F496239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2004 | 592 | 4006 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10359236|Ga0105249_103592361 |
| Length | 335 |
| Sequence | MTLCPTVTLRRSKSLRQYGAVMLESRHKKKGGARRGRASRLCWMVQIRSVGVIGAGQMGTGIAHVVALGGYDVLLHDVSQERIDSGLELIRHNMTRQVHRGIIDQDAMDAALGHIKGASELQSIGATDLAIEAATENEETKKTIFKALGPHLGDKTLLASNTSSISITRLAAATDRPDRFIGLHFMNPAPLMKLVEIIRGIATGPDTYETAVKFAQSLGKTTANAEDFPAFIVNRVLVPMINEAIYTLYEGVGTVEAIDTAMKLGANHPMGPLELGDFIGLDTVLSIMNVLYEGLADSKYRPCPLLTKYVEAGWLGRKAGRGFYDYRGEHPVPTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 243 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 244 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 259 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 263 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 264 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 265 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 268 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 269 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 270 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 271 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 272 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 273 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 274 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 275 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 276 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 277 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 281 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 282 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 283 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 300 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 301 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 304 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 305 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 307 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 308 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 309 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 310 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 311 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 312 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 313 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 314 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 317 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 318 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 319 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 320 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 321 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 322 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 323 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 324 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 325 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 326 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 327 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 328 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 329 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 330 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 331 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 332 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 333 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 334 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 483 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 486 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 487 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 489 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 490 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 493 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 494 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 495 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 497 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 498 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 499 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 501 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 505 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 506 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 508 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 511 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 512 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 513 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 514 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 518 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 519 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 520 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 521 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 522 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 523 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 524 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 525 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 526 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 527 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 528 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 529 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 530 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 531 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 532 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 533 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 534 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 535 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 536 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 537 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 538 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 539 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 540 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 541 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 542 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 543 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 544 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 545 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 546 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 547 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 548 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 549 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 550 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 551 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 552 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 553 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 554 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 555 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 556 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 557 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 558 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 559 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 560 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 561 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 562 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 563 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 564 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 565 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 566 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 567 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 568 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 569 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 570 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 571 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 572 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 573 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 574 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 575 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 576 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 577 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 578 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 579 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 580 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 581 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 582 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 583 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 584 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 585 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 586 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 587 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 588 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 589 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 590 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 591 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 592 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.76 |
| Metatranscriptomes | 0.45 |
| Isolates | 3.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.74 |
| Nodule | 0.3 |
| Rhizoplane | 4.04 |
| Rhizosphere | 82.53 |
| Stem | 0 |
| Stem Tuber | 0.05 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105249_10359236 | 3300009553 | Bacteria | 1478 |
| 2 | JGI24750J21931_1001757 | 3300002070 | Bacteria | 2647 |
| 3 | JGI24751J29686_10002743 | 3300002459 | Bacteria | 3542 |
| 4 | JGI25153J46596_10000269 | 3300003215 | Bacteria | 41135 |
| 5 | JGI25153J46596_10009271 | 3300003215 | Bacteria | 4599 |
| 6 | rootH2_10154904 | 3300003320 | Bacteria | 2161 |
| 7 | Ga0006562J51391_1051836 | 3300003578 | Bacteria | 2840 |
| 8 | Ga0055537_1005976 | 3300003773 | Bacteria | 3162 |
| 9 | Ga0055528_1003083 | 3300003790 | Bacteria | 8559 |
| 10 | Ga0055530_10000337 | 3300003791 | Bacteria | 42372 |
| 11 | Ga0055531_10000505 | 3300003794 | Bacteria | 35554 |
| 12 | Ga0055531_10001046 | 3300003794 | Bacteria | 21865 |
| 13 | Ga0055531_10029211 | 3300003794 | Bacteria | 1882 |
| 14 | Ga0058861_11804934 | 3300004800 | Bacteria | 1174 |
| 15 | Ga0058862_12801645 | 3300004803 | Bacteria | 1136 |
| 16 | Ga0065165_1000171 | 3300005262 | Bacteria | 114917 |
| 17 | Ga0065165_1001427 | 3300005262 | Bacteria | 25946 |
| 18 | Ga0065165_1009793 | 3300005262 | Bacteria | 4238 |
| 19 | Ga0070658_10003145 | 3300005327 | Bacteria | 13618 |
| 20 | Ga0070658_10009756 | 3300005327 | Bacteria | 7711 |
| 21 | Ga0070658_10034673 | 3300005327 | Bacteria | 4061 |
| 22 | Ga0070658_10062470 | 3300005327 | Bacteria | 3036 |
| 23 | Ga0070676_10002225 | 3300005328 | Bacteria | 9896 |
| 24 | Ga0070676_10054739 | 3300005328 | Bacteria | 2353 |
| 25 | Ga0070690_100000232 | 3300005330 | Bacteria | 28655 |
| 26 | Ga0070690_100015621 | 3300005330 | Bacteria | 4534 |
| 27 | Ga0070690_100051588 | 3300005330 | Bacteria | 2627 |
| 28 | Ga0070690_100122975 | 3300005330 | Bacteria | 1744 |
| 29 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 30 | Ga0070670_100000734 | 3300005331 | Bacteria | 25467 |
| 31 | Ga0070670_100025548 | 3300005331 | Bacteria | 5081 |
| 32 | Ga0068869_100034099 | 3300005334 | Bacteria | 3598 |
| 33 | Ga0068869_100100619 | 3300005334 | Bacteria | 2186 |
| 34 | Ga0070666_10000492 | 3300005335 | Bacteria | 23842 |
| 35 | Ga0070666_10007495 | 3300005335 | Bacteria | 6726 |
| 36 | Ga0070666_10008767 | 3300005335 | Bacteria | 6287 |
| 37 | Ga0070666_10017934 | 3300005335 | Bacteria | 4543 |
| 38 | Ga0070666_10096676 | 3300005335 | Bacteria | 2033 |
| 39 | Ga0070666_10142819 | 3300005335 | Bacteria | 1668 |
| 40 | Ga0070680_100001128 | 3300005336 | Bacteria | 19178 |
| 41 | Ga0070680_100005807 | 3300005336 | Bacteria | 9366 |
| 42 | Ga0070680_100021694 | 3300005336 | Bacteria | 5107 |
| 43 | Ga0070680_100025975 | 3300005336 | Bacteria | 4684 |
| 44 | Ga0070680_100027952 | 3300005336 | Bacteria | 4521 |
| 45 | Ga0070680_100029781 | 3300005336 | Bacteria | 4382 |
| 46 | Ga0070680_100048827 | 3300005336 | Bacteria | 3449 |
| 47 | Ga0070680_100087886 | 3300005336 | Bacteria | 2570 |
| 48 | Ga0070682_100003540 | 3300005337 | Bacteria | 8643 |
| 49 | Ga0070682_100003799 | 3300005337 | Bacteria | 8392 |
| 50 | Ga0070682_100133320 | 3300005337 | Bacteria | 1684 |
| 51 | Ga0068868_100001553 | 3300005338 | Bacteria | 15679 |
| 52 | Ga0068868_100037465 | 3300005338 | Bacteria | 3759 |
| 53 | Ga0068868_100103220 | 3300005338 | Bacteria | 2309 |
| 54 | Ga0070660_100001176 | 3300005339 | Bacteria | 17702 |
| 55 | Ga0070660_100012151 | 3300005339 | Bacteria | 6148 |
| 56 | Ga0070660_100023133 | 3300005339 | Bacteria | 4602 |
| 57 | Ga0070660_100032791 | 3300005339 | Bacteria | 3911 |
| 58 | Ga0070660_100045240 | 3300005339 | Bacteria | 3369 |
| 59 | Ga0070689_100000219 | 3300005340 | Bacteria | 34066 |
| 60 | Ga0070689_100037387 | 3300005340 | Bacteria | 3712 |
| 61 | Ga0070691_10004358 | 3300005341 | Bacteria | 6431 |
| 62 | Ga0070691_10020286 | 3300005341 | Bacteria | 3070 |
| 63 | Ga0070691_10033353 | 3300005341 | Bacteria | 2423 |
| 64 | Ga0070691_10067542 | 3300005341 | Bacteria | 1730 |
| 65 | Ga0070691_10093063 | 3300005341 | Bacteria | 1488 |
| 66 | Ga0070691_10100110 | 3300005341 | Bacteria | 1438 |
| 67 | Ga0070687_100000891 | 3300005343 | Bacteria | 10059 |
| 68 | Ga0070661_100002101 | 3300005344 | Bacteria | 13712 |
| 69 | Ga0070661_100034920 | 3300005344 | Bacteria | 3649 |
| 70 | Ga0070661_100068524 | 3300005344 | Bacteria | 2608 |
| 71 | Ga0070661_100307803 | 3300005344 | Bacteria | 1235 |
| 72 | Ga0070692_10000095 | 3300005345 | Bacteria | 19381 |
| 73 | Ga0070668_100000810 | 3300005347 | Bacteria | 21535 |
| 74 | Ga0070668_100002588 | 3300005347 | Bacteria | 13295 |
| 75 | Ga0070668_100002594 | 3300005347 | Bacteria | 13275 |
| 76 | Ga0070668_100017223 | 3300005347 | Bacteria | 5409 |
| 77 | Ga0070668_100039267 | 3300005347 | Bacteria | 3620 |
| 78 | Ga0070668_100040268 | 3300005347 | Bacteria | 3575 |
| 79 | Ga0070668_100381397 | 3300005347 | Bacteria | 1200 |
| 80 | Ga0070669_100000854 | 3300005353 | Bacteria | 22116 |
| 81 | Ga0070669_100003901 | 3300005353 | Bacteria | 10789 |
| 82 | Ga0070669_100006542 | 3300005353 | Bacteria | 8387 |
| 83 | Ga0070669_100060216 | 3300005353 | Bacteria | 2789 |
| 84 | Ga0070675_100037643 | 3300005354 | Bacteria | 3942 |
| 85 | Ga0070675_100228917 | 3300005354 | Bacteria | 1621 |
| 86 | Ga0070671_100007574 | 3300005355 | Bacteria | 8681 |
| 87 | Ga0070671_100008771 | 3300005355 | Bacteria | 8111 |
| 88 | Ga0070671_100122297 | 3300005355 | Bacteria | 2190 |
| 89 | Ga0070671_100272149 | 3300005355 | Bacteria | 1440 |
| 90 | Ga0070671_100557481 | 3300005355 | Bacteria | 988 |
| 91 | Ga0070674_100001983 | 3300005356 | Bacteria | 11202 |
| 92 | Ga0070674_100004537 | 3300005356 | Bacteria | 7931 |
| 93 | Ga0070674_100038016 | 3300005356 | Bacteria | 3240 |
| 94 | Ga0070673_100002867 | 3300005364 | Bacteria | 10612 |
| 95 | Ga0070673_100075833 | 3300005364 | Bacteria | 2713 |
| 96 | Ga0070673_100528258 | 3300005364 | Bacteria | 1070 |
| 97 | Ga0070688_100000552 | 3300005365 | Bacteria | 18917 |
| 98 | Ga0070688_100148926 | 3300005365 | Bacteria | 1598 |
| 99 | Ga0070659_100001675 | 3300005366 | Bacteria | 15927 |
| 100 | Ga0070659_100027251 | 3300005366 | Bacteria | 4401 |
| 101 | Ga0070659_100034835 | 3300005366 | Bacteria | 3918 |
| 102 | Ga0070659_100057134 | 3300005366 | Bacteria | 3076 |
| 103 | Ga0070659_100464665 | 3300005366 | Bacteria | 1075 |
| 104 | Ga0070667_100001267 | 3300005367 | Bacteria | 22911 |
| 105 | Ga0070667_100010421 | 3300005367 | Bacteria | 7674 |
| 106 | Ga0070667_100012674 | 3300005367 | Bacteria | 6972 |
| 107 | Ga0070667_100012745 | 3300005367 | Bacteria | 6951 |
| 108 | Ga0070667_100054065 | 3300005367 | Bacteria | 3390 |
| 109 | Ga0070667_100087631 | 3300005367 | Bacteria | 2672 |
| 110 | Ga0070667_100177344 | 3300005367 | Bacteria | 1883 |
| 111 | Ga0070667_100204043 | 3300005367 | Bacteria | 1755 |
| 112 | Ga0070703_10002510 | 3300005406 | Bacteria | 5279 |
| 113 | Ga0070709_10003641 | 3300005434 | Bacteria | 8273 |
| 114 | Ga0070709_10017337 | 3300005434 | Bacteria | 4129 |
| 115 | Ga0070709_10084634 | 3300005434 | Bacteria | 2077 |
| 116 | Ga0070714_100042364 | 3300005435 | Bacteria | 3846 |
| 117 | Ga0070714_100044290 | 3300005435 | Bacteria | 3767 |
| 118 | Ga0070714_100050098 | 3300005435 | Bacteria | 3556 |
| 119 | Ga0070714_100160830 | 3300005435 | Bacteria | 2031 |
| 120 | Ga0070713_100116518 | 3300005436 | Bacteria | 2336 |
| 121 | Ga0070713_100222337 | 3300005436 | Bacteria | 1713 |
| 122 | Ga0070713_100249782 | 3300005436 | Bacteria | 1618 |
| 123 | Ga0070713_100250895 | 3300005436 | Bacteria | 1614 |
| 124 | Ga0070713_100401356 | 3300005436 | Bacteria | 1280 |
| 125 | Ga0070713_100432234 | 3300005436 | Bacteria | 1234 |
| 126 | Ga0070710_10053669 | 3300005437 | Bacteria | 2271 |
| 127 | Ga0070710_10117397 | 3300005437 | Bacteria | 1606 |
| 128 | Ga0070701_10000263 | 3300005438 | Bacteria | 17088 |
| 129 | Ga0070711_100000201 | 3300005439 | Bacteria | 31559 |
| 130 | Ga0070705_100000751 | 3300005440 | Bacteria | 18407 |
| 131 | Ga0070705_100001721 | 3300005440 | Bacteria | 11385 |
| 132 | Ga0070705_100014535 | 3300005440 | Bacteria | 4053 |
| 133 | Ga0070700_100005030 | 3300005441 | Bacteria | 6972 |
| 134 | Ga0070700_100016215 | 3300005441 | Bacteria | 4242 |
| 135 | Ga0070700_100214686 | 3300005441 | Bacteria | 1359 |
| 136 | Ga0070700_100289699 | 3300005441 | Bacteria | 1191 |
| 137 | Ga0070694_100014968 | 3300005444 | Bacteria | 4860 |
| 138 | Ga0070694_100062723 | 3300005444 | Bacteria | 2540 |
| 139 | Ga0070694_100093835 | 3300005444 | Bacteria | 2110 |
| 140 | Ga0070708_100051101 | 3300005445 | Bacteria | 3662 |
| 141 | Ga0070663_100001331 | 3300005455 | Bacteria | 13505 |
| 142 | Ga0070663_100009128 | 3300005455 | Bacteria | 6130 |
| 143 | Ga0070663_100139086 | 3300005455 | Bacteria | 1852 |
| 144 | Ga0070663_100212961 | 3300005455 | Bacteria | 1514 |
| 145 | Ga0070678_100000963 | 3300005456 | Bacteria | 14841 |
| 146 | Ga0070678_100051658 | 3300005456 | Bacteria | 2981 |
| 147 | Ga0070678_100239128 | 3300005456 | Bacteria | 1517 |
| 148 | Ga0070678_100287767 | 3300005456 | Bacteria | 1392 |
| 149 | Ga0070662_100092341 | 3300005457 | Bacteria | 2275 |
| 150 | Ga0070662_100149364 | 3300005457 | Bacteria | 1817 |
| 151 | Ga0070681_10000057 | 3300005458 | Bacteria | 79475 |
| 152 | Ga0070681_10002960 | 3300005458 | Bacteria | 15767 |
| 153 | Ga0070681_10005511 | 3300005458 | Bacteria | 12228 |
| 154 | Ga0070681_10037851 | 3300005458 | Bacteria | 4838 |
| 155 | Ga0070681_10040784 | 3300005458 | Bacteria | 4650 |
| 156 | Ga0070681_10048272 | 3300005458 | Bacteria | 4255 |
| 157 | Ga0070681_10050025 | 3300005458 | Bacteria | 4171 |
| 158 | Ga0070681_10080219 | 3300005458 | Bacteria | 3219 |
| 159 | Ga0070681_10281442 | 3300005458 | Bacteria | 1574 |
| 160 | Ga0070681_10299394 | 3300005458 | Bacteria | 1518 |
| 161 | Ga0070681_10563842 | 3300005458 | Bacteria | 1053 |
| 162 | Ga0068867_100021656 | 3300005459 | Bacteria | 4588 |
| 163 | Ga0068867_100029714 | 3300005459 | Bacteria | 3939 |
| 164 | Ga0068867_100135279 | 3300005459 | Bacteria | 1920 |
| 165 | Ga0070685_10007261 | 3300005466 | Bacteria | 5665 |
| 166 | Ga0070685_10227484 | 3300005466 | Bacteria | 1225 |
| 167 | Ga0070707_100015874 | 3300005468 | Bacteria | 7068 |
| 168 | Ga0070698_100007183 | 3300005471 | Bacteria | 12067 |
| 169 | Ga0070698_100009690 | 3300005471 | Bacteria | 10300 |
| 170 | Ga0070698_100154498 | 3300005471 | Bacteria | 2241 |
| 171 | Ga0070698_100156902 | 3300005471 | Bacteria | 2221 |
| 172 | Ga0070699_100005628 | 3300005518 | Bacteria | 10986 |
| 173 | Ga0070699_100157206 | 3300005518 | Bacteria | 2012 |
| 174 | Ga0070699_100158442 | 3300005518 | Bacteria | 2003 |
| 175 | Ga0070699_100217575 | 3300005518 | Bacteria | 1702 |
| 176 | Ga0070699_100295559 | 3300005518 | Bacteria | 1453 |
| 177 | Ga0070699_100389231 | 3300005518 | Bacteria | 1259 |
| 178 | Ga0070679_100000043 | 3300005530 | Bacteria | 95125 |
| 179 | Ga0070679_100005852 | 3300005530 | Bacteria | 11410 |
| 180 | Ga0070679_100027144 | 3300005530 | Bacteria | 5631 |
| 181 | Ga0070679_100028853 | 3300005530 | Bacteria | 5473 |
| 182 | Ga0070679_100044488 | 3300005530 | Bacteria | 4423 |
| 183 | Ga0070679_100061454 | 3300005530 | Bacteria | 3744 |
| 184 | Ga0070679_100077998 | 3300005530 | Bacteria | 3302 |
| 185 | Ga0070679_100222634 | 3300005530 | Bacteria | 1848 |
| 186 | Ga0070679_100287381 | 3300005530 | Bacteria | 1596 |
| 187 | Ga0070679_100453202 | 3300005530 | Bacteria | 1227 |
| 188 | Ga0070697_100040258 | 3300005536 | Bacteria | 3780 |
| 189 | Ga0070697_100069957 | 3300005536 | Bacteria | 2876 |
| 190 | Ga0070697_100200373 | 3300005536 | Bacteria | 1697 |
| 191 | Ga0070697_100391711 | 3300005536 | Bacteria | 1205 |
| 192 | Ga0070697_100626005 | 3300005536 | Bacteria | 947 |
| 193 | Ga0068853_100002414 | 3300005539 | Bacteria | 13955 |
| 194 | Ga0068853_100002623 | 3300005539 | Bacteria | 13528 |
| 195 | Ga0068853_100003695 | 3300005539 | Bacteria | 11745 |
| 196 | Ga0068853_100015377 | 3300005539 | Bacteria | 6287 |
| 197 | Ga0068853_100030383 | 3300005539 | Bacteria | 4563 |
| 198 | Ga0068853_100085814 | 3300005539 | Bacteria | 2760 |
| 199 | Ga0068853_100097370 | 3300005539 | Bacteria | 2597 |
| 200 | Ga0068853_100264669 | 3300005539 | Bacteria | 1582 |
| 201 | Ga0070672_100003597 | 3300005543 | Bacteria | 10042 |
| 202 | Ga0070672_100465139 | 3300005543 | Bacteria | 1091 |
| 203 | Ga0070686_100000306 | 3300005544 | Bacteria | 32359 |
| 204 | Ga0070695_100000339 | 3300005545 | Bacteria | 24039 |
| 205 | Ga0070695_100006239 | 3300005545 | Bacteria | 7042 |
| 206 | Ga0070695_100063474 | 3300005545 | Bacteria | 2401 |
| 207 | Ga0070695_100080306 | 3300005545 | Bacteria | 2155 |
| 208 | Ga0070696_100001139 | 3300005546 | Bacteria | 17242 |
| 209 | Ga0070696_100005852 | 3300005546 | Bacteria | 8206 |
| 210 | Ga0070693_100002939 | 3300005547 | Bacteria | 7876 |
| 211 | Ga0070693_100115713 | 3300005547 | Bacteria | 1656 |
| 212 | Ga0070665_100000622 | 3300005548 | Bacteria | 48397 |
| 213 | Ga0070665_100001034 | 3300005548 | Bacteria | 34849 |
| 214 | Ga0070665_100001485 | 3300005548 | Bacteria | 27386 |
| 215 | Ga0070665_100002299 | 3300005548 | Bacteria | 21229 |
| 216 | Ga0070665_100003432 | 3300005548 | Bacteria | 16921 |
| 217 | Ga0070665_100016813 | 3300005548 | Bacteria | 7334 |
| 218 | Ga0070665_100046308 | 3300005548 | Bacteria | 4369 |
| 219 | Ga0070665_100084446 | 3300005548 | Bacteria | 3181 |
| 220 | Ga0070665_100096343 | 3300005548 | Bacteria | 2964 |
| 221 | Ga0070665_100111686 | 3300005548 | Bacteria | 2736 |
| 222 | Ga0070665_100114044 | 3300005548 | Bacteria | 2705 |
| 223 | Ga0070704_100148977 | 3300005549 | Bacteria | 1837 |
| 224 | Ga0068855_100007530 | 3300005563 | Bacteria | 13177 |
| 225 | Ga0068855_100032390 | 3300005563 | Bacteria | 6242 |
| 226 | Ga0068855_100059685 | 3300005563 | Bacteria | 4462 |
| 227 | Ga0068855_100073014 | 3300005563 | Bacteria | 3987 |
| 228 | Ga0068855_100099535 | 3300005563 | Bacteria | 3348 |
| 229 | Ga0068855_100105516 | 3300005563 | Bacteria | 3239 |
| 230 | Ga0068855_100117930 | 3300005563 | Bacteria | 3040 |
| 231 | Ga0068855_100173895 | 3300005563 | Bacteria | 2438 |
| 232 | Ga0068855_100187622 | 3300005563 | Bacteria | 2334 |
| 233 | Ga0068855_100209738 | 3300005563 | Bacteria | 2189 |
| 234 | Ga0068855_100219640 | 3300005563 | Bacteria | 2132 |
| 235 | Ga0068855_100245096 | 3300005563 | Bacteria | 2000 |
| 236 | Ga0068855_100327487 | 3300005563 | Bacteria | 1692 |
| 237 | Ga0068855_100524430 | 3300005563 | Bacteria | 1285 |
| 238 | Ga0070664_100003361 | 3300005564 | Bacteria | 12934 |
| 239 | Ga0070664_100008403 | 3300005564 | Bacteria | 8347 |
| 240 | Ga0070664_100043907 | 3300005564 | Bacteria | 3773 |
| 241 | Ga0070664_100127552 | 3300005564 | Bacteria | 2233 |
| 242 | Ga0070664_100285916 | 3300005564 | Bacteria | 1488 |
| 243 | Ga0068857_100000318 | 3300005577 | Bacteria | 33240 |
| 244 | Ga0068857_100011253 | 3300005577 | Bacteria | 7779 |
| 245 | Ga0068857_100039479 | 3300005577 | Bacteria | 4181 |
| 246 | Ga0068857_100152727 | 3300005577 | Bacteria | 2093 |
| 247 | Ga0068857_100161737 | 3300005577 | Bacteria | 2032 |
| 248 | Ga0068856_100006661 | 3300005614 | Bacteria | 11321 |
| 249 | Ga0068856_100008386 | 3300005614 | Bacteria | 10071 |
| 250 | Ga0068856_100196188 | 3300005614 | Bacteria | 2033 |
| 251 | Ga0068856_100301959 | 3300005614 | Bacteria | 1619 |
| 252 | Ga0068856_100353209 | 3300005614 | Bacteria | 1489 |
| 253 | Ga0068856_100522915 | 3300005614 | Bacteria | 1208 |
| 254 | Ga0070702_100000103 | 3300005615 | Bacteria | 25515 |
| 255 | Ga0070702_100057836 | 3300005615 | Bacteria | 2244 |
| 256 | Ga0070702_100135243 | 3300005615 | Bacteria | 1563 |
| 257 | Ga0070702_100298918 | 3300005615 | Bacteria | 1113 |
| 258 | Ga0068852_100003609 | 3300005616 | Bacteria | 10833 |
| 259 | Ga0068852_100115642 | 3300005616 | Bacteria | 2446 |
