F496239

General Info

Members Datasets Scaffolds Average Seq Length
2004 592 4006 298

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10359236|Ga0105249_103592361
Length 335
Sequence MTLCPTVTLRRSKSLRQYGAVMLESRHKKKGGARRGRASRLCWMVQIRSVGVIGAGQMGTGIAHVVALGGYDVLLHDVSQERIDSGLELIRHNMTRQVHRGIIDQDAMDAALGHIKGASELQSIGATDLAIEAATENEETKKTIFKALGPHLGDKTLLASNTSSISITRLAAATDRPDRFIGLHFMNPAPLMKLVEIIRGIATGPDTYETAVKFAQSLGKTTANAEDFPAFIVNRVLVPMINEAIYTLYEGVGTVEAIDTAMKLGANHPMGPLELGDFIGLDTVLSIMNVLYEGLADSKYRPCPLLTKYVEAGWLGRKAGRGFYDYRGEHPVPTR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
242 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
243 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
244 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
267 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
268 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
269 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
275 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
276 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
277 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
280 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
281 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
285 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
291 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
292 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
293 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
294 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
295 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
296 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
300 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
301 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
302 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
303 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
304 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
313 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
314 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
320 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
321 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
322 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
323 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
324 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
325 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
326 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
329 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
332 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
333 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
367 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
368 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
369 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
374 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
375 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
376 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
377 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
378 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
385 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
395 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
396 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
397 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
398 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
399 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
400 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
450 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
451 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
452 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
453 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
454 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
455 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
456 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
457 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
458 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
463 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
483 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
484 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
485 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
486 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
487 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
488 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
489 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
490 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
491 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
492 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
493 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
494 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
495 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
496 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
