_0178339_53_970 278
1281 3300049568 Ga0501031_0174117 Ga0501031_0174117_21_935 278
1282 3300049571 Ga0501034_0000994 Ga0501034_0000994_8513_9427 278
1283 3300049571 Ga0501034_0028437 Ga0501034_0028437_2284_3201 278
1284 3300049572 Ga0501036_0011812 Ga0501036_0011812_6055_6969 278
1285 3300049573 Ga0501037_0118632 Ga0501037_0118632_415_1329 278
1286 3300049574 Ga0501038_0004102 Ga0501038_0004102_3285_4199 278
1287 3300049579 Ga0501043_0012441 Ga0501043_0012441_415_1329 278
1288 3300049581 Ga0501047_0006456 Ga0501047_0006456_3222_4136 278
1289 3300049581 Ga0501047_0240731 Ga0501047_0240731_371_1285 278
1290 3300049584 Ga0501068_0294846 Ga0501068_0294846_82_996 278
1291 3300049586 Ga0501070_0139013 Ga0501070_0139013_508_1422 278
1292 3300049586 Ga0501070_0168520 Ga0501070_0168520_528_1445 278
1293 3300049588 Ga0501072_0299891 Ga0501072_0299891_61_975 278
1294 3300049742 Ga0501080_0142880 Ga0501080_0142880_1193_2113 278
1295 3300049744 Ga0501083_0079706 Ga0501083_0079706_125_1042 278
1296 3300049744 Ga0501083_0105662 Ga0501083_0105662_347_1261 278
1297 3300050511 nmdc:mga08y16_111973_c1 nmdc:mga08y16_111973_c1_614_1528 278
1298 3300053077 Ga0495601_0000002 Ga0495601_0000002_311639_312556 278
1299 3300053078 Ga0495612_0011420 Ga0495612_0011420_2475_3392 278
1300 3300053084 Ga0495595_0012077 Ga0495595_0012077_2542_3459 278
1301 3300053085 Ga0495619_0000003 Ga0495619_0000003_155_1072 278
1302 3300053142 Ga0500577_0074621 Ga0500577_0074621_388_1305 278
1303 3300053737 Ga0500601_000162 Ga0500601_000162_8875_9792 278
1304 3300055283 Ga0500661_005091 Ga0500661_005091_491_1408 278
1305 3300060353 Ga0501082_0084220 Ga0501082_0084220_753_1667 278
1306 3300060353 Ga0501082_0166752 Ga0501082_0166752_269_1186 278
1307 3300001991 JGI24743J22301_10000159 JGI24743J22301_100001595 279
1308 3300002070 JGI24750J21931_1000490 JGI24750J21931_10004903 279
1309 3300002077 JGI24744J21845_10000795 JGI24744J21845_100007953 279
1310 3300005295 Ga0065707_10097307 Ga0065707_100973073 279
1311 3300005327 Ga0070658_10021062 Ga0070658_100210625 279
1312 3300005327 Ga0070658_10037310 Ga0070658_100373103 279
1313 3300005328 Ga0070676_10029492 Ga0070676_100294922 279
1314 3300005329 Ga0070683_100056380 Ga0070683_1000563805 279
1315 3300005329 Ga0070683_100142091 Ga0070683_1001420912 279
1316 3300005329 Ga0070683_100338565 Ga0070683_1003385652 279
1317 3300005330 Ga0070690_100017544 Ga0070690_1000175443 279
1318 3300005330 Ga0070690_100065696 Ga0070690_1000656961 279
1319 3300005330 Ga0070690_100177381 Ga0070690_1001773812 279
1320 3300005331 Ga0070670_100013972 Ga0070670_1000139725 279
1321 3300005331 Ga0070670_100036467 Ga0070670_1000364674 279
1322 3300005331 Ga0070670_100454928 Ga0070670_1004549281 279
1323 3300005333 Ga0070677_10081323 Ga0070677_100813232 279
1324 3300005334 Ga0068869_100266342 Ga0068869_1002663422 279
1325 3300005335 Ga0070666_10011682 Ga0070666_100116824 279
1326 3300005336 Ga0070680_100005003 Ga0070680_1000050037 279
1327 3300005336 Ga0070680_100105161 Ga0070680_1001051612 279
1328 3300005336 Ga0070680_100273423 Ga0070680_1002734232 279
1329 3300005337 Ga0070682_100104409 Ga0070682_1001044092 279
1330 3300005338 Ga0068868_100033675 Ga0068868_1000336753 279
1331 3300005338 Ga0068868_100070828 Ga0068868_1000708283 279
1332 3300005338 Ga0068868_100353520 Ga0068868_1003535202 279
1333 3300005339 Ga0070660_100361986 Ga0070660_1003619861 279
1334 3300005340 Ga0070689_100005971 Ga0070689_1000059712 279
1335 3300005340 Ga0070689_100017795 Ga0070689_1000177952 279
1336 3300005343 Ga0070687_100013422 Ga0070687_1000134224 279
1337 3300005344 Ga0070661_100039500 Ga0070661_1000395001 279
1338 3300005344 Ga0070661_100084335 Ga0070661_1000843352 279
1339 3300005347 Ga0070668_100152462 Ga0070668_1001524622 279
1340 3300005353 Ga0070669_100031811 Ga0070669_1000318113 279
1341 3300005354 Ga0070675_100051528 Ga0070675_1000515284 279
1342 3300005354 Ga0070675_100225412 Ga0070675_1002254121 279
1343 3300005354 Ga0070675_100261421 Ga0070675_1002614212 279
1344 3300005355 Ga0070671_100013357 Ga0070671_1000133575 279
1345 3300005364 Ga0070673_100024611 Ga0070673_1000246113 279
1346 3300005364 Ga0070673_100024717 Ga0070673_1000247174 279
1347 3300005364 Ga0070673_100058891 Ga0070673_1000588913 279
1348 3300005364 Ga0070673_100065305 Ga0070673_1000653052 279
1349 3300005365 Ga0070688_100007645 Ga0070688_1000076452 279
1350 3300005365 Ga0070688_100008368 Ga0070688_1000083684 279
1351 3300005365 Ga0070688_100018126 Ga0070688_1000181263 279
1352 3300005367 Ga0070667_100222417 Ga0070667_1002224172 279
1353 3300005434 Ga0070709_10005165 Ga0070709_100051651 279
1354 3300005434 Ga0070709_10023382 Ga0070709_100233821 279
1355 3300005434 Ga0070709_10068961 Ga0070709_100689612 279
1356 3300005435 Ga0070714_100060740 Ga0070714_1000607402 279
1357 3300005435 Ga0070714_100063404 Ga0070714_1000634043 279
1358 3300005435 Ga0070714_100176622 Ga0070714_1001766222 279
1359 3300005436 Ga0070713_100001193 Ga0070713_10000119310 279
1360 3300005436 Ga0070713_100028635 Ga0070713_1000286352 279
1361 3300005436 Ga0070713_100186380 Ga0070713_1001863802 279
1362 3300005436 Ga0070713_100305893 Ga0070713_1003058932 279
1363 3300005438 Ga0070701_10011304 Ga0070701_100113042 279
1364 3300005439 Ga0070711_100002872 Ga0070711_1000028728 279
1365 3300005439 Ga0070711_100009620 Ga0070711_1000096205 279
1366 3300005439 Ga0070711_100029930 Ga0070711_1000299302 279
1367 3300005440 Ga0070705_100031359 Ga0070705_1000313593 279
1368 3300005440 Ga0070705_100056200 Ga0070705_1000562002 279
1369 3300005445 Ga0070708_100152897 Ga0070708_1001528972 279
1370 3300005455 Ga0070663_100071124 Ga0070663_1000711242 279