| 260 | Ga0068852_100145653 | 3300005616 | Bacteria | 2197 |
| 261 | Ga0068852_100165739 | 3300005616 | Bacteria | 2067 |
| 262 | Ga0068852_100183035 | 3300005616 | Bacteria | 1971 |
| 263 | Ga0068852_100356401 | 3300005616 | Bacteria | 1430 |
| 264 | Ga0068859_100000168 | 3300005617 | Bacteria | 63325 |
| 265 | Ga0068859_100004644 | 3300005617 | Bacteria | 13994 |
| 266 | Ga0068859_100008510 | 3300005617 | Bacteria | 10381 |
| 267 | Ga0068859_100012300 | 3300005617 | Bacteria | 8610 |
| 268 | Ga0068859_100450106 | 3300005617 | Bacteria | 1384 |
| 269 | Ga0068864_100000093 | 3300005618 | Bacteria | 93540 |
| 270 | Ga0068864_100000095 | 3300005618 | Bacteria | 91554 |
| 271 | Ga0068864_100004875 | 3300005618 | Bacteria | 10984 |
| 272 | Ga0068864_100041566 | 3300005618 | Bacteria | 3932 |
| 273 | Ga0068864_100054856 | 3300005618 | Bacteria | 3440 |
| 274 | Ga0068864_100060013 | 3300005618 | Bacteria | 3293 |
| 275 | Ga0068864_100214215 | 3300005618 | Bacteria | 1775 |
| 276 | Ga0068864_100264675 | 3300005618 | Bacteria | 1600 |
| 277 | Ga0068866_10011490 | 3300005718 | Bacteria | 3832 |
| 278 | Ga0068861_100119060 | 3300005719 | Bacteria | 2128 |
| 279 | Ga0068851_10053516 | 3300005834 | Bacteria | 2055 |
| 280 | Ga0068851_10198081 | 3300005834 | Bacteria | 1120 |
| 281 | Ga0068870_10112291 | 3300005840 | Bacteria | 1558 |
| 282 | Ga0068863_100000045 | 3300005841 | Bacteria | 147269 |
| 283 | Ga0068863_100007895 | 3300005841 | Bacteria | 10405 |
| 284 | Ga0068863_100014537 | 3300005841 | Bacteria | 7578 |
| 285 | Ga0068863_100027933 | 3300005841 | Bacteria | 5385 |
| 286 | Ga0068863_100078015 | 3300005841 | Bacteria | 3136 |
| 287 | Ga0068863_100408496 | 3300005841 | Bacteria | 1329 |
| 288 | Ga0068858_100003461 | 3300005842 | Bacteria | 15658 |
| 289 | Ga0068858_100003717 | 3300005842 | Bacteria | 15112 |
| 290 | Ga0068858_100013269 | 3300005842 | Bacteria | 7766 |
| 291 | Ga0068858_100016285 | 3300005842 | Bacteria | 6984 |
| 292 | Ga0068858_100027724 | 3300005842 | Bacteria | 5263 |
| 293 | Ga0068858_100058281 | 3300005842 | Bacteria | 3570 |
| 294 | Ga0068858_100079638 | 3300005842 | Bacteria | 3044 |
| 295 | Ga0068858_100083717 | 3300005842 | Bacteria | 2966 |
| 296 | Ga0068860_100000204 | 3300005843 | Bacteria | 93995 |
| 297 | Ga0068860_100005966 | 3300005843 | Bacteria | 12257 |
| 298 | Ga0068860_100010922 | 3300005843 | Bacteria | 8952 |
| 299 | Ga0068860_100033041 | 3300005843 | Bacteria | 4967 |
| 300 | Ga0068860_100037867 | 3300005843 | Bacteria | 4616 |
| 301 | Ga0068860_100050305 | 3300005843 | Bacteria | 3968 |
| 302 | Ga0068860_100118701 | 3300005843 | Bacteria | 2532 |
| 303 | Ga0068860_100190721 | 3300005843 | Bacteria | 1984 |
| 304 | Ga0068860_100256811 | 3300005843 | Bacteria | 1703 |
| 305 | Ga0068862_100001725 | 3300005844 | Bacteria | 19766 |
| 306 | Ga0068862_100003158 | 3300005844 | Bacteria | 14322 |
| 307 | Ga0068862_100005698 | 3300005844 | Bacteria | 10394 |
| 308 | Ga0068862_100006125 | 3300005844 | Bacteria | 10010 |
| 309 | Ga0068862_100010475 | 3300005844 | Bacteria | 7655 |
| 310 | Ga0068862_100016150 | 3300005844 | Bacteria | 6210 |
| 311 | Ga0068862_100111357 | 3300005844 | Bacteria | 2403 |
| 312 | Ga0068862_100116776 | 3300005844 | Bacteria | 2348 |
| 313 | Ga0068862_100209099 | 3300005844 | Bacteria | 1763 |
| 314 | Ga0081455_10000079 | 3300005937 | Bacteria | 104277 |
| 315 | Ga0081455_10005314 | 3300005937 | Bacteria | 14141 |
| 316 | Ga0081455_10006837 | 3300005937 | Bacteria | 12151 |
| 317 | Ga0081455_10023011 | 3300005937 | Bacteria | 5809 |
| 318 | Ga0081455_10061401 | 3300005937 | Bacteria | 3163 |
| 319 | Ga0081455_10069059 | 3300005937 | Bacteria | 2940 |
| 320 | Ga0081538_10009083 | 3300005981 | Bacteria | 8339 |
| 321 | Ga0081538_10017391 | 3300005981 | Bacteria | 5460 |
| 322 | Ga0081538_10048270 | 3300005981 | Bacteria | 2599 |
| 323 | Ga0081540_1000050 | 3300005983 | Bacteria | 126528 |
| 324 | Ga0081540_1035798 | 3300005983 | Bacteria | 2657 |
| 325 | Ga0081540_1041443 | 3300005983 | Bacteria | 2387 |
| 326 | Ga0081540_1059139 | 3300005983 | Bacteria | 1842 |
| 327 | Ga0081539_10021261 | 3300005985 | Bacteria | 4343 |
| 328 | Ga0081539_10032848 | 3300005985 | Bacteria | 3171 |
| 329 | Ga0081539_10071716 | 3300005985 | Bacteria | 1854 |
| 330 | Ga0070717_10002293 | 3300006028 | Bacteria | 13425 |
| 331 | Ga0070717_10048307 | 3300006028 | Bacteria | 3490 |
| 332 | Ga0070717_10136784 | 3300006028 | Bacteria | 2111 |
| 333 | Ga0075365_10022326 | 3300006038 | Bacteria | 3964 |
| 334 | Ga0075365_10028129 | 3300006038 | Bacteria | 3583 |
| 335 | Ga0075365_10357531 | 3300006038 | Bacteria | 1029 |
| 336 | Ga0075368_10000312 | 3300006042 | Bacteria | 14157 |
| 337 | Ga0075368_10073549 | 3300006042 | Bacteria | 1383 |
| 338 | Ga0075364_10001636 | 3300006051 | Bacteria | 12288 |
| 339 | Ga0075432_10004896 | 3300006058 | Bacteria | 4560 |
| 340 | Ga0070715_10002897 | 3300006163 | Bacteria | 5354 |
| 341 | Ga0070715_10074248 | 3300006163 | Bacteria | 1527 |
| 342 | Ga0070716_100001803 | 3300006173 | Bacteria | 9707 |
| 343 | Ga0070716_100094614 | 3300006173 | Bacteria | 1817 |
| 344 | Ga0070712_100000383 | 3300006175 | Bacteria | 25258 |
| 345 | Ga0070712_100006161 | 3300006175 | Bacteria | 7421 |
| 346 | Ga0070712_100010231 | 3300006175 | Bacteria | 5914 |
| 347 | Ga0070712_100020920 | 3300006175 | Bacteria | 4288 |
| 348 | Ga0070712_100031069 | 3300006175 | Bacteria | 3595 |
| 349 | Ga0070712_100142181 | 3300006175 | Bacteria | 1833 |
| 350 | Ga0070712_100230091 | 3300006175 | Bacteria | 1472 |
| 351 | Ga0070712_100299634 | 3300006175 | Bacteria | 1301 |
| 352 | Ga0075367_10004476 | 3300006178 | Bacteria | 6830 |
| 353 | Ga0075367_10149247 | 3300006178 | Bacteria | 1450 |
| 354 | Ga0075369_10052667 | 3300006186 | Bacteria | 1765 |
| 355 | Ga0075366_10004615 | 3300006195 | Bacteria | 7401 |
| 356 | Ga0075366_10017262 | 3300006195 | Bacteria | 4152 |
| 357 | Ga0075366_10102301 | 3300006195 | Bacteria | 1720 |
| 358 | Ga0075366_10146814 | 3300006195 | Bacteria | 1427 |
| 359 | Ga0097621_100001072 | 3300006237 | Bacteria | 19118 |
| 360 | Ga0097621_100028215 | 3300006237 | Bacteria | 4423 |
| 361 | Ga0097621_100097324 | 3300006237 | Bacteria | 2471 |
| 362 | Ga0097621_100231902 | 3300006237 | Bacteria | 1612 |
| 363 | Ga0075370_10022473 | 3300006353 | Bacteria | 3463 |
| 364 | Ga0075370_10176237 | 3300006353 | Bacteria | 1257 |
| 365 | Ga0075370_10182164 | 3300006353 | Bacteria | 1236 |
| 366 | Ga0068871_100001473 | 3300006358 | Bacteria | 15779 |
| 367 | Ga0068871_100043773 | 3300006358 | Bacteria | 3598 |
| 368 | Ga0068871_100088418 | 3300006358 | Bacteria | 2578 |
| 369 | Ga0068871_100175630 | 3300006358 | Bacteria | 1839 |
| 370 | Ga0068871_100255378 | 3300006358 | Bacteria | 1528 |
| 371 | Ga0068871_100282832 | 3300006358 | Bacteria | 1451 |
| 372 | Ga0068871_100364323 | 3300006358 | Bacteria | 1281 |
| 373 | Ga0068871_100373318 | 3300006358 | Bacteria | 1265 |
| 374 | Ga0075428_100051198 | 3300006844 | Bacteria | 4528 |
| 375 | Ga0075428_100059608 | 3300006844 | Bacteria | 4179 |
| 376 | Ga0075428_100064681 | 3300006844 | Bacteria | 4006 |
| 377 | Ga0075428_100303396 | 3300006844 | Bacteria | 1717 |
| 378 | Ga0075430_100025541 | 3300006846 | Bacteria | 5026 |
| 379 | Ga0075430_100265128 | 3300006846 | Bacteria | 1422 |
| 380 | Ga0075430_100318100 | 3300006846 | Bacteria | 1287 |
| 381 | Ga0075431_100000648 | 3300006847 | Bacteria | 29516 |
| 382 | Ga0075431_100001586 | 3300006847 | Bacteria | 21155 |
| 383 | Ga0075431_100007581 | 3300006847 | Bacteria | 10805 |
| 384 | Ga0075431_100189193 | 3300006847 | Bacteria | 2110 |
| 385 | Ga0075431_100195411 | 3300006847 | Bacteria | 2071 |
| 386 | Ga0075433_10003756 | 3300006852 | Bacteria | 11752 |
| 387 | Ga0075433_10458236 | 3300006852 | Bacteria | 1124 |
| 388 | Ga0075434_100001044 | 3300006871 | Bacteria | 22598 |
| 389 | Ga0075434_100100013 | 3300006871 | Bacteria | 2905 |
| 390 | Ga0075434_100144691 | 3300006871 | Bacteria | 2397 |
| 391 | Ga0075429_100020344 | 3300006880 | Bacteria | 5757 |
| 392 | Ga0075429_100045703 | 3300006880 | Bacteria | 3810 |
| 393 | Ga0068865_100000177 | 3300006881 | Bacteria | 35260 |
| 394 | Ga0068865_100004452 | 3300006881 | Bacteria | 8451 |
| 395 | Ga0068865_100006191 | 3300006881 | Bacteria | 7293 |
| 396 | Ga0068865_100029061 | 3300006881 | Bacteria | 3664 |
| 397 | Ga0068865_100107070 | 3300006881 | Bacteria | 2056 |
| 398 | Ga0068865_100116560 | 3300006881 | Bacteria | 1979 |
| 399 | Ga0068865_100131928 | 3300006881 | Bacteria | 1873 |
| 400 | Ga0075436_100004207 | 3300006914 | Bacteria | 9876 |
| 401 | Ga0075436_100076590 | 3300006914 | Bacteria | 2316 |
| 402 | Ga0075436_100261535 | 3300006914 | Bacteria | 1234 |
| 403 | Ga0097620_100000168 | 3300006931 | Bacteria | 63325 |
| 404 | Ga0097620_100004644 | 3300006931 | Bacteria | 13994 |
| 405 | Ga0097620_100008510 | 3300006931 | Bacteria | 10381 |
| 406 | Ga0097620_100012300 | 3300006931 | Bacteria | 8610 |
| 407 | Ga0097620_100450150 | 3300006931 | Bacteria | 1384 |
| 408 | Ga0075435_100022950 | 3300007076 | Bacteria | 4817 |
| 409 | Ga0075435_100115908 | 3300007076 | Bacteria | 2231 |
| 410 | Ga0075435_100193038 | 3300007076 | Bacteria | 1724 |
| 411 | Ga0099795_10006747 | 3300007788 | Bacteria | 3152 |
| 412 | Ga0099795_10019485 | 3300007788 | Bacteria | 2197 |
| 413 | Ga0105250_10031425 | 3300009092 | Bacteria | 2132 |
| 414 | Ga0105240_10000528 | 3300009093 | Bacteria | 70421 |
| 415 | Ga0105240_10000593 | 3300009093 | Bacteria | 67263 |
| 416 | Ga0105240_10006394 | 3300009093 | Bacteria | 17331 |
| 417 | Ga0105240_10008432 | 3300009093 | Bacteria | 14744 |
| 418 | Ga0105240_10016124 | 3300009093 | Bacteria | 10125 |
| 419 | Ga0105240_10025200 | 3300009093 | Bacteria | 7822 |
| 420 | Ga0105240_10030187 | 3300009093 | Bacteria | 7049 |
| 421 | Ga0105240_10041737 | 3300009093 | Bacteria | 5851 |
| 422 | Ga0105240_10161384 | 3300009093 | Bacteria | 2662 |
| 423 | Ga0105240_10169459 | 3300009093 | Bacteria | 2587 |
| 424 | Ga0105240_10171001 | 3300009093 | Bacteria | 2574 |
| 425 | Ga0105240_10203267 | 3300009093 | Bacteria | 2320 |
| 426 | Ga0105240_10221614 | 3300009093 | Bacteria | 2203 |
| 427 | Ga0105240_10442648 | 3300009093 | Bacteria | 1456 |
| 428 | Ga0105240_10572948 | 3300009093 | Bacteria | 1246 |
| 429 | Ga0105240_10658809 | 3300009093 | Bacteria | 1147 |
| 430 | Ga0111539_10007102 | 3300009094 | Bacteria | 14352 |
| 431 | Ga0111539_10011351 | 3300009094 | Bacteria | 11187 |
| 432 | Ga0111539_10095254 | 3300009094 | Bacteria | 3497 |
| 433 | Ga0111539_10317384 | 3300009094 | Bacteria | 1813 |
| 434 | Ga0105245_10000591 | 3300009098 | Bacteria | 32882 |
| 435 | Ga0105245_10067399 | 3300009098 | Bacteria | 3242 |
| 436 | Ga0105245_10095809 | 3300009098 | Bacteria | 2738 |
| 437 | Ga0105245_10200417 | 3300009098 | Bacteria | 1916 |
| 438 | Ga0105245_10253142 | 3300009098 | Bacteria | 1712 |
| 439 | Ga0105245_10273536 | 3300009098 | Bacteria | 1648 |
| 440 | Ga0105247_10000361 | 3300009101 | Bacteria | 38770 |
| 441 | Ga0105247_10060893 | 3300009101 | Bacteria | 2340 |
| 442 | Ga0105247_10108926 | 3300009101 | Bacteria | 1780 |
| 443 | Ga0114129_10065174 | 3300009147 | Bacteria | 5085 |
| 444 | Ga0114129_10325523 | 3300009147 | Bacteria | 2042 |
| 445 | Ga0105243_10003277 | 3300009148 | Bacteria | 13153 |
| 446 | Ga0105243_10102489 | 3300009148 | Bacteria | 2378 |
| 447 | Ga0105243_10643635 | 3300009148 | Bacteria | 1026 |
| 448 | Ga0105241_10000699 | 3300009174 | Bacteria | 25341 |
| 449 | Ga0105241_10006171 | 3300009174 | Bacteria | 8841 |
| 450 | Ga0105241_10007803 | 3300009174 | Bacteria | 7868 |
| 451 | Ga0105241_10087402 | 3300009174 | Bacteria | 2454 |
| 452 | Ga0105241_10260395 | 3300009174 | Bacteria | 1474 |
| 453 | Ga0105241_10264120 | 3300009174 | Bacteria | 1464 |
| 454 | Ga0105241_10596766 | 3300009174 | Bacteria | 997 |
| 455 | Ga0105242_10008014 | 3300009176 | Bacteria | 8137 |
| 456 | Ga0105242_10071387 | 3300009176 | Bacteria | 2881 |
| 457 | Ga0105242_10091262 | 3300009176 | Bacteria | 2564 |
| 458 | Ga0105242_10134833 | 3300009176 | Bacteria | 2136 |
| 459 | Ga0105242_10586647 | 3300009176 | Bacteria | 1074 |
| 460 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 461 | Ga0105248_10000097 | 3300009177 | Bacteria | 97424 |
| 462 | Ga0105248_10000586 | 3300009177 | Bacteria | 41465 |
| 463 | Ga0105248_10014989 | 3300009177 | Bacteria | 8533 |
| 464 | Ga0105248_10018673 | 3300009177 | Bacteria | 7665 |
| 465 | Ga0105248_10039694 | 3300009177 | Bacteria | 5276 |
| 466 | Ga0105248_10127670 | 3300009177 | Bacteria | 2869 |
| 467 | Ga0105248_10220265 | 3300009177 | Bacteria | 2137 |
| 468 | Ga0105248_10242825 | 3300009177 | Bacteria | 2027 |
| 469 | Ga0105237_10005447 | 3300009545 | Bacteria | 14353 |
| 470 | Ga0105237_10028604 | 3300009545 | Bacteria | 5675 |
| 471 | Ga0105237_10136315 | 3300009545 | Bacteria | 2449 |
| 472 | Ga0105237_10509890 | 3300009545 | Bacteria | 1209 |
| 473 | Ga0105237_10599801 | 3300009545 | Bacteria | 1108 |
| 474 | Ga0105237_10729863 | 3300009545 | Bacteria | 997 |
| 475 | Ga0105238_10000280 | 3300009551 | Bacteria | 56545 |
| 476 | Ga0105238_10012925 | 3300009551 | Bacteria | 8424 |
| 477 | Ga0105238_10036658 | 3300009551 | Bacteria | 4986 |
| 478 | Ga0105238_10109372 | 3300009551 | Bacteria | 2745 |
| 479 | Ga0105238_10144770 | 3300009551 | Bacteria | 2353 |
| 480 | Ga0105238_10316597 | 3300009551 | Bacteria | 1546 |
| 481 | Ga0105238_10324754 | 3300009551 | Bacteria | 1525 |
| 482 | Ga0105249_10000757 | 3300009553 | Bacteria | 29073 |
| 483 | Ga0105249_10000842 | 3300009553 | Bacteria | 27469 |
| 484 | Ga0105249_10014651 | 3300009553 | Bacteria | 6930 |
| 485 | Ga0105249_10033566 | 3300009553 | Bacteria | 4647 |
| 486 | Ga0105249_10120026 | 3300009553 | Bacteria | 2497 |
| 487 | Ga0105249_10243034 | 3300009553 | Bacteria | 1781 |
| 488 | Ga0105249_10746619 | 3300009553 | Bacteria | 1041 |
| 489 | Ga0105239_10001117 | 3300010375 | Bacteria | 37006 |
| 490 | Ga0105239_10010033 | 3300010375 | Bacteria | 10618 |
| 491 | Ga0105239_10012366 | 3300010375 | Bacteria | 9505 |
| 492 | Ga0105239_10287673 | 3300010375 | Bacteria | 1851 |
| 493 | Ga0105239_10343260 | 3300010375 | Bacteria | 1685 |
| 494 | Ga0105239_10364068 | 3300010375 | Bacteria | 1633 |
| 495 | Ga0105239_10391941 | 3300010375 | Bacteria | 1571 |
| 496 | Ga0105239_10640776 | 3300010375 | Bacteria | 1213 |
| 497 | Ga0105246_10005577 | 3300011119 | Bacteria | 7675 |
| 498 | Ga0105246_10097725 | 3300011119 | Bacteria | 2131 |
| 499 | Ga0105246_10146435 | 3300011119 | Bacteria | 1783 |
| 500 | Ga0105246_10255375 | 3300011119 | Bacteria | 1393 |
| 501 | Ga0157373_10020122 | 3300013100 | Bacteria | 4855 |
| 502 | Ga0157373_10021937 | 3300013100 | Bacteria | 4633 |
| 503 | Ga0157373_10030236 | 3300013100 | Bacteria | 3897 |
| 504 | Ga0157373_10161967 | 3300013100 | Bacteria | 1574 |
| 505 | Ga0157371_10009119 | 3300013102 | Bacteria | 7838 |
| 506 | Ga0157371_10024313 | 3300013102 | Bacteria | 4425 |
| 507 | Ga0157371_10097896 | 3300013102 | Bacteria | 2080 |
| 508 | Ga0157370_10024495 | 3300013104 | Bacteria | 5978 |
| 509 | Ga0157370_10060452 | 3300013104 | Bacteria | 3597 |
| 510 | Ga0157370_10101646 | 3300013104 | Bacteria | 2693 |
| 511 | Ga0157370_10123487 | 3300013104 | Bacteria | 2418 |
| 512 | Ga0157370_10126413 | 3300013104 | Bacteria | 2386 |
| 513 | Ga0157370_10216987 | 3300013104 | Bacteria | 1773 |
| 514 | Ga0157370_10633939 | 3300013104 | Bacteria | 977 |
| 515 | Ga0157369_10003360 | 3300013105 | Bacteria | 18997 |
| 516 | Ga0157369_10006431 | 3300013105 | Bacteria | 13619 |
| 517 | Ga0157369_10019553 | 3300013105 | Bacteria | 7578 |
| 518 | Ga0157369_10052011 | 3300013105 | Bacteria | 4432 |
| 519 | Ga0157369_10226294 | 3300013105 | Bacteria | 1956 |
| 520 | Ga0157369_10428098 | 3300013105 | Bacteria | 1372 |
| 521 | Ga0157374_10000592 | 3300013296 | Bacteria | 32031 |
| 522 | Ga0157374_10086021 | 3300013296 | Bacteria | 2990 |
| 523 | Ga0157374_10105614 | 3300013296 | Bacteria | 2705 |
| 524 | Ga0157374_10113836 | 3300013296 | Bacteria | 2604 |
| 525 | Ga0157374_10156142 | 3300013296 | Bacteria | 2221 |
| 526 | Ga0157374_10208164 | 3300013296 | Bacteria | 1917 |
| 527 | Ga0157378_10000401 | 3300013297 | Bacteria | 42628 |
| 528 | Ga0157378_10000452 | 3300013297 | Bacteria | 39237 |
| 529 | Ga0157378_10033741 | 3300013297 | Bacteria | 4526 |
| 530 | Ga0157378_10038103 | 3300013297 | Bacteria | 4260 |
| 531 | Ga0157378_10120994 | 3300013297 | Bacteria | 2413 |
| 532 | Ga0157378_10161106 | 3300013297 | Bacteria | 2098 |
| 533 | Ga0157378_10199414 | 3300013297 | Bacteria | 1892 |
| 534 | Ga0157378_10208375 | 3300013297 | Bacteria | 1853 |
| 535 | Ga0157378_10233485 | 3300013297 | Bacteria | 1754 |
| 536 | Ga0163162_10005348 | 3300013306 | Bacteria | 12394 |
| 537 | Ga0163162_10008105 | 3300013306 | Bacteria | 10252 |
| 538 | Ga0163162_10082532 | 3300013306 | Bacteria | 3286 |
| 539 | Ga0163162_10170630 | 3300013306 | Bacteria | 2300 |
| 540 | Ga0163162_10306368 | 3300013306 | Bacteria | 1721 |
| 541 | Ga0157372_10000528 | 3300013307 | Bacteria | 42366 |
| 542 | Ga0157372_10000529 | 3300013307 | Bacteria | 42341 |
| 543 | Ga0157372_10012635 | 3300013307 | Bacteria | 8995 |
| 544 | Ga0157372_10033013 | 3300013307 | Bacteria | 5682 |
| 545 | Ga0157372_10219556 | 3300013307 | Bacteria | 2204 |
| 546 | Ga0157372_10586118 | 3300013307 | Bacteria | 1300 |
| 547 | Ga0157372_10596319 | 3300013307 | Bacteria | 1288 |
| 548 | Ga0157375_10000739 | 3300013308 | Bacteria | 28688 |
| 549 | Ga0157375_10002597 | 3300013308 | Bacteria | 15678 |
| 550 | Ga0157375_10267049 | 3300013308 | Bacteria | 1873 |
| 551 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 552 | Ga0163163_10016192 | 3300014325 | Bacteria | 6922 |
| 553 | Ga0163163_10038829 | 3300014325 | Bacteria | 4642 |
| 554 | Ga0163163_10122028 | 3300014325 | Bacteria | 2640 |
| 555 | Ga0163163_10143263 | 3300014325 | Bacteria | 2432 |
| 556 | Ga0163163_10385476 | 3300014325 | Bacteria | 1459 |
| 557 | Ga0163163_10605586 | 3300014325 | Bacteria | 1159 |
| 558 | Ga0157380_10015122 | 3300014326 | Bacteria | 5663 |
| 559 | Ga0157380_10025451 | 3300014326 | Bacteria | 4487 |
| 560 | Ga0157380_10028596 | 3300014326 | Bacteria | 4252 |
| 561 | Ga0157380_10290042 | 3300014326 | Bacteria | 1502 |
| 562 | Ga0157377_10003058 | 3300014745 | Bacteria | 7503 |
| 563 | Ga0157377_10118821 | 3300014745 | Bacteria | 1599 |
| 564 | Ga0157379_10000889 | 3300014968 | Bacteria | 24172 |
| 565 | Ga0157379_10003386 | 3300014968 | Bacteria | 13488 |
| 566 | Ga0157379_10003905 | 3300014968 | Bacteria | 12707 |
| 567 | Ga0157379_10017982 | 3300014968 | Bacteria | 6230 |
| 568 | Ga0157379_10038754 | 3300014968 | Bacteria | 4251 |
| 569 | Ga0157379_10046028 | 3300014968 | Bacteria | 3895 |
| 570 | Ga0157379_10080593 | 3300014968 | Bacteria | 2916 |
| 571 | Ga0157379_10092652 | 3300014968 | Bacteria | 2711 |
| 572 | Ga0157379_10101613 | 3300014968 | Bacteria | 2580 |
| 573 | Ga0157379_10116547 | 3300014968 | Bacteria | 2402 |
| 574 | Ga0157379_10138128 | 3300014968 | Bacteria | 2197 |
| 575 | Ga0157379_10187561 | 3300014968 | Bacteria | 1869 |
| 576 | Ga0157379_10267865 | 3300014968 | Bacteria | 1553 |
| 577 | Ga0157379_10496408 | 3300014968 | Bacteria | 1131 |
| 578 | Ga0157376_10000548 | 3300014969 | Bacteria | 24147 |
| 579 | Ga0157376_10065610 | 3300014969 | Bacteria | 3066 |
| 580 | Ga0157376_10099615 | 3300014969 | Bacteria | 2536 |
| 581 | Ga0157376_10184750 | 3300014969 | Bacteria | 1908 |
| 582 | Ga0157376_10386640 | 3300014969 | Bacteria | 1349 |
| 583 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 584 | Ga0163161_10000549 | 3300017792 | Bacteria | 30479 |
| 585 | Ga0163161_10004033 | 3300017792 | Bacteria | 10275 |
| 586 | Ga0163161_10182406 | 3300017792 | Bacteria | 1610 |
| 587 | Ga0206356_11633707 | 3300020070 | Bacteria | 1231 |
| 588 | Ga0206352_10567578 | 3300020078 | Bacteria | 2176 |
| 589 | Ga0213873_10024643 | 3300021358 | Bacteria | 1446 |
| 590 | Ga0213872_10053344 | 3300021361 | Bacteria | 1834 |
| 591 | Ga0213872_10108917 | 3300021361 | Bacteria | 1231 |
| 592 | Ga0213874_10003223 | 3300021377 | Bacteria | 3599 |
| 593 | Ga0213874_10007462 | 3300021377 | Bacteria | 2626 |
| 594 | Ga0213874_10036580 | 3300021377 | Bacteria | 1448 |
| 595 | Ga0213876_10000257 | 3300021384 | Bacteria | 49797 |
| 596 | Ga0213876_10000423 | 3300021384 | Bacteria | 35276 |
| 597 | Ga0213876_10008949 | 3300021384 | Bacteria | 5400 |
| 598 | Ga0213876_10013999 | 3300021384 | Bacteria | 4252 |
| 599 | Ga0213876_10039306 | 3300021384 | Bacteria | 2499 |
| 600 | Ga0213876_10132363 | 3300021384 | Bacteria | 1326 |
| 601 | Ga0213875_10000175 | 3300021388 | Bacteria | 67639 |
| 602 | Ga0213875_10000580 | 3300021388 | Bacteria | 29736 |
| 603 | Ga0213875_10001523 | 3300021388 | Bacteria | 14897 |
| 604 | Ga0213875_10013115 | 3300021388 | Bacteria | 4076 |
| 605 | Ga0213875_10041498 | 3300021388 | Bacteria | 2165 |
| 606 | Ga0213871_10010846 | 3300021441 | Bacteria | 2077 |
| 607 | Ga0209026_1009205 | 3300025250 | Bacteria | 1965 |
| 608 | Ga0209026_1013307 | 3300025250 | Bacteria | 1405 |
| 609 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 610 | Ga0209233_1034431 | 3300025261 | Bacteria | 1153 |
| 611 | Ga0209565_1000065 | 3300025263 | Bacteria | 178266 |
| 612 | Ga0209673_1001051 | 3300025273 | Bacteria | 31913 |
| 613 | Ga0209675_1001154 | 3300025291 | Bacteria | 16072 |
| 614 | Ga0209676_1000043 | 3300025292 | Bacteria | 418680 |
| 615 | Ga0209676_1000928 | 3300025292 | Bacteria | 36206 |
| 616 | Ga0209676_1004405 | 3300025292 | Bacteria | 7861 |
| 617 | Ga0209564_1022616 | 3300025295 | Bacteria | 2214 |
| 618 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 619 | Ga0209758_1001776 | 3300025297 | Bacteria | 23900 |
| 620 | Ga0209758_1002436 | 3300025297 | Bacteria | 18990 |
| 621 | Ga0209758_1003522 | 3300025297 | Bacteria | 14112 |
| 622 | Ga0209050_1000095 | 3300025298 | Bacteria | 242722 |
| 623 | Ga0209050_1000729 | 3300025298 | Bacteria | 47913 |
| 624 | Ga0209050_1001088 | 3300025298 | Bacteria | 33087 |
| 625 | Ga0209256_1001303 | 3300025299 | Bacteria | 26860 |
| 626 | Ga0209256_1016688 | 3300025299 | Bacteria | 2485 |
| 627 | Ga0209051_1001677 | 3300025303 | Bacteria | 17853 |
| 628 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 629 | Ga0209257_1000106 | 3300025304 | Bacteria | 242634 |
| 630 | Ga0209257_1000184 | 3300025304 | Bacteria | 156438 |
| 631 | Ga0209257_1000641 | 3300025304 | Bacteria | 55911 |
| 632 | Ga0209257_1000979 | 3300025304 | Bacteria | 38834 |
| 633 | Ga0207656_10015952 | 3300025321 | Bacteria | 2916 |
| 634 | Ga0207696_1020376 | 3300025711 | Bacteria | 2141 |
| 635 | Ga0207692_10007515 | 3300025898 | Bacteria | 4470 |
| 636 | Ga0207692_10027461 | 3300025898 | Bacteria | 2682 |
| 637 | Ga0207642_10190451 | 3300025899 | Bacteria | 1125 |
| 638 | Ga0207710_10011535 | 3300025900 | Bacteria | 3719 |
| 639 | Ga0207710_10020485 | 3300025900 | Bacteria | 2828 |
| 640 | Ga0207710_10151745 | 3300025900 | Bacteria | 1124 |
| 641 | Ga0207680_10000548 | 3300025903 | Bacteria | 17845 |
| 642 | Ga0207680_10079277 | 3300025903 | Bacteria | 2059 |
| 643 | Ga0207647_10030560 | 3300025904 | Bacteria | 3472 |
| 644 | Ga0207685_10004123 | 3300025905 | Bacteria | 3646 |
| 645 | Ga0207699_10046469 | 3300025906 | Bacteria | 2540 |
| 646 | Ga0207699_10058059 | 3300025906 | Bacteria | 2313 |
| 647 | Ga0207699_10061156 | 3300025906 | Bacteria | 2265 |
| 648 | Ga0207699_10093545 | 3300025906 | Bacteria | 1892 |
| 649 | Ga0207699_10206866 | 3300025906 | Bacteria | 1333 |
| 650 | Ga0207645_10005726 | 3300025907 | Bacteria | 8965 |
| 651 | Ga0207645_10039453 | 3300025907 | Bacteria | 3026 |
| 652 | Ga0207645_10076314 | 3300025907 | Bacteria | 2146 |
| 653 | Ga0207645_10284481 | 3300025907 | Bacteria | 1099 |
| 654 | Ga0207643_10092736 | 3300025908 | Bacteria | 1762 |
| 655 | Ga0207643_10178774 | 3300025908 | Bacteria | 1283 |
| 656 | Ga0207705_10000039 | 3300025909 | Bacteria | 193592 |
| 657 | Ga0207705_10002551 | 3300025909 | Bacteria | 14004 |
| 658 | Ga0207705_10010984 | 3300025909 | Bacteria | 6576 |
| 659 | Ga0207705_10042110 | 3300025909 | Bacteria | 3278 |
| 660 | Ga0207705_10050295 | 3300025909 | Bacteria | 3000 |
| 661 | Ga0207705_10059985 | 3300025909 | Bacteria | 2747 |
| 662 | Ga0207705_10114476 | 3300025909 | Bacteria | 1995 |
| 663 | Ga0207705_10132004 | 3300025909 | Bacteria | 1859 |
| 664 | Ga0207684_10092116 | 3300025910 | Bacteria | 2583 |
| 665 | Ga0207654_10088255 | 3300025911 | Bacteria | 1884 |
| 666 | Ga0207654_10107385 | 3300025911 | Bacteria | 1730 |
| 667 | Ga0207654_10117887 | 3300025911 | Bacteria | 1662 |
| 668 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 669 | Ga0207707_10010788 | 3300025912 | Bacteria | 7939 |
| 670 | Ga0207707_10019058 | 3300025912 | Bacteria | 5987 |