497 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
498 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
499 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
500 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
501 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
504 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
505 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
506 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
507 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
508 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
509 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
510 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
511 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
512 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
513 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
514 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
515 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
516 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
517 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
518 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
519 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
520 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
521 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
522 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
523 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
524 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
525 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
526 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
527 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
528 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
529 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
530 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
531 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
532 2643221583 Caulobacter sp. Root655 Isolate Unclassified
533 2643221584 Caulobacter sp. Root656 Isolate Unclassified
534 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
535 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
536 2643221640 Caulobacter sp. Root342 Isolate Unclassified
537 2643221642 Caulobacter sp. Root343 Isolate Unclassified
538 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
539 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
540 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
541 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
542 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
543 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
544 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
545 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
546 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
547 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
548 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
549 2773857925 Microvirga vignae BR3299 Isolate Unclassified
550 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
551 2818991435 Caulobacter henricii 536 Isolate Unclassified
552 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
553 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
554 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
555 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
556 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
557 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
558 2849560528 Caulobacter zeae 410 Isolate Unclassified
559 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
560 2851153111 Caulobacter radicis 736 Isolate Unclassified
561 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
562 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
563 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
564 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
565 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
566 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
567 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
568 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
569 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
570 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
571 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
572 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
573 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
574 2902330777 Methylobacterium sp. 2A Isolate Unclassified
575 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
576 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
577 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
578 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
579 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
580 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
581 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
582 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