1371 3300005456 Ga0070678_100040679 Ga0070678_1000406792 279
1372 3300005458 Ga0070681_10036206 Ga0070681_100362064 279
1373 3300005458 Ga0070681_10044600 Ga0070681_100446002 279
1374 3300005458 Ga0070681_10171274 Ga0070681_101712742 279
1375 3300005458 Ga0070681_10183757 Ga0070681_101837572 279
1376 3300005458 Ga0070681_10221347 Ga0070681_102213472 279
1377 3300005458 Ga0070681_10315542 Ga0070681_103155422 279
1378 3300005459 Ga0068867_100005981 Ga0068867_1000059813 279
1379 3300005466 Ga0070685_10002466 Ga0070685_100024668 279
1380 3300005466 Ga0070685_10016722 Ga0070685_100167222 279
1381 3300005535 Ga0070684_100022289 Ga0070684_1000222894 279
1382 3300005535 Ga0070684_100206673 Ga0070684_1002066731 279
1383 3300005539 Ga0068853_100025687 Ga0068853_1000256875 279
1384 3300005545 Ga0070695_100040002 Ga0070695_1000400021 279
1385 3300005545 Ga0070695_100099621 Ga0070695_1000996212 279
1386 3300005547 Ga0070693_100029317 Ga0070693_1000293171 279
1387 3300005548 Ga0070665_100007752 Ga0070665_10000775210 279
1388 3300005548 Ga0070665_100050810 Ga0070665_1000508102 279
1389 3300005548 Ga0070665_100066998 Ga0070665_1000669981 279
1390 3300005563 Ga0068855_100057025 Ga0068855_1000570251 279
1391 3300005563 Ga0068855_100088921 Ga0068855_1000889212 279
1392 3300005563 Ga0068855_100095592 Ga0068855_1000955923 279
1393 3300005564 Ga0070664_100023695 Ga0070664_1000236955 279
1394 3300005564 Ga0070664_100029851 Ga0070664_1000298514 279
1395 3300005578 Ga0068854_100051244 Ga0068854_1000512442 279
1396 3300005578 Ga0068854_100265324 Ga0068854_1002653242 279
1397 3300005614 Ga0068856_100070913 Ga0068856_1000709134 279
1398 3300005615 Ga0070702_100053808 Ga0070702_1000538082 279
1399 3300005616 Ga0068852_100160249 Ga0068852_1001602492 279
1400 3300005616 Ga0068852_100229642 Ga0068852_1002296422 279
1401 3300005617 Ga0068859_100038786 Ga0068859_1000387863 279
1402 3300005617 Ga0068859_100173439 Ga0068859_1001734391 279
1403 3300005618 Ga0068864_100019069 Ga0068864_1000190695 279
1404 3300005618 Ga0068864_100036947 Ga0068864_1000369473 279
1405 3300005718 Ga0068866_10004536 Ga0068866_100045363 279
1406 3300005841 Ga0068863_100037192 Ga0068863_1000371921 279
1407 3300005842 Ga0068858_100019603 Ga0068858_1000196038 279
1408 3300005842 Ga0068858_100041088 Ga0068858_1000410883 279
1409 3300005844 Ga0068862_100027147 Ga0068862_1000271474 279
1410 3300005937 Ga0081455_10017138 Ga0081455_100171385 279
1411 3300005937 Ga0081455_10101207 Ga0081455_101012074 279
1412 3300006028 Ga0070717_10000217 Ga0070717_100002174 279
1413 3300006028 Ga0070717_10084386 Ga0070717_100843862 279
1414 3300006038 Ga0075365_10029572 Ga0075365_100295722 279
1415 3300006038 Ga0075365_10060672 Ga0075365_100606722 279
1416 3300006051 Ga0075364_10112086 Ga0075364_101120862 279
1417 3300006058 Ga0075432_10004699 Ga0075432_100046992 279
1418 3300006163 Ga0070715_10001366 Ga0070715_100013664 279
1419 3300006173 Ga0070716_100007041 Ga0070716_1000070415 279
1420 3300006175 Ga0070712_100002166 Ga0070712_1000021663 279
1421 3300006175 Ga0070712_100008131 Ga0070712_1000081314 279
1422 3300006175 Ga0070712_100150620 Ga0070712_1001506202 279
1423 3300006177 Ga0075362_10026934 Ga0075362_100269342 279
1424 3300006195 Ga0075366_10106745 Ga0075366_101067452 279
1425 3300006237 Ga0097621_100008062 Ga0097621_1000080629 279
1426 3300006237 Ga0097621_100233720 Ga0097621_1002337202 279
1427 3300006358 Ga0068871_100002599 Ga0068871_1000025993 279
1428 3300006844 Ga0075428_100005179 Ga0075428_1000051793 279
1429 3300006844 Ga0075428_100018890 Ga0075428_1000188905 279
1430 3300006846 Ga0075430_100016737 Ga0075430_1000167372 279
1431 3300006847 Ga0075431_100001781 Ga0075431_10000178113 279
1432 3300006847 Ga0075431_100001940 Ga0075431_1000019404 279
1433 3300006847 Ga0075431_100049539 Ga0075431_1000495392 279
1434 3300006847 Ga0075431_100138652 Ga0075431_1001386523 279
1435 3300006852 Ga0075433_10008805 Ga0075433_100088054 279
1436 3300006852 Ga0075433_10017290 Ga0075433_100172905 279
1437 3300006871 Ga0075434_100017436 Ga0075434_1000174364 279
1438 3300006871 Ga0075434_100122839 Ga0075434_1001228393 279
1439 3300006871 Ga0075434_100134851 Ga0075434_1001348512 279
1440 3300006871 Ga0075434_100232638 Ga0075434_1002326382 279
1441 3300006871 Ga0075434_100291203 Ga0075434_1002912032 279
1442 3300006871 Ga0075434_100493692 Ga0075434_1004936921 279
1443 3300006880 Ga0075429_100001284 Ga0075429_10000128418 279
1444 3300006880 Ga0075429_100054884 Ga0075429_1000548842 279
1445 3300006931 Ga0097620_100038786 Ga0097620_1000387863 279
1446 3300006931 Ga0097620_100173432 Ga0097620_1001734321 279
1447 3300006943 Ga0099822_1000191 Ga0099822_100019119 279
1448 3300007076 Ga0075435_100017307 Ga0075435_1000173075 279
1449 3300007076 Ga0075435_100113872 Ga0075435_1001138722 279
1450 3300007076 Ga0075435_100141885 Ga0075435_1001418852 279
1451 3300007076 Ga0075435_100182020 Ga0075435_1001820202 279
1452 3300009011 Ga0105251_10031643 Ga0105251_100316431 279
1453 3300009092 Ga0105250_10079766 Ga0105250_100797662 279
1454 3300009093 Ga0105240_10227620 Ga0105240_102276202 279
1455 3300009093 Ga0105240_10316542 Ga0105240_103165421 279
1456 3300009094 Ga0111539_10040138 Ga0111539_100401385 279
1457 3300009094 Ga0111539_10380587 Ga0111539_103805872 279
1458 3300009098 Ga0105245_10030663 Ga0105245_100306634 279
1459 3300009098 Ga0105245_10033559 Ga0105245_100335592 279
1460 3300009147 Ga0114129_10000003 Ga0114129_1000000392 279
1461 3300009147 Ga0114129_10019015 Ga0114129_100190157 279
1462 3300009147 Ga0114129_10040639 Ga0114129_100406395 279
1463 3300009147 Ga0114129_10087403 Ga0114129_100874032 279