| 671 | Ga0207707_10030735 | 3300025912 | Bacteria | 4698 |
| 672 | Ga0207707_10039792 | 3300025912 | Bacteria | 4108 |
| 673 | Ga0207707_10041161 | 3300025912 | Bacteria | 4035 |
| 674 | Ga0207707_10055055 | 3300025912 | Bacteria | 3461 |
| 675 | Ga0207707_10106410 | 3300025912 | Bacteria | 2452 |
| 676 | Ga0207707_10133498 | 3300025912 | Bacteria | 2171 |
| 677 | Ga0207707_10162139 | 3300025912 | Bacteria | 1955 |
| 678 | Ga0207707_10269466 | 3300025912 | Bacteria | 1476 |
| 679 | Ga0207707_10295316 | 3300025912 | Bacteria | 1402 |
| 680 | Ga0207707_10436937 | 3300025912 | Bacteria | 1120 |
| 681 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 682 | Ga0207695_10001649 | 3300025913 | Bacteria | 35962 |
| 683 | Ga0207695_10016276 | 3300025913 | Bacteria | 8711 |
| 684 | Ga0207695_10034422 | 3300025913 | Bacteria | 5509 |
| 685 | Ga0207695_10085020 | 3300025913 | Bacteria | 3193 |
| 686 | Ga0207695_10086922 | 3300025913 | Bacteria | 3151 |
| 687 | Ga0207695_10099655 | 3300025913 | Bacteria | 2903 |
| 688 | Ga0207695_10142285 | 3300025913 | Bacteria | 2346 |
| 689 | Ga0207695_10154775 | 3300025913 | Bacteria | 2228 |
| 690 | Ga0207695_10169773 | 3300025913 | Bacteria | 2107 |
| 691 | Ga0207695_10175181 | 3300025913 | Bacteria | 2068 |
| 692 | Ga0207695_10553224 | 3300025913 | Bacteria | 1032 |
| 693 | Ga0207671_10023167 | 3300025914 | Bacteria | 4684 |
| 694 | Ga0207671_10136664 | 3300025914 | Bacteria | 1885 |
| 695 | Ga0207671_10361075 | 3300025914 | Bacteria | 1153 |
| 696 | Ga0207693_10000127 | 3300025915 | Bacteria | 68379 |
| 697 | Ga0207693_10000247 | 3300025915 | Bacteria | 50003 |
| 698 | Ga0207693_10003312 | 3300025915 | Bacteria | 13783 |
| 699 | Ga0207693_10036417 | 3300025915 | Bacteria | 3879 |
| 700 | Ga0207693_10126511 | 3300025915 | Bacteria | 2009 |
| 701 | Ga0207693_10155944 | 3300025915 | Bacteria | 1796 |
| 702 | Ga0207663_10145553 | 3300025916 | Bacteria | 1656 |
| 703 | Ga0207663_10208513 | 3300025916 | Bacteria | 1415 |
| 704 | Ga0207660_10001305 | 3300025917 | Bacteria | 16649 |
| 705 | Ga0207660_10006328 | 3300025917 | Bacteria | 7676 |
| 706 | Ga0207660_10015367 | 3300025917 | Bacteria | 5050 |
| 707 | Ga0207660_10016006 | 3300025917 | Bacteria | 4958 |
| 708 | Ga0207660_10072410 | 3300025917 | Bacteria | 2510 |
| 709 | Ga0207660_10113135 | 3300025917 | Bacteria | 2046 |
| 710 | Ga0207660_10122663 | 3300025917 | Bacteria | 1970 |
| 711 | Ga0207662_10000924 | 3300025918 | Bacteria | 13610 |
| 712 | Ga0207662_10239392 | 3300025918 | Bacteria | 1188 |
| 713 | Ga0207657_10000257 | 3300025919 | Bacteria | 56368 |
| 714 | Ga0207657_10007684 | 3300025919 | Bacteria | 11019 |
| 715 | Ga0207657_10020778 | 3300025919 | Bacteria | 6197 |
| 716 | Ga0207657_10025453 | 3300025919 | Bacteria | 5457 |
| 717 | Ga0207657_10144002 | 3300025919 | Bacteria | 1945 |
| 718 | Ga0207657_10465423 | 3300025919 | Bacteria | 992 |
| 719 | Ga0207649_10000060 | 3300025920 | Bacteria | 99202 |
| 720 | Ga0207649_10013244 | 3300025920 | Bacteria | 4600 |
| 721 | Ga0207652_10000141 | 3300025921 | Bacteria | 76698 |
| 722 | Ga0207652_10008279 | 3300025921 | Bacteria | 8360 |
| 723 | Ga0207652_10019939 | 3300025921 | Bacteria | 5521 |
| 724 | Ga0207652_10023480 | 3300025921 | Bacteria | 5110 |
| 725 | Ga0207652_10040057 | 3300025921 | Bacteria | 3978 |
| 726 | Ga0207652_10050093 | 3300025921 | Bacteria | 3577 |
| 727 | Ga0207652_10133162 | 3300025921 | Bacteria | 2218 |
| 728 | Ga0207652_10176071 | 3300025921 | Bacteria | 1921 |
| 729 | Ga0207652_10183561 | 3300025921 | Bacteria | 1880 |
| 730 | Ga0207652_10193823 | 3300025921 | Bacteria | 1828 |
| 731 | Ga0207652_10585044 | 3300025921 | Bacteria | 1002 |
| 732 | Ga0207646_10007200 | 3300025922 | Bacteria | 11354 |
| 733 | Ga0207681_10027103 | 3300025923 | Bacteria | 3702 |
| 734 | Ga0207681_10032279 | 3300025923 | Bacteria | 3427 |
| 735 | Ga0207681_10045401 | 3300025923 | Bacteria | 2950 |
| 736 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 737 | Ga0207694_10001089 | 3300025924 | Bacteria | 23548 |
| 738 | Ga0207694_10009327 | 3300025924 | Bacteria | 7403 |
| 739 | Ga0207694_10021936 | 3300025924 | Bacteria | 4842 |
| 740 | Ga0207694_10033316 | 3300025924 | Bacteria | 3946 |
| 741 | Ga0207694_10070457 | 3300025924 | Bacteria | 2731 |
| 742 | Ga0207694_10076221 | 3300025924 | Bacteria | 2626 |
| 743 | Ga0207694_10272507 | 3300025924 | Bacteria | 1388 |
| 744 | Ga0207650_10000030 | 3300025925 | Bacteria | 235824 |
| 745 | Ga0207650_10002093 | 3300025925 | Bacteria | 13957 |
| 746 | Ga0207650_10020912 | 3300025925 | Bacteria | 4623 |
| 747 | Ga0207650_10143668 | 3300025925 | Bacteria | 1878 |
| 748 | Ga0207650_10171248 | 3300025925 | Bacteria | 1726 |
| 749 | Ga0207659_10235418 | 3300025926 | Bacteria | 1479 |
| 750 | Ga0207659_10413649 | 3300025926 | Bacteria | 1130 |
| 751 | Ga0207687_10015151 | 3300025927 | Bacteria | 5053 |
| 752 | Ga0207687_10026527 | 3300025927 | Bacteria | 3880 |
| 753 | Ga0207687_10057986 | 3300025927 | Bacteria | 2722 |
| 754 | Ga0207687_10126975 | 3300025927 | Bacteria | 1916 |
| 755 | Ga0207687_10192576 | 3300025927 | Bacteria | 1588 |
| 756 | Ga0207687_10531749 | 3300025927 | Bacteria | 984 |
| 757 | Ga0207700_10002798 | 3300025928 | Bacteria | 10046 |
| 758 | Ga0207700_10025473 | 3300025928 | Bacteria | 4108 |
| 759 | Ga0207700_10088283 | 3300025928 | Bacteria | 2441 |
| 760 | Ga0207700_10126616 | 3300025928 | Bacteria | 2079 |
| 761 | Ga0207700_10163008 | 3300025928 | Bacteria | 1853 |
| 762 | Ga0207664_10036901 | 3300025929 | Bacteria | 3780 |
| 763 | Ga0207664_10150050 | 3300025929 | Bacteria | 1979 |
| 764 | Ga0207664_10179688 | 3300025929 | Bacteria | 1816 |
| 765 | Ga0207664_10285742 | 3300025929 | Bacteria | 1448 |
| 766 | Ga0207644_10008376 | 3300025931 | Bacteria | 6767 |
| 767 | Ga0207644_10026216 | 3300025931 | Bacteria | 4014 |
| 768 | Ga0207644_10027526 | 3300025931 | Bacteria | 3927 |
| 769 | Ga0207644_10136397 | 3300025931 | Bacteria | 1884 |
| 770 | Ga0207644_10212491 | 3300025931 | Bacteria | 1530 |
| 771 | Ga0207644_10417894 | 3300025931 | Bacteria | 1098 |
| 772 | Ga0207690_10007048 | 3300025932 | Bacteria | 6669 |
| 773 | Ga0207690_10014732 | 3300025932 | Bacteria | 4728 |
| 774 | Ga0207690_10026365 | 3300025932 | Bacteria | 3659 |
| 775 | Ga0207690_10156836 | 3300025932 | Bacteria | 1693 |
| 776 | Ga0207690_10286902 | 3300025932 | Bacteria | 1283 |
| 777 | Ga0207706_10000295 | 3300025933 | Bacteria | 54132 |
| 778 | Ga0207706_10109953 | 3300025933 | Bacteria | 2425 |
| 779 | Ga0207706_10176226 | 3300025933 | Bacteria | 1878 |
| 780 | Ga0207686_10069922 | 3300025934 | Bacteria | 2253 |
| 781 | Ga0207686_10077146 | 3300025934 | Bacteria | 2163 |
| 782 | Ga0207686_10082644 | 3300025934 | Bacteria | 2100 |
| 783 | Ga0207686_10224063 | 3300025934 | Bacteria | 1359 |
| 784 | Ga0207709_10013293 | 3300025935 | Bacteria | 4542 |
| 785 | Ga0207709_10015111 | 3300025935 | Bacteria | 4277 |
| 786 | Ga0207709_10141093 | 3300025935 | Bacteria | 1656 |
| 787 | Ga0207669_10004332 | 3300025937 | Bacteria | 6236 |
| 788 | Ga0207669_10039227 | 3300025937 | Bacteria | 2734 |
| 789 | Ga0207704_10004157 | 3300025938 | Bacteria | 6600 |
| 790 | Ga0207704_10016025 | 3300025938 | Bacteria | 3840 |
| 791 | Ga0207704_10018903 | 3300025938 | Bacteria | 3608 |
| 792 | Ga0207704_10120333 | 3300025938 | Bacteria | 1795 |
| 793 | Ga0207704_10184588 | 3300025938 | Bacteria | 1511 |
| 794 | Ga0207665_10000664 | 3300025939 | Bacteria | 23168 |
| 795 | Ga0207665_10105406 | 3300025939 | Bacteria | 1974 |
| 796 | Ga0207665_10302314 | 3300025939 | Bacteria | 1196 |
| 797 | Ga0207691_10005624 | 3300025940 | Bacteria | 12115 |
| 798 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 799 | Ga0207711_10000267 | 3300025941 | Bacteria | 56315 |
| 800 | Ga0207711_10000919 | 3300025941 | Bacteria | 28369 |
| 801 | Ga0207711_10011983 | 3300025941 | Bacteria | 7206 |
| 802 | Ga0207711_10028457 | 3300025941 | Bacteria | 4703 |
| 803 | Ga0207711_10070867 | 3300025941 | Bacteria | 3023 |
| 804 | Ga0207711_10173241 | 3300025941 | Bacteria | 1959 |
| 805 | Ga0207711_10210179 | 3300025941 | Bacteria | 1777 |
| 806 | Ga0207711_10442267 | 3300025941 | Bacteria | 1210 |
| 807 | Ga0207689_10005479 | 3300025942 | Bacteria | 11358 |
| 808 | Ga0207689_10141879 | 3300025942 | Bacteria | 1979 |
| 809 | Ga0207661_10224630 | 3300025944 | Bacteria | 1661 |
| 810 | Ga0207661_10446046 | 3300025944 | Bacteria | 1178 |
| 811 | Ga0207679_10004900 | 3300025945 | Bacteria | 8344 |
| 812 | Ga0207679_10015049 | 3300025945 | Bacteria | 5100 |
| 813 | Ga0207679_10111870 | 3300025945 | Bacteria | 2157 |
| 814 | Ga0207679_10479158 | 3300025945 | Bacteria | 1107 |
| 815 | Ga0207667_10034948 | 3300025949 | Bacteria | 5394 |
| 816 | Ga0207667_10053661 | 3300025949 | Bacteria | 4241 |
| 817 | Ga0207667_10087961 | 3300025949 | Bacteria | 3213 |
| 818 | Ga0207667_10088796 | 3300025949 | Bacteria | 3196 |
| 819 | Ga0207667_10100708 | 3300025949 | Bacteria | 2980 |
| 820 | Ga0207667_10123750 | 3300025949 | Bacteria | 2664 |
| 821 | Ga0207667_10133802 | 3300025949 | Bacteria | 2553 |
| 822 | Ga0207667_10174150 | 3300025949 | Bacteria | 2211 |
| 823 | Ga0207667_10304577 | 3300025949 | Bacteria | 1628 |
| 824 | Ga0207667_10421216 | 3300025949 | Bacteria | 1359 |
| 825 | Ga0207651_10015625 | 3300025960 | Bacteria | 4418 |
| 826 | Ga0207651_10164882 | 3300025960 | Bacteria | 1741 |
| 827 | Ga0207651_10353907 | 3300025960 | Bacteria | 1237 |
| 828 | Ga0207712_10000683 | 3300025961 | Bacteria | 26236 |
| 829 | Ga0207712_10002026 | 3300025961 | Bacteria | 13297 |
| 830 | Ga0207712_10008618 | 3300025961 | Bacteria | 6448 |
| 831 | Ga0207712_10025416 | 3300025961 | Bacteria | 3934 |
| 832 | Ga0207712_10168464 | 3300025961 | Bacteria | 1710 |
| 833 | Ga0207712_10172836 | 3300025961 | Bacteria | 1690 |
| 834 | Ga0207712_10271074 | 3300025961 | Bacteria | 1381 |
| 835 | Ga0207712_10333127 | 3300025961 | Bacteria | 1256 |
| 836 | Ga0207668_10000010 | 3300025972 | Bacteria | 185249 |
| 837 | Ga0207668_10000152 | 3300025972 | Bacteria | 47686 |
| 838 | Ga0207668_10001656 | 3300025972 | Bacteria | 13009 |
| 839 | Ga0207668_10006351 | 3300025972 | Bacteria | 6989 |
| 840 | Ga0207668_10014968 | 3300025972 | Bacteria | 4811 |
| 841 | Ga0207668_10141138 | 3300025972 | Bacteria | 1853 |
| 842 | Ga0207668_10513245 | 3300025972 | Bacteria | 1033 |
| 843 | Ga0207658_10000211 | 3300025986 | Bacteria | 60993 |
| 844 | Ga0207658_10003894 | 3300025986 | Bacteria | 10503 |
| 845 | Ga0207658_10006609 | 3300025986 | Bacteria | 7902 |
| 846 | Ga0207658_10007025 | 3300025986 | Bacteria | 7663 |
| 847 | Ga0207658_10034901 | 3300025986 | Bacteria | 3598 |
| 848 | Ga0207658_10300139 | 3300025986 | Bacteria | 1383 |
| 849 | Ga0207658_10489243 | 3300025986 | Bacteria | 1094 |
| 850 | Ga0207677_10078267 | 3300026023 | Bacteria | 2361 |
| 851 | Ga0207703_10000049 | 3300026035 | Bacteria | 149817 |
| 852 | Ga0207703_10002309 | 3300026035 | Bacteria | 16642 |
| 853 | Ga0207703_10002704 | 3300026035 | Bacteria | 15188 |
| 854 | Ga0207703_10008329 | 3300026035 | Bacteria | 8193 |
| 855 | Ga0207703_10064876 | 3300026035 | Bacteria | 2999 |
| 856 | Ga0207703_10075251 | 3300026035 | Bacteria | 2798 |
| 857 | Ga0207703_10437586 | 3300026035 | Bacteria | 1219 |
| 858 | Ga0207639_10002055 | 3300026041 | Bacteria | 13572 |
| 859 | Ga0207639_10010332 | 3300026041 | Bacteria | 6463 |
| 860 | Ga0207639_10014521 | 3300026041 | Bacteria | 5543 |
| 861 | Ga0207639_10075771 | 3300026041 | Bacteria | 2647 |
| 862 | Ga0207639_10185022 | 3300026041 | Bacteria | 1775 |
| 863 | Ga0207678_10000401 | 3300026067 | Bacteria | 39431 |
| 864 | Ga0207678_10002715 | 3300026067 | Bacteria | 16044 |
| 865 | Ga0207678_10003650 | 3300026067 | Bacteria | 13834 |
| 866 | Ga0207678_10164574 | 3300026067 | Bacteria | 1894 |
| 867 | Ga0207708_10000535 | 3300026075 | Bacteria | 29316 |
| 868 | Ga0207708_10009632 | 3300026075 | Bacteria | 7164 |
| 869 | Ga0207708_10064750 | 3300026075 | Bacteria | 2793 |
| 870 | Ga0207708_10074469 | 3300026075 | Bacteria | 2602 |
| 871 | Ga0207708_10141177 | 3300026075 | Bacteria | 1890 |
| 872 | Ga0207708_10163300 | 3300026075 | Bacteria | 1760 |
| 873 | Ga0207708_10192079 | 3300026075 | Bacteria | 1626 |
| 874 | Ga0207708_10365733 | 3300026075 | Bacteria | 1186 |
| 875 | Ga0207708_10398335 | 3300026075 | Bacteria | 1138 |
| 876 | Ga0207702_10014870 | 3300026078 | Bacteria | 6456 |
| 877 | Ga0207702_10062519 | 3300026078 | Bacteria | 3180 |
| 878 | Ga0207702_10076898 | 3300026078 | Bacteria | 2885 |
| 879 | Ga0207702_10160480 | 3300026078 | Bacteria | 2053 |
| 880 | Ga0207702_10196741 | 3300026078 | Bacteria | 1866 |
| 881 | Ga0207702_10259219 | 3300026078 | Bacteria | 1636 |
| 882 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 883 | Ga0207641_10001161 | 3300026088 | Bacteria | 26478 |
| 884 | Ga0207641_10001597 | 3300026088 | Bacteria | 22136 |
| 885 | Ga0207641_10044489 | 3300026088 | Bacteria | 3734 |
| 886 | Ga0207641_10059513 | 3300026088 | Bacteria | 3253 |
| 887 | Ga0207641_10275747 | 3300026088 | Bacteria | 1580 |
| 888 | Ga0207641_10311955 | 3300026088 | Bacteria | 1489 |
| 889 | Ga0207648_10007860 | 3300026089 | Bacteria | 10406 |
| 890 | Ga0207648_10010475 | 3300026089 | Bacteria | 8784 |
| 891 | Ga0207648_10042402 | 3300026089 | Bacteria | 3994 |
| 892 | Ga0207676_10000095 | 3300026095 | Bacteria | 80405 |
| 893 | Ga0207676_10003207 | 3300026095 | Bacteria | 11654 |
| 894 | Ga0207676_10040508 | 3300026095 | Bacteria | 3570 |
| 895 | Ga0207676_10063775 | 3300026095 | Bacteria | 2927 |
| 896 | Ga0207676_10195228 | 3300026095 | Bacteria | 1784 |
| 897 | Ga0207676_10215556 | 3300026095 | Bacteria | 1706 |
| 898 | Ga0207674_10000524 | 3300026116 | Bacteria | 50350 |
| 899 | Ga0207674_10001583 | 3300026116 | Bacteria | 29309 |
| 900 | Ga0207674_10087264 | 3300026116 | Bacteria | 3114 |
| 901 | Ga0207674_10092167 | 3300026116 | Bacteria | 3020 |
| 902 | Ga0207674_10117784 | 3300026116 | Bacteria | 2626 |
| 903 | Ga0207674_10184938 | 3300026116 | Bacteria | 2034 |
| 904 | Ga0207675_100012361 | 3300026118 | Bacteria | 7974 |
| 905 | Ga0207675_100042871 | 3300026118 | Bacteria | 4225 |
| 906 | Ga0207675_100074800 | 3300026118 | Bacteria | 3170 |
| 907 | Ga0207675_100136906 | 3300026118 | Bacteria | 2325 |
| 908 | Ga0207675_100148779 | 3300026118 | Bacteria | 2228 |
| 909 | Ga0207675_100203997 | 3300026118 | Bacteria | 1899 |
| 910 | Ga0207675_100210459 | 3300026118 | Bacteria | 1870 |
| 911 | Ga0207675_100302991 | 3300026118 | Bacteria | 1557 |
| 912 | Ga0207683_10000416 | 3300026121 | Bacteria | 39377 |
| 913 | Ga0207683_10006084 | 3300026121 | Bacteria | 10333 |
| 914 | Ga0207683_10008739 | 3300026121 | Bacteria | 8648 |
| 915 | Ga0207683_10013120 | 3300026121 | Bacteria | 7067 |
| 916 | Ga0207683_10074459 | 3300026121 | Bacteria | 3004 |
| 917 | Ga0207698_10090286 | 3300026142 | Bacteria | 2505 |
| 918 | Ga0207698_10115779 | 3300026142 | Bacteria | 2258 |
| 919 | Ga0209981_1000228 | 3300027378 | Bacteria | 7188 |
| 920 | Ga0209984_1017703 | 3300027424 | Bacteria | 959 |
| 921 | Ga0210000_1004649 | 3300027462 | Bacteria | 1980 |
| 922 | Ga0209983_1009790 | 3300027665 | Bacteria | 1959 |
| 923 | Ga0209813_10000327 | 3300027866 | Bacteria | 12478 |
| 924 | Ga0209813_10016463 | 3300027866 | Bacteria | 2018 |
| 925 | Ga0209974_10042379 | 3300027876 | Bacteria | 1515 |
| 926 | Ga0207428_10000235 | 3300027907 | Bacteria | 75923 |
| 927 | Ga0207428_10004815 | 3300027907 | Bacteria | 12744 |
| 928 | Ga0207428_10026155 | 3300027907 | Bacteria | 4873 |
| 929 | Ga0207428_10040270 | 3300027907 | Bacteria | 3792 |
| 930 | Ga0207428_10054598 | 3300027907 | Bacteria | 3181 |
| 931 | Ga0268266_10000453 | 3300028379 | Bacteria | 60062 |
| 932 | Ga0268266_10000551 | 3300028379 | Bacteria | 52218 |
| 933 | Ga0268266_10000621 | 3300028379 | Bacteria | 48218 |
| 934 | Ga0268266_10001015 | 3300028379 | Bacteria | 35377 |
| 935 | Ga0268266_10032142 | 3300028379 | Bacteria | 4458 |
| 936 | Ga0268266_10039501 | 3300028379 | Bacteria | 4020 |
| 937 | Ga0268266_10040576 | 3300028379 | Bacteria | 3967 |
| 938 | Ga0268266_10048617 | 3300028379 | Bacteria | 3636 |
| 939 | Ga0268266_10057032 | 3300028379 | Bacteria | 3360 |
| 940 | Ga0268266_10073664 | 3300028379 | Bacteria | 2964 |
| 941 | Ga0268266_10101247 | 3300028379 | Bacteria | 2539 |
| 942 | Ga0268266_10299680 | 3300028379 | Bacteria | 1499 |
| 943 | Ga0268265_10001201 | 3300028380 | Bacteria | 22545 |
| 944 | Ga0268265_10003906 | 3300028380 | Bacteria | 10506 |
| 945 | Ga0268265_10013342 | 3300028380 | Bacteria | 5582 |
| 946 | Ga0268265_10041738 | 3300028380 | Bacteria | 3398 |
| 947 | Ga0268265_10076488 | 3300028380 | Bacteria | 2626 |
| 948 | Ga0268265_10085941 | 3300028380 | Bacteria | 2498 |
| 949 | Ga0268264_10000125 | 3300028381 | Bacteria | 186416 |
| 950 | Ga0268264_10004262 | 3300028381 | Bacteria | 12211 |
| 951 | Ga0268264_10025320 | 3300028381 | Bacteria | 4847 |
| 952 | Ga0268264_10027689 | 3300028381 | Bacteria | 4633 |
| 953 | Ga0268264_10047913 | 3300028381 | Bacteria | 3554 |
| 954 | Ga0268264_10094662 | 3300028381 | Bacteria | 2583 |
| 955 | Ga0268264_10299038 | 3300028381 | Bacteria | 1514 |
| 956 | Ga0268264_10300407 | 3300028381 | Bacteria | 1511 |
| 957 | Ga0268264_10304859 | 3300028381 | Bacteria | 1500 |
| 958 | Ga0265337_1001829 | 3300028556 | Bacteria | 10205 |
| 959 | Ga0265334_10010903 | 3300028573 | Bacteria | 3836 |
| 960 | Ga0265334_10016579 | 3300028573 | Bacteria | 3046 |
| 961 | Ga0265318_10000235 | 3300028577 | Bacteria | 48102 |
| 962 | Ga0265318_10002471 | 3300028577 | Bacteria | 9872 |
| 963 | Ga0307517_10000835 | 3300028786 | Bacteria | 53001 |
| 964 | Ga0307517_10231575 | 3300028786 | Bacteria | 1108 |
| 965 | Ga0307515_10066324 | 3300028794 | Bacteria | 5003 |
| 966 | Ga0307515_10106806 | 3300028794 | Bacteria | 3316 |
| 967 | Ga0307515_10259688 | 3300028794 | Bacteria | 1475 |
| 968 | Ga0265338_10000043 | 3300028800 | Bacteria | 226293 |
| 969 | Ga0265338_10005705 | 3300028800 | Bacteria | 16099 |
| 970 | Ga0265338_10015424 | 3300028800 | Bacteria | 8394 |
| 971 | Ga0265338_10020630 | 3300028800 | Bacteria | 6920 |
| 972 | Ga0265338_10035573 | 3300028800 | Bacteria | 4784 |
| 973 | Ga0265338_10039574 | 3300028800 | Bacteria | 4445 |
| 974 | Ga0265338_10040541 | 3300028800 | Bacteria | 4372 |
| 975 | Ga0265338_10082092 | 3300028800 | Bacteria | 2700 |
| 976 | Ga0265338_10084214 | 3300028800 | Bacteria | 2655 |
| 977 | Ga0265338_10128440 | 3300028800 | Bacteria | 2006 |
| 978 | Ga0265338_10152077 | 3300028800 | Bacteria | 1797 |
| 979 | Ga0265338_10192370 | 3300028800 | Bacteria | 1545 |
| 980 | Ga0310981_1042390 | 3300029285 | Bacteria | 1353 |
| 981 | Ga0307511_10033370 | 3300030521 | Bacteria | 4546 |
| 982 | Ga0265760_10038615 | 3300031090 | Bacteria | 1420 |
| 983 | Ga0265330_10002470 | 3300031235 | Bacteria | 10054 |
| 984 | Ga0265330_10024699 | 3300031235 | Bacteria | 2725 |
| 985 | Ga0265332_10011270 | 3300031238 | Bacteria | 3975 |
| 986 | Ga0265332_10033467 | 3300031238 | Bacteria | 2237 |
| 987 | Ga0265332_10088810 | 3300031238 | Bacteria | 1308 |
| 988 | Ga0265328_10118179 | 3300031239 | Bacteria | 988 |
| 989 | Ga0265320_10074813 | 3300031240 | Bacteria | 1590 |
| 990 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 991 | Ga0265325_10001880 | 3300031241 | Bacteria | 14490 |
| 992 | Ga0265325_10002687 | 3300031241 | Bacteria | 11897 |
| 993 | Ga0265325_10070773 | 3300031241 | Bacteria | 1752 |
| 994 | Ga0265340_10000353 | 3300031247 | Bacteria | 24451 |
| 995 | Ga0265340_10001830 | 3300031247 | Bacteria | 12157 |
| 996 | Ga0265340_10003755 | 3300031247 | Bacteria | 8545 |
| 997 | Ga0265340_10086389 | 3300031247 | Bacteria | 1471 |
| 998 | Ga0265340_10134287 | 3300031247 | Bacteria | 1134 |
| 999 | Ga0265339_10000313 | 3300031249 | Bacteria | 39589 |
| 1000 | Ga0265339_10000763 | 3300031249 | Bacteria | 24917 |
| 1001 | Ga0265339_10018271 | 3300031249 | Bacteria | 4136 |
| 1002 | Ga0265339_10023677 | 3300031249 | Bacteria | 3547 |
| 1003 | Ga0265339_10106100 | 3300031249 | Bacteria | 1458 |
| 1004 | Ga0265339_10110046 | 3300031249 | Bacteria | 1426 |
| 1005 | Ga0265339_10131887 | 3300031249 | Bacteria | 1277 |
| 1006 | Ga0265331_10000049 | 3300031250 | Bacteria | 182618 |
| 1007 | Ga0265331_10000250 | 3300031250 | Bacteria | 63883 |
| 1008 | Ga0265331_10001017 | 3300031250 | Bacteria | 21939 |
| 1009 | Ga0265331_10002339 | 3300031250 | Bacteria | 12884 |
| 1010 | Ga0265331_10007204 | 3300031250 | Bacteria | 6461 |
| 1011 | Ga0265331_10011352 | 3300031250 | Bacteria | 4883 |
| 1012 | Ga0265331_10022694 | 3300031250 | Bacteria | 3200 |
| 1013 | Ga0265331_10052331 | 3300031250 | Bacteria | 1951 |
| 1014 | Ga0265331_10085035 | 3300031250 | Bacteria | 1466 |
| 1015 | Ga0265331_10106605 | 3300031250 | Bacteria | 1287 |
| 1016 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 1017 | Ga0265327_10000280 | 3300031251 | Bacteria | 100757 |
| 1018 | Ga0265327_10000771 | 3300031251 | Bacteria | 49408 |
| 1019 | Ga0265327_10004124 | 3300031251 | Bacteria | 13125 |
| 1020 | Ga0265327_10080192 | 3300031251 | Bacteria | 1614 |
| 1021 | Ga0265316_10007569 | 3300031344 | Bacteria | 10219 |
| 1022 | Ga0265316_10017960 | 3300031344 | Bacteria | 6095 |
| 1023 | Ga0265316_10041506 | 3300031344 | Bacteria | 3682 |
| 1024 | Ga0265316_10051397 | 3300031344 | Bacteria | 3238 |
| 1025 | Ga0265316_10066867 | 3300031344 | Bacteria | 2780 |
| 1026 | Ga0265316_10110083 | 3300031344 | Bacteria | 2086 |
| 1027 | Ga0265316_10168435 | 3300031344 | Bacteria | 1635 |
| 1028 | Ga0265316_10173466 | 3300031344 | Bacteria | 1608 |
| 1029 | Ga0307513_10001002 | 3300031456 | Bacteria | 40842 |
| 1030 | Ga0307513_10003622 | 3300031456 | Bacteria | 20908 |
| 1031 | Ga0307513_10013077 | 3300031456 | Bacteria | 10204 |
| 1032 | Ga0307513_10016442 | 3300031456 | Bacteria | 8920 |
| 1033 | Ga0307408_100038619 | 3300031548 | Bacteria | 3370 |
| 1034 | Ga0307408_100130898 | 3300031548 | Bacteria | 1957 |
| 1035 | Ga0307408_100196031 | 3300031548 | Bacteria | 1631 |
| 1036 | Ga0265313_10000665 | 3300031595 | Bacteria | 35397 |
| 1037 | Ga0265313_10001152 | 3300031595 | Bacteria | 25241 |
| 1038 | Ga0265313_10001900 | 3300031595 | Bacteria | 18950 |
| 1039 | Ga0265313_10001912 | 3300031595 | Bacteria | 18889 |
| 1040 | Ga0265313_10005546 | 3300031595 | Bacteria | 9249 |
| 1041 | Ga0265313_10009355 | 3300031595 | Bacteria | 6369 |
| 1042 | Ga0265313_10017490 | 3300031595 | Bacteria | 4073 |
| 1043 | Ga0265313_10023056 | 3300031595 | Bacteria | 3360 |
| 1044 | Ga0316575_10028152 | 3300031665 | Bacteria | 2189 |
| 1045 | Ga0316579_10018453 | 3300031691 | Bacteria | 3072 |
| 1046 | Ga0316579_10042471 | 3300031691 | Bacteria | 2112 |
| 1047 | Ga0316579_10066877 | 3300031691 | Bacteria | 1697 |
| 1048 | Ga0265314_10000624 | 3300031711 | Bacteria | 43582 |
| 1049 | Ga0265314_10003187 | 3300031711 | Bacteria | 16061 |
| 1050 | Ga0265314_10004046 | 3300031711 | Bacteria | 13848 |
| 1051 | Ga0265314_10013133 | 3300031711 | Bacteria | 6709 |
| 1052 | Ga0265314_10014558 | 3300031711 | Bacteria | 6284 |
| 1053 | Ga0265314_10015300 | 3300031711 | Bacteria | 6092 |
| 1054 | Ga0265314_10017417 | 3300031711 | Bacteria | 5641 |
| 1055 | Ga0265314_10089190 | 3300031711 | Bacteria | 2012 |
| 1056 | Ga0265314_10130186 | 3300031711 | Bacteria | 1571 |
| 1057 | Ga0265342_10013377 | 3300031712 | Bacteria | 5510 |
| 1058 | Ga0265342_10014194 | 3300031712 | Bacteria | 5298 |
| 1059 | Ga0265342_10030469 | 3300031712 | Bacteria | 3343 |
| 1060 | Ga0265342_10030996 | 3300031712 | Bacteria | 3309 |
| 1061 | Ga0265342_10052553 | 3300031712 | Bacteria | 2428 |
| 1062 | Ga0316576_10007695 | 3300031727 | Bacteria | 6796 |
| 1063 | Ga0316576_10016330 | 3300031727 | Bacteria | 5010 |
| 1064 | Ga0316576_10023907 | 3300031727 | Bacteria | 4262 |
| 1065 | Ga0316576_10035120 | 3300031727 | Bacteria | 3577 |
| 1066 | Ga0316576_10045230 | 3300031727 | Bacteria | 3182 |
| 1067 | Ga0316576_10146856 | 3300031727 | Bacteria | 1776 |
| 1068 | Ga0316578_10003781 | 3300031728 | Bacteria | 7004 |
| 1069 | Ga0316578_10016134 | 3300031728 | Bacteria | 4035 |
| 1070 | Ga0316578_10113747 | 3300031728 | Bacteria | 1626 |
| 1071 | Ga0307516_10013152 | 3300031730 | Bacteria | 8843 |
| 1072 | Ga0307516_10046918 | 3300031730 | Bacteria | 4260 |
| 1073 | Ga0307405_10422349 | 3300031731 | Bacteria | 1050 |
| 1074 | Ga0316577_10007617 | 3300031733 | Bacteria | 5777 |
| 1075 | Ga0316577_10053591 | 3300031733 | Bacteria | 2251 |
| 1076 | Ga0316577_10094327 | 3300031733 | Bacteria | 1676 |
| 1077 | Ga0316577_10100688 | 3300031733 | Bacteria | 1619 |
| 1078 | Ga0307413_10082170 | 3300031824 | Bacteria | 2068 |
| 1079 | Ga0307413_10148596 | 3300031824 | Bacteria | 1630 |
| 1080 | Ga0307410_10143194 | 3300031852 | Bacteria | 1771 |
| 1081 | Ga0307406_10000448 | 3300031901 | Bacteria | 24069 |