583 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
584 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
585 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
586 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
587 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
588 641522639 Methylobacterium sp. 4-46 Isolate Nodule
589 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
590 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
591 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
592 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 0.45
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0.3
Rhizoplane 4.04
Rhizosphere 82.53
Stem 0
Stem Tuber 0.05
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10359236 3300009553 Bacteria 1478
2 JGI24750J21931_1001757 3300002070 Bacteria 2647
3 JGI24751J29686_10002743 3300002459 Bacteria 3542
4 JGI25153J46596_10000269 3300003215 Bacteria 41135
5 JGI25153J46596_10009271 3300003215 Bacteria 4599
6 rootH2_10154904 3300003320 Bacteria 2161
7 Ga0006562J51391_1051836 3300003578 Bacteria 2840
8 Ga0055537_1005976 3300003773 Bacteria 3162
9 Ga0055528_1003083 3300003790 Bacteria 8559
10 Ga0055530_10000337 3300003791 Bacteria 42372
11 Ga0055531_10000505 3300003794 Bacteria 35554
12 Ga0055531_10001046 3300003794 Bacteria 21865
13 Ga0055531_10029211 3300003794 Bacteria 1882
14 Ga0058861_11804934 3300004800 Bacteria 1174
15 Ga0058862_12801645 3300004803 Bacteria 1136
16 Ga0065165_1000171 3300005262 Bacteria 114917
17 Ga0065165_1001427 3300005262 Bacteria 25946
18 Ga0065165_1009793 3300005262 Bacteria 4238
19 Ga0070658_10003145 3300005327 Bacteria 13618
20 Ga0070658_10009756 3300005327 Bacteria 7711
21 Ga0070658_10034673 3300005327 Bacteria 4061
22 Ga0070658_10062470 3300005327 Bacteria 3036
23 Ga0070676_10002225 3300005328 Bacteria 9896
24 Ga0070676_10054739 3300005328 Bacteria 2353
25 Ga0070690_100000232 3300005330 Bacteria 28655
26 Ga0070690_100015621 3300005330 Bacteria 4534
27 Ga0070690_100051588 3300005330 Bacteria 2627
28 Ga0070690_100122975 3300005330 Bacteria 1744
29 Ga0070670_100000007 3300005331 Bacteria 318672
30 Ga0070670_100000734 3300005331 Bacteria 25467
31 Ga0070670_100025548 3300005331 Bacteria 5081
32 Ga0068869_100034099 3300005334 Bacteria 3598
33 Ga0068869_100100619 3300005334 Bacteria 2186
34 Ga0070666_10000492 3300005335 Bacteria 23842
35 Ga0070666_10007495 3300005335 Bacteria 6726
36 Ga0070666_10008767 3300005335 Bacteria 6287
37 Ga0070666_10017934 3300005335 Bacteria 4543
38 Ga0070666_10096676 3300005335 Bacteria 2033
39 Ga0070666_10142819 3300005335 Bacteria 1668
40 Ga0070680_100001128 3300005336 Bacteria 19178
41 Ga0070680_100005807 3300005336 Bacteria 9366
42 Ga0070680_100021694 3300005336 Bacteria 5107
43 Ga0070680_100025975 3300005336 Bacteria 4684
44 Ga0070680_100027952 3300005336 Bacteria 4521
45 Ga0070680_100029781 3300005336 Bacteria 4382
46 Ga0070680_100048827 3300005336 Bacteria 3449
47 Ga0070680_100087886 3300005336 Bacteria 2570
48 Ga0070682_100003540 3300005337 Bacteria 8643
49 Ga0070682_100003799 3300005337 Bacteria 8392
50 Ga0070682_100133320 3300005337 Bacteria 1684
51 Ga0068868_100001553 3300005338 Bacteria 15679
52 Ga0068868_100037465 3300005338 Bacteria 3759
53 Ga0068868_100103220 3300005338 Bacteria 2309
54 Ga0070660_100001176 3300005339 Bacteria 17702
55 Ga0070660_100012151 3300005339 Bacteria 6148
56 Ga0070660_100023133 3300005339 Bacteria 4602
57 Ga0070660_100032791 3300005339 Bacteria 3911
58 Ga0070660_100045240 3300005339 Bacteria 3369
59 Ga0070689_100000219 3300005340 Bacteria 34066
60 Ga0070689_100037387 3300005340 Bacteria 3712
61 Ga0070691_10004358 3300005341 Bacteria 6431
62 Ga0070691_10020286 3300005341 Bacteria 3070
63 Ga0070691_10033353 3300005341 Bacteria 2423
64 Ga0070691_10067542 3300005341 Bacteria 1730
65 Ga0070691_10093063 3300005341 Bacteria 1488
66 Ga0070691_10100110 3300005341 Bacteria 1438
67 Ga0070687_100000891 3300005343 Bacteria 10059
68 Ga0070661_100002101 3300005344 Bacteria 13712
69 Ga0070661_100034920 3300005344 Bacteria 3649
70 Ga0070661_100068524 3300005344 Bacteria 2608
71 Ga0070661_100307803 3300005344 Bacteria 1235
72 Ga0070692_10000095 3300005345 Bacteria 19381
73 Ga0070668_100000810 3300005347 Bacteria 21535
74 Ga0070668_100002588 3300005347 Bacteria 13295
75 Ga0070668_100002594 3300005347 Bacteria 13275
76 Ga0070668_100017223 3300005347 Bacteria 5409
77 Ga0070668_100039267 3300005347 Bacteria 3620
78 Ga0070668_100040268 3300005347 Bacteria 3575
79 Ga0070668_100381397 3300005347 Bacteria 1200
80 Ga0070669_100000854 3300005353 Bacteria 22116
81 Ga0070669_100003901 3300005353 Bacteria 10789
82 Ga0070669_100006542 3300005353 Bacteria 8387
83 Ga0070669_100060216 3300005353 Bacteria 2789
84 Ga0070675_100037643 3300005354 Bacteria 3942
85 Ga0070675_100228917 3300005354 Bacteria 1621
86 Ga0070671_100007574 3300005355 Bacteria 8681
87 Ga0070671_100008771 3300005355 Bacteria 8111