1464 3300009148 Ga0105243_10017546 Ga0105243_100175464 279
1465 3300009174 Ga0105241_10017827 Ga0105241_100178274 279
1466 3300009174 Ga0105241_10048385 Ga0105241_100483853 279
1467 3300009174 Ga0105241_10224170 Ga0105241_102241702 279
1468 3300009176 Ga0105242_10373413 Ga0105242_103734131 279
1469 3300009177 Ga0105248_10055746 Ga0105248_100557462 279
1470 3300009177 Ga0105248_10439423 Ga0105248_104394232 279
1471 3300009545 Ga0105237_10077431 Ga0105237_100774312 279
1472 3300009545 Ga0105237_10297458 Ga0105237_102974581 279
1473 3300009545 Ga0105237_10306137 Ga0105237_103061372 279
1474 3300009551 Ga0105238_10023216 Ga0105238_100232165 279
1475 3300009551 Ga0105238_10154597 Ga0105238_101545972 279
1476 3300009551 Ga0105238_10245501 Ga0105238_102455012 279
1477 3300009553 Ga0105249_10079338 Ga0105249_100793383 279
1478 3300010375 Ga0105239_10044186 Ga0105239_100441864 279
1479 3300011119 Ga0105246_10026068 Ga0105246_100260683 279
1480 3300011119 Ga0105246_10141421 Ga0105246_101414211 279
1481 3300011119 Ga0105246_10282165 Ga0105246_102821652 279
1482 3300013104 Ga0157370_10030287 Ga0157370_100302875 279
1483 3300013104 Ga0157370_10039138 Ga0157370_100391383 279
1484 3300013105 Ga0157369_10011280 Ga0157369_100112802 279
1485 3300013105 Ga0157369_10087143 Ga0157369_100871432 279
1486 3300013105 Ga0157369_10197367 Ga0157369_101973672 279
1487 3300013105 Ga0157369_10753330 Ga0157369_107533301 279
1488 3300013296 Ga0157374_10307525 Ga0157374_103075251 279
1489 3300013297 Ga0157378_10016743 Ga0157378_100167438 279
1490 3300013307 Ga0157372_10075595 Ga0157372_100755952 279
1491 3300013307 Ga0157372_10342547 Ga0157372_103425472 279
1492 3300013308 Ga0157375_10036665 Ga0157375_100366654 279
1493 3300013308 Ga0157375_10107255 Ga0157375_101072553 279
1494 3300014325 Ga0163163_10013076 Ga0163163_100130766 279
1495 3300014325 Ga0163163_10016286 Ga0163163_100162866 279
1496 3300014325 Ga0163163_10020301 Ga0163163_100203015 279
1497 3300014325 Ga0163163_10029786 Ga0163163_100297862 279
1498 3300014325 Ga0163163_10604133 Ga0163163_106041331 279
1499 3300014326 Ga0157380_10106049 Ga0157380_101060492 279
1500 3300014326 Ga0157380_10259718 Ga0157380_102597181 279
1501 3300014745 Ga0157377_10006770 Ga0157377_100067703 279
1502 3300014968 Ga0157379_10005269 Ga0157379_100052699 279
1503 3300014968 Ga0157379_10089161 Ga0157379_100891612 279
1504 3300014968 Ga0157379_10118890 Ga0157379_101188903 279
1505 3300017792 Ga0163161_10050291 Ga0163161_100502913 279
1506 3300017792 Ga0163161_10113394 Ga0163161_101133942 279
1507 3300020081 Ga0206354_11516033 Ga0206354_115160332 279
1508 3300025898 Ga0207692_10068178 Ga0207692_100681782 279
1509 3300025898 Ga0207692_10132223 Ga0207692_101322231 279
1510 3300025898 Ga0207692_10132858 Ga0207692_101328581 279
1511 3300025899 Ga0207642_10081216 Ga0207642_100812162 279
1512 3300025900 Ga0207710_10031231 Ga0207710_100312311 279
1513 3300025901 Ga0207688_10000274 Ga0207688_100002743 279
1514 3300025903 Ga0207680_10009419 Ga0207680_100094194 279
1515 3300025906 Ga0207699_10000138 Ga0207699_1000013822 279
1516 3300025906 Ga0207699_10085543 Ga0207699_100855432 279
1517 3300025907 Ga0207645_10008125 Ga0207645_100081258 279
1518 3300025907 Ga0207645_10038873 Ga0207645_100388733 279
1519 3300025907 Ga0207645_10153805 Ga0207645_101538052 279
1520 3300025909 Ga0207705_10013654 Ga0207705_100136543 279
1521 3300025909 Ga0207705_10064143 Ga0207705_100641432 279
1522 3300025911 Ga0207654_10036667 Ga0207654_100366672 279
1523 3300025912 Ga0207707_10000816 Ga0207707_1000081615 279
1524 3300025912 Ga0207707_10005420 Ga0207707_100054207 279
1525 3300025912 Ga0207707_10006010 Ga0207707_100060103 279
1526 3300025912 Ga0207707_10045493 Ga0207707_100454932 279
1527 3300025912 Ga0207707_10048026 Ga0207707_100480262 279
1528 3300025912 Ga0207707_10270557 Ga0207707_102705572 279
1529 3300025913 Ga0207695_10039529 Ga0207695_100395292 279
1530 3300025913 Ga0207695_10121465 Ga0207695_101214652 279
1531 3300025913 Ga0207695_10226543 Ga0207695_102265432 279
1532 3300025915 Ga0207693_10003459 Ga0207693_1000345914 279
1533 3300025915 Ga0207693_10015786 Ga0207693_100157863 279
1534 3300025915 Ga0207693_10039222 Ga0207693_100392223 279
1535 3300025915 Ga0207693_10155039 Ga0207693_101550392 279
1536 3300025915 Ga0207693_10155930 Ga0207693_101559302 279
1537 3300025915 Ga0207693_10389899 Ga0207693_103898991 279
1538 3300025916 Ga0207663_10120386 Ga0207663_101203862 279
1539 3300025916 Ga0207663_10177409 Ga0207663_101774092 279
1540 3300025917 Ga0207660_10054201 Ga0207660_100542013 279
1541 3300025917 Ga0207660_10068382 Ga0207660_100683822 279
1542 3300025918 Ga0207662_10007651 Ga0207662_100076516 279
1543 3300025919 Ga0207657_10017678 Ga0207657_100176782 279
1544 3300025919 Ga0207657_10029015 Ga0207657_100290153 279
1545 3300025919 Ga0207657_10052437 Ga0207657_100524373 279
1546 3300025920 Ga0207649_10121501 Ga0207649_101215012 279
1547 3300025921 Ga0207652_10014386 Ga0207652_100143863 279
1548 3300025921 Ga0207652_10027682 Ga0207652_100276825 279
1549 3300025921 Ga0207652_10048255 Ga0207652_100482551 279
1550 3300025921 Ga0207652_10050636 Ga0207652_100506364 279
1551 3300025923 Ga0207681_10022271 Ga0207681_100222714 279
1552 3300025923 Ga0207681_10274216 Ga0207681_102742162 279
1553 3300025924 Ga0207694_10082032 Ga0207694_100820322 279
1554 3300025924 Ga0207694_10082447 Ga0207694_100824472 279
1555 3300025924 Ga0207694_10129724 Ga0207694_101297242 279
1556 3300025925 Ga0207650_10007377 Ga0207650_100073775 279
1557 3300025925 Ga0207650_10014950 Ga0207650_100149504 279
1558 3300025925 Ga0207650_10082521 Ga0207650_100825213 279
1559 3300025926 Ga0207659_10021913 Ga0207659_100219134 279