| 1082 | Ga0307406_10148259 | 3300031901 | Bacteria | 1670 |
| 1083 | Ga0307407_10056838 | 3300031903 | Bacteria | 2268 |
| 1084 | Ga0307412_10210208 | 3300031911 | Bacteria | 1484 |
| 1085 | Ga0307412_10272581 | 3300031911 | Bacteria | 1325 |
| 1086 | Ga0307409_100038917 | 3300031995 | Bacteria | 3523 |
| 1087 | Ga0307416_100191680 | 3300032002 | Bacteria | 1929 |
| 1088 | Ga0307416_100705342 | 3300032002 | Bacteria | 1098 |
| 1089 | Ga0316585_10006235 | 3300032137 | Bacteria | 3400 |
| 1090 | Ga0316585_10034545 | 3300032137 | Bacteria | 1598 |
| 1091 | Ga0316580_10004852 | 3300032139 | Bacteria | 3910 |
| 1092 | Ga0316580_10015818 | 3300032139 | Bacteria | 2310 |
| 1093 | Ga0307510_10019906 | 3300033180 | Bacteria | 7860 |
| 1094 | Ga0316592_1011005 | 3300033524 | Bacteria | 1832 |
| 1095 | Ga0316596_1001927 | 3300033541 | Bacteria | 4349 |
| 1096 | Ga0373930_0038171 | 3300034816 | Bacteria | 1014 |
| 1097 | Ga0373948_0027857 | 3300034817 | Bacteria | 1122 |
| 1098 | Ga0373938_0008082 | 3300034957 | Bacteria | 1871 |
| 1099 | Ga0373934_0022896 | 3300035086 | Bacteria | 2412 |
| 1100 | Ga0373934_0040695 | 3300035086 | Bacteria | 1834 |
| 1101 | Ga0373934_0159156 | 3300035086 | Bacteria | 926 |
| 1102 | Ga0373923_0033188 | 3300035111 | Bacteria | 2089 |
| 1103 | Ga0373932_0006725 | 3300035112 | Bacteria | 2727 |
| 1104 | Ga0373936_0014842 | 3300035113 | Bacteria | 2982 |
| 1105 | Ga0373941_0006359 | 3300035115 | Bacteria | 2843 |
| 1106 | Ga0373945_0052781 | 3300035116 | Bacteria | 1499 |
| 1107 | Ga0373945_0061247 | 3300035116 | Bacteria | 1405 |
| 1108 | Ga0373954_0019886 | 3300035118 | Bacteria | 3031 |
| 1109 | Ga0373956_0055627 | 3300035119 | Bacteria | 1785 |
| 1110 | Ga0373956_0075914 | 3300035119 | Bacteria | 1537 |
| 1111 | Ga0373960_0010106 | 3300035121 | Bacteria | 2300 |
| 1112 | Ga0373960_0021937 | 3300035121 | Bacteria | 1704 |
| 1113 | Ga0373943_0012466 | 3300035170 | Bacteria | 3829 |
| 1114 | Ga0373943_0038009 | 3300035170 | Bacteria | 2312 |
| 1115 | Ga0373955_0015773 | 3300035172 | Bacteria | 3707 |
| 1116 | Ga0373942_0036883 | 3300035207 | Bacteria | 1319 |
| 1117 | Ga0373961_0017262 | 3300035241 | Bacteria | 1870 |
| 1118 | Ga0373961_0043369 | 3300035241 | Bacteria | 1308 |
| 1119 | Ga0373962_0009720 | 3300035242 | Bacteria | 2388 |
| 1120 | Ga0316574_0028279 | 3300035398 | Bacteria | 3380 |
| 1121 | Ga0316574_0090702 | 3300035398 | Bacteria | 1948 |
| 1122 | Ga0373931_0001346 | 3300035691 | Bacteria | 10513 |
| 1123 | Ga0373931_0001932 | 3300035691 | Bacteria | 9081 |
| 1124 | Ga0373931_0002117 | 3300035691 | Bacteria | 8744 |
| 1125 | Ga0373931_0005624 | 3300035691 | Bacteria | 5814 |
| 1126 | Ga0373935_0149843 | 3300035692 | Bacteria | 1582 |
| 1127 | Ga0373935_0152573 | 3300035692 | Bacteria | 1569 |
| 1128 | Ga0373935_0309551 | 3300035692 | Bacteria | 1118 |
| 1129 | Ga0373927_0000731 | 3300035695 | Bacteria | 25089 |
| 1130 | Ga0373927_0013684 | 3300035695 | Bacteria | 5387 |
| 1131 | Ga0373927_0015215 | 3300035695 | Bacteria | 5085 |
| 1132 | Ga0373927_0037518 | 3300035695 | Bacteria | 3149 |
| 1133 | Ga0373927_0070795 | 3300035695 | Bacteria | 2257 |
| 1134 | Ga0373933_0017460 | 3300035724 | Bacteria | 4025 |
| 1135 | Ga0373933_0034003 | 3300035724 | Bacteria | 2968 |
| 1136 | Ga0373933_0066885 | 3300035724 | Bacteria | 2179 |
| 1137 | Ga0373947_0018153 | 3300035725 | Bacteria | 4048 |
| 1138 | Ga0373947_0062984 | 3300035725 | Bacteria | 2258 |
| 1139 | Ga0373947_0096239 | 3300035725 | Bacteria | 1853 |
| 1140 | Ga0373947_0155237 | 3300035725 | Bacteria | 1477 |
| 1141 | Ga0373947_0274113 | 3300035725 | Bacteria | 1120 |
| 1142 | Ga0373937_0001423 | 3300036401 | Bacteria | 19994 |
| 1143 | Ga0373937_0002342 | 3300036401 | Bacteria | 15788 |
| 1144 | Ga0373937_0002962 | 3300036401 | Bacteria | 14207 |
| 1145 | Ga0373937_0003675 | 3300036401 | Bacteria | 12955 |
| 1146 | Ga0373937_0026345 | 3300036401 | Bacteria | 5254 |
| 1147 | Ga0373937_0061345 | 3300036401 | Bacteria | 3456 |
| 1148 | Ga0373937_0115599 | 3300036401 | Bacteria | 2498 |
| 1149 | Ga0373937_0121846 | 3300036401 | Bacteria | 2431 |
| 1150 | Ga0373937_0131952 | 3300036401 | Bacteria | 2333 |
| 1151 | Ga0373937_0154255 | 3300036401 | Bacteria | 2152 |
| 1152 | Ga0373937_0367853 | 3300036401 | Bacteria | 1363 |
| 1153 | Ga0373937_0662347 | 3300036401 | Bacteria | 990 |
| 1154 | Ga0373937_0663393 | 3300036401 | Bacteria | 989 |
| 1155 | Ga0316582_0012360 | 3300036647 | Bacteria | 4761 |
| 1156 | Ga0316582_0052854 | 3300036647 | Bacteria | 2583 |
| 1157 | Ga0316582_0115571 | 3300036647 | Bacteria | 1790 |
| 1158 | Ga0316582_0147545 | 3300036647 | Bacteria | 1589 |
| 1159 | Ga0316582_0213057 | 3300036647 | Bacteria | 1320 |
| 1160 | Ga0316584_0000315 | 3300036712 | Bacteria | 24865 |
| 1161 | Ga0316584_0028549 | 3300036712 | Bacteria | 4116 |
| 1162 | Ga0316584_0033689 | 3300036712 | Bacteria | 3794 |
| 1163 | Ga0316584_0044380 | 3300036712 | Bacteria | 3314 |
| 1164 | Ga0316584_0169650 | 3300036712 | Bacteria | 1619 |
| 1165 | Ga0373925_0000049 | 3300037068 | Bacteria | 128065 |
| 1166 | Ga0373925_0020859 | 3300037068 | Bacteria | 4775 |
| 1167 | Ga0373925_0034949 | 3300037068 | Bacteria | 3706 |
| 1168 | Ga0373925_0055440 | 3300037068 | Bacteria | 2967 |
| 1169 | Ga0373925_0063554 | 3300037068 | Bacteria | 2777 |
| 1170 | Ga0373925_0196098 | 3300037068 | Bacteria | 1604 |
| 1171 | Ga0373925_0216804 | 3300037068 | Bacteria | 1526 |
| 1172 | Ga0373925_0373098 | 3300037068 | Bacteria | 1161 |
| 1173 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 1174 | Ga0395899_0001404 | 3300037312 | Bacteria | 20645 |
| 1175 | Ga0395899_0027182 | 3300037312 | Bacteria | 4315 |
| 1176 | Ga0395899_0034035 | 3300037312 | Bacteria | 3825 |
| 1177 | Ga0395899_0036915 | 3300037312 | Bacteria | 3664 |
| 1178 | Ga0395899_0117030 | 3300037312 | Bacteria | 1912 |
| 1179 | Ga0395899_0150529 | 3300037312 | Bacteria | 1649 |
| 1180 | Ga0395900_0000072 | 3300037418 | Bacteria | 187428 |
| 1181 | Ga0395900_0007333 | 3300037418 | Bacteria | 11410 |
| 1182 | Ga0395900_0013029 | 3300037418 | Bacteria | 8497 |
| 1183 | Ga0395900_0032387 | 3300037418 | Bacteria | 5376 |
| 1184 | Ga0395900_0041435 | 3300037418 | Bacteria | 4747 |
| 1185 | Ga0395900_0044633 | 3300037418 | Bacteria | 4566 |
| 1186 | Ga0395900_0054353 | 3300037418 | Bacteria | 4123 |
| 1187 | Ga0395900_0171116 | 3300037418 | Bacteria | 2211 |
| 1188 | Ga0395900_0212715 | 3300037418 | Bacteria | 1952 |
| 1189 | Ga0395900_0230183 | 3300037418 | Bacteria | 1864 |
| 1190 | Ga0395898_0013476 | 3300037466 | Bacteria | 8418 |
| 1191 | Ga0395898_0017819 | 3300037466 | Bacteria | 7246 |
| 1192 | Ga0395898_0017968 | 3300037466 | Bacteria | 7215 |
| 1193 | Ga0395898_0022634 | 3300037466 | Bacteria | 6363 |
| 1194 | Ga0395898_0033282 | 3300037466 | Bacteria | 5145 |
| 1195 | Ga0395898_0052976 | 3300037466 | Bacteria | 3963 |
| 1196 | Ga0395898_0143321 | 3300037466 | Bacteria | 2287 |
| 1197 | Ga0395898_0149035 | 3300037466 | Bacteria | 2239 |
| 1198 | Ga0395898_0180037 | 3300037466 | Bacteria | 2020 |
| 1199 | Ga0395898_0317207 | 3300037466 | Bacteria | 1487 |
| 1200 | Ga0395905_0002499 | 3300037471 | Bacteria | 20331 |
| 1201 | Ga0395905_0003717 | 3300037471 | Bacteria | 16167 |
| 1202 | Ga0395905_0025761 | 3300037471 | Bacteria | 5545 |
| 1203 | Ga0395905_0033855 | 3300037471 | Bacteria | 4799 |
| 1204 | Ga0395905_0050626 | 3300037471 | Bacteria | 3891 |
| 1205 | Ga0395905_0131441 | 3300037471 | Bacteria | 2354 |
| 1206 | Ga0436364_0086082 | 3300037853 | Bacteria | 1030 |
| 1207 | Ga0436364_0160208 | 3300037853 | Bacteria | 27808 |
| 1208 | Ga0436364_0167282 | 3300037853 | Bacteria | 8800 |
| 1209 | Ga0436364_0210663 | 3300037853 | Bacteria | 9471 |
| 1210 | Ga0436364_0534280 | 3300037853 | Bacteria | 2202 |
| 1211 | Ga0436364_0595239 | 3300037853 | Bacteria | 105667 |
| 1212 | Ga0436364_0711284 | 3300037853 | Bacteria | 2364 |
| 1213 | Ga0436364_0727525 | 3300037853 | Bacteria | 12494 |
| 1214 | Ga0436364_0783603 | 3300037853 | Bacteria | 20633 |
| 1215 | Ga0436364_1216533 | 3300037853 | Bacteria | 1066 |
| 1216 | Ga0436364_1348565 | 3300037853 | Bacteria | 28540 |
| 1217 | Ga0436364_1376752 | 3300037853 | Bacteria | 12366 |
| 1218 | Ga0436364_1490963 | 3300037853 | Bacteria | 3520 |
| 1219 | Ga0395901_0006683 | 3300038443 | Bacteria | 11656 |
| 1220 | Ga0395901_0015122 | 3300038443 | Bacteria | 7848 |
| 1221 | Ga0395901_0075498 | 3300038443 | Bacteria | 3516 |
| 1222 | Ga0395901_0161651 | 3300038443 | Bacteria | 2352 |
| 1223 | Ga0395901_0188810 | 3300038443 | Bacteria | 2161 |
| 1224 | Ga0395901_0390296 | 3300038443 | Bacteria | 1431 |
| 1225 | Ga0400485_11815 | 3300038735 | Bacteria | 1777 |
| 1226 | Ga0400483_032686 | 3300039062 | Bacteria | 4131 |
| 1227 | Ga0400483_140078 | 3300039062 | Bacteria | 2956 |
| 1228 | Ga0400483_173548 | 3300039062 | Bacteria | 3143 |
| 1229 | Ga0400483_203337 | 3300039062 | Bacteria | 3958 |
| 1230 | Ga0400483_277787 | 3300039062 | Bacteria | 33179 |
| 1231 | Ga0400487_06748 | 3300039110 | Bacteria | 2782 |
| 1232 | Ga0436365_0120856 | 3300039437 | Bacteria | 4697 |
| 1233 | Ga0436365_0298223 | 3300039437 | Bacteria | 74249 |
| 1234 | Ga0436365_0364034 | 3300039437 | Bacteria | 67701 |
| 1235 | Ga0436365_0422279 | 3300039437 | Bacteria | 1047 |
| 1236 | Ga0436365_0439594 | 3300039437 | Bacteria | 58263 |
| 1237 | Ga0436365_0458221 | 3300039437 | Bacteria | 1009 |
| 1238 | Ga0436365_0486465 | 3300039437 | Bacteria | 4086 |
| 1239 | Ga0436365_0588205 | 3300039437 | Bacteria | 2792 |
| 1240 | Ga0436365_0653853 | 3300039437 | Bacteria | 26654 |
| 1241 | Ga0436365_0994541 | 3300039437 | Bacteria | 5371 |
| 1242 | Ga0436365_1478328 | 3300039437 | Bacteria | 5118 |
| 1243 | Ga0436365_1638122 | 3300039437 | Bacteria | 3854 |
| 1244 | Ga0436360_0305107 | 3300039438 | Bacteria | 1584 |
| 1245 | Ga0436360_0670466 | 3300039438 | Bacteria | 1371 |
| 1246 | Ga0436360_0771010 | 3300039438 | Bacteria | 2211 |
| 1247 | Ga0436360_0787345 | 3300039438 | Bacteria | 1186 |
| 1248 | Ga0436360_0808839 | 3300039438 | Bacteria | 4547 |
| 1249 | Ga0436360_1157040 | 3300039438 | Bacteria | 1085 |
| 1250 | Ga0436361_0077926 | 3300039447 | Bacteria | 1883 |
| 1251 | Ga0436361_0382143 | 3300039447 | Bacteria | 1996 |
| 1252 | Ga0436361_0455600 | 3300039447 | Bacteria | 2616 |
| 1253 | Ga0436361_0458313 | 3300039447 | Bacteria | 2027 |
| 1254 | Ga0436361_0468973 | 3300039447 | Bacteria | 5347 |
| 1255 | Ga0436361_0553807 | 3300039447 | Bacteria | 20297 |
| 1256 | Ga0436361_0623924 | 3300039447 | Bacteria | 2902 |
| 1257 | Ga0436361_0643175 | 3300039447 | Bacteria | 6771 |
| 1258 | Ga0436361_0714426 | 3300039447 | Bacteria | 2008 |
| 1259 | Ga0436363_0221619 | 3300039450 | Bacteria | 5095 |
| 1260 | Ga0436363_0261799 | 3300039450 | Bacteria | 3335 |
| 1261 | Ga0436363_0407094 | 3300039450 | Bacteria | 1169 |
| 1262 | Ga0436363_0434034 | 3300039450 | Bacteria | 20695 |
| 1263 | Ga0436363_0908068 | 3300039450 | Bacteria | 1667 |
| 1264 | Ga0436363_1083955 | 3300039450 | Bacteria | 1195 |
| 1265 | Ga0436363_1184338 | 3300039450 | Bacteria | 22162 |
| 1266 | Ga0436363_1589623 | 3300039450 | Bacteria | 18680 |
| 1267 | Ga0436363_1639159 | 3300039450 | Bacteria | 3358 |
| 1268 | Ga0436362_0132298 | 3300039453 | Bacteria | 2223 |
| 1269 | Ga0436362_0706265 | 3300039453 | Bacteria | 1206 |
| 1270 | Ga0436362_1295071 | 3300039453 | Bacteria | 3317 |
| 1271 | Ga0439431_0043840 | 3300041997 | Bacteria | 1146 |
| 1272 | Ga0439441_027275 | 3300042001 | Bacteria | 1089 |
| 1273 | Ga0439458_0036343 | 3300042157 | Bacteria | 1186 |
| 1274 | Ga0439435_0037066 | 3300042436 | Bacteria | 1350 |
| 1275 | Ga0439459_0036595 | 3300042438 | Bacteria | 1025 |
| 1276 | Ga0450916_006125 | 3300042530 | Bacteria | 1408 |
| 1277 | Ga0450901_003488 | 3300042533 | Bacteria | 1639 |
| 1278 | Ga0451577_0022138 | 3300042876 | Bacteria | 5805 |
| 1279 | Ga0451577_0420130 | 3300042876 | Bacteria | 1214 |
| 1280 | Ga0466969_0000722 | 3300044656 | Bacteria | 17863 |
| 1281 | Ga0466966_0050018 | 3300044684 | Bacteria | 2660 |
| 1282 | Ga0466961_0001425 | 3300044693 | Bacteria | 14831 |
| 1283 | Ga0466963_0057966 | 3300044694 | Bacteria | 2581 |
| 1284 | Ga0466963_0062811 | 3300044694 | Bacteria | 2485 |
| 1285 | Ga0453684_0043324 | 3300044712 | Bacteria | 6050 |
| 1286 | Ga0466971_0009671 | 3300044719 | Bacteria | 4207 |
| 1287 | Ga0466970_0009156 | 3300044765 | Bacteria | 4995 |
| 1288 | Ga0466957_0031207 | 3300044842 | Bacteria | 3183 |
| 1289 | Ga0466960_0035913 | 3300044901 | Bacteria | 2319 |
| 1290 | Ga0466959_0000040 | 3300045049 | Bacteria | 101109 |
| 1291 | Ga0466959_0153490 | 3300045049 | Bacteria | 1622 |
| 1292 | Ga0451576_0000537 | 3300045051 | Bacteria | 81691 |
| 1293 | Ga0451576_0005502 | 3300045051 | Bacteria | 15834 |
| 1294 | Ga0451576_0047456 | 3300045051 | Bacteria | 4515 |
| 1295 | Ga0451576_0408413 | 3300045051 | Bacteria | 1424 |
| 1296 | Ga0466958_0026837 | 3300045836 | Bacteria | 3404 |
| 1297 | Ga0466967_0041270 | 3300045976 | Bacteria | 3977 |
| 1298 | Ga0466967_0127232 | 3300045976 | Bacteria | 2361 |
| 1299 | Ga0466967_0270461 | 3300045976 | Bacteria | 1628 |
| 1300 | Ga0495627_004351 | 3300046453 | Bacteria | 5946 |
| 1301 | Ga0495592_0017429 | 3300046454 | Bacteria | 5457 |
| 1302 | Ga0495603_0001208 | 3300046455 | Bacteria | 15085 |
| 1303 | Ga0495603_0044314 | 3300046455 | Bacteria | 2655 |
| 1304 | Ga0495590_0000622 | 3300046457 | Bacteria | 16501 |
| 1305 | Ga0495629_0018635 | 3300046459 | Bacteria | 4962 |
| 1306 | Ga0495629_0046189 | 3300046459 | Bacteria | 3054 |
| 1307 | Ga0495638_0000147 | 3300046460 | Bacteria | 110817 |
| 1308 | Ga0495638_0004669 | 3300046460 | Bacteria | 10359 |
| 1309 | Ga0495638_0005127 | 3300046460 | Bacteria | 9811 |
| 1310 | Ga0495638_0016403 | 3300046460 | Bacteria | 4962 |
| 1311 | Ga0495638_0082840 | 3300046460 | Bacteria | 1944 |
| 1312 | Ga0495641_0013557 | 3300046461 | Bacteria | 4468 |
| 1313 | Ga0495651_0046441 | 3300046462 | Bacteria | 3361 |
| 1314 | Ga0495651_0220274 | 3300046462 | Bacteria | 1314 |
| 1315 | Ga0495651_0307631 | 3300046462 | Bacteria | 1061 |
| 1316 | Ga0495650_0000045 | 3300046471 | Bacteria | 346204 |
| 1317 | Ga0495580_0000261 | 3300046472 | Bacteria | 42129 |
| 1318 | Ga0495582_0002712 | 3300046473 | Bacteria | 9886 |
| 1319 | Ga0495582_0294715 | 3300046473 | Bacteria | 932 |
| 1320 | Ga0495639_0011317 | 3300046475 | Bacteria | 3845 |
| 1321 | Ga0495664_0030612 | 3300046477 | Bacteria | 3153 |
| 1322 | Ga0495664_0116888 | 3300046477 | Bacteria | 1612 |
| 1323 | Ga0495664_0213607 | 3300046477 | Bacteria | 1168 |
| 1324 | Ga0495594_0001016 | 3300046499 | Bacteria | 14638 |
| 1325 | Ga0495594_0073681 | 3300046499 | Bacteria | 1901 |
| 1326 | Ga0495607_0192119 | 3300046501 | Bacteria | 1016 |
| 1327 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 1328 | Ga0495583_0048378 | 3300046506 | Bacteria | 1952 |
| 1329 | Ga0495606_0004052 | 3300046507 | Bacteria | 14934 |
| 1330 | Ga0495606_0117612 | 3300046507 | Bacteria | 1595 |
| 1331 | Ga0495608_0037550 | 3300046511 | Bacteria | 3257 |
| 1332 | Ga0495610_0000101 | 3300046512 | Bacteria | 99012 |
| 1333 | Ga0495616_0000905 | 3300046513 | Bacteria | 21388 |
| 1334 | Ga0495620_0088411 | 3300046515 | Bacteria | 1245 |
| 1335 | Ga0495628_0053545 | 3300046516 | Bacteria | 3184 |
| 1336 | Ga0495630_0196782 | 3300046517 | Bacteria | 1538 |
| 1337 | Ga0495631_0002661 | 3300046518 | Bacteria | 9960 |
| 1338 | Ga0495637_0007923 | 3300046520 | Bacteria | 5234 |
| 1339 | Ga0495637_0053066 | 3300046520 | Bacteria | 1689 |
| 1340 | Ga0495648_0000575 | 3300046524 | Bacteria | 39312 |
| 1341 | Ga0495642_0001834 | 3300046528 | Bacteria | 9098 |
| 1342 | Ga0495652_0058906 | 3300046529 | Bacteria | 3251 |
| 1343 | Ga0495652_0129079 | 3300046529 | Bacteria | 2004 |
| 1344 | Ga0495652_0167787 | 3300046529 | Bacteria | 1697 |
| 1345 | Ga0495652_0172039 | 3300046529 | Bacteria | 1671 |
| 1346 | Ga0495654_0000018 | 3300046530 | Bacteria | 293124 |
| 1347 | Ga0495665_0005634 | 3300046531 | Bacteria | 6753 |
| 1348 | Ga0495640_0122730 | 3300046533 | Bacteria | 1687 |
| 1349 | Ga0495640_0165127 | 3300046533 | Bacteria | 1417 |
| 1350 | Ga0495640_0187228 | 3300046533 | Bacteria | 1317 |
| 1351 | Ga0495586_0148968 | 3300046535 | Bacteria | 1316 |
| 1352 | Ga0495609_0035053 | 3300046538 | Bacteria | 2273 |
| 1353 | Ga0495597_0012047 | 3300046542 | Bacteria | 4179 |
| 1354 | Ga0495645_0001337 | 3300046543 | Bacteria | 16682 |
| 1355 | Ga0495645_0102392 | 3300046543 | Bacteria | 2035 |
| 1356 | Ga0495622_0003259 | 3300046557 | Bacteria | 7679 |
| 1357 | Ga0495622_0024063 | 3300046557 | Bacteria | 2842 |
| 1358 | Ga0495633_0000314 | 3300046558 | Bacteria | 55070 |
| 1359 | Ga0495633_0086677 | 3300046558 | Bacteria | 1456 |
| 1360 | Ga0495667_0006560 | 3300046559 | Bacteria | 7897 |
| 1361 | Ga0495668_0000061 | 3300046616 | Bacteria | 192499 |
| 1362 | Ga0495668_0005125 | 3300046616 | Bacteria | 9010 |
| 1363 | Ga0495668_0007234 | 3300046616 | Bacteria | 7123 |
| 1364 | Ga0495668_0016736 | 3300046616 | Bacteria | 4262 |
| 1365 | Ga0495668_0044770 | 3300046616 | Bacteria | 2459 |
| 1366 | Ga0495668_0063383 | 3300046616 | Bacteria | 2036 |
| 1367 | Ga0495668_0096547 | 3300046616 | Bacteria | 1617 |
| 1368 | Ga0495668_0188062 | 3300046616 | Bacteria | 1131 |
| 1369 | Ga0495634_0009907 | 3300046642 | Bacteria | 7005 |
| 1370 | Ga0495611_0116876 | 3300046648 | Bacteria | 1243 |
| 1371 | Ga0495625_0004160 | 3300046660 | Bacteria | 13789 |
| 1372 | Ga0495625_0005790 | 3300046660 | Bacteria | 11163 |
| 1373 | Ga0495625_0006681 | 3300046660 | Bacteria | 10232 |
| 1374 | Ga0495625_0009050 | 3300046660 | Bacteria | 8404 |
| 1375 | Ga0495625_0024749 | 3300046660 | Bacteria | 4562 |
| 1376 | Ga0495635_0027669 | 3300046663 | Bacteria | 3943 |
| 1377 | Ga0495635_0065013 | 3300046663 | Bacteria | 2503 |
| 1378 | Ga0495635_0118428 | 3300046663 | Bacteria | 1807 |
| 1379 | Ga0495635_0189477 | 3300046663 | Bacteria | 1397 |
| 1380 | Ga0495635_0249315 | 3300046663 | Bacteria | 1197 |
| 1381 | Ga0495588_0013850 | 3300046674 | Bacteria | 3849 |
| 1382 | Ga0495647_0007552 | 3300046681 | Bacteria | 3647 |
| 1383 | Ga0495658_0004453 | 3300046683 | Bacteria | 6896 |
| 1384 | Ga0495658_0030155 | 3300046683 | Bacteria | 2943 |
| 1385 | Ga0495658_0103244 | 3300046683 | Bacteria | 1705 |
| 1386 | Ga0495658_0116266 | 3300046683 | Bacteria | 1613 |
| 1387 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 1388 | Ga0495669_0000369 | 3300046684 | Bacteria | 22928 |
| 1389 | Ga0495613_0000707 | 3300046689 | Bacteria | 26213 |
| 1390 | Ga0495613_0003535 | 3300046689 | Bacteria | 11714 |
| 1391 | Ga0495649_0000627 | 3300046694 | Bacteria | 29078 |
| 1392 | Ga0495589_0130981 | 3300046794 | Bacteria | 1204 |
| 1393 | Ga0495660_0004741 | 3300046810 | Bacteria | 8211 |
| 1394 | Ga0495581_0000368 | 3300047315 | Bacteria | 22619 |
| 1395 | Ga0495581_0021429 | 3300047315 | Bacteria | 3747 |
| 1396 | Ga0495604_0137403 | 3300047317 | Bacteria | 1750 |
| 1397 | Ga0495604_0202824 | 3300047317 | Bacteria | 1375 |
| 1398 | Ga0495674_0126448 | 3300047319 | Bacteria | 2156 |
| 1399 | Ga0495672_0001490 | 3300047320 | Bacteria | 22961 |
| 1400 | Ga0495672_0007884 | 3300047320 | Bacteria | 7945 |
| 1401 | Ga0495683_0059907 | 3300047323 | Bacteria | 1888 |
| 1402 | Ga0495687_013678 | 3300047443 | Bacteria | 4218 |
| 1403 | Ga0495673_0000119 | 3300047469 | Bacteria | 145179 |
| 1404 | Ga0495673_0000264 | 3300047469 | Bacteria | 72931 |
| 1405 | Ga0495681_0124370 | 3300047470 | Bacteria | 1104 |
| 1406 | Ga0495684_0061528 | 3300047471 | Bacteria | 2856 |
| 1407 | Ga0495684_0100602 | 3300047471 | Bacteria | 2186 |
| 1408 | Ga0495684_0263219 | 3300047471 | Bacteria | 1250 |
| 1409 | Ga0495686_0000096 | 3300047472 | Bacteria | 184611 |
| 1410 | Ga0495686_0001221 | 3300047472 | Bacteria | 29433 |
| 1411 | Ga0495686_0003784 | 3300047472 | Bacteria | 12856 |
| 1412 | Ga0495686_0026999 | 3300047472 | Bacteria | 3752 |
| 1413 | Ga0495686_0027289 | 3300047472 | Bacteria | 3730 |
| 1414 | Ga0495686_0049096 | 3300047472 | Bacteria | 2656 |
| 1415 | Ga0495686_0112000 | 3300047472 | Bacteria | 1635 |
| 1416 | Ga0495593_0003713 | 3300047673 | Bacteria | 9117 |
| 1417 | Ga0495593_0188398 | 3300047673 | Bacteria | 1038 |
| 1418 | Ga0495602_0011229 | 3300048088 | Bacteria | 9262 |
| 1419 | Ga0495602_0362417 | 3300048088 | Bacteria | 1043 |
| 1420 | Ga0495614_0011074 | 3300048089 | Bacteria | 3968 |
| 1421 | Ga0496100_0000888 | 3300048903 | Bacteria | 14273 |
| 1422 | Ga0496100_0016389 | 3300048903 | Bacteria | 4351 |
| 1423 | Ga0496100_0214973 | 3300048903 | Bacteria | 1408 |
| 1424 | Ga0496101_0005049 | 3300048904 | Bacteria | 8391 |
| 1425 | Ga0496101_0025576 | 3300048904 | Bacteria | 4097 |
| 1426 | Ga0496101_0086661 | 3300048904 | Bacteria | 2323 |
| 1427 | Ga0496101_0159197 | 3300048904 | Bacteria | 1731 |
| 1428 | Ga0496102_0014500 | 3300048905 | Bacteria | 6847 |
| 1429 | Ga0496102_0044401 | 3300048905 | Bacteria | 4033 |
| 1430 | Ga0496102_0045269 | 3300048905 | Bacteria | 3995 |
| 1431 | Ga0496102_0057144 | 3300048905 | Bacteria | 3561 |
| 1432 | Ga0496102_0129891 | 3300048905 | Bacteria | 2357 |
| 1433 | Ga0496102_0358026 | 3300048905 | Bacteria | 1374 |
| 1434 | Ga0496103_0051190 | 3300048906 | Bacteria | 2556 |
| 1435 | Ga0496104_0000175 | 3300048907 | Bacteria | 56916 |
| 1436 | Ga0496104_0007205 | 3300048907 | Bacteria | 9808 |
| 1437 | Ga0496104_0032624 | 3300048907 | Bacteria | 4848 |
| 1438 | Ga0496104_0045404 | 3300048907 | Bacteria | 4132 |
| 1439 | Ga0496104_0076235 | 3300048907 | Bacteria | 3194 |
| 1440 | Ga0496104_0128702 | 3300048907 | Bacteria | 2432 |
| 1441 | Ga0496104_0198346 | 3300048907 | Bacteria | 1919 |
| 1442 | Ga0496104_0294277 | 3300048907 | Bacteria | 1536 |
| 1443 | Ga0496105_0010602 | 3300048908 | Bacteria | 7251 |
| 1444 | Ga0496105_0014060 | 3300048908 | Bacteria | 6369 |
| 1445 | Ga0496105_0016830 | 3300048908 | Bacteria | 5846 |
| 1446 | Ga0496105_0048042 | 3300048908 | Bacteria | 3523 |
| 1447 | Ga0496105_0324425 | 3300048908 | Bacteria | 1233 |
| 1448 | Ga0496106_0007110 | 3300048909 | Bacteria | 8272 |
| 1449 | Ga0496106_0007877 | 3300048909 | Bacteria | 7875 |
| 1450 | Ga0496106_0012041 | 3300048909 | Bacteria | 6383 |
| 1451 | Ga0496106_0020304 | 3300048909 | Bacteria | 4930 |
| 1452 | Ga0496106_0159017 | 3300048909 | Bacteria | 1786 |
| 1453 | Ga0496107_0001574 | 3300048910 | Bacteria | 14192 |
| 1454 | Ga0496107_0006517 | 3300048910 | Bacteria | 8029 |
| 1455 | Ga0496107_0022536 | 3300048910 | Bacteria | 4450 |
| 1456 | Ga0496107_0097844 | 3300048910 | Bacteria | 2149 |
| 1457 | Ga0496107_0341440 | 3300048910 | Bacteria | 1114 |
| 1458 | Ga0496107_0500874 | 3300048910 | Bacteria | 901 |
| 1459 | Ga0496108_0006491 | 3300048911 | Bacteria | 9488 |
| 1460 | Ga0496108_0016024 | 3300048911 | Bacteria | 6111 |
| 1461 | Ga0496108_0047229 | 3300048911 | Bacteria | 3599 |
| 1462 | Ga0496108_0064110 | 3300048911 | Bacteria | 3095 |
| 1463 | Ga0496108_0513180 | 3300048911 | Bacteria | 1047 |
| 1464 | Ga0496109_0003143 | 3300048912 | Bacteria | 13775 |
| 1465 | Ga0496109_0028937 | 3300048912 | Bacteria | 4960 |
| 1466 | Ga0496109_0041855 | 3300048912 | Bacteria | 4150 |
| 1467 | Ga0496109_0200967 | 3300048912 | Bacteria | 1873 |
| 1468 | Ga0496109_0297055 | 3300048912 | Bacteria | 1523 |
| 1469 | Ga0496110_0000549 | 3300048913 | Bacteria | 25571 |
| 1470 | Ga0496110_0007751 | 3300048913 | Bacteria | 8596 |
| 1471 | Ga0496110_0082000 | 3300048913 | Bacteria | 2876 |
| 1472 | Ga0496110_0162415 | 3300048913 | Bacteria | 2025 |
| 1473 | Ga0496110_0203572 | 3300048913 | Bacteria | 1798 |
| 1474 | Ga0496111_0006678 | 3300048914 | Bacteria | 7505 |
| 1475 | Ga0496111_0025793 | 3300048914 | Bacteria | 4147 |
| 1476 | Ga0496111_0138676 | 3300048914 | Bacteria | 1802 |
| 1477 | Ga0496111_0328516 | 3300048914 | Bacteria | 1132 |
| 1478 | Ga0496111_0415729 | 3300048914 | Bacteria | 993 |
| 1479 | Ga0496112_0010229 | 3300048915 | Bacteria | 8504 |
| 1480 | Ga0496112_0015256 | 3300048915 | Bacteria | 7163 |
| 1481 | Ga0496112_0037705 | 3300048915 | Bacteria | 4718 |
| 1482 | Ga0496112_0041350 | 3300048915 | Bacteria | 4510 |
| 1483 | Ga0496112_0045837 | 3300048915 | Bacteria | 4286 |
| 1484 | Ga0496112_0079257 | 3300048915 | Bacteria | 3249 |
| 1485 | Ga0496112_0108721 | 3300048915 | Bacteria | 2743 |
| 1486 | Ga0496112_0396084 | 3300048915 | Bacteria | 1321 |
| 1487 | Ga0496113_0004354 | 3300048916 | Bacteria | 8680 |
| 1488 | Ga0496113_0029421 | 3300048916 | Bacteria | 3966 |
| 1489 | Ga0496113_0048824 | 3300048916 | Bacteria | 3150 |
| 1490 | Ga0496113_0282940 | 3300048916 | Bacteria | 1326 |
| 1491 | Ga0496114_0000794 | 3300048917 | Bacteria | 23623 |
| 1492 | Ga0496114_0007626 | 3300048917 | Bacteria | 8558 |
| 1493 | Ga0496114_0420852 | 3300048917 | Bacteria | 1183 |