88 Ga0070671_100122297 3300005355 Bacteria 2190
89 Ga0070671_100272149 3300005355 Bacteria 1440
90 Ga0070671_100557481 3300005355 Bacteria 988
91 Ga0070674_100001983 3300005356 Bacteria 11202
92 Ga0070674_100004537 3300005356 Bacteria 7931
93 Ga0070674_100038016 3300005356 Bacteria 3240
94 Ga0070673_100002867 3300005364 Bacteria 10612
95 Ga0070673_100075833 3300005364 Bacteria 2713
96 Ga0070673_100528258 3300005364 Bacteria 1070
97 Ga0070688_100000552 3300005365 Bacteria 18917
98 Ga0070688_100148926 3300005365 Bacteria 1598
99 Ga0070659_100001675 3300005366 Bacteria 15927
100 Ga0070659_100027251 3300005366 Bacteria 4401
101 Ga0070659_100034835 3300005366 Bacteria 3918
102 Ga0070659_100057134 3300005366 Bacteria 3076
103 Ga0070659_100464665 3300005366 Bacteria 1075
104 Ga0070667_100001267 3300005367 Bacteria 22911
105 Ga0070667_100010421 3300005367 Bacteria 7674
106 Ga0070667_100012674 3300005367 Bacteria 6972
107 Ga0070667_100012745 3300005367 Bacteria 6951
108 Ga0070667_100054065 3300005367 Bacteria 3390
109 Ga0070667_100087631 3300005367 Bacteria 2672
110 Ga0070667_100177344 3300005367 Bacteria 1883
111 Ga0070667_100204043 3300005367 Bacteria 1755
112 Ga0070703_10002510 3300005406 Bacteria 5279
113 Ga0070709_10003641 3300005434 Bacteria 8273
114 Ga0070709_10017337 3300005434 Bacteria 4129
115 Ga0070709_10084634 3300005434 Bacteria 2077
116 Ga0070714_100042364 3300005435 Bacteria 3846
117 Ga0070714_100044290 3300005435 Bacteria 3767
118 Ga0070714_100050098 3300005435 Bacteria 3556
119 Ga0070714_100160830 3300005435 Bacteria 2031
120 Ga0070713_100116518 3300005436 Bacteria 2336
121 Ga0070713_100222337 3300005436 Bacteria 1713
122 Ga0070713_100249782 3300005436 Bacteria 1618
123 Ga0070713_100250895 3300005436 Bacteria 1614
124 Ga0070713_100401356 3300005436 Bacteria 1280
125 Ga0070713_100432234 3300005436 Bacteria 1234
126 Ga0070710_10053669 3300005437 Bacteria 2271
127 Ga0070710_10117397 3300005437 Bacteria 1606
128 Ga0070701_10000263 3300005438 Bacteria 17088
129 Ga0070711_100000201 3300005439 Bacteria 31559
130 Ga0070705_100000751 3300005440 Bacteria 18407
131 Ga0070705_100001721 3300005440 Bacteria 11385
132 Ga0070705_100014535 3300005440 Bacteria 4053
133 Ga0070700_100005030 3300005441 Bacteria 6972
134 Ga0070700_100016215 3300005441 Bacteria 4242
135 Ga0070700_100214686 3300005441 Bacteria 1359
136 Ga0070700_100289699 3300005441 Bacteria 1191
137 Ga0070694_100014968 3300005444 Bacteria 4860
138 Ga0070694_100062723 3300005444 Bacteria 2540
139 Ga0070694_100093835 3300005444 Bacteria 2110
140 Ga0070708_100051101 3300005445 Bacteria 3662
141 Ga0070663_100001331 3300005455 Bacteria 13505
142 Ga0070663_100009128 3300005455 Bacteria 6130
143 Ga0070663_100139086 3300005455 Bacteria 1852
144 Ga0070663_100212961 3300005455 Bacteria 1514
145 Ga0070678_100000963 3300005456 Bacteria 14841
146 Ga0070678_100051658 3300005456 Bacteria 2981
147 Ga0070678_100239128 3300005456 Bacteria 1517
148 Ga0070678_100287767 3300005456 Bacteria 1392
149 Ga0070662_100092341 3300005457 Bacteria 2275
150 Ga0070662_100149364 3300005457 Bacteria 1817
151 Ga0070681_10000057 3300005458 Bacteria 79475
152 Ga0070681_10002960 3300005458 Bacteria 15767
153 Ga0070681_10005511 3300005458 Bacteria 12228
154 Ga0070681_10037851 3300005458 Bacteria 4838
155 Ga0070681_10040784 3300005458 Bacteria 4650
156 Ga0070681_10048272 3300005458 Bacteria 4255
157 Ga0070681_10050025 3300005458 Bacteria 4171
158 Ga0070681_10080219 3300005458 Bacteria 3219
159 Ga0070681_10281442 3300005458 Bacteria 1574
160 Ga0070681_10299394 3300005458 Bacteria 1518
161 Ga0070681_10563842 3300005458 Bacteria 1053
162 Ga0068867_100021656 3300005459 Bacteria 4588
163 Ga0068867_100029714 3300005459 Bacteria 3939
164 Ga0068867_100135279 3300005459 Bacteria 1920
165 Ga0070685_10007261 3300005466 Bacteria 5665
166 Ga0070685_10227484 3300005466 Bacteria 1225
167 Ga0070707_100015874 3300005468 Bacteria 7068
168 Ga0070698_100007183 3300005471 Bacteria 12067
169 Ga0070698_100009690 3300005471 Bacteria 10300
170 Ga0070698_100154498 3300005471 Bacteria 2241
171 Ga0070698_100156902 3300005471 Bacteria 2221
172 Ga0070699_100005628 3300005518 Bacteria 10986
173 Ga0070699_100157206 3300005518 Bacteria 2012
174 Ga0070699_100158442 3300005518 Bacteria 2003
175 Ga0070699_100217575 3300005518 Bacteria 1702
176 Ga0070699_100295559 3300005518 Bacteria 1453
177 Ga0070699_100389231 3300005518 Bacteria 1259
178 Ga0070679_100000043 3300005530 Bacteria 95125
179 Ga0070679_100005852 3300005530 Bacteria 11410
180 Ga0070679_100027144 3300005530 Bacteria 5631
181 Ga0070679_100028853 3300005530 Bacteria 5473
182 Ga0070679_100044488 3300005530 Bacteria 4423
183 Ga0070679_100061454 3300005530 Bacteria 3744
184 Ga0070679_100077998 3300005530 Bacteria 3302
185 Ga0070679_100222634 3300005530 Bacteria 1848
186 Ga0070679_100287381 3300005530 Bacteria 1596
187 Ga0070679_100453202 3300005530 Bacteria 1227