1560 3300025927 Ga0207687_10008300 Ga0207687_100083003 279
1561 3300025928 Ga0207700_10005380 Ga0207700_100053807 279
1562 3300025928 Ga0207700_10038128 Ga0207700_100381284 279
1563 3300025928 Ga0207700_10080459 Ga0207700_100804592 279
1564 3300025928 Ga0207700_10477377 Ga0207700_104773772 279
1565 3300025929 Ga0207664_10014759 Ga0207664_100147594 279
1566 3300025929 Ga0207664_10026436 Ga0207664_100264365 279
1567 3300025929 Ga0207664_10049035 Ga0207664_100490352 279
1568 3300025929 Ga0207664_10474617 Ga0207664_104746171 279
1569 3300025931 Ga0207644_10004262 Ga0207644_100042625 279
1570 3300025931 Ga0207644_10021955 Ga0207644_100219554 279
1571 3300025931 Ga0207644_10093566 Ga0207644_100935662 279
1572 3300025932 Ga0207690_10038216 Ga0207690_100382162 279
1573 3300025933 Ga0207706_10004619 Ga0207706_100046193 279
1574 3300025934 Ga0207686_10022966 Ga0207686_100229664 279
1575 3300025934 Ga0207686_10075727 Ga0207686_100757272 279
1576 3300025936 Ga0207670_10001217 Ga0207670_100012172 279
1577 3300025936 Ga0207670_10006412 Ga0207670_100064126 279
1578 3300025937 Ga0207669_10004872 Ga0207669_100048724 279
1579 3300025937 Ga0207669_10181023 Ga0207669_101810231 279
1580 3300025938 Ga0207704_10004552 Ga0207704_100045525 279
1581 3300025939 Ga0207665_10008609 Ga0207665_100086095 279
1582 3300025940 Ga0207691_10001917 Ga0207691_1000191714 279
1583 3300025940 Ga0207691_10174662 Ga0207691_101746622 279
1584 3300025941 Ga0207711_10019748 Ga0207711_100197484 279
1585 3300025942 Ga0207689_10019992 Ga0207689_100199923 279
1586 3300025942 Ga0207689_10137231 Ga0207689_101372312 279
1587 3300025944 Ga0207661_10007410 Ga0207661_100074105 279
1588 3300025944 Ga0207661_10057286 Ga0207661_100572862 279
1589 3300025945 Ga0207679_10030410 Ga0207679_100304103 279
1590 3300025949 Ga0207667_10024097 Ga0207667_100240972 279
1591 3300025949 Ga0207667_10057316 Ga0207667_100573164 279
1592 3300025960 Ga0207651_10012605 Ga0207651_100126052 279
1593 3300025960 Ga0207651_10024835 Ga0207651_100248353 279
1594 3300025960 Ga0207651_10040262 Ga0207651_100402623 279
1595 3300025961 Ga0207712_10027706 Ga0207712_100277065 279
1596 3300025961 Ga0207712_10319838 Ga0207712_103198382 279
1597 3300025972 Ga0207668_10023269 Ga0207668_100232694 279
1598 3300025972 Ga0207668_10109093 Ga0207668_101090932 279
1599 3300025981 Ga0207640_10176736 Ga0207640_101767362 279
1600 3300025986 Ga0207658_10037986 Ga0207658_100379863 279
1601 3300025986 Ga0207658_10176273 Ga0207658_101762731 279
1602 3300026023 Ga0207677_10043281 Ga0207677_100432812 279
1603 3300026035 Ga0207703_10004180 Ga0207703_100041803 279
1604 3300026035 Ga0207703_10010048 Ga0207703_100100485 279
1605 3300026067 Ga0207678_10004077 Ga0207678_100040776 279
1606 3300026067 Ga0207678_10014823 Ga0207678_100148234 279
1607 3300026075 Ga0207708_10002274 Ga0207708_100022743 279
1608 3300026078 Ga0207702_10012149 Ga0207702_100121495 279
1609 3300026078 Ga0207702_10070783 Ga0207702_100707834 279
1610 3300026088 Ga0207641_10006517 Ga0207641_100065173 279
1611 3300026088 Ga0207641_10084754 Ga0207641_100847542 279
1612 3300026089 Ga0207648_10010742 Ga0207648_100107423 279
1613 3300026089 Ga0207648_10395638 Ga0207648_103956382 279
1614 3300026095 Ga0207676_10003488 Ga0207676_100034883 279
1615 3300026095 Ga0207676_10008505 Ga0207676_100085055 279
1616 3300026095 Ga0207676_10010089 Ga0207676_100100895 279
1617 3300026118 Ga0207675_100005913 Ga0207675_1000059133 279
1618 3300026121 Ga0207683_10001479 Ga0207683_100014794 279
1619 3300026121 Ga0207683_10007199 Ga0207683_100071992 279
1620 3300026142 Ga0207698_10016401 Ga0207698_100164014 279
1621 3300027907 Ga0207428_10051897 Ga0207428_100518972 279
1622 3300028379 Ga0268266_10039407 Ga0268266_100394074 279
1623 3300028379 Ga0268266_10078587 Ga0268266_100785871 279
1624 3300028380 Ga0268265_10051595 Ga0268265_100515952 279
1625 3300028381 Ga0268264_10049361 Ga0268264_100493612 279
1626 3300028800 Ga0265338_10048070 Ga0265338_100480704 279
1627 3300031235 Ga0265330_10041769 Ga0265330_100417692 279
1628 3300031241 Ga0265325_10042020 Ga0265325_100420202 279
1629 3300031241 Ga0265325_10118455 Ga0265325_101184551 279
1630 3300031247 Ga0265340_10024110 Ga0265340_100241102 279
1631 3300031249 Ga0265339_10094334 Ga0265339_100943342 279
1632 3300031250 Ga0265331_10043063 Ga0265331_100430631 279
1633 3300031344 Ga0265316_10322924 Ga0265316_103229241 279
1634 3300031595 Ga0265313_10078415 Ga0265313_100784152 279
1635 3300031711 Ga0265314_10000672 Ga0265314_1000067212 279
1636 3300031711 Ga0265314_10008415 Ga0265314_100084156 279
1637 3300031712 Ga0265342_10000510 Ga0265342_100005104 279
1638 3300031712 Ga0265342_10008960 Ga0265342_100089603 279
1639 3300032126 Ga0307415_100138991 Ga0307415_1001389912 279
1640 3300032133 Ga0316583_10005017 Ga0316583_100050174 279
1641 3300035083 Ga0373926_0003841 Ga0373926_0003841_1260_2177 279
1642 3300035083 Ga0373926_0004802 Ga0373926_0004802_391_1308 279
1643 3300035083 Ga0373926_0058940 Ga0373926_0058940_426_1343 279
1644 3300035084 Ga0373928_0002001 Ga0373928_0002001_2448_3365 279
1645 3300035086 Ga0373934_0068065 Ga0373934_0068065_334_1251 279
1646 3300035089 Ga0373944_0002147 Ga0373944_0002147_1120_2037 279
1647 3300035089 Ga0373944_0015553 Ga0373944_0015553_215_1132 279
1648 3300035089 Ga0373944_0031029 Ga0373944_0031029_504_1421 279
1649 3300035090 Ga0373949_0004828 Ga0373949_0004828_1204_2121 279
1650 3300035091 Ga0373951_0004988 Ga0373951_0004988_210_1127 279
1651 3300035111 Ga0373923_0025274 Ga0373923_0025274_1120_2037 279
1652 3300035111 Ga0373923_0108314 Ga0373923_0108314_258_1175 279
1653 3300035112 Ga0373932_0009187 Ga0373932_0009187_1328_2245 279