| 1494 | Ga0496115_0000050 | 3300048918 | Bacteria | 109402 |
| 1495 | Ga0496115_0000862 | 3300048918 | Bacteria | 22030 |
| 1496 | Ga0496115_0008977 | 3300048918 | Bacteria | 7411 |
| 1497 | Ga0496115_0010603 | 3300048918 | Bacteria | 6892 |
| 1498 | Ga0496115_0010863 | 3300048918 | Bacteria | 6814 |
| 1499 | Ga0496115_0033370 | 3300048918 | Bacteria | 4064 |
| 1500 | Ga0496115_0266317 | 3300048918 | Bacteria | 1409 |
| 1501 | Ga0496115_0368245 | 3300048918 | Bacteria | 1170 |
| 1502 | Ga0496118_0012536 | 3300048921 | Bacteria | 8124 |
| 1503 | Ga0496119_0031855 | 3300048922 | Bacteria | 3525 |
| 1504 | Ga0496121_0000397 | 3300048924 | Bacteria | 87422 |
| 1505 | Ga0496121_0001859 | 3300048924 | Bacteria | 33884 |
| 1506 | Ga0496121_0004198 | 3300048924 | Bacteria | 19675 |
| 1507 | Ga0496121_0115248 | 3300048924 | Bacteria | 2041 |
| 1508 | Ga0496121_0228241 | 3300048924 | Bacteria | 1306 |
| 1509 | Ga0496122_0251081 | 3300048925 | Bacteria | 989 |
| 1510 | Ga0496123_0001218 | 3300048926 | Bacteria | 37586 |
| 1511 | Ga0496124_0018292 | 3300048927 | Bacteria | 6566 |
| 1512 | Ga0496126_0002022 | 3300048929 | Bacteria | 28683 |
| 1513 | Ga0495678_001567 | 3300049459 | Bacteria | 17566 |
| 1514 | Ga0495682_0001979 | 3300049460 | Bacteria | 10130 |
| 1515 | Ga0495682_0009967 | 3300049460 | Bacteria | 3696 |
| 1516 | Ga0501031_0020902 | 3300049568 | Bacteria | 4268 |
| 1517 | Ga0501031_0050146 | 3300049568 | Bacteria | 2720 |
| 1518 | Ga0501031_0063777 | 3300049568 | Bacteria | 2400 |
| 1519 | Ga0501031_0103794 | 3300049568 | Bacteria | 1855 |
| 1520 | Ga0501031_0161821 | 3300049568 | Bacteria | 1463 |
| 1521 | Ga0501032_0000393 | 3300049569 | Bacteria | 36019 |
| 1522 | Ga0501032_0001085 | 3300049569 | Bacteria | 21700 |
| 1523 | Ga0501032_0009467 | 3300049569 | Bacteria | 7062 |
| 1524 | Ga0501032_0099046 | 3300049569 | Bacteria | 1931 |
| 1525 | Ga0501033_0003745 | 3300049570 | Bacteria | 12362 |
| 1526 | Ga0501033_0021039 | 3300049570 | Bacteria | 4924 |
| 1527 | Ga0501033_0069486 | 3300049570 | Bacteria | 2588 |
| 1528 | Ga0501033_0100456 | 3300049570 | Bacteria | 2111 |
| 1529 | Ga0501033_0116310 | 3300049570 | Bacteria | 1943 |
| 1530 | Ga0501033_0213882 | 3300049570 | Bacteria | 1374 |
| 1531 | Ga0501033_0350485 | 3300049570 | Bacteria | 1034 |
| 1532 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 1533 | Ga0501034_0000293 | 3300049571 | Bacteria | 88978 |
| 1534 | Ga0501034_0002384 | 3300049571 | Bacteria | 22822 |
| 1535 | Ga0501034_0009371 | 3300049571 | Bacteria | 10258 |
| 1536 | Ga0501034_0022687 | 3300049571 | Bacteria | 6394 |
| 1537 | Ga0501034_0024173 | 3300049571 | Bacteria | 6180 |
| 1538 | Ga0501034_0036607 | 3300049571 | Bacteria | 4970 |
| 1539 | Ga0501034_0036636 | 3300049571 | Bacteria | 4967 |
| 1540 | Ga0501034_0042735 | 3300049571 | Bacteria | 4588 |
| 1541 | Ga0501034_0061556 | 3300049571 | Bacteria | 3769 |
| 1542 | Ga0501034_0065142 | 3300049571 | Bacteria | 3656 |
| 1543 | Ga0501034_0077613 | 3300049571 | Bacteria | 3327 |
| 1544 | Ga0501034_0188727 | 3300049571 | Bacteria | 2024 |
| 1545 | Ga0501034_0350030 | 3300049571 | Bacteria | 1406 |
| 1546 | Ga0501034_0373545 | 3300049571 | Bacteria | 1352 |
| 1547 | Ga0501034_0524502 | 3300049571 | Bacteria | 1096 |
| 1548 | Ga0501034_0599294 | 3300049571 | Bacteria | 1007 |
| 1549 | Ga0501036_0000573 | 3300049572 | Bacteria | 26478 |
| 1550 | Ga0501036_0019277 | 3300049572 | Bacteria | 5725 |
| 1551 | Ga0501036_0056835 | 3300049572 | Bacteria | 3315 |
| 1552 | Ga0501036_0059651 | 3300049572 | Bacteria | 3233 |
| 1553 | Ga0501036_0089297 | 3300049572 | Bacteria | 2604 |
| 1554 | Ga0501036_0092941 | 3300049572 | Bacteria | 2549 |
| 1555 | Ga0501036_0166261 | 3300049572 | Bacteria | 1859 |
| 1556 | Ga0501036_0223847 | 3300049572 | Bacteria | 1579 |
| 1557 | Ga0501037_0001135 | 3300049573 | Bacteria | 19731 |
| 1558 | Ga0501037_0019417 | 3300049573 | Bacteria | 5013 |
| 1559 | Ga0501037_0042986 | 3300049573 | Bacteria | 3321 |
| 1560 | Ga0501037_0133980 | 3300049573 | Bacteria | 1775 |
| 1561 | Ga0501037_0287301 | 3300049573 | Bacteria | 1145 |
| 1562 | Ga0501038_0020349 | 3300049574 | Bacteria | 5966 |
| 1563 | Ga0501038_0033540 | 3300049574 | Bacteria | 4522 |
| 1564 | Ga0501038_0074234 | 3300049574 | Bacteria | 2878 |
| 1565 | Ga0501038_0285909 | 3300049574 | Bacteria | 1297 |
| 1566 | Ga0501039_0000452 | 3300049575 | Bacteria | 29793 |
| 1567 | Ga0501039_0034178 | 3300049575 | Bacteria | 3923 |
| 1568 | Ga0501039_0079424 | 3300049575 | Bacteria | 2552 |
| 1569 | Ga0501039_0090104 | 3300049575 | Bacteria | 2390 |
| 1570 | Ga0501039_0178252 | 3300049575 | Bacteria | 1671 |
| 1571 | Ga0501039_0359488 | 3300049575 | Bacteria | 1144 |
| 1572 | Ga0501040_0000753 | 3300049576 | Bacteria | 20096 |
| 1573 | Ga0501040_0004689 | 3300049576 | Bacteria | 8870 |
| 1574 | Ga0501040_0025592 | 3300049576 | Bacteria | 3968 |
| 1575 | Ga0501040_0042041 | 3300049576 | Bacteria | 3113 |
| 1576 | Ga0501040_0132240 | 3300049576 | Bacteria | 1755 |
| 1577 | Ga0501040_0296136 | 3300049576 | Bacteria | 1156 |
| 1578 | Ga0501041_0015930 | 3300049577 | Bacteria | 4467 |
| 1579 | Ga0501041_0019141 | 3300049577 | Bacteria | 4084 |
| 1580 | Ga0501041_0164405 | 3300049577 | Bacteria | 1388 |
| 1581 | Ga0501042_0014718 | 3300049578 | Bacteria | 5341 |
| 1582 | Ga0501042_0085769 | 3300049578 | Bacteria | 2258 |
| 1583 | Ga0501042_0117858 | 3300049578 | Bacteria | 1911 |
| 1584 | Ga0501042_0218263 | 3300049578 | Bacteria | 1375 |
| 1585 | Ga0501042_0258461 | 3300049578 | Bacteria | 1257 |
| 1586 | Ga0501043_0009819 | 3300049579 | Bacteria | 7503 |
| 1587 | Ga0501043_0014748 | 3300049579 | Bacteria | 6118 |
| 1588 | Ga0501043_0033540 | 3300049579 | Bacteria | 4040 |
| 1589 | Ga0501043_0060434 | 3300049579 | Bacteria | 2975 |
| 1590 | Ga0501043_0077234 | 3300049579 | Bacteria | 2616 |
| 1591 | Ga0501043_0078731 | 3300049579 | Bacteria | 2590 |
| 1592 | Ga0501043_0115030 | 3300049579 | Bacteria | 2111 |
| 1593 | Ga0501043_0116875 | 3300049579 | Bacteria | 2093 |
| 1594 | Ga0501043_0257498 | 3300049579 | Bacteria | 1343 |
| 1595 | Ga0501043_0339544 | 3300049579 | Bacteria | 1143 |
| 1596 | Ga0501046_0000224 | 3300049580 | Bacteria | 58986 |
| 1597 | Ga0501046_0001372 | 3300049580 | Bacteria | 23445 |
| 1598 | Ga0501046_0003178 | 3300049580 | Bacteria | 15162 |
| 1599 | Ga0501046_0014585 | 3300049580 | Bacteria | 6622 |
| 1600 | Ga0501046_0034673 | 3300049580 | Bacteria | 4071 |
| 1601 | Ga0501046_0040933 | 3300049580 | Bacteria | 3700 |
| 1602 | Ga0501046_0073657 | 3300049580 | Bacteria | 2650 |
| 1603 | Ga0501046_0203757 | 3300049580 | Bacteria | 1471 |
| 1604 | Ga0501047_0000283 | 3300049581 | Bacteria | 58613 |
| 1605 | Ga0501047_0000643 | 3300049581 | Bacteria | 36707 |
| 1606 | Ga0501047_0002385 | 3300049581 | Bacteria | 17961 |
| 1607 | Ga0501047_0012475 | 3300049581 | Bacteria | 8048 |
| 1608 | Ga0501047_0017227 | 3300049581 | Bacteria | 6917 |
| 1609 | Ga0501047_0026443 | 3300049581 | Bacteria | 5583 |
| 1610 | Ga0501047_0026914 | 3300049581 | Bacteria | 5537 |
| 1611 | Ga0501047_0029202 | 3300049581 | Bacteria | 5318 |
| 1612 | Ga0501047_0041630 | 3300049581 | Bacteria | 4439 |
| 1613 | Ga0501047_0068585 | 3300049581 | Bacteria | 3415 |
| 1614 | Ga0501047_0073181 | 3300049581 | Bacteria | 3299 |
| 1615 | Ga0501047_0372289 | 3300049581 | Bacteria | 1263 |
| 1616 | Ga0501048_0000649 | 3300049582 | Bacteria | 25020 |
| 1617 | Ga0501048_0017618 | 3300049582 | Bacteria | 5259 |
| 1618 | Ga0501048_0126057 | 3300049582 | Bacteria | 1810 |
| 1619 | Ga0501048_0139986 | 3300049582 | Bacteria | 1711 |
| 1620 | Ga0501048_0143658 | 3300049582 | Bacteria | 1687 |
| 1621 | Ga0501067_0000034 | 3300049583 | Bacteria | 84068 |
| 1622 | Ga0501067_0001137 | 3300049583 | Bacteria | 14411 |
| 1623 | Ga0501067_0001833 | 3300049583 | Bacteria | 11681 |
| 1624 | Ga0501067_0007840 | 3300049583 | Bacteria | 5936 |
| 1625 | Ga0501067_0010141 | 3300049583 | Bacteria | 5210 |
| 1626 | Ga0501068_0027576 | 3300049584 | Bacteria | 3354 |
| 1627 | Ga0501068_0078899 | 3300049584 | Bacteria | 2018 |
| 1628 | Ga0501068_0174240 | 3300049584 | Bacteria | 1359 |
| 1629 | Ga0501068_0180178 | 3300049584 | Bacteria | 1336 |
| 1630 | Ga0501069_0005268 | 3300049585 | Bacteria | 6718 |
| 1631 | Ga0501069_0017674 | 3300049585 | Bacteria | 3843 |
| 1632 | Ga0501069_0020008 | 3300049585 | Bacteria | 3623 |
| 1633 | Ga0501069_0031051 | 3300049585 | Bacteria | 2936 |
| 1634 | Ga0501070_0006852 | 3300049586 | Bacteria | 9696 |
| 1635 | Ga0501070_0013555 | 3300049586 | Bacteria | 6871 |
| 1636 | Ga0501070_0042188 | 3300049586 | Bacteria | 3800 |
| 1637 | Ga0501070_0052496 | 3300049586 | Bacteria | 3384 |
| 1638 | Ga0501070_0185107 | 3300049586 | Bacteria | 1713 |
| 1639 | Ga0501071_0022728 | 3300049587 | Bacteria | 4373 |
| 1640 | Ga0501071_0086866 | 3300049587 | Bacteria | 2294 |
| 1641 | Ga0501071_0111696 | 3300049587 | Bacteria | 2020 |
| 1642 | Ga0501071_0142669 | 3300049587 | Bacteria | 1784 |
| 1643 | Ga0501071_0220018 | 3300049587 | Bacteria | 1429 |
| 1644 | Ga0501071_0289678 | 3300049587 | Bacteria | 1240 |
| 1645 | Ga0501072_0017631 | 3300049588 | Bacteria | 5491 |
| 1646 | Ga0501072_0026088 | 3300049588 | Bacteria | 4553 |
| 1647 | Ga0501072_0032705 | 3300049588 | Bacteria | 4073 |
| 1648 | Ga0501072_0041455 | 3300049588 | Bacteria | 3616 |
| 1649 | Ga0501072_0041762 | 3300049588 | Bacteria | 3602 |
| 1650 | Ga0501072_0069545 | 3300049588 | Bacteria | 2780 |
| 1651 | Ga0501072_0088646 | 3300049588 | Bacteria | 2455 |
| 1652 | Ga0501072_0109945 | 3300049588 | Bacteria | 2194 |
| 1653 | Ga0501072_0114876 | 3300049588 | Bacteria | 2143 |
| 1654 | Ga0501072_0173038 | 3300049588 | Bacteria | 1723 |
| 1655 | Ga0501072_0262635 | 3300049588 | Bacteria | 1374 |
| 1656 | Ga0501072_0377622 | 3300049588 | Bacteria | 1125 |
| 1657 | Ga0501073_0000013 | 3300049589 | Bacteria | 160591 |
| 1658 | Ga0501073_0001616 | 3300049589 | Bacteria | 16696 |
| 1659 | Ga0501073_0013717 | 3300049589 | Bacteria | 5894 |
| 1660 | Ga0501073_0022747 | 3300049589 | Bacteria | 4510 |
| 1661 | Ga0501073_0066687 | 3300049589 | Bacteria | 2509 |
| 1662 | Ga0501073_0146604 | 3300049589 | Bacteria | 1636 |
| 1663 | Ga0501073_0149174 | 3300049589 | Bacteria | 1620 |
| 1664 | Ga0501073_0244677 | 3300049589 | Bacteria | 1238 |
| 1665 | Ga0501073_0282778 | 3300049589 | Bacteria | 1145 |
| 1666 | Ga0501074_0022336 | 3300049590 | Bacteria | 4596 |
| 1667 | Ga0501074_0069593 | 3300049590 | Bacteria | 2530 |
| 1668 | Ga0501074_0141173 | 3300049590 | Bacteria | 1723 |
| 1669 | Ga0501074_0219711 | 3300049590 | Bacteria | 1353 |
| 1670 | Ga0501074_0264619 | 3300049590 | Bacteria | 1222 |
| 1671 | Ga0501074_0312973 | 3300049590 | Bacteria | 1115 |
| 1672 | Ga0501075_0001958 | 3300049591 | Bacteria | 13583 |
| 1673 | Ga0501075_0007759 | 3300049591 | Bacteria | 7447 |
| 1674 | Ga0501075_0035010 | 3300049591 | Bacteria | 3743 |
| 1675 | Ga0501075_0037459 | 3300049591 | Bacteria | 3624 |
| 1676 | Ga0501075_0071646 | 3300049591 | Bacteria | 2620 |
| 1677 | Ga0501075_0077203 | 3300049591 | Bacteria | 2520 |
| 1678 | Ga0501075_0180931 | 3300049591 | Bacteria | 1608 |
| 1679 | Ga0501076_0002771 | 3300049592 | Bacteria | 12131 |
| 1680 | Ga0501076_0076938 | 3300049592 | Bacteria | 2676 |
| 1681 | Ga0501076_0078153 | 3300049592 | Bacteria | 2655 |
| 1682 | Ga0501076_0103508 | 3300049592 | Bacteria | 2296 |
| 1683 | Ga0501076_0113893 | 3300049592 | Bacteria | 2188 |
| 1684 | Ga0501076_0343798 | 3300049592 | Bacteria | 1225 |
| 1685 | Ga0501076_0391467 | 3300049592 | Bacteria | 1142 |
| 1686 | Ga0501077_0000032 | 3300049593 | Bacteria | 69728 |
| 1687 | Ga0501077_0003508 | 3300049593 | Bacteria | 9414 |
| 1688 | Ga0501077_0048318 | 3300049593 | Bacteria | 2703 |
| 1689 | Ga0501077_0051285 | 3300049593 | Bacteria | 2622 |
| 1690 | Ga0501077_0057879 | 3300049593 | Bacteria | 2461 |
| 1691 | Ga0501077_0069657 | 3300049593 | Bacteria | 2229 |
| 1692 | Ga0501077_0072007 | 3300049593 | Bacteria | 2190 |
| 1693 | Ga0501077_0149333 | 3300049593 | Bacteria | 1483 |
| 1694 | Ga0501077_0201904 | 3300049593 | Bacteria | 1263 |
| 1695 | Ga0501077_0309142 | 3300049593 | Bacteria | 1007 |
| 1696 | Ga0501079_0001097 | 3300049741 | Bacteria | 18812 |
| 1697 | Ga0501079_0012147 | 3300049741 | Bacteria | 6575 |
| 1698 | Ga0501079_0075110 | 3300049741 | Bacteria | 2613 |
| 1699 | Ga0501079_0076925 | 3300049741 | Bacteria | 2581 |
| 1700 | Ga0501079_0077944 | 3300049741 | Bacteria | 2563 |
| 1701 | Ga0501079_0101057 | 3300049741 | Bacteria | 2236 |
| 1702 | Ga0501079_0140582 | 3300049741 | Bacteria | 1881 |
| 1703 | Ga0501079_0356933 | 3300049741 | Bacteria | 1145 |
| 1704 | Ga0501080_0000315 | 3300049742 | Bacteria | 37063 |
| 1705 | Ga0501080_0002921 | 3300049742 | Bacteria | 15015 |
| 1706 | Ga0501080_0004237 | 3300049742 | Bacteria | 12723 |
| 1707 | Ga0501080_0006226 | 3300049742 | Bacteria | 10708 |
| 1708 | Ga0501080_0024099 | 3300049742 | Bacteria | 5641 |
| 1709 | Ga0501080_0025399 | 3300049742 | Bacteria | 5497 |
| 1710 | Ga0501080_0070328 | 3300049742 | Bacteria | 3255 |
| 1711 | Ga0501080_0083070 | 3300049742 | Bacteria | 2976 |
| 1712 | Ga0501080_0122642 | 3300049742 | Bacteria | 2407 |
| 1713 | Ga0501080_0126788 | 3300049742 | Bacteria | 2364 |
| 1714 | Ga0501080_0182576 | 3300049742 | Bacteria | 1930 |
| 1715 | Ga0501080_0248969 | 3300049742 | Bacteria | 1620 |
| 1716 | Ga0501080_0250153 | 3300049742 | Bacteria | 1616 |
| 1717 | Ga0501080_0447353 | 3300049742 | Bacteria | 1158 |
| 1718 | Ga0501080_0511549 | 3300049742 | Bacteria | 1072 |
| 1719 | Ga0501081_0000197 | 3300049743 | Bacteria | 29348 |
| 1720 | Ga0501081_0004838 | 3300049743 | Bacteria | 8654 |
| 1721 | Ga0501081_0006179 | 3300049743 | Bacteria | 7757 |
| 1722 | Ga0501081_0014493 | 3300049743 | Bacteria | 5200 |
| 1723 | Ga0501081_0048475 | 3300049743 | Bacteria | 2923 |
| 1724 | Ga0501081_0068946 | 3300049743 | Bacteria | 2463 |
| 1725 | Ga0501081_0156971 | 3300049743 | Bacteria | 1637 |
| 1726 | Ga0501081_0256298 | 3300049743 | Bacteria | 1278 |
| 1727 | Ga0501083_0006676 | 3300049744 | Bacteria | 8186 |
| 1728 | Ga0501083_0010086 | 3300049744 | Bacteria | 6658 |
| 1729 | Ga0501083_0022332 | 3300049744 | Bacteria | 4392 |
| 1730 | Ga0501083_0083400 | 3300049744 | Bacteria | 2117 |
| 1731 | Ga0501083_0083409 | 3300049744 | Bacteria | 2117 |
| 1732 | Ga0501083_0101529 | 3300049744 | Bacteria | 1896 |
| 1733 | Ga0501083_0266516 | 3300049744 | Bacteria | 1114 |
| 1734 | Ga0501083_0398461 | 3300049744 | Bacteria | 895 |
| 1735 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 1736 | Ga0501035_0004157 | 3300049822 | Bacteria | 13760 |
| 1737 | Ga0501035_0017251 | 3300049822 | Bacteria | 6656 |
| 1738 | Ga0501035_0019450 | 3300049822 | Bacteria | 6245 |
| 1739 | Ga0501035_0034636 | 3300049822 | Bacteria | 4587 |
| 1740 | Ga0501035_0063808 | 3300049822 | Bacteria | 3275 |
| 1741 | Ga0501035_0089729 | 3300049822 | Bacteria | 2707 |
| 1742 | Ga0501035_0093460 | 3300049822 | Bacteria | 2646 |
| 1743 | Ga0501035_0143575 | 3300049822 | Bacteria | 2074 |
| 1744 | Ga0501035_0167887 | 3300049822 | Bacteria | 1897 |
| 1745 | Ga0501035_0179237 | 3300049822 | Bacteria | 1826 |
| 1746 | Ga0501035_0180239 | 3300049822 | Bacteria | 1820 |
| 1747 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 1748 | Ga0501044_0002338 | 3300049823 | Bacteria | 21619 |
| 1749 | Ga0501044_0006073 | 3300049823 | Bacteria | 13326 |
| 1750 | Ga0501044_0013504 | 3300049823 | Bacteria | 8832 |
| 1751 | Ga0501044_0015609 | 3300049823 | Bacteria | 8181 |
| 1752 | Ga0501044_0016919 | 3300049823 | Bacteria | 7823 |
| 1753 | Ga0501044_0024961 | 3300049823 | Bacteria | 6338 |
| 1754 | Ga0501044_0031208 | 3300049823 | Bacteria | 5609 |
| 1755 | Ga0501044_0047398 | 3300049823 | Bacteria | 4444 |
| 1756 | Ga0501044_0068731 | 3300049823 | Bacteria | 3608 |
| 1757 | Ga0501044_0092258 | 3300049823 | Bacteria | 3054 |
| 1758 | Ga0501044_0170850 | 3300049823 | Bacteria | 2146 |
| 1759 | Ga0501044_0211874 | 3300049823 | Bacteria | 1891 |
| 1760 | Ga0501044_0306815 | 3300049823 | Bacteria | 1514 |
| 1761 | Ga0501044_0332239 | 3300049823 | Bacteria | 1442 |
| 1762 | Ga0501045_0008028 | 3300049824 | Bacteria | 7350 |
| 1763 | Ga0501045_0024337 | 3300049824 | Bacteria | 4347 |
| 1764 | Ga0501045_0090001 | 3300049824 | Bacteria | 2267 |
| 1765 | Ga0501045_0104102 | 3300049824 | Bacteria | 2102 |
| 1766 | Ga0501045_0105664 | 3300049824 | Bacteria | 2086 |
| 1767 | Ga0501045_0157645 | 3300049824 | Bacteria | 1689 |
| 1768 | Ga0501045_0186813 | 3300049824 | Bacteria | 1544 |
| 1769 | Ga0501045_0196881 | 3300049824 | Bacteria | 1502 |
| 1770 | Ga0501045_0244115 | 3300049824 | Bacteria | 1337 |
| 1771 | nmdc:mga03683_134274_c1 | 3300050489 | Bacteria | 1109 |
| 1772 | nmdc:mga03683_67370_c1 | 3300050489 | Bacteria | 1524 |
| 1773 | nmdc:mga00v17_263953_c1 | 3300050491 | Bacteria | 1117 |
| 1774 | nmdc:mga00v17_509_c1 | 3300050491 | Bacteria | 21768 |
| 1775 | nmdc:mga00v17_54865_c1 | 3300050491 | Bacteria | 2432 |
| 1776 | nmdc:mga0yw44_63019_c1 | 3300050492 | Bacteria | 2279 |
| 1777 | nmdc:mga0yw44_8358_c1 | 3300050492 | Bacteria | 5151 |
| 1778 | nmdc:mga0k408_142329_c1 | 3300050493 | Bacteria | 1427 |
| 1779 | nmdc:mga0k408_42496_c1 | 3300050493 | Bacteria | 2618 |
| 1780 | nmdc:mga0k408_77846_c1 | 3300050493 | Bacteria | 1939 |
| 1781 | nmdc:mga06z11_2382_c1 | 3300050494 | Bacteria | 7160 |
| 1782 | nmdc:mga06z11_7594_c1 | 3300050494 | Bacteria | 4474 |
| 1783 | nmdc:mga04h51_230_c1 | 3300050495 | Bacteria | 14875 |
| 1784 | nmdc:mga04h51_2815_c1 | 3300050495 | Bacteria | 4159 |
| 1785 | nmdc:mga04h51_30937_c1 | 3300050495 | Bacteria | 1688 |
| 1786 | nmdc:mga07m45_159056_c1 | 3300050496 | Bacteria | 1311 |
| 1787 | nmdc:mga05p37_14898_c1 | 3300050507 | Bacteria | 9336 |
| 1788 | nmdc:mga05p37_424127_c1 | 3300050507 | Bacteria | 1547 |
| 1789 | nmdc:mga05p37_475407_c1 | 3300050507 | Bacteria | 1441 |
| 1790 | nmdc:mga05p37_59194_c1 | 3300050507 | Bacteria | 4718 |
| 1791 | nmdc:mga09592_19535_c1 | 3300050508 | Bacteria | 5565 |
| 1792 | nmdc:mga09592_565933_c1 | 3300050508 | Bacteria | 975 |
| 1793 | nmdc:mga0qj67_21702_c1 | 3300050509 | Bacteria | 4927 |
| 1794 | nmdc:mga06r32_14451_c1 | 3300050510 | Bacteria | 7166 |
| 1795 | nmdc:mga06r32_25520_c1 | 3300050510 | Bacteria | 5498 |
| 1796 | nmdc:mga06r32_67460_c1 | 3300050510 | Bacteria | 3454 |
| 1797 | nmdc:mga06r32_70210_c1 | 3300050510 | Bacteria | 3387 |
| 1798 | nmdc:mga08y16_175_c1 | 3300050511 | Bacteria | 56460 |
| 1799 | nmdc:mga08y16_198871_c1 | 3300050511 | Bacteria | 2077 |
| 1800 | nmdc:mga08y16_211052_c1 | 3300050511 | Bacteria | 2011 |
| 1801 | nmdc:mga08y16_247928_c1 | 3300050511 | Bacteria | 1840 |
| 1802 | nmdc:mga08y16_368635_c1 | 3300050511 | Bacteria | 1473 |
| 1803 | nmdc:mga08y16_83478_c1 | 3300050511 | Bacteria | 3330 |
| 1804 | nmdc:mga0n895_159904_c1 | 3300050512 | Bacteria | 2284 |
| 1805 | nmdc:mga0n895_182774_c1 | 3300050512 | Bacteria | 2128 |
| 1806 | nmdc:mga0n895_295439_c1 | 3300050512 | Bacteria | 1642 |
| 1807 | nmdc:mga0n895_6848_c1 | 3300050512 | Bacteria | 9735 |
| 1808 | nmdc:mga0n895_97053_c1 | 3300050512 | Bacteria | 2953 |
| 1809 | nmdc:mga0rr50_13712_c2 | 3300050513 | Bacteria | 1701 |
| 1810 | nmdc:mga0rr50_17190_c1 | 3300050513 | Bacteria | 4823 |
| 1811 | nmdc:mga0rr50_251206_c1 | 3300050513 | Bacteria | 1469 |
| 1812 | nmdc:mga08x19_165366_c1 | 3300050514 | Bacteria | 1504 |
| 1813 | nmdc:mga08x19_3036_c1 | 3300050514 | Bacteria | 10089 |
| 1814 | nmdc:mga08x19_35621_c1 | 3300050514 | Bacteria | 3150 |
| 1815 | nmdc:mga0a205_169862_c1 | 3300050515 | Bacteria | 2077 |
| 1816 | nmdc:mga0a205_227977_c1 | 3300050515 | Bacteria | 1747 |
| 1817 | nmdc:mga0a205_3040_c1 | 3300050515 | Bacteria | 14873 |
| 1818 | nmdc:mga0sz30_5290_c1 | 3300050516 | Bacteria | 4728 |
| 1819 | Ga0495601_0002642 | 3300053077 | Bacteria | 10172 |
| 1820 | Ga0495601_0004037 | 3300053077 | Bacteria | 8456 |
| 1821 | Ga0495612_0012290 | 3300053078 | Bacteria | 3451 |
| 1822 | Ga0495612_0029221 | 3300053078 | Bacteria | 2220 |
| 1823 | Ga0500635_0000216 | 3300053080 | Bacteria | 27202 |
| 1824 | Ga0500635_0002546 | 3300053080 | Bacteria | 4534 |
| 1825 | Ga0495595_0007562 | 3300053084 | Bacteria | 4448 |
| 1826 | Ga0495595_0026766 | 3300053084 | Bacteria | 2564 |
| 1827 | Ga0495595_0107670 | 3300053084 | Bacteria | 1349 |
| 1828 | Ga0495619_0014082 | 3300053085 | Bacteria | 5047 |
| 1829 | Ga0495619_0018044 | 3300053085 | Bacteria | 4474 |
| 1830 | Ga0495619_0077400 | 3300053085 | Bacteria | 2234 |
| 1831 | Ga0495619_0180851 | 3300053085 | Bacteria | 1459 |
| 1832 | Ga0500578_0000070 | 3300053086 | Bacteria | 113202 |
| 1833 | Ga0500643_000017 | 3300053087 | Bacteria | 305781 |
| 1834 | Ga0500643_000374 | 3300053087 | Bacteria | 34998 |
| 1835 | Ga0500643_007339 | 3300053087 | Bacteria | 4465 |
| 1836 | Ga0500643_041485 | 3300053087 | Bacteria | 1351 |
| 1837 | Ga0500644_0000087 | 3300053088 | Bacteria | 56947 |
| 1838 | Ga0500644_0002225 | 3300053088 | Bacteria | 4893 |
| 1839 | Ga0500644_0006658 | 3300053088 | Bacteria | 2973 |
| 1840 | Ga0500647_0012142 | 3300053091 | Bacteria | 3869 |
| 1841 | Ga0500651_0011452 | 3300053093 | Bacteria | 5349 |
| 1842 | Ga0500651_0038466 | 3300053093 | Bacteria | 3013 |
| 1843 | Ga0500641_0001055 | 3300053096 | Bacteria | 9831 |
| 1844 | Ga0500641_0066799 | 3300053096 | Bacteria | 1506 |
| 1845 | Ga0500641_0083496 | 3300053096 | Bacteria | 1358 |
| 1846 | Ga0500555_008402 | 3300053103 | Bacteria | 2941 |
| 1847 | Ga0500556_0000379 | 3300053104 | Bacteria | 32454 |
| 1848 | Ga0500556_0001645 | 3300053104 | Bacteria | 8735 |
| 1849 | Ga0500556_0006342 | 3300053104 | Bacteria | 3355 |
| 1850 | Ga0500562_005578 | 3300053108 | Bacteria | 3163 |
| 1851 | Ga0500562_010000 | 3300053108 | Bacteria | 2400 |
| 1852 | Ga0500562_010799 | 3300053108 | Bacteria | 2316 |
| 1853 | Ga0500569_000301 | 3300053109 | Bacteria | 7900 |
| 1854 | Ga0500572_000259 | 3300053111 | Bacteria | 19013 |
| 1855 | Ga0500594_0000146 | 3300053118 | Bacteria | 19223 |
| 1856 | Ga0500595_000630 | 3300053119 | Bacteria | 21144 |
| 1857 | Ga0500595_003016 | 3300053119 | Bacteria | 8013 |
| 1858 | Ga0500595_003866 | 3300053119 | Bacteria | 6877 |
| 1859 | Ga0500595_006380 | 3300053119 | Bacteria | 5006 |
| 1860 | Ga0500595_011880 | 3300053119 | Bacteria | 3389 |
| 1861 | Ga0500595_033925 | 3300053119 | Bacteria | 1691 |
| 1862 | Ga0500608_000048 | 3300053122 | Bacteria | 55108 |
| 1863 | Ga0500608_008519 | 3300053122 | Bacteria | 4317 |
| 1864 | Ga0500618_000336 | 3300053125 | Bacteria | 33703 |
| 1865 | Ga0500652_091300 | 3300053131 | Bacteria | 1272 |
| 1866 | Ga0500655_033196 | 3300053133 | Bacteria | 998 |
| 1867 | Ga0500559_0000039 | 3300053136 | Bacteria | 109430 |
| 1868 | Ga0500559_0000070 | 3300053136 | Bacteria | 82088 |
| 1869 | Ga0500559_0006751 | 3300053136 | Bacteria | 5155 |
| 1870 | Ga0500564_000023 | 3300053138 | Bacteria | 45842 |
| 1871 | Ga0500573_0000026 | 3300053140 | Bacteria | 144363 |
| 1872 | Ga0500590_008718 | 3300053148 | Bacteria | 5074 |
| 1873 | Ga0500616_0002568 | 3300053153 | Bacteria | 14953 |
| 1874 | Ga0500616_0004681 | 3300053153 | Bacteria | 9646 |
| 1875 | Ga0500616_0016403 | 3300053153 | Bacteria | 4217 |
| 1876 | Ga0500616_0017981 | 3300053153 | Bacteria | 4002 |
| 1877 | Ga0500616_0048493 | 3300053153 | Bacteria | 2252 |
| 1878 | Ga0500616_0055550 | 3300053153 | Bacteria | 2070 |
| 1879 | Ga0500622_0002894 | 3300053156 | Bacteria | 11972 |
| 1880 | Ga0500622_0010072 | 3300053156 | Bacteria | 5207 |
| 1881 | Ga0500622_0015184 | 3300053156 | Bacteria | 4129 |
| 1882 | Ga0500622_0019007 | 3300053156 | Bacteria | 3650 |
| 1883 | Ga0500638_015003 | 3300053162 | Bacteria | 3546 |
| 1884 | Ga0500636_0039430 | 3300053177 | Bacteria | 2794 |
| 1885 | Ga0500636_0056950 | 3300053177 | Bacteria | 2288 |
| 1886 | Ga0500637_0053907 | 3300053178 | Bacteria | 2295 |
| 1887 | Ga0500637_0059374 | 3300053178 | Bacteria | 2189 |
| 1888 | Ga0500645_000674 | 3300053730 | Bacteria | 21414 |
| 1889 | Ga0500645_001836 | 3300053730 | Bacteria | 10179 |
| 1890 | Ga0500645_001866 | 3300053730 | Bacteria | 10084 |
| 1891 | Ga0500645_039783 | 3300053730 | Bacteria | 1392 |
| 1892 | Ga0500609_000122 | 3300053731 | Bacteria | 10340 |
| 1893 | Ga0500552_003643 | 3300053733 | Bacteria | 1577 |
| 1894 | Ga0501084_0004473 | 3300054114 | Bacteria | 11417 |
| 1895 | Ga0501084_0005188 | 3300054114 | Bacteria | 10657 |
| 1896 | Ga0501084_0007894 | 3300054114 | Bacteria | 8760 |
| 1897 | Ga0501084_0008308 | 3300054114 | Bacteria | 8567 |
| 1898 | Ga0501084_0008886 | 3300054114 | Bacteria | 8313 |
| 1899 | Ga0501084_0011060 | 3300054114 | Bacteria | 7473 |
| 1900 | Ga0501084_0011078 | 3300054114 | Bacteria | 7468 |
| 1901 | Ga0501084_0011118 | 3300054114 | Bacteria | 7454 |
| 1902 | Ga0501084_0018253 | 3300054114 | Bacteria | 5842 |