1654 3300035113 Ga0373936_0004573 Ga0373936_0004573_1030_1947 279
1655 3300035113 Ga0373936_0009978 Ga0373936_0009978_2653_3570 279
1656 3300035116 Ga0373945_0003133 Ga0373945_0003133_3997_4914 279
1657 3300035116 Ga0373945_0015826 Ga0373945_0015826_1208_2125 279
1658 3300035116 Ga0373945_0025796 Ga0373945_0025796_571_1488 279
1659 3300035118 Ga0373954_0085527 Ga0373954_0085527_574_1491 279
1660 3300035121 Ga0373960_0020881 Ga0373960_0020881_678_1595 279
1661 3300035170 Ga0373943_0003484 Ga0373943_0003484_5503_6420 279
1662 3300035170 Ga0373943_0017879 Ga0373943_0017879_299_1216 279
1663 3300035170 Ga0373943_0045353 Ga0373943_0045353_477_1394 279
1664 3300035170 Ga0373943_0157834 Ga0373943_0157834_258_1175 279
1665 3300035171 Ga0373946_0000300 Ga0373946_0000300_2905_3822 279
1666 3300035171 Ga0373946_0003127 Ga0373946_0003127_1109_2026 279
1667 3300035171 Ga0373946_0043170 Ga0373946_0043170_413_1330 279
1668 3300035171 Ga0373946_0156436 Ga0373946_0156436_57_974 279
1669 3300035172 Ga0373955_0049200 Ga0373955_0049200_543_1460 279
1670 3300035242 Ga0373962_0020825 Ga0373962_0020825_778_1695 279
1671 3300035398 Ga0316574_0079157 Ga0316574_0079157_287_1207 279
1672 3300035410 Ga0373924_0041297 Ga0373924_0041297_763_1680 279
1673 3300035410 Ga0373924_0155297 Ga0373924_0155297_33_950 279
1674 3300035691 Ga0373931_0004970 Ga0373931_0004970_1285_2202 279
1675 3300035691 Ga0373931_0024509 Ga0373931_0024509_1837_2754 279
1676 3300035691 Ga0373931_0085705 Ga0373931_0085705_760_1677 279
1677 3300035692 Ga0373935_0007664 Ga0373935_0007664_416_1333 279
1678 3300035692 Ga0373935_0056929 Ga0373935_0056929_1040_1957 279
1679 3300035692 Ga0373935_0327291 Ga0373935_0327291_36_953 279
1680 3300035695 Ga0373927_0004291 Ga0373927_0004291_1372_2289 279
1681 3300035695 Ga0373927_0026493 Ga0373927_0026493_645_1562 279
1682 3300035695 Ga0373927_0035352 Ga0373927_0035352_1060_1977 279
1683 3300035695 Ga0373927_0077041 Ga0373927_0077041_483_1400 279
1684 3300035695 Ga0373927_0349914 Ga0373927_0349914_46_963 279
1685 3300035725 Ga0373947_0000620 Ga0373947_0000620_15326_16243 279
1686 3300035725 Ga0373947_0052643 Ga0373947_0052643_112_1029 279
1687 3300035725 Ga0373947_0071034 Ga0373947_0071034_938_1855 279
1688 3300036401 Ga0373937_0038433 Ga0373937_0038433_1725_2642 279
1689 3300037068 Ga0373925_0000631 Ga0373925_0000631_4814_5731 279
1690 3300037068 Ga0373925_0017870 Ga0373925_0017870_3920_4837 279
1691 3300037068 Ga0373925_0053414 Ga0373925_0053414_1458_2375 279
1692 3300037068 Ga0373925_0069115 Ga0373925_0069115_526_1443 279
1693 3300037068 Ga0373925_0206020 Ga0373925_0206020_441_1358 279
1694 3300037312 Ga0395899_0073300 Ga0395899_0073300_895_1812 279
1695 3300037312 Ga0395899_0078472 Ga0395899_0078472_457_1374 279
1696 3300037418 Ga0395900_0000833 Ga0395900_0000833_8285_9202 279
1697 3300037418 Ga0395900_0064230 Ga0395900_0064230_2437_3354 279
1698 3300037418 Ga0395900_0125461 Ga0395900_0125461_1399_2316 279
1699 3300037418 Ga0395900_0134840 Ga0395900_0134840_19_936 279
1700 3300037466 Ga0395898_0018138 Ga0395898_0018138_2016_2933 279
1701 3300037466 Ga0395898_0024605 Ga0395898_0024605_4960_5877 279
1702 3300037466 Ga0395898_0069008 Ga0395898_0069008_30_947 279
1703 3300037466 Ga0395898_0378763 Ga0395898_0378763_323_1240 279
1704 3300038443 Ga0395901_0281908 Ga0395901_0281908_281_1198 279
1705 3300038443 Ga0395901_0543685 Ga0395901_0543685_204_1121 279
1706 3300039437 Ga0436365_0304790 Ga0436365_0304790_1816_2733 279
1707 3300039437 Ga0436365_0457267 Ga0436365_0457267_317_1267 279
1708 3300039437 Ga0436365_1335625 Ga0436365_1335625_995_1912 279
1709 3300039447 Ga0436361_0958477 Ga0436361_0958477_659_1576 279
1710 3300044656 Ga0466969_0014167 Ga0466969_0014167_2102_3019 279
1711 3300044684 Ga0466966_0301424 Ga0466966_0301424_27_944 279
1712 3300044694 Ga0466963_0045709 Ga0466963_0045709_982_1899 279
1713 3300044842 Ga0466957_0045562 Ga0466957_0045562_1285_2202 279
1714 3300044842 Ga0466957_0062232 Ga0466957_0062232_344_1261 279
1715 3300045049 Ga0466959_0090170 Ga0466959_0090170_14_931 279
1716 3300045976 Ga0466967_0022056 Ga0466967_0022056_391_1308 279
1717 3300046454 Ga0495592_0007287 Ga0495592_0007287_904_1821 279
1718 3300046454 Ga0495592_0044773 Ga0495592_0044773_1942_2859 279
1719 3300046455 Ga0495603_0078092 Ga0495603_0078092_732_1649 279
1720 3300046459 Ga0495629_0032196 Ga0495629_0032196_1211_2128 279
1721 3300046459 Ga0495629_0036482 Ga0495629_0036482_1534_2451 279
1722 3300046459 Ga0495629_0052248 Ga0495629_0052248_20_937 279
1723 3300046459 Ga0495629_0058236 Ga0495629_0058236_636_1553 279
1724 3300046460 Ga0495638_0005325 Ga0495638_0005325_7164_8081 279
1725 3300046461 Ga0495641_0047786 Ga0495641_0047786_441_1358 279
1726 3300046462 Ga0495651_0053810 Ga0495651_0053810_391_1308 279
1727 3300046463 Ga0495653_0017101 Ga0495653_0017101_440_1357 279
1728 3300046472 Ga0495580_0017620 Ga0495580_0017620_895_1812 279
1729 3300046473 Ga0495582_0018382 Ga0495582_0018382_2175_3092 279
1730 3300046473 Ga0495582_0018471 Ga0495582_0018471_1111_2028 279
1731 3300046475 Ga0495639_0146438 Ga0495639_0146438_195_1112 279
1732 3300046476 Ga0495662_0001450 Ga0495662_0001450_7768_8685 279
1733 3300046476 Ga0495662_0019329 Ga0495662_0019329_1485_2402 279
1734 3300046476 Ga0495662_0027553 Ga0495662_0027553_748_1665 279
1735 3300046477 Ga0495664_0000364 Ga0495664_0000364_10637_11554 279
1736 3300046477 Ga0495664_0000482 Ga0495664_0000482_824_1741 279
1737 3300046492 Ga0495585_0003727 Ga0495585_0003727_4467_5384 279
1738 3300046492 Ga0495585_0019697 Ga0495585_0019697_48_965 279
1739 3300046499 Ga0495594_0053260 Ga0495594_0053260_1019_1936 279
1740 3300046499 Ga0495594_0103390 Ga0495594_0103390_43_960 279
1741 3300046501 Ga0495607_0025799 Ga0495607_0025799_798_1715 279
1742 3300046511 Ga0495608_0137716 Ga0495608_0137716_159_1112 279
1743 3300046511 Ga0495608_0210160 Ga0495608_0210160_247_1164 279
1744 3300046514 Ga0495618_0004765 Ga0495618_0004765_191_1108 279
1745 3300046516 Ga0495628_0054407 Ga0495628_0054407_1381_2298 279
1746 3300046517 Ga0495630_0005321 Ga0495630_0005321_5390_6307 279
1747 3300046517 Ga0495630_0076352 Ga0495630_0076352_860_1777 279
1748 3300046517 Ga0495630_0240784 Ga0495630_0240784_67_984 279
1749 3300046523 Ga0495644_0001708 Ga0495644_0001708_2854_3771 279
1750 3300046525 Ga0495663_0029857 Ga0495663_0029857_192_1109 279
1751 3300046526 Ga0495666_0013021 Ga0495666_0013021_2534_3451 279
1752 3300046526 Ga0495666_0023376 Ga0495666_0023376_1494_2411 279
1753 3300046526 Ga0495666_0126716 Ga0495666_0126716_105_1022 279
1754 3300046529 Ga0495652_0058485 Ga0495652_0058485_1599_2516 279
1755 3300046529 Ga0495652_0078225 Ga0495652_0078225_1437_2354 279
1756 3300046531 Ga0495665_0010221 Ga0495665_0010221_3278_4195 279
1757 3300046531 Ga0495665_0119855 Ga0495665_0119855_143_1060 279
1758 3300046533 Ga0495640_0001062 Ga0495640_0001062_16934_17851 279
1759 3300046533 Ga0495640_0060262 Ga0495640_0060262_633_1550 279
1760 3300046533 Ga0495640_0105528 Ga0495640_0105528_587_1504 279
1761 3300046543 Ga0495645_0145371 Ga0495645_0145371_39_956 279
1762 3300046557 Ga0495622_0153665 Ga0495622_0153665_88_1005 279
1763 3300046558 Ga0495633_0031217 Ga0495633_0031217_427_1344 279
1764 3300046559 Ga0495667_0013521 Ga0495667_0013521_2596_3513 279
1765 3300046559 Ga0495667_0095404 Ga0495667_0095404_451_1368 279
1766 3300046559 Ga0495667_0112092 Ga0495667_0112092_297_1214 279
1767 3300046615 Ga0495656_0024551 Ga0495656_0024551_737_1654 279
1768 3300046642 Ga0495634_0001363 Ga0495634_0001363_17442_18359 279
1769 3300046642 Ga0495634_0026669 Ga0495634_0026669_891_1808 279
1770 3300046642 Ga0495634_0061968 Ga0495634_0061968_726_1643 279
1771 3300046663 Ga0495635_0000813 Ga0495635_0000813_3435_4352 279
1772 3300046663 Ga0495635_0066125 Ga0495635_0066125_483_1400 279
1773 3300046664 Ga0495659_0008292 Ga0495659_0008292_2162_3079 279
1774 3300046665 Ga0495661_0227881 Ga0495661_0227881_35_952 279
1775 3300046674 Ga0495588_0020968 Ga0495588_0020968_2192_3109 279
1776 3300046678 Ga0495599_0088135 Ga0495599_0088135_346_1263 279
1777 3300046680 Ga0495646_0016867 Ga0495646_0016867_2476_3393 279
1778 3300046681 Ga0495647_0001559 Ga0495647_0001559_2796_3713 279
1779 3300046681 Ga0495647_0009117 Ga0495647_0009117_49_966 279
1780 3300046683 Ga0495658_0000185 Ga0495658_0000185_3452_4369 279
1781 3300046684 Ga0495669_0026908 Ga0495669_0026908_440_1357 279
1782 3300046689 Ga0495613_0003704 Ga0495613_0003704_1777_2694 279
1783 3300046689 Ga0495613_0167887 Ga0495613_0167887_95_1012 279
1784 3300046689 Ga0495613_0300975 Ga0495613_0300975_65_982 279
1785 3300046690 Ga0495624_0025722 Ga0495624_0025722_1914_2831 279
1786 3300046691 Ga0495670_0018272 Ga0495670_0018272_954_1871 279
1787 3300046694 Ga0495649_0020109 Ga0495649_0020109_36_953 279
1788 3300046794 Ga0495589_0048226 Ga0495589_0048226_399_1316 279
1789 3300046809 Ga0495600_0000568 Ga0495600_0000568_575_1492 279
1790 3300047315 Ga0495581_0001207 Ga0495581_0001207_2569_3486 279
1791 3300047315 Ga0495581_0058413 Ga0495581_0058413_420_1337 279
1792 3300047315 Ga0495581_0152445 Ga0495581_0152445_423_1340 279
1793 3300047319 Ga0495674_0011063 Ga0495674_0011063_5135_6052 279
1794 3300047319 Ga0495674_0072102 Ga0495674_0072102_1488_2405 279
1795 3300047319 Ga0495674_0129599 Ga0495674_0129599_491_1408 279
1796 3300047321 Ga0495676_0040884 Ga0495676_0040884_78_995 279
1797 3300047321 Ga0495676_0119875 Ga0495676_0119875_353_1270 279
1798 3300047322 Ga0495680_0033363 Ga0495680_0033363_432_1349 279
1799 3300047322 Ga0495680_0085519 Ga0495680_0085519_1439_2356 279
1800 3300047323 Ga0495683_0084726 Ga0495683_0084726_421_1338 279
1801 3300047471 Ga0495684_0000075 Ga0495684_0000075_17350_18267 279
1802 3300047471 Ga0495684_0000926 Ga0495684_0000926_2349_3266 279
1803 3300047471 Ga0495684_0006090 Ga0495684_0006090_1463_2380 279
1804 3300047471 Ga0495684_0012001 Ga0495684_0012001_5462_6379 279
1805 3300047673 Ga0495593_0051507 Ga0495593_0051507_449_1366 279
1806 3300047673 Ga0495593_0093497 Ga0495593_0093497_84_1001 279
1807 3300047673 Ga0495593_0127787 Ga0495593_0127787_41_958 279
1808 3300048088 Ga0495602_0229156 Ga0495602_0229156_31_948 279
1809 3300048903 Ga0496100_0006368 Ga0496100_0006368_2373_3290 279
1810 3300048903 Ga0496100_0079179 Ga0496100_0079179_1248_2165 279
1811 3300048904 Ga0496101_0002221 Ga0496101_0002221_7893_8810 279
1812 3300048904 Ga0496101_0020971 Ga0496101_0020971_3122_4039 279
1813 3300048904 Ga0496101_0204784 Ga0496101_0204784_82_999 279
1814 3300048905 Ga0496102_0029360 Ga0496102_0029360_3602_4519 279
1815 3300048905 Ga0496102_0045105 Ga0496102_0045105_129_1046 279
1816 3300048906 Ga0496103_0008195 Ga0496103_0008195_2924_3841 279
1817 3300048906 Ga0496103_0032222 Ga0496103_0032222_1884_2801 279
1818 3300048906 Ga0496103_0146710 Ga0496103_0146710_57_974 279
1819 3300048906 Ga0496103_0294031 Ga0496103_0294031_17_934 279
1820 3300048907 Ga0496104_0001668 Ga0496104_0001668_6546_7463 279
1821 3300048907 Ga0496104_0033146 Ga0496104_0033146_3803_4720 279
1822 3300048907 Ga0496104_0041734 Ga0496104_0041734_1403_2320 279
1823 3300048907 Ga0496104_0066397 Ga0496104_0066397_2331_3248 279
1824 3300048908 Ga0496105_0003662 Ga0496105_0003662_3156_4073 279
1825 3300048908 Ga0496105_0008016 Ga0496105_0008016_4938_5855 279