| 1903 | Ga0501084_0049411 | 3300054114 | Bacteria | 3521 |
| 1904 | Ga0501082_0000168 | 3300060353 | Bacteria | 56207 |
| 1905 | Ga0501082_0006709 | 3300060353 | Bacteria | 9956 |
| 1906 | Ga0501082_0019419 | 3300060353 | Bacteria | 5858 |
| 1907 | Ga0501082_0034493 | 3300060353 | Bacteria | 4362 |
| 1908 | Ga0501082_0037495 | 3300060353 | Bacteria | 4178 |
| 1909 | Ga0501082_0052842 | 3300060353 | Bacteria | 3503 |
| 1910 | Ga0501082_0109853 | 3300060353 | Bacteria | 2387 |
| 1911 | Ga0501082_0126507 | 3300060353 | Bacteria | 2216 |
| 1912 | Ga0501082_0139236 | 3300060353 | Bacteria | 2106 |
| 1913 | Ga0501082_0236104 | 3300060353 | Bacteria | 1591 |
| 1914 | Ga0501082_0248180 | 3300060353 | Bacteria | 1549 |
| 1915 | Ga0501082_0267505 | 3300060353 | Bacteria | 1488 |
| 1916 | Ga0501082_0293947 | 3300060353 | Bacteria | 1414 |
| 1917 | Ga0466962_0000450 | 3300061719 | Bacteria | 17837 |
| 1918 | Ga0530510_0007936 | 3300061734 | Bacteria | 7405 |
| 1919 | Ga0530510_0012177 | 3300061734 | Bacteria | 6038 |
| 1920 | Ga0530510_0056191 | 3300061734 | Bacteria | 2843 |
| 1921 | Ga0530510_0059805 | 3300061734 | Bacteria | 2757 |
| 1922 | Ga0530510_0061070 | 3300061734 | Bacteria | 2729 |
| 1923 | Ga0530510_0153927 | 3300061734 | Bacteria | 1698 |
| 1924 | Ga0530510_0246838 | 3300061734 | Bacteria | 1330 |
| 1925 | Ga0530510_0319349 | 3300061734 | Bacteria | 1164 |
| 1926 | Ga0530510_0332454 | 3300061734 | Bacteria | 1140 |
| 1927 | Ga0530510_0339818 | 3300061734 | Bacteria | 1127 |
| 1928 | 2511122101 | 2510917020 | Bacteria | 5657507 |
| 1929 | 2512035755 | 2511231221 | Bacteria | 6846400 |
| 1930 | 2523108112 | 2522572158 | Bacteria | 6514390 |
| 1931 | 2524609465 | 2524023250 | Bacteria | 5457705 |
| 1932 | 2545673161 | 2545555834 | Bacteria | 8130841 |
| 1933 | 2585146612 | 2582581279 | Bacteria | 4980720 |
| 1934 | 2585152378 | 2582581280 | Bacteria | 5994497 |
| 1935 | 2585199028 | 2582581293 | Bacteria | 5907401 |
| 1936 | 2587917752 | 2585428106 | Bacteria | 5179711 |
| 1937 | 2596373405 | 2595698237 | Bacteria | 6712432 |
| 1938 | 2599105835 | 2597490356 | Bacteria | 7030811 |
| 1939 | 2643750097 | 2643221545 | Bacteria | 5083237 |
| 1940 | 2643782483 | 2643221552 | Bacteria | 5708754 |
| 1941 | 2643882351 | 2643221574 | Bacteria | 2789653 |
| 1942 | 2643924262 | 2643221583 | Bacteria | 5218014 |
| 1943 | 2643928692 | 2643221584 | Bacteria | 5511711 |
| 1944 | 2643998845 | 2643221598 | Bacteria | 4578346 |
| 1945 | 2644087127 | 2643221614 | Bacteria | 4260023 |
| 1946 | 2644226728 | 2643221640 | Bacteria | 5258820 |
| 1947 | 2644233802 | 2643221642 | Bacteria | 5357871 |
| 1948 | 2644342081 | 2643221661 | Bacteria | 4267604 |
| 1949 | 2644353564 | 2643221663 | Bacteria | 3425771 |
| 1950 | 2644368368 | 2643221666 | Bacteria | 4265935 |
| 1951 | 2644510747 | 2643221691 | Bacteria | 5093099 |
| 1952 | 2644548659 | 2643221699 | Bacteria | 5731501 |
| 1953 | 2644549376 | 2643221699 | Bacteria | 5731501 |
| 1954 | 2671695435 | 2671180139 | Bacteria | 4196045 |
| 1955 | 2715501371 | 2713897090 | Bacteria | 3353799 |
| 1956 | 2738743187 | 2738541281 | Bacteria | 5112672 |
| 1957 | 2739352804 | 2738543032 | Bacteria | 5115625 |
| 1958 | 2739792463 | 2739367756 | Bacteria | 4553612 |
| 1959 | 2757570352 | 2757320392 | Bacteria | 3737298 |
| 1960 | 2774873043 | 2773857925 | Bacteria | 6472445 |
| 1961 | 2792462957 | 2791355048 | Bacteria | 5832535 |
| 1962 | 2819537309 | 2818991435 | Bacteria | 5433759 |
| 1963 | 2819646629 | 2818991454 | Bacteria | 5563326 |
| 1964 | 2840880697 | 2840878972 | Bacteria | 5483153 |
| 1965 | 2842700468 | 2842698319 | Bacteria | 5190321 |
| 1966 | 2843746505 | 2843744320 | Bacteria | 5659202 |
| 1967 | 2846955617 | 2846952575 | Bacteria | 6587527 |
| 1968 | 2848862395 | 2848858292 | Bacteria | 7391279 |
| 1969 | 2849561782 | 2849560528 | Bacteria | 5393480 |
| 1970 | 2849574155 | 2849573788 | Bacteria | 5421256 |
| 1971 | 2851157833 | 2851153111 | Bacteria | 5542585 |
| 1972 | 2854683035 | 2854681122 | Bacteria | 4548679 |
| 1973 | 2855021455 | 2855020534 | Bacteria | 3204685 |
| 1974 | 2857507009 | 2857504554 | Bacteria | 5369913 |
| 1975 | 2882461349 | 2882456835 | Bacteria | 6863978 |
| 1976 | 2884961658 | 2884960567 | Bacteria | 5437054 |
| 1977 | 2889307847 | 2889306138 | Bacteria | 6358934 |
| 1978 | 2889793135 | 2889790730 | Bacteria | 5689708 |
| 1979 | 2889917633 | 2889914905 | Bacteria | 5702301 |
| 1980 | 2897804453 | 2897803580 | Bacteria | 7000062 |
| 1981 | 2898332520 | 2898329390 | Bacteria | 5168154 |
| 1982 | 2898797796 | 2898795034 | Bacteria | 4294459 |
| 1983 | 2899262033 | 2899259804 | Bacteria | 3320927 |
| 1984 | 2899277373 | 2899275550 | Bacteria | 3958688 |
| 1985 | 2902336623 | 2902330777 | Bacteria | 6395352 |
| 1986 | 2902406894 | 2902405164 | Bacteria | 6784948 |
| 1987 | 2917554441 | 2917554339 | Bacteria | 4987857 |
| 1988 | 2919679334 | 2919679072 | Bacteria | 4629602 |
| 1989 | 2928127069 | 2928125067 | Bacteria | 5937560 |
| 1990 | 2928531402 | 2928531327 | Bacteria | 5101314 |
| 1991 | 2928974321 | 2928972540 | Bacteria | 3058286 |
| 1992 | 2937845332 | 2937843397 | Bacteria | 5256375 |
| 1993 | 2939673994 | 2939669807 | Bacteria | 5028511 |
| 1994 | 2977243244 | 2977240413 | Bacteria | 3191065 |
| 1995 | 2989771371 | 2989771324 | Bacteria | 5605128 |
| 1996 | 3000019371 | 3000017691 | Bacteria | 3772574 |
| 1997 | 3000406591 | 3000405567 | Bacteria | 3779330 |
| 1998 | 3003666057 | 3003665799 | Bacteria | 7279786 |
| 1999 | 641642235 | 641522639 | Bacteria | 7737025 |
| 2000 | 643598241 | 643348564 | Bacteria | 8839022 |
| 2001 | 8054007928 | 8054002106 | Bacteria | 7987183 |
| 2002 | 8054561364 | 8054558443 | Bacteria | 5204801 |
| 2003 | 8057134478 | 8057132660 | Bacteria | 4061191 |
| 2004 | Ga0105249_10359236 | |||
| 2005 | JGI24750J21931_1001757 | |||
| 2006 | JGI24751J29686_10002743 | |||
| 2007 | JGI25153J46596_10000269 | |||
| 2008 | JGI25153J46596_10009271 | |||
| 2009 | rootH2_10154904 | |||
| 2010 | Ga0006562J51391_1051836 | |||
| 2011 | Ga0055537_1005976 | |||
| 2012 | Ga0055528_1003083 | |||
| 2013 | Ga0055530_10000337 | |||
| 2014 | Ga0055531_10000505 | |||
| 2015 | Ga0055531_10001046 | |||
| 2016 | Ga0055531_10029211 | |||
| 2017 | Ga0058861_11804934 | |||
| 2018 | Ga0058862_12801645 | |||
| 2019 | Ga0065165_1000171 | |||
| 2020 | Ga0065165_1001427 | |||
| 2021 | Ga0065165_1009793 | |||
| 2022 | Ga0070658_10003145 | |||
| 2023 | Ga0070658_10009756 | |||
| 2024 | Ga0070658_10034673 | |||
| 2025 | Ga0070658_10062470 | |||
| 2026 | Ga0070676_10002225 | |||
| 2027 | Ga0070676_10054739 | |||
| 2028 | Ga0070690_100000232 | |||
| 2029 | Ga0070690_100015621 | |||
| 2030 | Ga0070690_100051588 | |||
| 2031 | Ga0070690_100122975 | |||
| 2032 | Ga0070670_100000007 | |||
| 2033 | Ga0070670_100000734 | |||
| 2034 | Ga0070670_100025548 | |||
| 2035 | Ga0068869_100034099 | |||
| 2036 | Ga0068869_100100619 | |||
| 2037 | Ga0070666_10000492 | |||
| 2038 | Ga0070666_10007495 | |||
| 2039 | Ga0070666_10008767 | |||
| 2040 | Ga0070666_10017934 | |||
| 2041 | Ga0070666_10096676 | |||
| 2042 | Ga0070666_10142819 | |||
| 2043 | Ga0070680_100001128 | |||
| 2044 | Ga0070680_100005807 | |||
| 2045 | Ga0070680_100021694 | |||
| 2046 | Ga0070680_100025975 | |||
| 2047 | Ga0070680_100027952 | |||
| 2048 | Ga0070680_100029781 | |||
| 2049 | Ga0070680_100048827 | |||
| 2050 | Ga0070680_100087886 | |||
| 2051 | Ga0070682_100003540 | |||
| 2052 | Ga0070682_100003799 | |||
| 2053 | Ga0070682_100133320 | |||
| 2054 | Ga0068868_100001553 | |||
| 2055 | Ga0068868_100037465 | |||
| 2056 | Ga0068868_100103220 | |||
| 2057 | Ga0070660_100001176 | |||
| 2058 | Ga0070660_100012151 | |||
| 2059 | Ga0070660_100023133 | |||
| 2060 | Ga0070660_100032791 | |||
| 2061 | Ga0070660_100045240 | |||
| 2062 | Ga0070689_100000219 | |||
| 2063 | Ga0070689_100037387 | |||
| 2064 | Ga0070691_10004358 | |||
| 2065 | Ga0070691_10020286 | |||
| 2066 | Ga0070691_10033353 | |||
| 2067 | Ga0070691_10067542 | |||
| 2068 | Ga0070691_10093063 | |||
| 2069 | Ga0070691_10100110 | |||
| 2070 | Ga0070687_100000891 | |||
| 2071 | Ga0070661_100002101 | |||
| 2072 | Ga0070661_100034920 | |||
| 2073 | Ga0070661_100068524 | |||
| 2074 | Ga0070661_100307803 | |||
| 2075 | Ga0070692_10000095 | |||
| 2076 | Ga0070668_100000810 | |||
| 2077 | Ga0070668_100002588 | |||
| 2078 | Ga0070668_100002594 | |||
| 2079 | Ga0070668_100017223 | |||
| 2080 | Ga0070668_100039267 | |||
| 2081 | Ga0070668_100040268 | |||
| 2082 | Ga0070668_100381397 | |||
| 2083 | Ga0070669_100000854 | |||
| 2084 | Ga0070669_100003901 | |||
| 2085 | Ga0070669_100006542 | |||
| 2086 | Ga0070669_100060216 | |||
| 2087 | Ga0070675_100037643 | |||
| 2088 | Ga0070675_100228917 | |||
| 2089 | Ga0070671_100007574 | |||
| 2090 | Ga0070671_100008771 | |||
| 2091 | Ga0070671_100122297 | |||
| 2092 | Ga0070671_100272149 | |||
| 2093 | Ga0070671_100557481 | |||
| 2094 | Ga0070674_100001983 | |||
| 2095 | Ga0070674_100004537 | |||
| 2096 | Ga0070674_100038016 | |||
| 2097 | Ga0070673_100002867 | |||
| 2098 | Ga0070673_100075833 | |||
| 2099 | Ga0070673_100528258 | |||
| 2100 | Ga0070688_100000552 | |||
| 2101 | Ga0070688_100148926 | |||
| 2102 | Ga0070659_100001675 | |||
| 2103 | Ga0070659_100027251 | |||
| 2104 | Ga0070659_100034835 | |||
| 2105 | Ga0070659_100057134 | |||
| 2106 | Ga0070659_100464665 | |||
| 2107 | Ga0070667_100001267 | |||
| 2108 | Ga0070667_100010421 | |||
| 2109 | Ga0070667_100012674 | |||
| 2110 | Ga0070667_100012745 | |||
| 2111 | Ga0070667_100054065 | |||
| 2112 | Ga0070667_100087631 | |||
| 2113 | Ga0070667_100177344 | |||
| 2114 | Ga0070667_100204043 | |||
| 2115 | Ga0070703_10002510 | |||
| 2116 | Ga0070709_10003641 | |||
| 2117 | Ga0070709_10017337 | |||
| 2118 | Ga0070709_10084634 | |||
| 2119 | Ga0070714_100042364 | |||
| 2120 | Ga0070714_100044290 | |||
| 2121 | Ga0070714_100050098 | |||
| 2122 | Ga0070714_100160830 | |||
| 2123 | Ga0070713_100116518 | |||
| 2124 | Ga0070713_100222337 | |||
| 2125 | Ga0070713_100249782 | |||
| 2126 | Ga0070713_100250895 | |||
| 2127 | Ga0070713_100401356 | |||
| 2128 | Ga0070713_100432234 | |||
| 2129 | Ga0070710_10053669 | |||
| 2130 | Ga0070710_10117397 | |||
| 2131 | Ga0070701_10000263 | |||
| 2132 | Ga0070711_100000201 | |||
| 2133 | Ga0070705_100000751 | |||
| 2134 | Ga0070705_100001721 | |||
| 2135 | Ga0070705_100014535 | |||
| 2136 | Ga0070700_100005030 | |||
| 2137 | Ga0070700_100016215 | |||
| 2138 | Ga0070700_100214686 | |||
| 2139 | Ga0070700_100289699 | |||
| 2140 | Ga0070694_100014968 | |||
| 2141 | Ga0070694_100062723 | |||
| 2142 | Ga0070694_100093835 | |||
| 2143 | Ga0070708_100051101 | |||
| 2144 | Ga0070663_100001331 | |||
| 2145 | Ga0070663_100009128 | |||
| 2146 | Ga0070663_100139086 | |||
| 2147 | Ga0070663_100212961 | |||
| 2148 | Ga0070678_100000963 | |||
| 2149 | Ga0070678_100051658 | |||
| 2150 | Ga0070678_100239128 | |||
| 2151 | Ga0070678_100287767 | |||
| 2152 | Ga0070662_100092341 | |||
| 2153 | Ga0070662_100149364 | |||
| 2154 | Ga0070681_10000057 | |||
| 2155 | Ga0070681_10002960 | |||
| 2156 | Ga0070681_10005511 | |||
| 2157 | Ga0070681_10037851 | |||
| 2158 | Ga0070681_10040784 | |||
| 2159 | Ga0070681_10048272 | |||
| 2160 | Ga0070681_10050025 | |||
| 2161 | Ga0070681_10080219 | |||
| 2162 | Ga0070681_10281442 | |||
| 2163 | Ga0070681_10299394 | |||
| 2164 | Ga0070681_10563842 | |||
| 2165 | Ga0068867_100021656 | |||
| 2166 | Ga0068867_100029714 | |||
| 2167 | Ga0068867_100135279 | |||
| 2168 | Ga0070685_10007261 | |||
| 2169 | Ga0070685_10227484 | |||
| 2170 | Ga0070707_100015874 | |||
| 2171 | Ga0070698_100007183 | |||
| 2172 | Ga0070698_100009690 | |||
| 2173 | Ga0070698_100154498 | |||
| 2174 | Ga0070698_100156902 | |||
| 2175 | Ga0070699_100005628 | |||
| 2176 | Ga0070699_100157206 | |||
| 2177 | Ga0070699_100158442 | |||
| 2178 | Ga0070699_100217575 | |||
| 2179 | Ga0070699_100295559 | |||
| 2180 | Ga0070699_100389231 | |||
| 2181 | Ga0070679_100000043 | |||
| 2182 | Ga0070679_100005852 | |||
| 2183 | Ga0070679_100027144 | |||
| 2184 | Ga0070679_100028853 | |||
| 2185 | Ga0070679_100044488 | |||
| 2186 | Ga0070679_100061454 | |||
| 2187 | Ga0070679_100077998 | |||
| 2188 | Ga0070679_100222634 | |||
| 2189 | Ga0070679_100287381 | |||
| 2190 | Ga0070679_100453202 | |||
| 2191 | Ga0070697_100040258 | |||
| 2192 | Ga0070697_100069957 | |||
| 2193 | Ga0070697_100200373 | |||
| 2194 | Ga0070697_100391711 | |||
| 2195 | Ga0070697_100626005 | |||
| 2196 | Ga0068853_100002414 | |||
| 2197 | Ga0068853_100002623 | |||
| 2198 | Ga0068853_100003695 | |||
| 2199 | Ga0068853_100015377 | |||
| 2200 | Ga0068853_100030383 | |||
| 2201 | Ga0068853_100085814 | |||
| 2202 | Ga0068853_100097370 | |||
| 2203 | Ga0068853_100264669 | |||
| 2204 | Ga0070672_100003597 | |||
| 2205 | Ga0070672_100465139 | |||
| 2206 | Ga0070686_100000306 | |||
| 2207 | Ga0070695_100000339 | |||
| 2208 | Ga0070695_100006239 | |||
| 2209 | Ga0070695_100063474 | |||
| 2210 | Ga0070695_100080306 | |||
| 2211 | Ga0070696_100001139 | |||
| 2212 | Ga0070696_100005852 | |||
| 2213 | Ga0070693_100002939 | |||
| 2214 | Ga0070693_100115713 | |||
| 2215 | Ga0070665_100000622 | |||
| 2216 | Ga0070665_100001034 | |||
| 2217 | Ga0070665_100001485 | |||
| 2218 | Ga0070665_100002299 | |||
| 2219 | Ga0070665_100003432 | |||
| 2220 | Ga0070665_100016813 | |||
| 2221 | Ga0070665_100046308 | |||
| 2222 | Ga0070665_100084446 | |||
| 2223 | Ga0070665_100096343 | |||
| 2224 | Ga0070665_100111686 | |||
| 2225 | Ga0070665_100114044 | |||
| 2226 | Ga0070704_100148977 | |||
| 2227 | Ga0068855_100007530 | |||
| 2228 | Ga0068855_100032390 | |||
| 2229 | Ga0068855_100059685 | |||
| 2230 | Ga0068855_100073014 | |||
| 2231 | Ga0068855_100099535 | |||
| 2232 | Ga0068855_100105516 | |||
| 2233 | Ga0068855_100117930 | |||
| 2234 | Ga0068855_100173895 | |||
| 2235 | Ga0068855_100187622 | |||
| 2236 | Ga0068855_100209738 | |||
| 2237 | Ga0068855_100219640 | |||
| 2238 | Ga0068855_100245096 | |||
| 2239 | Ga0068855_100327487 | |||
| 2240 | Ga0068855_100524430 | |||
| 2241 | Ga0070664_100003361 | |||
| 2242 | Ga0070664_100008403 | |||
| 2243 | Ga0070664_100043907 | |||
| 2244 | Ga0070664_100127552 | |||
| 2245 | Ga0070664_100285916 | |||
| 2246 | Ga0068857_100000318 | |||
| 2247 | Ga0068857_100011253 | |||
| 2248 | Ga0068857_100039479 | |||
| 2249 | Ga0068857_100152727 | |||
| 2250 | Ga0068857_100161737 | |||
| 2251 | Ga0068856_100006661 | |||
| 2252 | Ga0068856_100008386 | |||
| 2253 | Ga0068856_100196188 | |||
| 2254 | Ga0068856_100301959 | |||
| 2255 | Ga0068856_100353209 | |||
| 2256 | Ga0068856_100522915 | |||
| 2257 | Ga0070702_100000103 | |||
| 2258 | Ga0070702_100057836 | |||
| 2259 | Ga0070702_100135243 | |||
| 2260 | Ga0070702_100298918 | |||
| 2261 | Ga0068852_100003609 | |||
| 2262 | Ga0068852_100115642 | |||
| 2263 | Ga0068852_100145653 | |||
| 2264 | Ga0068852_100165739 | |||
| 2265 | Ga0068852_100183035 | |||
| 2266 | Ga0068852_100356401 | |||
| 2267 | Ga0068859_100000168 | |||
| 2268 | Ga0068859_100004644 | |||
| 2269 | Ga0068859_100008510 | |||
| 2270 | Ga0068859_100012300 | |||
| 2271 | Ga0068859_100450106 | |||
| 2272 | Ga0068864_100000093 | |||
| 2273 | Ga0068864_100000095 | |||
| 2274 | Ga0068864_100004875 | |||
| 2275 | Ga0068864_100041566 | |||
| 2276 | Ga0068864_100054856 | |||
| 2277 | Ga0068864_100060013 | |||
| 2278 | Ga0068864_100214215 | |||
| 2279 | Ga0068864_100264675 | |||
| 2280 | Ga0068866_10011490 | |||
| 2281 | Ga0068861_100119060 | |||
| 2282 | Ga0068851_10053516 | |||
| 2283 | Ga0068851_10198081 | |||
| 2284 | Ga0068870_10112291 | |||
| 2285 | Ga0068863_100000045 | |||
| 2286 | Ga0068863_100007895 | |||
| 2287 | Ga0068863_100014537 | |||
| 2288 | Ga0068863_100027933 | |||
| 2289 | Ga0068863_100078015 | |||
| 2290 | Ga0068863_100408496 | |||
| 2291 | Ga0068858_100003461 | |||
| 2292 | Ga0068858_100003717 | |||
| 2293 | Ga0068858_100013269 | |||
| 2294 | Ga0068858_100016285 | |||
| 2295 | Ga0068858_100027724 | |||
| 2296 | Ga0068858_100058281 | |||
| 2297 | Ga0068858_100079638 | |||
| 2298 | Ga0068858_100083717 | |||
| 2299 | Ga0068860_100000204 | |||
| 2300 | Ga0068860_100005966 | |||
| 2301 | Ga0068860_100010922 | |||
| 2302 | Ga0068860_100033041 | |||
| 2303 | Ga0068860_100037867 | |||
| 2304 | Ga0068860_100050305 | |||
| 2305 | Ga0068860_100118701 | |||
| 2306 | Ga0068860_100190721 | |||
| 2307 | Ga0068860_100256811 | |||
| 2308 | Ga0068862_100001725 | |||
| 2309 | Ga0068862_100003158 | |||
| 2310 | Ga0068862_100005698 | |||
| 2311 | Ga0068862_100006125 | |||
| 2312 | Ga0068862_100010475 | |||
| 2313 | Ga0068862_100016150 | |||
| 2314 | Ga0068862_100111357 | |||
| 2315 | Ga0068862_100116776 | |||
| 2316 | Ga0068862_100209099 | |||
| 2317 | Ga0081455_10000079 | |||
| 2318 | Ga0081455_10005314 | |||
| 2319 | Ga0081455_10006837 | |||
| 2320 | Ga0081455_10023011 | |||
| 2321 | Ga0081455_10061401 | |||
| 2322 | Ga0081455_10069059 | |||
| 2323 | Ga0081538_10009083 | |||
| 2324 | Ga0081538_10017391 | |||
| 2325 | Ga0081538_10048270 | |||
| 2326 | Ga0081540_1000050 | |||
| 2327 | Ga0081540_1035798 | |||
| 2328 | Ga0081540_1041443 | |||
| 2329 | Ga0081540_1059139 | |||
| 2330 | Ga0081539_10021261 | |||
| 2331 | Ga0081539_10032848 | |||
| 2332 | Ga0081539_10071716 | |||
| 2333 | Ga0070717_10002293 | |||
| 2334 | Ga0070717_10048307 | |||
| 2335 | Ga0070717_10136784 | |||
| 2336 | Ga0075365_10022326 | |||
| 2337 | Ga0075365_10028129 | |||
| 2338 | Ga0075365_10357531 | |||
| 2339 | Ga0075368_10000312 | |||
| 2340 | Ga0075368_10073549 | |||
| 2341 | Ga0075364_10001636 | |||
| 2342 | Ga0075432_10004896 | |||
| 2343 | Ga0070715_10002897 | |||
| 2344 | Ga0070715_10074248 | |||
| 2345 | Ga0070716_100001803 | |||
| 2346 | Ga0070716_100094614 | |||
| 2347 | Ga0070712_100000383 | |||
| 2348 | Ga0070712_100006161 | |||
| 2349 | Ga0070712_100010231 | |||
| 2350 | Ga0070712_100020920 | |||
| 2351 | Ga0070712_100031069 | |||
| 2352 | Ga0070712_100142181 | |||
| 2353 | Ga0070712_100230091 | |||
| 2354 | Ga0070712_100299634 | |||
| 2355 | Ga0075367_10004476 | |||
| 2356 | Ga0075367_10149247 | |||
| 2357 | Ga0075369_10052667 | |||
| 2358 | Ga0075366_10004615 | |||
| 2359 | Ga0075366_10017262 | |||
| 2360 | Ga0075366_10102301 | |||
| 2361 | Ga0075366_10146814 | |||
| 2362 | Ga0097621_100001072 | |||
| 2363 | Ga0097621_100028215 | |||
| 2364 | Ga0097621_100097324 | |||
| 2365 | Ga0097621_100231902 | |||
| 2366 | Ga0075370_10022473 | |||
| 2367 | Ga0075370_10176237 | |||
| 2368 | Ga0075370_10182164 | |||
| 2369 | Ga0068871_100001473 | |||
| 2370 | Ga0068871_100043773 | |||
| 2371 | Ga0068871_100088418 | |||
| 2372 | Ga0068871_100175630 | |||
| 2373 | Ga0068871_100255378 | |||
| 2374 | Ga0068871_100282832 | |||
| 2375 | Ga0068871_100364323 | |||
| 2376 | Ga0068871_100373318 | |||
| 2377 | Ga0075428_100051198 | |||
| 2378 | Ga0075428_100059608 | |||
| 2379 | Ga0075428_100064681 | |||
| 2380 | Ga0075428_100303396 | |||
| 2381 | Ga0075430_100025541 | |||
| 2382 | Ga0075430_100265128 | |||
| 2383 | Ga0075430_100318100 | |||
| 2384 | Ga0075431_100000648 | |||
| 2385 | Ga0075431_100001586 | |||
| 2386 | Ga0075431_100007581 | |||
| 2387 | Ga0075431_100189193 | |||
| 2388 | Ga0075431_100195411 | |||
| 2389 | Ga0075433_10003756 | |||
| 2390 | Ga0075433_10458236 | |||
| 2391 | Ga0075434_100001044 | |||
| 2392 | Ga0075434_100100013 | |||
| 2393 | Ga0075434_100144691 | |||
| 2394 | Ga0075429_100020344 | |||
| 2395 | Ga0075429_100045703 | |||
| 2396 | Ga0068865_100000177 | |||
| 2397 | Ga0068865_100004452 | |||
| 2398 | Ga0068865_100006191 | |||
| 2399 | Ga0068865_100029061 | |||
| 2400 | Ga0068865_100107070 | |||
| 2401 | Ga0068865_100116560 | |||
| 2402 | Ga0068865_100131928 | |||
| 2403 | Ga0075436_100004207 | |||
| 2404 | Ga0075436_100076590 | |||
| 2405 | Ga0075436_100261535 | |||
| 2406 | Ga0097620_100000168 | |||
| 2407 | Ga0097620_100004644 | |||
| 2408 | Ga0097620_100008510 | |||
| 2409 | Ga0097620_100012300 | |||
| 2410 | Ga0097620_100450150 | |||
| 2411 | Ga0075435_100022950 | |||
| 2412 | Ga0075435_100115908 | |||
| 2413 | Ga0075435_100193038 | |||
| 2414 | Ga0099795_10006747 | |||
| 2415 | Ga0099795_10019485 | |||
| 2416 | Ga0105250_10031425 | |||
| 2417 | Ga0105240_10000528 | |||
| 2418 | Ga0105240_10000593 | |||
| 2419 | Ga0105240_10006394 | |||
| 2420 | Ga0105240_10008432 | |||
| 2421 | Ga0105240_10016124 | |||
| 2422 | Ga0105240_10025200 | |||
| 2423 | Ga0105240_10030187 | |||
| 2424 | Ga0105240_10041737 | |||
| 2425 | Ga0105240_10161384 | |||
| 2426 | Ga0105240_10169459 | |||
| 2427 | Ga0105240_10171001 | |||
| 2428 | Ga0105240_10203267 | |||
| 2429 | Ga0105240_10221614 | |||
| 2430 | Ga0105240_10442648 | |||
| 2431 | Ga0105240_10572948 | |||
| 2432 | Ga0105240_10658809 | |||
| 2433 | Ga0111539_10007102 | |||
| 2434 | Ga0111539_10011351 | |||
| 2435 | Ga0111539_10095254 | |||
| 2436 | Ga0111539_10317384 | |||
| 2437 | Ga0105245_10000591 | |||
| 2438 | Ga0105245_10067399 | |||
| 2439 | Ga0105245_10095809 | |||
| 2440 | Ga0105245_10200417 | |||
| 2441 | Ga0105245_10253142 | |||
| 2442 | Ga0105245_10273536 | |||
| 2443 | Ga0105247_10000361 | |||
| 2444 | Ga0105247_10060893 | |||
| 2445 | Ga0105247_10108926 | |||
| 2446 | Ga0114129_10065174 | |||
| 2447 | Ga0114129_10325523 | |||
| 2448 | Ga0105243_10003277 | |||
| 2449 | Ga0105243_10102489 | |||
| 2450 | Ga0105243_10643635 | |||
| 2451 | Ga0105241_10000699 | |||
| 2452 | Ga0105241_10006171 | |||
| 2453 | Ga0105241_10007803 | |||
| 2454 | Ga0105241_10087402 | |||
| 2455 | Ga0105241_10260395 | |||
| 2456 | Ga0105241_10264120 | |||
| 2457 | Ga0105241_10596766 | |||
| 2458 | Ga0105242_10008014 | |||
| 2459 | Ga0105242_10071387 | |||
| 2460 | Ga0105242_10091262 | |||
| 2461 | Ga0105242_10134833 | |||
| 2462 | Ga0105242_10586647 | |||
| 2463 | Ga0105248_10000001 | |||
| 2464 | Ga0105248_10000097 | |||
| 2465 | Ga0105248_10000586 | |||
| 2466 | Ga0105248_10014989 | |||
| 2467 | Ga0105248_10018673 | |||
| 2468 | Ga0105248_10039694 | |||
| 2469 | Ga0105248_10127670 | |||
| 2470 | Ga0105248_10220265 | |||
| 2471 | Ga0105248_10242825 | |||
| 2472 | Ga0105237_10005447 | |||
| 2473 | Ga0105237_10028604 | |||
| 2474 | Ga0105237_10136315 | |||
| 2475 | Ga0105237_10509890 | |||
| 2476 | Ga0105237_10599801 | |||
| 2477 | Ga0105237_10729863 | |||
| 2478 | Ga0105238_10000280 | |||
| 2479 | Ga0105238_10012925 | |||
| 2480 | Ga0105238_10036658 | |||
| 2481 | Ga0105238_10109372 | |||
| 2482 | Ga0105238_10144770 | |||
| 2483 | Ga0105238_10316597 | |||
| 2484 | Ga0105238_10324754 | |||
| 2485 | Ga0105249_10000757 | |||
| 2486 | Ga0105249_10000842 | |||
| 2487 | Ga0105249_10014651 | |||
| 2488 | Ga0105249_10033566 | |||
| 2489 | Ga0105249_10120026 | |||
| 2490 | Ga0105249_10243034 | |||
| 2491 | Ga0105249_10746619 | |||
| 2492 | Ga0105239_10001117 | |||
| 2493 | Ga0105239_10010033 | |||
| 2494 | Ga0105239_10012366 | |||
| 2495 | Ga0105239_10287673 | |||
| 2496 | Ga0105239_10343260 | |||
| 2497 | Ga0105239_10364068 | |||
| 2498 | Ga0105239_10391941 | |||
| 2499 | Ga0105239_10640776 | |||
| 2500 | Ga0105246_10005577 | |||
| 2501 | Ga0105246_10097725 | |||
| 2502 | Ga0105246_10146435 | |||
| 2503 | Ga0105246_10255375 | |||
| 2504 | Ga0157373_10020122 | |||
| 2505 | Ga0157373_10021937 | |||
| 2506 | Ga0157373_10030236 | |||
| 2507 | Ga0157373_10161967 | |||
| 2508 | Ga0157371_10009119 | |||
| 2509 | Ga0157371_10024313 | |||
| 2510 | Ga0157371_10097896 | |||
| 2511 | Ga0157370_10024495 | |||
| 2512 | Ga0157370_10060452 | |||
| 2513 | Ga0157370_10101646 | |||
| 2514 | Ga0157370_10123487 | |||
| 2515 | Ga0157370_10126413 | |||
| 2516 | Ga0157370_10216987 | |||
| 2517 | Ga0157370_10633939 | |||
| 2518 | Ga0157369_10003360 | |||
| 2519 | Ga0157369_10006431 | |||
| 2520 | Ga0157369_10019553 | |||
| 2521 | Ga0157369_10052011 | |||
| 2522 | Ga0157369_10226294 | |||
| 2523 | Ga0157369_10428098 | |||
| 2524 | Ga0157374_10000592 | |||
| 2525 | Ga0157374_10086021 | |||
| 2526 | Ga0157374_10105614 | |||
| 2527 | Ga0157374_10113836 | |||
| 2528 | Ga0157374_10156142 | |||
| 2529 | Ga0157374_10208164 | |||
| 2530 | Ga0157378_10000401 | |||
| 2531 | Ga0157378_10000452 | |||
| 2532 | Ga0157378_10033741 | |||
| 2533 | Ga0157378_10038103 | |||
| 2534 | Ga0157378_10120994 | |||
| 2535 | Ga0157378_10161106 | |||
| 2536 | Ga0157378_10199414 | |||
| 2537 | Ga0157378_10208375 | |||
| 2538 | Ga0157378_10233485 | |||
| 2539 | Ga0163162_10005348 | |||
| 2540 | Ga0163162_10008105 | |||
| 2541 | Ga0163162_10082532 | |||
| 2542 | Ga0163162_10170630 | |||
| 2543 | Ga0163162_10306368 | |||
| 2544 | Ga0157372_10000528 | |||
| 2545 | Ga0157372_10000529 | |||
| 2546 | Ga0157372_10012635 | |||
| 2547 | Ga0157372_10033013 | |||
| 2548 | Ga0157372_10219556 | |||
| 2549 | Ga0157372_10586118 | |||
| 2550 | Ga0157372_10596319 | |||
| 2551 | Ga0157375_10000739 | |||
| 2552 | Ga0157375_10002597 | |||
| 2553 | Ga0157375_10267049 | |||
| 2554 | Ga0163163_10000004 | |||
| 2555 | Ga0163163_10016192 | |||