1826 3300048908 Ga0496105_0074763 Ga0496105_0074763_180_1097 279
1827 3300048908 Ga0496105_0148215 Ga0496105_0148215_100_1017 279
1828 3300048908 Ga0496105_0197562 Ga0496105_0197562_70_987 279
1829 3300048909 Ga0496106_0001992 Ga0496106_0001992_8634_9551 279
1830 3300048909 Ga0496106_0054703 Ga0496106_0054703_944_1861 279
1831 3300048910 Ga0496107_0002763 Ga0496107_0002763_3934_4851 279
1832 3300048910 Ga0496107_0255305 Ga0496107_0255305_83_1000 279
1833 3300048911 Ga0496108_0005596 Ga0496108_0005596_8076_8993 279
1834 3300048911 Ga0496108_0013672 Ga0496108_0013672_345_1262 279
1835 3300048912 Ga0496109_0003609 Ga0496109_0003609_5600_6517 279
1836 3300048912 Ga0496109_0007566 Ga0496109_0007566_6020_6937 279
1837 3300048912 Ga0496109_0008250 Ga0496109_0008250_7893_8810 279
1838 3300048912 Ga0496109_0022690 Ga0496109_0022690_345_1262 279
1839 3300048913 Ga0496110_0022948 Ga0496110_0022948_4235_5152 279
1840 3300048913 Ga0496110_0023702 Ga0496110_0023702_2209_3126 279
1841 3300048914 Ga0496111_0001147 Ga0496111_0001147_10875_11792 279
1842 3300048914 Ga0496111_0021137 Ga0496111_0021137_3034_3951 279
1843 3300048914 Ga0496111_0101083 Ga0496111_0101083_528_1445 279
1844 3300048915 Ga0496112_0000320 Ga0496112_0000320_12155_13072 279
1845 3300048915 Ga0496112_0014243 Ga0496112_0014243_2759_3676 279
1846 3300048915 Ga0496112_0017770 Ga0496112_0017770_3573_4490 279
1847 3300048916 Ga0496113_0001355 Ga0496113_0001355_7710_8627 279
1848 3300048916 Ga0496113_0162203 Ga0496113_0162203_674_1591 279
1849 3300048917 Ga0496114_0004710 Ga0496114_0004710_3119_4036 279
1850 3300048917 Ga0496114_0102898 Ga0496114_0102898_655_1572 279
1851 3300048918 Ga0496115_0013034 Ga0496115_0013034_3156_4073 279
1852 3300048918 Ga0496115_0059396 Ga0496115_0059396_1858_2775 279
1853 3300048918 Ga0496115_0159313 Ga0496115_0159313_754_1671 279
1854 3300048918 Ga0496115_0312565 Ga0496115_0312565_240_1157 279
1855 3300048922 Ga0496119_0062207 Ga0496119_0062207_1288_2205 279
1856 3300048929 Ga0496126_0352032 Ga0496126_0352032_92_1009 279
1857 3300049568 Ga0501031_0000538 Ga0501031_0000538_5632_6549 279
1858 3300049569 Ga0501032_0000040 Ga0501032_0000040_40291_41208 279
1859 3300049570 Ga0501033_0000326 Ga0501033_0000326_20942_21859 279
1860 3300049571 Ga0501034_0000254 Ga0501034_0000254_62367_63284 279
1861 3300049571 Ga0501034_0009264 Ga0501034_0009264_1667_2596 279
1862 3300049571 Ga0501034_0084677 Ga0501034_0084677_1988_2908 279
1863 3300049572 Ga0501036_0002216 Ga0501036_0002216_1056_1973 279
1864 3300049573 Ga0501037_0000041 Ga0501037_0000041_40191_41108 279
1865 3300049574 Ga0501038_0000057 Ga0501038_0000057_70815_71732 279
1866 3300049575 Ga0501039_0000084 Ga0501039_0000084_14324_15241 279
1867 3300049575 Ga0501039_0423659 Ga0501039_0423659_72_989 279
1868 3300049577 Ga0501041_0154257 Ga0501041_0154257_103_1020 279
1869 3300049579 Ga0501043_0006263 Ga0501043_0006263_279_1196 279
1870 3300049579 Ga0501043_0090780 Ga0501043_0090780_780_1697 279
1871 3300049579 Ga0501043_0098914 Ga0501043_0098914_253_1182 279
1872 3300049580 Ga0501046_0000072 Ga0501046_0000072_65176_66093 279
1873 3300049581 Ga0501047_0000044 Ga0501047_0000044_40273_41190 279
1874 3300049581 Ga0501047_0114465 Ga0501047_0114465_158_1078 279
1875 3300049582 Ga0501048_0008592 Ga0501048_0008592_5621_6538 279
1876 3300049583 Ga0501067_0000139 Ga0501067_0000139_4163_5080 279
1877 3300049583 Ga0501067_0093076 Ga0501067_0093076_67_984 279
1878 3300049585 Ga0501069_0004244 Ga0501069_0004244_2193_3110 279
1879 3300049585 Ga0501069_0020506 Ga0501069_0020506_1077_1994 279
1880 3300049586 Ga0501070_0028461 Ga0501070_0028461_253_1170 279
1881 3300049586 Ga0501070_0039368 Ga0501070_0039368_2749_3666 279
1882 3300049586 Ga0501070_0099921 Ga0501070_0099921_1004_1921 279
1883 3300049586 Ga0501070_0167072 Ga0501070_0167072_651_1589 279
1884 3300049587 Ga0501071_0322869 Ga0501071_0322869_43_960 279
1885 3300049588 Ga0501072_0000297 Ga0501072_0000297_7739_8656 279
1886 3300049588 Ga0501072_0082893 Ga0501072_0082893_428_1345 279
1887 3300049588 Ga0501072_0451750 Ga0501072_0451750_56_973 279
1888 3300049589 Ga0501073_0000043 Ga0501073_0000043_52297_53214 279
1889 3300049589 Ga0501073_0009892 Ga0501073_0009892_19_936 279
1890 3300049589 Ga0501073_0012757 Ga0501073_0012757_1312_2229 279
1891 3300049589 Ga0501073_0047522 Ga0501073_0047522_716_1633 279
1892 3300049589 Ga0501073_0069800 Ga0501073_0069800_960_1880 279
1893 3300049590 Ga0501074_0000111 Ga0501074_0000111_23530_24447 279
1894 3300049590 Ga0501074_0027180 Ga0501074_0027180_2957_3874 279
1895 3300049590 Ga0501074_0085833 Ga0501074_0085833_53_970 279
1896 3300049591 Ga0501075_0035666 Ga0501075_0035666_847_1821 279
1897 3300049591 Ga0501075_0186854 Ga0501075_0186854_527_1444 279
1898 3300049591 Ga0501075_0192175 Ga0501075_0192175_35_961 279
1899 3300049592 Ga0501076_0106424 Ga0501076_0106424_1196_2119 279
1900 3300049592 Ga0501076_0247850 Ga0501076_0247850_156_1073 279
1901 3300049741 Ga0501079_0001226 Ga0501079_0001226_7183_8100 279
1902 3300049742 Ga0501080_0003893 Ga0501080_0003893_9284_10201 279
1903 3300049742 Ga0501080_0373358 Ga0501080_0373358_32_949 279
1904 3300049744 Ga0501083_0000723 Ga0501083_0000723_15318_16235 279
1905 3300049744 Ga0501083_0045127 Ga0501083_0045127_904_1824 279
1906 3300049822 Ga0501035_0000128 Ga0501035_0000128_4275_5192 279
1907 3300049823 Ga0501044_0000907 Ga0501044_0000907_8984_9901 279
1908 3300049823 Ga0501044_0118830 Ga0501044_0118830_72_992 279
1909 3300049823 Ga0501044_0140079 Ga0501044_0140079_789_1706 279
1910 3300049824 Ga0501045_0046844 Ga0501045_0046844_1091_2008 279
1911 3300050490 nmdc:mga03n38_56302_c1 nmdc:mga03n38_56302_c1_102_1019 279