| 2556 | Ga0163163_10038829 | |||
| 2557 | Ga0163163_10122028 | |||
| 2558 | Ga0163163_10143263 | |||
| 2559 | Ga0163163_10385476 | |||
| 2560 | Ga0163163_10605586 | |||
| 2561 | Ga0157380_10015122 | |||
| 2562 | Ga0157380_10025451 | |||
| 2563 | Ga0157380_10028596 | |||
| 2564 | Ga0157380_10290042 | |||
| 2565 | Ga0157377_10003058 | |||
| 2566 | Ga0157377_10118821 | |||
| 2567 | Ga0157379_10000889 | |||
| 2568 | Ga0157379_10003386 | |||
| 2569 | Ga0157379_10003905 | |||
| 2570 | Ga0157379_10017982 | |||
| 2571 | Ga0157379_10038754 | |||
| 2572 | Ga0157379_10046028 | |||
| 2573 | Ga0157379_10080593 | |||
| 2574 | Ga0157379_10092652 | |||
| 2575 | Ga0157379_10101613 | |||
| 2576 | Ga0157379_10116547 | |||
| 2577 | Ga0157379_10138128 | |||
| 2578 | Ga0157379_10187561 | |||
| 2579 | Ga0157379_10267865 | |||
| 2580 | Ga0157379_10496408 | |||
| 2581 | Ga0157376_10000548 | |||
| 2582 | Ga0157376_10065610 | |||
| 2583 | Ga0157376_10099615 | |||
| 2584 | Ga0157376_10184750 | |||
| 2585 | Ga0157376_10386640 | |||
| 2586 | Ga0183365_10001 | |||
| 2587 | Ga0163161_10000549 | |||
| 2588 | Ga0163161_10004033 | |||
| 2589 | Ga0163161_10182406 | |||
| 2590 | Ga0206356_11633707 | |||
| 2591 | Ga0206352_10567578 | |||
| 2592 | Ga0213873_10024643 | |||
| 2593 | Ga0213872_10053344 | |||
| 2594 | Ga0213872_10108917 | |||
| 2595 | Ga0213874_10003223 | |||
| 2596 | Ga0213874_10007462 | |||
| 2597 | Ga0213874_10036580 | |||
| 2598 | Ga0213876_10000257 | |||
| 2599 | Ga0213876_10000423 | |||
| 2600 | Ga0213876_10008949 | |||
| 2601 | Ga0213876_10013999 | |||
| 2602 | Ga0213876_10039306 | |||
| 2603 | Ga0213876_10132363 | |||
| 2604 | Ga0213875_10000175 | |||
| 2605 | Ga0213875_10000580 | |||
| 2606 | Ga0213875_10001523 | |||
| 2607 | Ga0213875_10013115 | |||
| 2608 | Ga0213875_10041498 | |||
| 2609 | Ga0213871_10010846 | |||
| 2610 | Ga0209026_1009205 | |||
| 2611 | Ga0209026_1013307 | |||
| 2612 | Ga0209233_1000006 | |||
| 2613 | Ga0209233_1034431 | |||
| 2614 | Ga0209565_1000065 | |||
| 2615 | Ga0209673_1001051 | |||
| 2616 | Ga0209675_1001154 | |||
| 2617 | Ga0209676_1000043 | |||
| 2618 | Ga0209676_1000928 | |||
| 2619 | Ga0209676_1004405 | |||
| 2620 | Ga0209564_1022616 | |||
| 2621 | Ga0209758_1000008 | |||
| 2622 | Ga0209758_1001776 | |||
| 2623 | Ga0209758_1002436 | |||
| 2624 | Ga0209758_1003522 | |||
| 2625 | Ga0209050_1000095 | |||
| 2626 | Ga0209050_1000729 | |||
| 2627 | Ga0209050_1001088 | |||
| 2628 | Ga0209256_1001303 | |||
| 2629 | Ga0209256_1016688 | |||
| 2630 | Ga0209051_1001677 | |||
| 2631 | Ga0209257_1000036 | |||
| 2632 | Ga0209257_1000106 | |||
| 2633 | Ga0209257_1000184 | |||
| 2634 | Ga0209257_1000641 | |||
| 2635 | Ga0209257_1000979 | |||
| 2636 | Ga0207656_10015952 | |||
| 2637 | Ga0207696_1020376 | |||
| 2638 | Ga0207692_10007515 | |||
| 2639 | Ga0207692_10027461 | |||
| 2640 | Ga0207642_10190451 | |||
| 2641 | Ga0207710_10011535 | |||
| 2642 | Ga0207710_10020485 | |||
| 2643 | Ga0207710_10151745 | |||
| 2644 | Ga0207680_10000548 | |||
| 2645 | Ga0207680_10079277 | |||
| 2646 | Ga0207647_10030560 | |||
| 2647 | Ga0207685_10004123 | |||
| 2648 | Ga0207699_10046469 | |||
| 2649 | Ga0207699_10058059 | |||
| 2650 | Ga0207699_10061156 | |||
| 2651 | Ga0207699_10093545 | |||
| 2652 | Ga0207699_10206866 | |||
| 2653 | Ga0207645_10005726 | |||
| 2654 | Ga0207645_10039453 | |||
| 2655 | Ga0207645_10076314 | |||
| 2656 | Ga0207645_10284481 | |||
| 2657 | Ga0207643_10092736 | |||
| 2658 | Ga0207643_10178774 | |||
| 2659 | Ga0207705_10000039 | |||
| 2660 | Ga0207705_10002551 | |||
| 2661 | Ga0207705_10010984 | |||
| 2662 | Ga0207705_10042110 | |||
| 2663 | Ga0207705_10050295 | |||
| 2664 | Ga0207705_10059985 | |||
| 2665 | Ga0207705_10114476 | |||
| 2666 | Ga0207705_10132004 | |||
| 2667 | Ga0207684_10092116 | |||
| 2668 | Ga0207654_10088255 | |||
| 2669 | Ga0207654_10107385 | |||
| 2670 | Ga0207654_10117887 | |||
| 2671 | Ga0207707_10000001 | |||
| 2672 | Ga0207707_10010788 | |||
| 2673 | Ga0207707_10019058 | |||
| 2674 | Ga0207707_10030735 | |||
| 2675 | Ga0207707_10039792 | |||
| 2676 | Ga0207707_10041161 | |||
| 2677 | Ga0207707_10055055 | |||
| 2678 | Ga0207707_10106410 | |||
| 2679 | Ga0207707_10133498 | |||
| 2680 | Ga0207707_10162139 | |||
| 2681 | Ga0207707_10269466 | |||
| 2682 | Ga0207707_10295316 | |||
| 2683 | Ga0207707_10436937 | |||
| 2684 | Ga0207695_10000012 | |||
| 2685 | Ga0207695_10001649 | |||
| 2686 | Ga0207695_10016276 | |||
| 2687 | Ga0207695_10034422 | |||
| 2688 | Ga0207695_10085020 | |||
| 2689 | Ga0207695_10086922 | |||
| 2690 | Ga0207695_10099655 | |||
| 2691 | Ga0207695_10142285 | |||
| 2692 | Ga0207695_10154775 | |||
| 2693 | Ga0207695_10169773 | |||
| 2694 | Ga0207695_10175181 | |||
| 2695 | Ga0207695_10553224 | |||
| 2696 | Ga0207671_10023167 | |||
| 2697 | Ga0207671_10136664 | |||
| 2698 | Ga0207671_10361075 | |||
| 2699 | Ga0207693_10000127 | |||
| 2700 | Ga0207693_10000247 | |||
| 2701 | Ga0207693_10003312 | |||
| 2702 | Ga0207693_10036417 | |||
| 2703 | Ga0207693_10126511 | |||
| 2704 | Ga0207693_10155944 | |||
| 2705 | Ga0207663_10145553 | |||
| 2706 | Ga0207663_10208513 | |||
| 2707 | Ga0207660_10001305 | |||
| 2708 | Ga0207660_10006328 | |||
| 2709 | Ga0207660_10015367 | |||
| 2710 | Ga0207660_10016006 | |||
| 2711 | Ga0207660_10072410 | |||
| 2712 | Ga0207660_10113135 | |||
| 2713 | Ga0207660_10122663 | |||
| 2714 | Ga0207662_10000924 | |||
| 2715 | Ga0207662_10239392 | |||
| 2716 | Ga0207657_10000257 | |||
| 2717 | Ga0207657_10007684 | |||
| 2718 | Ga0207657_10020778 | |||
| 2719 | Ga0207657_10025453 | |||
| 2720 | Ga0207657_10144002 | |||
| 2721 | Ga0207657_10465423 | |||
| 2722 | Ga0207649_10000060 | |||
| 2723 | Ga0207649_10013244 | |||
| 2724 | Ga0207652_10000141 | |||
| 2725 | Ga0207652_10008279 | |||
| 2726 | Ga0207652_10019939 | |||
| 2727 | Ga0207652_10023480 | |||
| 2728 | Ga0207652_10040057 | |||
| 2729 | Ga0207652_10050093 | |||
| 2730 | Ga0207652_10133162 | |||
| 2731 | Ga0207652_10176071 | |||
| 2732 | Ga0207652_10183561 | |||
| 2733 | Ga0207652_10193823 | |||
| 2734 | Ga0207652_10585044 | |||
| 2735 | Ga0207646_10007200 | |||
| 2736 | Ga0207681_10027103 | |||
| 2737 | Ga0207681_10032279 | |||
| 2738 | Ga0207681_10045401 | |||
| 2739 | Ga0207694_10000006 | |||
| 2740 | Ga0207694_10001089 | |||
| 2741 | Ga0207694_10009327 | |||
| 2742 | Ga0207694_10021936 | |||
| 2743 | Ga0207694_10033316 | |||
| 2744 | Ga0207694_10070457 | |||
| 2745 | Ga0207694_10076221 | |||
| 2746 | Ga0207694_10272507 | |||
| 2747 | Ga0207650_10000030 | |||
| 2748 | Ga0207650_10002093 | |||
| 2749 | Ga0207650_10020912 | |||
| 2750 | Ga0207650_10143668 | |||
| 2751 | Ga0207650_10171248 | |||
| 2752 | Ga0207659_10235418 | |||
| 2753 | Ga0207659_10413649 | |||
| 2754 | Ga0207687_10015151 | |||
| 2755 | Ga0207687_10026527 | |||
| 2756 | Ga0207687_10057986 | |||
| 2757 | Ga0207687_10126975 | |||
| 2758 | Ga0207687_10192576 | |||
| 2759 | Ga0207687_10531749 | |||
| 2760 | Ga0207700_10002798 | |||
| 2761 | Ga0207700_10025473 | |||
| 2762 | Ga0207700_10088283 | |||
| 2763 | Ga0207700_10126616 | |||
| 2764 | Ga0207700_10163008 | |||
| 2765 | Ga0207664_10036901 | |||
| 2766 | Ga0207664_10150050 | |||
| 2767 | Ga0207664_10179688 | |||
| 2768 | Ga0207664_10285742 | |||
| 2769 | Ga0207644_10008376 | |||
| 2770 | Ga0207644_10026216 | |||
| 2771 | Ga0207644_10027526 | |||
| 2772 | Ga0207644_10136397 | |||
| 2773 | Ga0207644_10212491 | |||
| 2774 | Ga0207644_10417894 | |||
| 2775 | Ga0207690_10007048 | |||
| 2776 | Ga0207690_10014732 | |||
| 2777 | Ga0207690_10026365 | |||
| 2778 | Ga0207690_10156836 | |||
| 2779 | Ga0207690_10286902 | |||
| 2780 | Ga0207706_10000295 | |||
| 2781 | Ga0207706_10109953 | |||
| 2782 | Ga0207706_10176226 | |||
| 2783 | Ga0207686_10069922 | |||
| 2784 | Ga0207686_10077146 | |||
| 2785 | Ga0207686_10082644 | |||
| 2786 | Ga0207686_10224063 | |||
| 2787 | Ga0207709_10013293 | |||
| 2788 | Ga0207709_10015111 | |||
| 2789 | Ga0207709_10141093 | |||
| 2790 | Ga0207669_10004332 | |||
| 2791 | Ga0207669_10039227 | |||
| 2792 | Ga0207704_10004157 | |||
| 2793 | Ga0207704_10016025 | |||
| 2794 | Ga0207704_10018903 | |||
| 2795 | Ga0207704_10120333 | |||
| 2796 | Ga0207704_10184588 | |||
| 2797 | Ga0207665_10000664 | |||
| 2798 | Ga0207665_10105406 | |||
| 2799 | Ga0207665_10302314 | |||
| 2800 | Ga0207691_10005624 | |||
| 2801 | Ga0207711_10000001 | |||
| 2802 | Ga0207711_10000267 | |||
| 2803 | Ga0207711_10000919 | |||
| 2804 | Ga0207711_10011983 | |||
| 2805 | Ga0207711_10028457 | |||
| 2806 | Ga0207711_10070867 | |||
| 2807 | Ga0207711_10173241 | |||
| 2808 | Ga0207711_10210179 | |||
| 2809 | Ga0207711_10442267 | |||
| 2810 | Ga0207689_10005479 | |||
| 2811 | Ga0207689_10141879 | |||
| 2812 | Ga0207661_10224630 | |||
| 2813 | Ga0207661_10446046 | |||
| 2814 | Ga0207679_10004900 | |||
| 2815 | Ga0207679_10015049 | |||
| 2816 | Ga0207679_10111870 | |||
| 2817 | Ga0207679_10479158 | |||
| 2818 | Ga0207667_10034948 | |||
| 2819 | Ga0207667_10053661 | |||
| 2820 | Ga0207667_10087961 | |||
| 2821 | Ga0207667_10088796 | |||
| 2822 | Ga0207667_10100708 | |||
| 2823 | Ga0207667_10123750 | |||
| 2824 | Ga0207667_10133802 | |||
| 2825 | Ga0207667_10174150 | |||
| 2826 | Ga0207667_10304577 | |||
| 2827 | Ga0207667_10421216 | |||
| 2828 | Ga0207651_10015625 | |||
| 2829 | Ga0207651_10164882 | |||
| 2830 | Ga0207651_10353907 | |||
| 2831 | Ga0207712_10000683 | |||
| 2832 | Ga0207712_10002026 | |||
| 2833 | Ga0207712_10008618 | |||
| 2834 | Ga0207712_10025416 | |||
| 2835 | Ga0207712_10168464 | |||
| 2836 | Ga0207712_10172836 | |||
| 2837 | Ga0207712_10271074 | |||
| 2838 | Ga0207712_10333127 | |||
| 2839 | Ga0207668_10000010 | |||
| 2840 | Ga0207668_10000152 | |||
| 2841 | Ga0207668_10001656 | |||
| 2842 | Ga0207668_10006351 | |||
| 2843 | Ga0207668_10014968 | |||
| 2844 | Ga0207668_10141138 | |||
| 2845 | Ga0207668_10513245 | |||
| 2846 | Ga0207658_10000211 | |||
| 2847 | Ga0207658_10003894 | |||
| 2848 | Ga0207658_10006609 | |||
| 2849 | Ga0207658_10007025 | |||
| 2850 | Ga0207658_10034901 | |||
| 2851 | Ga0207658_10300139 | |||
| 2852 | Ga0207658_10489243 | |||
| 2853 | Ga0207677_10078267 | |||
| 2854 | Ga0207703_10000049 | |||
| 2855 | Ga0207703_10002309 | |||
| 2856 | Ga0207703_10002704 | |||
| 2857 | Ga0207703_10008329 | |||
| 2858 | Ga0207703_10064876 | |||
| 2859 | Ga0207703_10075251 | |||
| 2860 | Ga0207703_10437586 | |||
| 2861 | Ga0207639_10002055 | |||
| 2862 | Ga0207639_10010332 | |||
| 2863 | Ga0207639_10014521 | |||
| 2864 | Ga0207639_10075771 | |||
| 2865 | Ga0207639_10185022 | |||
| 2866 | Ga0207678_10000401 | |||
| 2867 | Ga0207678_10002715 | |||
| 2868 | Ga0207678_10003650 | |||
| 2869 | Ga0207678_10164574 | |||
| 2870 | Ga0207708_10000535 | |||
| 2871 | Ga0207708_10009632 | |||
| 2872 | Ga0207708_10064750 | |||
| 2873 | Ga0207708_10074469 | |||
| 2874 | Ga0207708_10141177 | |||
| 2875 | Ga0207708_10163300 | |||
| 2876 | Ga0207708_10192079 | |||
| 2877 | Ga0207708_10365733 | |||
| 2878 | Ga0207708_10398335 | |||
| 2879 | Ga0207702_10014870 | |||
| 2880 | Ga0207702_10062519 | |||
| 2881 | Ga0207702_10076898 | |||
| 2882 | Ga0207702_10160480 | |||
| 2883 | Ga0207702_10196741 | |||
| 2884 | Ga0207702_10259219 | |||
| 2885 | Ga0207641_10000011 | |||
| 2886 | Ga0207641_10001161 | |||
| 2887 | Ga0207641_10001597 | |||
| 2888 | Ga0207641_10044489 | |||
| 2889 | Ga0207641_10059513 | |||
| 2890 | Ga0207641_10275747 | |||
| 2891 | Ga0207641_10311955 | |||
| 2892 | Ga0207648_10007860 | |||
| 2893 | Ga0207648_10010475 | |||
| 2894 | Ga0207648_10042402 | |||
| 2895 | Ga0207676_10000095 | |||
| 2896 | Ga0207676_10003207 | |||
| 2897 | Ga0207676_10040508 | |||
| 2898 | Ga0207676_10063775 | |||
| 2899 | Ga0207676_10195228 | |||
| 2900 | Ga0207676_10215556 | |||
| 2901 | Ga0207674_10000524 | |||
| 2902 | Ga0207674_10001583 | |||
| 2903 | Ga0207674_10087264 | |||
| 2904 | Ga0207674_10092167 | |||
| 2905 | Ga0207674_10117784 | |||
| 2906 | Ga0207674_10184938 | |||
| 2907 | Ga0207675_100012361 | |||
| 2908 | Ga0207675_100042871 | |||
| 2909 | Ga0207675_100074800 | |||
| 2910 | Ga0207675_100136906 | |||
| 2911 | Ga0207675_100148779 | |||
| 2912 | Ga0207675_100203997 | |||
| 2913 | Ga0207675_100210459 | |||
| 2914 | Ga0207675_100302991 | |||
| 2915 | Ga0207683_10000416 | |||
| 2916 | Ga0207683_10006084 | |||
| 2917 | Ga0207683_10008739 | |||
| 2918 | Ga0207683_10013120 | |||
| 2919 | Ga0207683_10074459 | |||
| 2920 | Ga0207698_10090286 | |||
| 2921 | Ga0207698_10115779 | |||
| 2922 | Ga0209981_1000228 | |||
| 2923 | Ga0209984_1017703 | |||
| 2924 | Ga0210000_1004649 | |||
| 2925 | Ga0209983_1009790 | |||
| 2926 | Ga0209813_10000327 | |||
| 2927 | Ga0209813_10016463 | |||
| 2928 | Ga0209974_10042379 | |||
| 2929 | Ga0207428_10000235 | |||
| 2930 | Ga0207428_10004815 | |||
| 2931 | Ga0207428_10026155 | |||
| 2932 | Ga0207428_10040270 | |||
| 2933 | Ga0207428_10054598 | |||
| 2934 | Ga0268266_10000453 | |||
| 2935 | Ga0268266_10000551 | |||
| 2936 | Ga0268266_10000621 | |||
| 2937 | Ga0268266_10001015 | |||
| 2938 | Ga0268266_10032142 | |||
| 2939 | Ga0268266_10039501 | |||
| 2940 | Ga0268266_10040576 | |||
| 2941 | Ga0268266_10048617 | |||
| 2942 | Ga0268266_10057032 | |||
| 2943 | Ga0268266_10073664 | |||
| 2944 | Ga0268266_10101247 | |||
| 2945 | Ga0268266_10299680 | |||
| 2946 | Ga0268265_10001201 | |||
| 2947 | Ga0268265_10003906 | |||
| 2948 | Ga0268265_10013342 | |||
| 2949 | Ga0268265_10041738 | |||
| 2950 | Ga0268265_10076488 | |||
| 2951 | Ga0268265_10085941 | |||
| 2952 | Ga0268264_10000125 | |||
| 2953 | Ga0268264_10004262 | |||
| 2954 | Ga0268264_10025320 | |||
| 2955 | Ga0268264_10027689 | |||
| 2956 | Ga0268264_10047913 | |||
| 2957 | Ga0268264_10094662 | |||
| 2958 | Ga0268264_10299038 | |||
| 2959 | Ga0268264_10300407 | |||
| 2960 | Ga0268264_10304859 | |||
| 2961 | Ga0265337_1001829 | |||
| 2962 | Ga0265334_10010903 | |||
| 2963 | Ga0265334_10016579 | |||
| 2964 | Ga0265318_10000235 | |||
| 2965 | Ga0265318_10002471 | |||
| 2966 | Ga0307517_10000835 | |||
| 2967 | Ga0307517_10231575 | |||
| 2968 | Ga0307515_10066324 | |||
| 2969 | Ga0307515_10106806 | |||
| 2970 | Ga0307515_10259688 | |||
| 2971 | Ga0265338_10000043 | |||
| 2972 | Ga0265338_10005705 | |||
| 2973 | Ga0265338_10015424 | |||
| 2974 | Ga0265338_10020630 | |||
| 2975 | Ga0265338_10035573 | |||
| 2976 | Ga0265338_10039574 | |||
| 2977 | Ga0265338_10040541 | |||
| 2978 | Ga0265338_10082092 | |||
| 2979 | Ga0265338_10084214 | |||
| 2980 | Ga0265338_10128440 | |||
| 2981 | Ga0265338_10152077 | |||
| 2982 | Ga0265338_10192370 | |||
| 2983 | Ga0310981_1042390 | |||
| 2984 | Ga0307511_10033370 | |||
| 2985 | Ga0265760_10038615 | |||
| 2986 | Ga0265330_10002470 | |||
| 2987 | Ga0265330_10024699 | |||
| 2988 | Ga0265332_10011270 | |||
| 2989 | Ga0265332_10033467 | |||
| 2990 | Ga0265332_10088810 | |||
| 2991 | Ga0265328_10118179 | |||
| 2992 | Ga0265320_10074813 | |||
| 2993 | Ga0265325_10000002 | |||
| 2994 | Ga0265325_10001880 | |||
| 2995 | Ga0265325_10002687 | |||
| 2996 | Ga0265325_10070773 | |||
| 2997 | Ga0265340_10000353 | |||
| 2998 | Ga0265340_10001830 | |||
| 2999 | Ga0265340_10003755 | |||
| 3000 | Ga0265340_10086389 | |||
| 3001 | Ga0265340_10134287 | |||
| 3002 | Ga0265339_10000313 | |||
| 3003 | Ga0265339_10000763 | |||
| 3004 | Ga0265339_10018271 | |||
| 3005 | Ga0265339_10023677 | |||
| 3006 | Ga0265339_10106100 | |||
| 3007 | Ga0265339_10110046 | |||
| 3008 | Ga0265339_10131887 | |||
| 3009 | Ga0265331_10000049 | |||
| 3010 | Ga0265331_10000250 | |||
| 3011 | Ga0265331_10001017 | |||
| 3012 | Ga0265331_10002339 | |||
| 3013 | Ga0265331_10007204 | |||
| 3014 | Ga0265331_10011352 | |||
| 3015 | Ga0265331_10022694 | |||
| 3016 | Ga0265331_10052331 | |||
| 3017 | Ga0265331_10085035 | |||
| 3018 | Ga0265331_10106605 | |||
| 3019 | Ga0265327_10000007 | |||
| 3020 | Ga0265327_10000280 | |||
| 3021 | Ga0265327_10000771 | |||
| 3022 | Ga0265327_10004124 | |||
| 3023 | Ga0265327_10080192 | |||
| 3024 | Ga0265316_10007569 | |||
| 3025 | Ga0265316_10017960 | |||
| 3026 | Ga0265316_10041506 | |||
| 3027 | Ga0265316_10051397 | |||
| 3028 | Ga0265316_10066867 | |||
| 3029 | Ga0265316_10110083 | |||
| 3030 | Ga0265316_10168435 | |||
| 3031 | Ga0265316_10173466 | |||
| 3032 | Ga0307513_10001002 | |||
| 3033 | Ga0307513_10003622 | |||
| 3034 | Ga0307513_10013077 | |||
| 3035 | Ga0307513_10016442 | |||
| 3036 | Ga0307408_100038619 | |||
| 3037 | Ga0307408_100130898 | |||
| 3038 | Ga0307408_100196031 | |||
| 3039 | Ga0265313_10000665 | |||
| 3040 | Ga0265313_10001152 | |||
| 3041 | Ga0265313_10001900 | |||
| 3042 | Ga0265313_10001912 | |||
| 3043 | Ga0265313_10005546 | |||
| 3044 | Ga0265313_10009355 | |||
| 3045 | Ga0265313_10017490 | |||
| 3046 | Ga0265313_10023056 | |||
| 3047 | Ga0316575_10028152 | |||
| 3048 | Ga0316579_10018453 | |||
| 3049 | Ga0316579_10042471 | |||
| 3050 | Ga0316579_10066877 | |||
| 3051 | Ga0265314_10000624 | |||
| 3052 | Ga0265314_10003187 | |||
| 3053 | Ga0265314_10004046 | |||
| 3054 | Ga0265314_10013133 | |||
| 3055 | Ga0265314_10014558 | |||
| 3056 | Ga0265314_10015300 | |||
| 3057 | Ga0265314_10017417 | |||
| 3058 | Ga0265314_10089190 | |||
| 3059 | Ga0265314_10130186 | |||
| 3060 | Ga0265342_10013377 | |||
| 3061 | Ga0265342_10014194 | |||
| 3062 | Ga0265342_10030469 | |||
| 3063 | Ga0265342_10030996 | |||
| 3064 | Ga0265342_10052553 | |||
| 3065 | Ga0316576_10007695 | |||
| 3066 | Ga0316576_10016330 | |||
| 3067 | Ga0316576_10023907 | |||
| 3068 | Ga0316576_10035120 | |||
| 3069 | Ga0316576_10045230 | |||
| 3070 | Ga0316576_10146856 | |||
| 3071 | Ga0316578_10003781 | |||
| 3072 | Ga0316578_10016134 | |||
| 3073 | Ga0316578_10113747 | |||
| 3074 | Ga0307516_10013152 | |||
| 3075 | Ga0307516_10046918 | |||
| 3076 | Ga0307405_10422349 | |||
| 3077 | Ga0316577_10007617 | |||
| 3078 | Ga0316577_10053591 | |||
| 3079 | Ga0316577_10094327 | |||
| 3080 | Ga0316577_10100688 | |||
| 3081 | Ga0307413_10082170 | |||
| 3082 | Ga0307413_10148596 | |||
| 3083 | Ga0307410_10143194 | |||
| 3084 | Ga0307406_10000448 | |||
| 3085 | Ga0307406_10148259 | |||
| 3086 | Ga0307407_10056838 | |||
| 3087 | Ga0307412_10210208 | |||
| 3088 | Ga0307412_10272581 | |||
| 3089 | Ga0307409_100038917 | |||
| 3090 | Ga0307416_100191680 | |||
| 3091 | Ga0307416_100705342 | |||
| 3092 | Ga0316585_10006235 | |||
| 3093 | Ga0316585_10034545 | |||
| 3094 | Ga0316580_10004852 | |||
| 3095 | Ga0316580_10015818 | |||
| 3096 | Ga0307510_10019906 | |||
| 3097 | Ga0316592_1011005 | |||
| 3098 | Ga0316596_1001927 | |||
| 3099 | Ga0373930_0038171 | |||
| 3100 | Ga0373948_0027857 | |||
| 3101 | Ga0373938_0008082 | |||
| 3102 | Ga0373934_0022896 | |||
| 3103 | Ga0373934_0040695 | |||
| 3104 | Ga0373934_0159156 | |||
| 3105 | Ga0373923_0033188 | |||
| 3106 | Ga0373932_0006725 | |||
| 3107 | Ga0373936_0014842 | |||
| 3108 | Ga0373941_0006359 | |||
| 3109 | Ga0373945_0052781 | |||
| 3110 | Ga0373945_0061247 | |||
| 3111 | Ga0373954_0019886 | |||
| 3112 | Ga0373956_0055627 | |||
| 3113 | Ga0373956_0075914 | |||
| 3114 | Ga0373960_0010106 | |||
| 3115 | Ga0373960_0021937 | |||
| 3116 | Ga0373943_0012466 | |||
| 3117 | Ga0373943_0038009 | |||
| 3118 | Ga0373955_0015773 | |||
| 3119 | Ga0373942_0036883 | |||
| 3120 | Ga0373961_0017262 | |||
| 3121 | Ga0373961_0043369 | |||
| 3122 | Ga0373962_0009720 | |||
| 3123 | Ga0316574_0028279 | |||
| 3124 | Ga0316574_0090702 | |||
| 3125 | Ga0373931_0001346 | |||
| 3126 | Ga0373931_0001932 | |||
| 3127 | Ga0373931_0002117 | |||
| 3128 | Ga0373931_0005624 | |||
| 3129 | Ga0373935_0149843 | |||
| 3130 | Ga0373935_0152573 | |||
| 3131 | Ga0373935_0309551 | |||
| 3132 | Ga0373927_0000731 | |||
| 3133 | Ga0373927_0013684 | |||
| 3134 | Ga0373927_0015215 | |||
| 3135 | Ga0373927_0037518 | |||
| 3136 | Ga0373927_0070795 | |||
| 3137 | Ga0373933_0017460 | |||
| 3138 | Ga0373933_0034003 | |||
| 3139 | Ga0373933_0066885 | |||
| 3140 | Ga0373947_0018153 | |||
| 3141 | Ga0373947_0062984 | |||
| 3142 | Ga0373947_0096239 | |||
| 3143 | Ga0373947_0155237 | |||
| 3144 | Ga0373947_0274113 | |||
| 3145 | Ga0373937_0001423 | |||
| 3146 | Ga0373937_0002342 | |||
| 3147 | Ga0373937_0002962 | |||
| 3148 | Ga0373937_0003675 | |||
| 3149 | Ga0373937_0026345 | |||
| 3150 | Ga0373937_0061345 | |||
| 3151 | Ga0373937_0115599 | |||
| 3152 | Ga0373937_0121846 | |||
| 3153 | Ga0373937_0131952 | |||
| 3154 | Ga0373937_0154255 | |||
| 3155 | Ga0373937_0367853 | |||
| 3156 | Ga0373937_0662347 | |||
| 3157 | Ga0373937_0663393 | |||
| 3158 | Ga0316582_0012360 | |||
| 3159 | Ga0316582_0052854 | |||
| 3160 | Ga0316582_0115571 | |||
| 3161 | Ga0316582_0147545 | |||
| 3162 | Ga0316582_0213057 | |||
| 3163 | Ga0316584_0000315 | |||
| 3164 | Ga0316584_0028549 | |||
| 3165 | Ga0316584_0033689 | |||
| 3166 | Ga0316584_0044380 | |||
| 3167 | Ga0316584_0169650 | |||
| 3168 | Ga0373925_0000049 | |||
| 3169 | Ga0373925_0020859 | |||
| 3170 | Ga0373925_0034949 | |||
| 3171 | Ga0373925_0055440 | |||
| 3172 | Ga0373925_0063554 | |||
| 3173 | Ga0373925_0196098 | |||
| 3174 | Ga0373925_0216804 | |||
| 3175 | Ga0373925_0373098 | |||
| 3176 | Ga0395899_0000018 | |||
| 3177 | Ga0395899_0001404 | |||
| 3178 | Ga0395899_0027182 | |||
| 3179 | Ga0395899_0034035 | |||
| 3180 | Ga0395899_0036915 | |||
| 3181 | Ga0395899_0117030 | |||
| 3182 | Ga0395899_0150529 | |||
| 3183 | Ga0395900_0000072 | |||
| 3184 | Ga0395900_0007333 | |||
| 3185 | Ga0395900_0013029 | |||
| 3186 | Ga0395900_0032387 | |||
| 3187 | Ga0395900_0041435 | |||
| 3188 | Ga0395900_0044633 | |||
| 3189 | Ga0395900_0054353 | |||
| 3190 | Ga0395900_0171116 | |||
| 3191 | Ga0395900_0212715 | |||
| 3192 | Ga0395900_0230183 | |||
| 3193 | Ga0395898_0013476 | |||
| 3194 | Ga0395898_0017819 | |||
| 3195 | Ga0395898_0017968 | |||
| 3196 | Ga0395898_0022634 | |||
| 3197 | Ga0395898_0033282 | |||
| 3198 | Ga0395898_0052976 | |||
| 3199 | Ga0395898_0143321 | |||
| 3200 | Ga0395898_0149035 | |||
| 3201 | Ga0395898_0180037 | |||
| 3202 | Ga0395898_0317207 | |||
| 3203 | Ga0395905_0002499 | |||
| 3204 | Ga0395905_0003717 | |||
| 3205 | Ga0395905_0025761 | |||
| 3206 | Ga0395905_0033855 | |||
| 3207 | Ga0395905_0050626 | |||
| 3208 | Ga0395905_0131441 | |||
| 3209 | Ga0436364_0086082 | |||
| 3210 | Ga0436364_0160208 | |||
| 3211 | Ga0436364_0167282 | |||
| 3212 | Ga0436364_0210663 | |||
| 3213 | Ga0436364_0534280 | |||
| 3214 | Ga0436364_0595239 | |||
| 3215 | Ga0436364_0711284 | |||
| 3216 | Ga0436364_0727525 | |||
| 3217 | Ga0436364_0783603 | |||
| 3218 | Ga0436364_1216533 | |||
| 3219 | Ga0436364_1348565 | |||
| 3220 | Ga0436364_1376752 | |||
| 3221 | Ga0436364_1490963 | |||
| 3222 | Ga0395901_0006683 | |||
| 3223 | Ga0395901_0015122 | |||
| 3224 | Ga0395901_0075498 | |||
| 3225 | Ga0395901_0161651 | |||
| 3226 | Ga0395901_0188810 | |||
| 3227 | Ga0395901_0390296 | |||
| 3228 | Ga0400485_11815 | |||
| 3229 | Ga0400483_032686 | |||
| 3230 | Ga0400483_140078 | |||
| 3231 | Ga0400483_173548 | |||
| 3232 | Ga0400483_203337 | |||
| 3233 | Ga0400483_277787 | |||
| 3234 | Ga0400487_06748 | |||
| 3235 | Ga0436365_0120856 | |||
| 3236 | Ga0436365_0298223 | |||
| 3237 | Ga0436365_0364034 | |||
| 3238 | Ga0436365_0422279 | |||
| 3239 | Ga0436365_0439594 | |||
| 3240 | Ga0436365_0458221 | |||
| 3241 | Ga0436365_0486465 | |||
| 3242 | Ga0436365_0588205 | |||
| 3243 | Ga0436365_0653853 | |||
| 3244 | Ga0436365_0994541 | |||
| 3245 | Ga0436365_1478328 | |||
| 3246 | Ga0436365_1638122 | |||
| 3247 | Ga0436360_0305107 | |||
| 3248 | Ga0436360_0670466 | |||
| 3249 | Ga0436360_0771010 | |||
| 3250 | Ga0436360_0787345 | |||
| 3251 | Ga0436360_0808839 | |||
| 3252 | Ga0436360_1157040 | |||
| 3253 | Ga0436361_0077926 | |||
| 3254 | Ga0436361_0382143 | |||
| 3255 | Ga0436361_0455600 | |||
| 3256 | Ga0436361_0458313 | |||
| 3257 | Ga0436361_0468973 | |||
| 3258 | Ga0436361_0553807 | |||
| 3259 | Ga0436361_0623924 | |||
| 3260 | Ga0436361_0643175 | |||
| 3261 | Ga0436361_0714426 | |||
| 3262 | Ga0436363_0221619 | |||
| 3263 | Ga0436363_0261799 | |||
| 3264 | Ga0436363_0407094 | |||
| 3265 | Ga0436363_0434034 | |||
| 3266 | Ga0436363_0908068 | |||
| 3267 | Ga0436363_1083955 | |||
| 3268 | Ga0436363_1184338 | |||
| 3269 | Ga0436363_1589623 | |||
| 3270 | Ga0436363_1639159 | |||
| 3271 | Ga0436362_0132298 | |||
| 3272 | Ga0436362_0706265 | |||
| 3273 | Ga0436362_1295071 | |||
| 3274 | Ga0439431_0043840 | |||
| 3275 | Ga0439441_027275 | |||
| 3276 | Ga0439458_0036343 | |||
| 3277 | Ga0439435_0037066 | |||
| 3278 | Ga0439459_0036595 | |||
| 3279 | Ga0450916_006125 | |||
| 3280 | Ga0450901_003488 | |||
| 3281 | Ga0451577_0022138 | |||
| 3282 | Ga0451577_0420130 | |||
| 3283 | Ga0466969_0000722 | |||
| 3284 | Ga0466966_0050018 | |||
| 3285 | Ga0466961_0001425 | |||
| 3286 | Ga0466963_0057966 | |||
| 3287 | Ga0466963_0062811 | |||
| 3288 | Ga0453684_0043324 | |||
| 3289 | Ga0466971_0009671 | |||
| 3290 | Ga0466970_0009156 | |||
| 3291 | Ga0466957_0031207 | |||
| 3292 | Ga0466960_0035913 | |||
| 3293 | Ga0466959_0000040 | |||
| 3294 | Ga0466959_0153490 | |||
| 3295 | Ga0451576_0000537 | |||
| 3296 | Ga0451576_0005502 | |||
| 3297 | Ga0451576_0047456 | |||
| 3298 | Ga0451576_0408413 | |||
| 3299 | Ga0466958_0026837 | |||
| 3300 | Ga0466967_0041270 | |||
| 3301 | Ga0466967_0127232 | |||
| 3302 | Ga0466967_0270461 | |||
| 3303 | Ga0495627_004351 | |||
| 3304 | Ga0495592_0017429 | |||
| 3305 | Ga0495603_0001208 | |||
| 3306 | Ga0495603_0044314 | |||
| 3307 | Ga0495590_0000622 | |||
| 3308 | Ga0495629_0018635 | |||
| 3309 | Ga0495629_0046189 | |||
| 3310 | Ga0495638_0000147 | |||
| 3311 | Ga0495638_0004669 | |||
| 3312 | Ga0495638_0005127 | |||
| 3313 | Ga0495638_0016403 | |||
| 3314 | Ga0495638_0082840 | |||
| 3315 | Ga0495641_0013557 | |||
| 3316 | Ga0495651_0046441 | |||
| 3317 | Ga0495651_0220274 | |||
| 3318 | Ga0495651_0307631 | |||
| 3319 | Ga0495650_0000045 | |||
| 3320 | Ga0495580_0000261 | |||
| 3321 | Ga0495582_0002712 | |||
| 3322 | Ga0495582_0294715 | |||
| 3323 | Ga0495639_0011317 | |||
| 3324 | Ga0495664_0030612 | |||
| 3325 | Ga0495664_0116888 | |||
| 3326 | Ga0495664_0213607 | |||
| 3327 | Ga0495594_0001016 | |||
| 3328 | Ga0495594_0073681 | |||
| 3329 | Ga0495607_0192119 | |||
| 3330 | Ga0495583_0000005 | |||
| 3331 | Ga0495583_0048378 | |||
| 3332 | Ga0495606_0004052 | |||
| 3333 | Ga0495606_0117612 | |||
| 3334 | Ga0495608_0037550 | |||
| 3335 | Ga0495610_0000101 | |||
| 3336 | Ga0495616_0000905 | |||
| 3337 | Ga0495620_0088411 | |||
| 3338 | Ga0495628_0053545 | |||
| 3339 | Ga0495630_0196782 | |||
| 3340 | Ga0495631_0002661 | |||
| 3341 | Ga0495637_0007923 | |||
| 3342 | Ga0495637_0053066 | |||
| 3343 | Ga0495648_0000575 | |||
| 3344 | Ga0495642_0001834 | |||
| 3345 | Ga0495652_0058906 | |||
| 3346 | Ga0495652_0129079 | |||
| 3347 | Ga0495652_0167787 | |||
| 3348 | Ga0495652_0172039 | |||
| 3349 | Ga0495654_0000018 | |||
| 3350 | Ga0495665_0005634 | |||
| 3351 | Ga0495640_0122730 | |||
| 3352 | Ga0495640_0165127 | |||
| 3353 | Ga0495640_0187228 | |||
| 3354 | Ga0495586_0148968 | |||
| 3355 | Ga0495609_0035053 | |||
| 3356 | Ga0495597_0012047 | |||
| 3357 | Ga0495645_0001337 | |||
| 3358 | Ga0495645_0102392 | |||
| 3359 | Ga0495622_0003259 | |||
| 3360 | Ga0495622_0024063 | |||
| 3361 | Ga0495633_0000314 | |||
| 3362 | Ga0495633_0086677 | |||
| 3363 | Ga0495667_0006560 | |||
| 3364 | Ga0495668_0000061 | |||
| 3365 | Ga0495668_0005125 | |||
| 3366 | Ga0495668_0007234 | |||
| 3367 | Ga0495668_0016736 | |||
| 3368 | Ga0495668_0044770 | |||
| 3369 | Ga0495668_0063383 | |||
| 3370 | Ga0495668_0096547 | |||
| 3371 | Ga0495668_0188062 | |||
| 3372 | Ga0495634_0009907 | |||
| 3373 | Ga0495611_0116876 | |||
| 3374 | Ga0495625_0004160 | |||
| 3375 | Ga0495625_0005790 | |||
| 3376 | Ga0495625_0006681 | |||
| 3377 | Ga0495625_0009050 | |||
| 3378 | Ga0495625_0024749 | |||
| 3379 | Ga0495635_0027669 | |||
| 3380 | Ga0495635_0065013 | |||
| 3381 | Ga0495635_0118428 | |||
| 3382 | Ga0495635_0189477 | |||
| 3383 | Ga0495635_0249315 | |||
| 3384 | Ga0495588_0013850 | |||
| 3385 | Ga0495647_0007552 | |||
| 3386 | Ga0495658_0004453 | |||
| 3387 | Ga0495658_0030155 | |||
| 3388 | Ga0495658_0103244 | |||
| 3389 | Ga0495658_0116266 | |||
| 3390 | Ga0495669_0000002 | |||
| 3391 | Ga0495669_0000369 | |||
| 3392 | Ga0495613_0000707 | |||
| 3393 | Ga0495613_0003535 | |||
| 3394 | Ga0495649_0000627 | |||
| 3395 | Ga0495589_0130981 | |||
| 3396 | Ga0495660_0004741 | |||
| 3397 | Ga0495581_0000368 | |||
| 3398 | Ga0495581_0021429 | |||
| 3399 | Ga0495604_0137403 | |||
| 3400 | Ga0495604_0202824 | |||
| 3401 | Ga0495674_0126448 | |||
| 3402 | Ga0495672_0001490 | |||
| 3403 | Ga0495672_0007884 | |||
| 3404 | Ga0495683_0059907 | |||
| 3405 | Ga0495687_013678 | |||
| 3406 | Ga0495673_0000119 | |||
| 3407 | Ga0495673_0000264 | |||
| 3408 | Ga0495681_0124370 | |||
| 3409 | Ga0495684_0061528 | |||
| 3410 | Ga0495684_0100602 | |||
| 3411 | Ga0495684_0263219 | |||
| 3412 | Ga0495686_0000096 | |||
| 3413 | Ga0495686_0001221 | |||
| 3414 | Ga0495686_0003784 | |||
| 3415 | Ga0495686_0026999 | |||
| 3416 | Ga0495686_0027289 | |||
| 3417 | Ga0495686_0049096 | |||
| 3418 | Ga0495686_0112000 | |||
| 3419 | Ga0495593_0003713 | |||
| 3420 | Ga0495593_0188398 | |||
| 3421 | Ga0495602_0011229 | |||
| 3422 | Ga0495602_0362417 | |||
| 3423 | Ga0495614_0011074 | |||
| 3424 | Ga0496100_0000888 | |||
| 3425 | Ga0496100_0016389 | |||
| 3426 | Ga0496100_0214973 | |||
| 3427 | Ga0496101_0005049 | |||
| 3428 | Ga0496101_0025576 | |||
| 3429 | Ga0496101_0086661 | |||
| 3430 | Ga0496101_0159197 | |||
| 3431 | Ga0496102_0014500 | |||
| 3432 | Ga0496102_0044401 | |||
| 3433 | Ga0496102_0045269 | |||
| 3434 | Ga0496102_0057144 | |||
| 3435 | Ga0496102_0129891 | |||
| 3436 | Ga0496102_0358026 | |||
| 3437 | Ga0496103_0051190 | |||
| 3438 | Ga0496104_0000175 | |||
| 3439 | Ga0496104_0007205 | |||
| 3440 | Ga0496104_0032624 | |||
| 3441 | Ga0496104_0045404 | |||
| 3442 | Ga0496104_0076235 | |||
| 3443 | Ga0496104_0128702 | |||
| 3444 | Ga0496104_0198346 | |||
| 3445 | Ga0496104_0294277 | |||
| 3446 | Ga0496105_0010602 | |||
| 3447 | Ga0496105_0014060 | |||
| 3448 | Ga0496105_0016830 | |||
| 3449 | Ga0496105_0048042 | |||
| 3450 | Ga0496105_0324425 | |||
| 3451 | Ga0496106_0007110 | |||
| 3452 | Ga0496106_0007877 | |||
| 3453 | Ga0496106_0012041 | |||
| 3454 | Ga0496106_0020304 | |||
| 3455 | Ga0496106_0159017 | |||
| 3456 | Ga0496107_0001574 | |||
| 3457 | Ga0496107_0006517 | |||
| 3458 | Ga0496107_0022536 | |||
| 3459 | Ga0496107_0097844 | |||
| 3460 | Ga0496107_0341440 | |||
| 3461 | Ga0496107_0500874 | |||
| 3462 | Ga0496108_0006491 | |||
| 3463 | Ga0496108_0016024 | |||
| 3464 | Ga0496108_0047229 | |||
| 3465 | Ga0496108_0064110 | |||
| 3466 | Ga0496108_0513180 | |||
| 3467 | Ga0496109_0003143 | |||
| 3468 | Ga0496109_0028937 | |||
| 3469 | Ga0496109_0041855 | |||
| 3470 | Ga0496109_0200967 | |||
| 3471 | Ga0496109_0297055 | |||
| 3472 | Ga0496110_0000549 | |||
| 3473 | Ga0496110_0007751 | |||
| 3474 | Ga0496110_0082000 | |||
| 3475 | Ga0496110_0162415 | |||
| 3476 | Ga0496110_0203572 | |||
| 3477 | Ga0496111_0006678 | |||
| 3478 | Ga0496111_0025793 | |||
| 3479 | Ga0496111_0138676 | |||
| 3480 | Ga0496111_0328516 | |||
| 3481 | Ga0496111_0415729 | |||
| 3482 | Ga0496112_0010229 | |||
| 3483 | Ga0496112_0015256 | |||
| 3484 | Ga0496112_0037705 | |||
| 3485 | Ga0496112_0041350 | |||
| 3486 | Ga0496112_0045837 | |||
| 3487 | Ga0496112_0079257 | |||
| 3488 | Ga0496112_0108721 | |||
| 3489 | Ga0496112_0396084 | |||
| 3490 | Ga0496113_0004354 | |||
| 3491 | Ga0496113_0029421 | |||
| 3492 | Ga0496113_0048824 | |||
| 3493 | Ga0496113_0282940 | |||
| 3494 | Ga0496114_0000794 | |||
| 3495 | Ga0496114_0007626 | |||
| 3496 | Ga0496114_0420852 | |||
| 3497 | Ga0496115_0000050 | |||
| 3498 | Ga0496115_0000862 | |||
| 3499 | Ga0496115_0008977 | |||
| 3500 | Ga0496115_0010603 | |||
| 3501 | Ga0496115_0010863 | |||
| 3502 | Ga0496115_0033370 | |||
| 3503 | Ga0496115_0266317 | |||
| 3504 | Ga0496115_0368245 | |||
| 3505 | Ga0496118_0012536 | |||
| 3506 | Ga0496119_0031855 | |||
| 3507 | Ga0496121_0000397 | |||
| 3508 | Ga0496121_0001859 | |||
| 3509 | Ga0496121_0004198 | |||
| 3510 | Ga0496121_0115248 | |||
| 3511 | Ga0496121_0228241 | |||
| 3512 | Ga0496122_0251081 | |||
| 3513 | Ga0496123_0001218 | |||
| 3514 | Ga0496124_0018292 | |||
| 3515 | Ga0496126_0002022 | |||
| 3516 | Ga0495678_001567 | |||
| 3517 | Ga0495682_0001979 | |||
| 3518 | Ga0495682_0009967 | |||
| 3519 | Ga0501031_0020902 | |||
| 3520 | Ga0501031_0050146 | |||
| 3521 | Ga0501031_0063777 | |||
| 3522 | Ga0501031_0103794 | |||
| 3523 | Ga0501031_0161821 | |||
| 3524 | Ga0501032_0000393 | |||
| 3525 | Ga0501032_0001085 | |||
| 3526 | Ga0501032_0009467 | |||
| 3527 | Ga0501032_0099046 | |||
| 3528 | Ga0501033_0003745 | |||
| 3529 | Ga0501033_0021039 | |||
| 3530 | Ga0501033_0069486 | |||
| 3531 | Ga0501033_0100456 | |||
| 3532 | Ga0501033_0116310 | |||
| 3533 | Ga0501033_0213882 | |||
| 3534 | Ga0501033_0350485 | |||
| 3535 | Ga0501034_0000166 | |||
| 3536 | Ga0501034_0000293 | |||
| 3537 | Ga0501034_0002384 | |||
| 3538 | Ga0501034_0009371 | |||
| 3539 | Ga0501034_0022687 | |||
| 3540 | Ga0501034_0024173 | |||
| 3541 | Ga0501034_0036607 | |||
| 3542 | Ga0501034_0036636 | |||
| 3543 | Ga0501034_0042735 | |||
| 3544 | Ga0501034_0061556 | |||
| 3545 | Ga0501034_0065142 | |||
| 3546 | Ga0501034_0077613 | |||
| 3547 | Ga0501034_0188727 | |||
| 3548 | Ga0501034_0350030 | |||
| 3549 | Ga0501034_0373545 | |||
| 3550 | Ga0501034_0524502 | |||
| 3551 | Ga0501034_0599294 | |||
| 3552 | Ga0501036_0000573 | |||
| 3553 | Ga0501036_0019277 | |||
| 3554 | Ga0501036_0056835 | |||
| 3555 | Ga0501036_0059651 | |||
| 3556 | Ga0501036_0089297 | |||
| 3557 | Ga0501036_0092941 | |||
| 3558 | Ga0501036_0166261 | |||
| 3559 | Ga0501036_0223847 | |||
| 3560 | Ga0501037_0001135 | |||
| 3561 | Ga0501037_0019417 | |||
| 3562 | Ga0501037_0042986 | |||
| 3563 | Ga0501037_0133980 | |||
| 3564 | Ga0501037_0287301 | |||
| 3565 | Ga0501038_0020349 | |||
| 3566 | Ga0501038_0033540 | |||
| 3567 | Ga0501038_0074234 | |||
| 3568 | Ga0501038_0285909 | |||
| 3569 | Ga0501039_0000452 | |||
| 3570 | Ga0501039_0034178 | |||
| 3571 | Ga0501039_0079424 | |||
| 3572 | Ga0501039_0090104 | |||
| 3573 | Ga0501039_0178252 | |||
| 3574 | Ga0501039_0359488 | |||
| 3575 | Ga0501040_0000753 | |||
| 3576 | Ga0501040_0004689 | |||
| 3577 | Ga0501040_0025592 | |||
| 3578 | Ga0501040_0042041 | |||
| 3579 | Ga0501040_0132240 | |||
| 3580 | Ga0501040_0296136 | |||
| 3581 | Ga0501041_0015930 | |||
| 3582 | Ga0501041_0019141 | |||
| 3583 | Ga0501041_0164405 | |||
| 3584 | Ga0501042_0014718 | |||
| 3585 | Ga0501042_0085769 | |||
| 3586 | Ga0501042_0117858 | |||
| 3587 | Ga0501042_0218263 | |||
| 3588 | Ga0501042_0258461 | |||
| 3589 | Ga0501043_0009819 | |||
| 3590 | Ga0501043_0014748 | |||
| 3591 | Ga0501043_0033540 | |||
| 3592 | Ga0501043_0060434 | |||
| 3593 | Ga0501043_0077234 | |||
| 3594 | Ga0501043_0078731 | |||
| 3595 | Ga0501043_0115030 | |||
| 3596 | Ga0501043_0116875 | |||
| 3597 | Ga0501043_0257498 | |||
| 3598 | Ga0501043_0339544 | |||
| 3599 | Ga0501046_0000224 | |||
| 3600 | Ga0501046_0001372 | |||
| 3601 | Ga0501046_0003178 | |||
| 3602 | Ga0501046_0014585 | |||
| 3603 | Ga0501046_0034673 | |||
| 3604 | Ga0501046_0040933 | |||
| 3605 | Ga0501046_0073657 | |||
| 3606 | Ga0501046_0203757 | |||
| 3607 | Ga0501047_0000283 | |||
| 3608 | Ga0501047_0000643 | |||
| 3609 | Ga0501047_0002385 | |||
| 3610 | Ga0501047_0012475 | |||
| 3611 | Ga0501047_0017227 | |||
| 3612 | Ga0501047_0026443 | |||
| 3613 | Ga0501047_0026914 | |||
| 3614 | Ga0501047_0029202 | |||
| 3615 | Ga0501047_0041630 | |||
| 3616 | Ga0501047_0068585 | |||
| 3617 | Ga0501047_0073181 | |||
| 3618 | Ga0501047_0372289 | |||
| 3619 | Ga0501048_0000649 | |||
| 3620 | Ga0501048_0017618 | |||
| 3621 | Ga0501048_0126057 | |||
| 3622 | Ga0501048_0139986 | |||
| 3623 | Ga0501048_0143658 | |||
| 3624 | Ga0501067_0000034 | |||
| 3625 | Ga0501067_0001137 | |||
| 3626 | Ga0501067_0001833 | |||
| 3627 | Ga0501067_0007840 | |||
| 3628 | Ga0501067_0010141 | |||
| 3629 | Ga0501068_0027576 | |||
| 3630 | Ga0501068_0078899 | |||
| 3631 | Ga0501068_0174240 | |||
| 3632 | Ga0501068_0180178 | |||
| 3633 | Ga0501069_0005268 | |||
| 3634 | Ga0501069_0017674 | |||
| 3635 | Ga0501069_0020008 | |||
| 3636 | Ga0501069_0031051 | |||
| 3637 | Ga0501070_0006852 | |||
| 3638 | Ga0501070_0013555 | |||
| 3639 | Ga0501070_0042188 | |||
| 3640 | Ga0501070_0052496 | |||
| 3641 | Ga0501070_0185107 | |||
| 3642 | Ga0501071_0022728 | |||
| 3643 | Ga0501071_0086866 | |||
| 3644 | Ga0501071_0111696 | |||
| 3645 | Ga0501071_0142669 | |||
| 3646 | Ga0501071_0220018 | |||
| 3647 | Ga0501071_0289678 | |||
| 3648 | Ga0501072_0017631 | |||
| 3649 | Ga0501072_0026088 | |||
| 3650 | Ga0501072_0032705 | |||
| 3651 | Ga0501072_0041455 | |||
| 3652 | Ga0501072_0041762 | |||
| 3653 | Ga0501072_0069545 | |||
| 3654 | Ga0501072_0088646 | |||
| 3655 | Ga0501072_0109945 | |||
| 3656 | Ga0501072_0114876 | |||
| 3657 | Ga0501072_0173038 | |||
| 3658 | Ga0501072_0262635 | |||
| 3659 | Ga0501072_0377622 | |||
| 3660 | Ga0501073_0000013 | |||
| 3661 | Ga0501073_0001616 | |||
| 3662 | Ga0501073_0013717 | |||
| 3663 | Ga0501073_0022747 | |||
| 3664 | Ga0501073_0066687 | |||
| 3665 | Ga0501073_0146604 | |||
| 3666 | Ga0501073_0149174 | |||
| 3667 | Ga0501073_0244677 | |||
| 3668 | Ga0501073_0282778 | |||
| 3669 | Ga0501074_0022336 | |||
| 3670 | Ga0501074_0069593 | |||
| 3671 | Ga0501074_0141173 | |||
| 3672 | Ga0501074_0219711 | |||
| 3673 | Ga0501074_0264619 | |||
| 3674 | Ga0501074_0312973 | |||
| 3675 | Ga0501075_0001958 | |||
| 3676 | Ga0501075_0007759 | |||
| 3677 | Ga0501075_0035010 | |||
| 3678 | Ga0501075_0037459 | |||
| 3679 | Ga0501075_0071646 | |||
| 3680 | Ga0501075_0077203 | |||
| 3681 | Ga0501075_0180931 | |||
| 3682 | Ga0501076_0002771 | |||
| 3683 | Ga0501076_0076938 | |||
| 3684 | Ga0501076_0078153 | |||
| 3685 | Ga0501076_0103508 | |||
| 3686 | Ga0501076_0113893 | |||
| 3687 | Ga0501076_0343798 | |||
| 3688 | Ga0501076_0391467 | |||
| 3689 | Ga0501077_0000032 | |||
| 3690 | Ga0501077_0003508 | |||
| 3691 | Ga0501077_0048318 | |||
| 3692 | Ga0501077_0051285 | |||
| 3693 | Ga0501077_0057879 | |||
| 3694 | Ga0501077_0069657 | |||
| 3695 | Ga0501077_0072007 | |||
| 3696 | Ga0501077_0149333 | |||
| 3697 | Ga0501077_0201904 | |||
| 3698 | Ga0501077_0309142 | |||
| 3699 | Ga0501079_0001097 | |||
| 3700 | Ga0501079_0012147 | |||
| 3701 | Ga0501079_0075110 | |||
| 3702 | Ga0501079_0076925 | |||
| 3703 | Ga0501079_0077944 | |||
| 3704 | Ga0501079_0101057 | |||
| 3705 | Ga0501079_0140582 | |||
| 3706 | Ga0501079_0356933 | |||
| 3707 | Ga0501080_0000315 | |||
| 3708 | Ga0501080_0002921 | |||
| 3709 | Ga0501080_0004237 | |||
| 3710 | Ga0501080_0006226 | |||
| 3711 | Ga0501080_0024099 | |||
| 3712 | Ga0501080_0025399 | |||
| 3713 | Ga0501080_0070328 | |||
| 3714 | Ga0501080_0083070 | |||
| 3715 | Ga0501080_0122642 | |||
| 3716 | Ga0501080_0126788 | |||
| 3717 | Ga0501080_0182576 | |||
| 3718 | Ga0501080_0248969 | |||
| 3719 | Ga0501080_0250153 | |||
| 3720 | Ga0501080_0447353 | |||
| 3721 | Ga0501080_0511549 | |||
| 3722 | Ga0501081_0000197 | |||
| 3723 | Ga0501081_0004838 | |||
| 3724 | Ga0501081_0006179 | |||
| 3725 | Ga0501081_0014493 | |||
| 3726 | Ga0501081_0048475 | |||
| 3727 | Ga0501081_0068946 | |||
| 3728 | Ga0501081_0156971 | |||
| 3729 | Ga0501081_0256298 | |||
| 3730 | Ga0501083_0006676 | |||
| 3731 | Ga0501083_0010086 | |||
| 3732 | Ga0501083_0022332 | |||
| 3733 | Ga0501083_0083400 | |||
| 3734 | Ga0501083_0083409 | |||
| 3735 | Ga0501083_0101529 | |||
| 3736 | Ga0501083_0266516 | |||
| 3737 | Ga0501083_0398461 | |||
| 3738 | Ga0501035_0000084 | |||
| 3739 | Ga0501035_0004157 | |||
| 3740 | Ga0501035_0017251 | |||
| 3741 | Ga0501035_0019450 | |||
| 3742 | Ga0501035_0034636 | |||
| 3743 | Ga0501035_0063808 | |||
| 3744 | Ga0501035_0089729 | |||
| 3745 | Ga0501035_0093460 | |||
| 3746 | Ga0501035_0143575 | |||
| 3747 | Ga0501035_0167887 | |||
| 3748 | Ga0501035_0179237 | |||
| 3749 | Ga0501035_0180239 | |||
| 3750 | Ga0501044_0000073 | |||
| 3751 | Ga0501044_0002338 | |||
| 3752 | Ga0501044_0006073 | |||
| 3753 | Ga0501044_0013504 | |||
| 3754 | Ga0501044_0015609 | |||
| 3755 | Ga0501044_0016919 | |||
| 3756 | Ga0501044_0024961 | |||
| 3757 | Ga0501044_0031208 | |||
| 3758 | Ga0501044_0047398 | |||
| 3759 | Ga0501044_0068731 | |||
| 3760 | Ga0501044_0092258 | |||
| 3761 | Ga0501044_0170850 | |||
| 3762 | Ga0501044_0211874 | |||
| 3763 | Ga0501044_0306815 | |||
| 3764 | Ga0501044_0332239 | |||
| 3765 | Ga0501045_0008028 | |||
| 3766 | Ga0501045_0024337 | |||
| 3767 | Ga0501045_0090001 | |||
| 3768 | Ga0501045_0104102 | |||
| 3769 | Ga0501045_0105664 | |||
| 3770 | Ga0501045_0157645 | |||
| 3771 | Ga0501045_0186813 | |||
| 3772 | Ga0501045_0196881 | |||
| 3773 | Ga0501045_0244115 | |||
| 3774 | nmdc:mga03683_134274_c1 | |||
| 3775 | nmdc:mga03683_67370_c1 | |||
| 3776 | nmdc:mga00v17_263953_c1 | |||
| 3777 | nmdc:mga00v17_509_c1 | |||
| 3778 | nmdc:mga00v17_54865_c1 | |||
| 3779 | nmdc:mga0yw44_63019_c1 | |||
| 3780 | nmdc:mga0yw44_8358_c1 | |||
| 3781 | nmdc:mga0k408_142329_c1 | |||
| 3782 | nmdc:mga0k408_42496_c1 | |||
| 3783 | nmdc:mga0k408_77846_c1 | |||
| 3784 | nmdc:mga06z11_2382_c1 | |||
| 3785 | nmdc:mga06z11_7594_c1 | |||
| 3786 | nmdc:mga04h51_230_c1 | |||
| 3787 | nmdc:mga04h51_2815_c1 | |||
| 3788 | nmdc:mga04h51_30937_c1 | |||
| 3789 | nmdc:mga07m45_159056_c1 | |||
| 3790 | nmdc:mga05p37_14898_c1 | |||
| 3791 | nmdc:mga05p37_424127_c1 | |||
| 3792 | nmdc:mga05p37_475407_c1 | |||
| 3793 | nmdc:mga05p37_59194_c1 | |||
| 3794 | nmdc:mga09592_19535_c1 | |||
| 3795 | nmdc:mga09592_565933_c1 | |||
| 3796 | nmdc:mga0qj67_21702_c1 | |||
| 3797 | nmdc:mga06r32_14451_c1 | |||
| 3798 | nmdc:mga06r32_25520_c1 | |||
| 3799 | nmdc:mga06r32_67460_c1 | |||
| 3800 | nmdc:mga06r32_70210_c1 | |||
| 3801 | nmdc:mga08y16_175_c1 | |||
| 3802 | nmdc:mga08y16_198871_c1 | |||
| 3803 | nmdc:mga08y16_211052_c1 | |||
| 3804 | nmdc:mga08y16_247928_c1 | |||
| 3805 | nmdc:mga08y16_368635_c1 | |||
| 3806 | nmdc:mga08y16_83478_c1 | |||
| 3807 | nmdc:mga0n895_159904_c1 | |||
| 3808 | nmdc:mga0n895_182774_c1 | |||
| 3809 | nmdc:mga0n895_295439_c1 | |||
| 3810 | nmdc:mga0n895_6848_c1 | |||
| 3811 | nmdc:mga0n895_97053_c1 | |||
| 3812 | nmdc:mga0rr50_13712_c2 | |||
| 3813 | nmdc:mga0rr50_17190_c1 | |||
| 3814 | nmdc:mga0rr50_251206_c1 | |||
| 3815 | nmdc:mga08x19_165366_c1 | |||
| 3816 | nmdc:mga08x19_3036_c1 | |||
| 3817 | nmdc:mga08x19_35621_c1 | |||
| 3818 | nmdc:mga0a205_169862_c1 | |||
| 3819 | nmdc:mga0a205_227977_c1 | |||
| 3820 | nmdc:mga0a205_3040_c1 | |||
| 3821 | nmdc:mga0sz30_5290_c1 | |||
| 3822 | Ga0495601_0002642 | |||
| 3823 | Ga0495601_0004037 | |||
| 3824 | Ga0495612_0012290 | |||
| 3825 | Ga0495612_0029221 | |||
| 3826 | Ga0500635_0000216 | |||
| 3827 | Ga0500635_0002546 | |||
| 3828 | Ga0495595_0007562 | |||
| 3829 | Ga0495595_0026766 | |||
| 3830 | Ga0495595_0107670 | |||
| 3831 | Ga0495619_0014082 | |||
| 3832 | Ga0495619_0018044 | |||
| 3833 | Ga0495619_0077400 | |||
| 3834 | Ga0495619_0180851 | |||
| 3835 | Ga0500578_0000070 | |||
| 3836 | Ga0500643_000017 | |||
| 3837 | Ga0500643_000374 | |||
| 3838 | Ga0500643_007339 | |||
| 3839 | Ga0500643_041485 | |||
| 3840 | Ga0500644_0000087 | |||
| 3841 | Ga0500644_0002225 | |||
| 3842 | Ga0500644_0006658 | |||
| 3843 | Ga0500647_0012142 | |||
| 3844 | Ga0500651_0011452 | |||
| 3845 | Ga0500651_0038466 | |||
| 3846 | Ga0500641_0001055 | |||
| 3847 | Ga0500641_0066799 | |||
| 3848 | Ga0500641_0083496 | |||
| 3849 | Ga0500555_008402 | |||
| 3850 | Ga0500556_0000379 | |||
| 3851 | Ga0500556_0001645 | |||
| 3852 | Ga0500556_0006342 | |||
| 3853 | Ga0500562_005578 | |||
| 3854 | Ga0500562_010000 | |||
| 3855 | Ga0500562_010799 | |||
| 3856 | Ga0500569_000301 | |||
| 3857 | Ga0500572_000259 | |||
| 3858 | Ga0500594_0000146 | |||
| 3859 | Ga0500595_000630 | |||
| 3860 | Ga0500595_003016 | |||
| 3861 | Ga0500595_003866 | |||
| 3862 | Ga0500595_006380 | |||
| 3863 | Ga0500595_011880 | |||
| 3864 | Ga0500595_033925 | |||
| 3865 | Ga0500608_000048 | |||
| 3866 | Ga0500608_008519 | |||
| 3867 | Ga0500618_000336 | |||
| 3868 | Ga0500652_091300 | |||
| 3869 | Ga0500655_033196 | |||
| 3870 | Ga0500559_0000039 | |||
| 3871 | Ga0500559_0000070 | |||
| 3872 | Ga0500559_0006751 | |||
| 3873 | Ga0500564_000023 | |||
| 3874 | Ga0500573_0000026 | |||
| 3875 | Ga0500590_008718 | |||
| 3876 | Ga0500616_0002568 | |||
| 3877 | Ga0500616_0004681 | |||
| 3878 | Ga0500616_0016403 | |||
| 3879 | Ga0500616_0017981 | |||
| 3880 | Ga0500616_0048493 | |||
| 3881 | Ga0500616_0055550 | |||
| 3882 | Ga0500622_0002894 | |||
| 3883 | Ga0500622_0010072 | |||
| 3884 | Ga0500622_0015184 | |||
| 3885 | Ga0500622_0019007 | |||
| 3886 | Ga0500638_015003 | |||
| 3887 | Ga0500636_0039430 | |||
| 3888 | Ga0500636_0056950 | |||
| 3889 | Ga0500637_0053907 | |||
| 3890 | Ga0500637_0059374 | |||
| 3891 | Ga0500645_000674 | |||
| 3892 | Ga0500645_001836 | |||
| 3893 | Ga0500645_001866 | |||
| 3894 | Ga0500645_039783 | |||
| 3895 | Ga0500609_000122 | |||
| 3896 | Ga0500552_003643 | |||
| 3897 | Ga0501084_0004473 | |||
| 3898 | Ga0501084_0005188 | |||
| 3899 | Ga0501084_0007894 | |||
| 3900 | Ga0501084_0008308 | |||
| 3901 | Ga0501084_0008886 | |||
| 3902 | Ga0501084_0011060 | |||
| 3903 | Ga0501084_0011078 | |||
| 3904 | Ga0501084_0011118 | |||
| 3905 | Ga0501084_0018253 | |||
| 3906 | Ga0501084_0049411 | |||
| 3907 | Ga0501082_0000168 | |||
| 3908 | Ga0501082_0006709 | |||
| 3909 | Ga0501082_0019419 | |||
| 3910 | Ga0501082_0034493 | |||
| 3911 | Ga0501082_0037495 | |||
| 3912 | Ga0501082_0052842 | |||
| 3913 | Ga0501082_0109853 | |||
| 3914 | Ga0501082_0126507 | |||
| 3915 | Ga0501082_0139236 | |||
| 3916 | Ga0501082_0236104 | |||
| 3917 | Ga0501082_0248180 | |||
| 3918 | Ga0501082_0267505 | |||
| 3919 | Ga0501082_0293947 | |||
| 3920 | Ga0466962_0000450 | |||
| 3921 | Ga0530510_0007936 | |||
| 3922 | Ga0530510_0012177 | |||
| 3923 | Ga0530510_0056191 | |||
| 3924 | Ga0530510_0059805 | |||
| 3925 | Ga0530510_0061070 | |||
| 3926 | Ga0530510_0153927 | |||
| 3927 | Ga0530510_0246838 | |||
| 3928 | Ga0530510_0319349 | |||
| 3929 | Ga0530510_0332454 | |||
| 3930 | Ga0530510_0339818 | |||
| 3931 | 2511122101 | |||
| 3932 | 2512035755 | |||
| 3933 | 2523108112 | |||
| 3934 | 2524609465 | |||
| 3935 | 2545673161 | |||
| 3936 | 2585146612 | |||
| 3937 | 2585152378 | |||
| 3938 | 2585199028 | |||
| 3939 | 2587917752 | |||
| 3940 | 2596373405 | |||
| 3941 | 2599105835 | |||
| 3942 | 2643750097 | |||
| 3943 | 2643782483 | |||
| 3944 | 2643882351 | |||
| 3945 | 2643924262 | |||
| 3946 | 2643928692 | |||
| 3947 | 2643998845 | |||
| 3948 | 2644087127 | |||
| 3949 | 2644226728 | |||
| 3950 | 2644233802 | |||
| 3951 | 2644342081 | |||
| 3952 | 2644353564 | |||
| 3953 | 2644368368 | |||
| 3954 | 2644510747 | |||
| 3955 | 2644548659 | |||
| 3956 | 2644549376 | |||
| 3957 | 2671695435 | |||
| 3958 | 2715501371 | |||
| 3959 | 2738743187 | |||
| 3960 | 2739352804 | |||
| 3961 | 2739792463 | |||
| 3962 | 2757570352 | |||
| 3963 | 2774873043 | |||
| 3964 | 2792462957 | |||
| 3965 | 2819537309 | |||
| 3966 | 2819646629 | |||
| 3967 | 2840880697 | |||
| 3968 | 2842700468 | |||
| 3969 | 2843746505 | |||
| 3970 | 2846955617 | |||
| 3971 | 2848862395 | |||
| 3972 | 2849561782 | |||
| 3973 | 2849574155 | |||
| 3974 | 2851157833 | |||
| 3975 | 2854683035 | |||
| 3976 | 2855021455 | |||
| 3977 | 2857507009 | |||
| 3978 | 2882461349 | |||
| 3979 | 2884961658 | |||
| 3980 | 2889307847 | |||
| 3981 | 2889793135 | |||
| 3982 | 2889917633 | |||
| 3983 | 2897804453 | |||
| 3984 | 2898332520 | |||
| 3985 | 2898797796 | |||
| 3986 | 2899262033 | |||
| 3987 | 2899277373 | |||
| 3988 | 2902336623 | |||
| 3989 | 2902406894 | |||
| 3990 | 2917554441 | |||
| 3991 | 2919679334 | |||
| 3992 | 2928127069 | |||
| 3993 | 2928531402 | |||
| 3994 | 2928974321 | |||
| 3995 | 2937845332 | |||
| 3996 | 2939673994 | |||
| 3997 | 2977243244 | |||
| 3998 | 2989771371 | |||
| 3999 | 3000019371 | |||
| 4000 | 3000406591 | |||
| 4001 | 3003666057 | |||
| 4002 | 641642235 | |||
| 4003 | 643598241 | |||
| 4004 | 8054007928 | |||
| 4005 | 8054561364 | |||
| 4006 | 8057134478 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lkd-assembly1.cif.gz_A | in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor | 1.002 | 26 | 55 |
| 4j31-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-396prot) | 1.002 | 26 | 55 |
| 6j0z-assembly1.cif.gz_C-2 | crystal structure of alpk | 0.9991 | 28 | 55 |
| 6lke-assembly1.cif.gz_A | in meso full-length rat kmo in complex with an inhibitor identified via dna-encoded chemical library screening | 0.998 | 26 | 55 |
| 7c4a-assembly1.cif.gz_B | nica2 with cofactor fad | 0.9907 | 27 | 55 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F6P928_26_379_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 1.003 | 28 | 54 | 3.50.50.60 |
| 6j0zC01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9991 | 28 | 55 | 3.50.50.60 |
| af_I1MHA5_112_472_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9975 | 27 | 54 | 3.50.50.60 |
| 3ka7A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9953 | 28 | 55 | 3.50.50.60 |
| af_Q54US8_49_419_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9949 | 28 | 54 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519PEM2-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.9997 | 213 | 313 |
GO:0006631
GO:0008691 |
| AF-A0A656TFL7-F1-model_v4 | deleted | 0.998 | 217 | 304 |
|
| AF-A0A061S868-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9932 | 208 | 306 |
GO:0006631
GO:0016616 |
| AF-A0A3B9B4L3-F1-model_v4 | deleted | 0.9915 | 213 | 306 |
|
| AF-A0A519PEM2-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.9899 | 213 | 313 |
GO:0006631
GO:0008691 |