1912 3300050492 nmdc:mga0yw44_41036_c1 nmdc:mga0yw44_41036_c1_1511_2449 279
1913 3300050492 nmdc:mga0yw44_49483_c1 nmdc:mga0yw44_49483_c1_820_1737 279
1914 3300050492 nmdc:mga0yw44_8268_c1 nmdc:mga0yw44_8268_c1_3870_4787 279
1915 3300050496 nmdc:mga07m45_58146_c1 nmdc:mga07m45_58146_c1_348_1265 279
1916 3300050507 nmdc:mga05p37_29092_c1 nmdc:mga05p37_29092_c1_2925_3875 279
1917 3300050507 nmdc:mga05p37_38977_c1 nmdc:mga05p37_38977_c1_2866_3783 279
1918 3300050507 nmdc:mga05p37_8357_c1 nmdc:mga05p37_8357_c1_8919_9836 279
1919 3300050508 nmdc:mga09592_23614_c1 nmdc:mga09592_23614_c1_2877_3827 279
1920 3300050508 nmdc:mga09592_5865_c1 nmdc:mga09592_5865_c1_6669_7592 279
1921 3300050509 nmdc:mga0qj67_16351_c1 nmdc:mga0qj67_16351_c1_2239_3189 279
1922 3300050509 nmdc:mga0qj67_88489_c1 nmdc:mga0qj67_88489_c1_534_1457 279
1923 3300050510 nmdc:mga06r32_19261_c1 nmdc:mga06r32_19261_c1_2876_3826 279
1924 3300050510 nmdc:mga06r32_3354_c1 nmdc:mga06r32_3354_c1_4982_5899 279
1925 3300050510 nmdc:mga06r32_8602_c1 nmdc:mga06r32_8602_c1_6036_6959 279
1926 3300050511 nmdc:mga08y16_100943_c1 nmdc:mga08y16_100943_c1_921_1838 279
1927 3300050511 nmdc:mga08y16_230311_c1 nmdc:mga08y16_230311_c1_645_1562 279
1928 3300050511 nmdc:mga08y16_496379_c1 nmdc:mga08y16_496379_c1_271_1188 279
1929 3300050511 nmdc:mga08y16_59066_c1 nmdc:mga08y16_59066_c1_1541_2491 279
1930 3300050512 nmdc:mga0n895_110086_c1 nmdc:mga0n895_110086_c1_1443_2360 279
1931 3300050512 nmdc:mga0n895_14993_c1 nmdc:mga0n895_14993_c1_4211_5161 279
1932 3300050512 nmdc:mga0n895_467153_c1 nmdc:mga0n895_467153_c1_225_1142 279
1933 3300050512 nmdc:mga0n895_74754_c1 nmdc:mga0n895_74754_c1_1578_2495 279
1934 3300050512 nmdc:mga0n895_82232_c1 nmdc:mga0n895_82232_c1_524_1441 279
1935 3300050513 nmdc:mga0rr50_120223_c1 nmdc:mga0rr50_120223_c1_154_1071 279
1936 3300050513 nmdc:mga0rr50_13944_c1 nmdc:mga0rr50_13944_c1_2060_3010 279
1937 3300050513 nmdc:mga0rr50_16755_c1 nmdc:mga0rr50_16755_c1_340_1257 279
1938 3300050513 nmdc:mga0rr50_21786_c1 nmdc:mga0rr50_21786_c1_1451_2368 279
1939 3300050513 nmdc:mga0rr50_274315_c1 nmdc:mga0rr50_274315_c1_458_1375 279
1940 3300050513 nmdc:mga0rr50_36300_c1 nmdc:mga0rr50_36300_c1_285_1202 279
1941 3300050515 nmdc:mga0a205_164095_c1 nmdc:mga0a205_164095_c1_516_1433 279
1942 3300050515 nmdc:mga0a205_2194_c1 nmdc:mga0a205_2194_c1_3535_4485 279
1943 3300050515 nmdc:mga0a205_69021_c1 nmdc:mga0a205_69021_c1_1242_2159 279
1944 3300053077 Ga0495601_0005347 Ga0495601_0005347_2939_3856 279
1945 3300053078 Ga0495612_0037454 Ga0495612_0037454_862_1779 279
1946 3300053078 Ga0495612_0105907 Ga0495612_0105907_189_1106 279
1947 3300053078 Ga0495612_0149687 Ga0495612_0149687_32_949 279
1948 3300053083 Ga0495655_0003922 Ga0495655_0003922_1068_1985 279
1949 3300053085 Ga0495619_0000381 Ga0495619_0000381_26012_26929 279
1950 3300053085 Ga0495619_0002847 Ga0495619_0002847_9868_10785 279
1951 3300053085 Ga0495619_0004023 Ga0495619_0004023_860_1777 279
1952 3300053085 Ga0495619_0013464 Ga0495619_0013464_2415_3332 279
1953 3300053087 Ga0500643_000091 Ga0500643_000091_51106_52023 279
1954 3300053103 Ga0500555_004861 Ga0500555_004861_787_1704 279
1955 3300053104 Ga0500556_0102104 Ga0500556_0102104_139_1056 279
1956 3300053130 Ga0500642_0008382 Ga0500642_0008382_2414_3331 279
1957 3300053153 Ga0500616_0023908 Ga0500616_0023908_944_1861 279
1958 3300053156 Ga0500622_0009281 Ga0500622_0009281_3808_4725 279
1959 3300053736 Ga0500599_001712 Ga0500599_001712_562_1479 279
1960 3300054114 Ga0501084_0001848 Ga0501084_0001848_10182_11099 279
1961 3300054114 Ga0501084_0064578 Ga0501084_0064578_112_1086 279
1962 3300054114 Ga0501084_0147653 Ga0501084_0147653_281_1198 279
1963 3300054114 Ga0501084_0265964 Ga0501084_0265964_242_1159 279
1964 3300060353 Ga0501082_0016434 Ga0501082_0016434_2468_3388 279
1965 3300060353 Ga0501082_0062097 Ga0501082_0062097_1313_2230 279
1966 3300061719 Ga0466962_0030281 Ga0466962_0030281_128_1045 279
1967 3300061734 Ga0530510_0312346 Ga0530510_0312346_215_1138 279
1968 3300061734 Ga0530510_0409063 Ga0530510_0409063_13_930 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

7

274

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xjj-assembly1.cif.gz_A crystal structure of a mate family protein 0.2547 4 269
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.2523 2 267
8e6m-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wt in an inward-open, cadmium-bound state 0.2469 3 266
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.2469 3 266
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.2449 2 267
ID Description Score Start End Superfamily
af_Q2FZP5_4_80_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7876 226 259 3.10.110.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6733 8 261 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6467 9 267 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6151 8 261 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6026 9 267 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A536XZK0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9616 79 275 GO:0005886
GO:0006865
GO:0022857
AF-A0A536XZK0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9431 79 275 GO:0005886
GO:0006865
GO:0022857
AF-A0A519GRD0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9425 70 278 GO:0005886
GO:0006865
GO:0022857
AF-A0A519GRD0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9339 70 278 GO:0005886
GO:0006865
GO:0022857
AF-A0A1Q6WKH8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8742 1 275 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
79.37 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map