188 Ga0070697_100040258 3300005536 Bacteria 3780
189 Ga0070697_100069957 3300005536 Bacteria 2876
190 Ga0070697_100200373 3300005536 Bacteria 1697
191 Ga0070697_100391711 3300005536 Bacteria 1205
192 Ga0070697_100626005 3300005536 Bacteria 947
193 Ga0068853_100002414 3300005539 Bacteria 13955
194 Ga0068853_100002623 3300005539 Bacteria 13528
195 Ga0068853_100003695 3300005539 Bacteria 11745
196 Ga0068853_100015377 3300005539 Bacteria 6287
197 Ga0068853_100030383 3300005539 Bacteria 4563
198 Ga0068853_100085814 3300005539 Bacteria 2760
199 Ga0068853_100097370 3300005539 Bacteria 2597
200 Ga0068853_100264669 3300005539 Bacteria 1582
201 Ga0070672_100003597 3300005543 Bacteria 10042
202 Ga0070672_100465139 3300005543 Bacteria 1091
203 Ga0070686_100000306 3300005544 Bacteria 32359
204 Ga0070695_100000339 3300005545 Bacteria 24039
205 Ga0070695_100006239 3300005545 Bacteria 7042
206 Ga0070695_100063474 3300005545 Bacteria 2401
207 Ga0070695_100080306 3300005545 Bacteria 2155
208 Ga0070696_100001139 3300005546 Bacteria 17242
209 Ga0070696_100005852 3300005546 Bacteria 8206
210 Ga0070693_100002939 3300005547 Bacteria 7876
211 Ga0070693_100115713 3300005547 Bacteria 1656
212 Ga0070665_100000622 3300005548 Bacteria 48397
213 Ga0070665_100001034 3300005548 Bacteria 34849
214 Ga0070665_100001485 3300005548 Bacteria 27386
215 Ga0070665_100002299 3300005548 Bacteria 21229
216 Ga0070665_100003432 3300005548 Bacteria 16921
217 Ga0070665_100016813 3300005548 Bacteria 7334
218 Ga0070665_100046308 3300005548 Bacteria 4369
219 Ga0070665_100084446 3300005548 Bacteria 3181
220 Ga0070665_100096343 3300005548 Bacteria 2964
221 Ga0070665_100111686 3300005548 Bacteria 2736
222 Ga0070665_100114044 3300005548 Bacteria 2705
223 Ga0070704_100148977 3300005549 Bacteria 1837
224 Ga0068855_100007530 3300005563 Bacteria 13177
225 Ga0068855_100032390 3300005563 Bacteria 6242
226 Ga0068855_100059685 3300005563 Bacteria 4462
227 Ga0068855_100073014 3300005563 Bacteria 3987
228 Ga0068855_100099535 3300005563 Bacteria 3348
229 Ga0068855_100105516 3300005563 Bacteria 3239
230 Ga0068855_100117930 3300005563 Bacteria 3040
231 Ga0068855_100173895 3300005563 Bacteria 2438
232 Ga0068855_100187622 3300005563 Bacteria 2334
233 Ga0068855_100209738 3300005563 Bacteria 2189
234 Ga0068855_100219640 3300005563 Bacteria 2132
235 Ga0068855_100245096 3300005563 Bacteria 2000
236 Ga0068855_100327487 3300005563 Bacteria 1692
237 Ga0068855_100524430 3300005563 Bacteria 1285
238 Ga0070664_100003361 3300005564 Bacteria 12934
239 Ga0070664_100008403 3300005564 Bacteria 8347
240 Ga0070664_100043907 3300005564 Bacteria 3773
241 Ga0070664_100127552 3300005564 Bacteria 2233
242 Ga0070664_100285916 3300005564 Bacteria 1488
243 Ga0068857_100000318 3300005577 Bacteria 33240
244 Ga0068857_100011253 3300005577 Bacteria 7779
245 Ga0068857_100039479 3300005577 Bacteria 4181
246 Ga0068857_100152727 3300005577 Bacteria 2093
247 Ga0068857_100161737 3300005577 Bacteria 2032
248 Ga0068856_100006661 3300005614 Bacteria 11321
249 Ga0068856_100008386 3300005614 Bacteria 10071
250 Ga0068856_100196188 3300005614 Bacteria 2033
251 Ga0068856_100301959 3300005614 Bacteria 1619
252 Ga0068856_100353209 3300005614 Bacteria 1489
253 Ga0068856_100522915 3300005614 Bacteria 1208
254 Ga0070702_100000103 3300005615 Bacteria 25515
255 Ga0070702_100057836 3300005615 Bacteria 2244
256 Ga0070702_100135243 3300005615 Bacteria 1563
257 Ga0070702_100298918 3300005615 Bacteria 1113
258 Ga0068852_100003609 3300005616 Bacteria 10833
259 Ga0068852_100115642 3300005616 Bacteria 2446
260 Ga0068852_100145653 3300005616 Bacteria 2197
261 Ga0068852_100165739 3300005616 Bacteria 2067
262 Ga0068852_100183035 3300005616 Bacteria 1971
263 Ga0068852_100356401 3300005616 Bacteria 1430
264 Ga0068859_100000168 3300005617 Bacteria 63325
265 Ga0068859_100004644 3300005617 Bacteria 13994
266 Ga0068859_100008510 3300005617 Bacteria 10381
267 Ga0068859_100012300 3300005617 Bacteria 8610
268 Ga0068859_100450106 3300005617 Bacteria 1384
269 Ga0068864_100000093 3300005618 Bacteria 93540
270 Ga0068864_100000095 3300005618 Bacteria 91554
271 Ga0068864_100004875 3300005618 Bacteria 10984
272 Ga0068864_100041566 3300005618 Bacteria 3932
273 Ga0068864_100054856 3300005618 Bacteria 3440
274 Ga0068864_100060013 3300005618 Bacteria 3293
275 Ga0068864_100214215 3300005618 Bacteria 1775
276 Ga0068864_100264675 3300005618 Bacteria 1600
277 Ga0068866_10011490 3300005718 Bacteria 3832
278 Ga0068861_100119060 3300005719 Bacteria 2128
279 Ga0068851_10053516 3300005834 Bacteria 2055
280 Ga0068851_10198081 3300005834 Bacteria 1120
281 Ga0068870_10112291 3300005840 Bacteria 1558
282 Ga0068863_100000045 3300005841 Bacteria 147269
283 Ga0068863_100007895 3300005841 Bacteria 10405
284 Ga0068863_100014537 3300005841 Bacteria 7578
285 Ga0068863_100027933 3300005841 Bacteria 5385
286 Ga0068863_100078015 3300005841 Bacteria 3136
287 Ga0068863_100408496 3300005841 Bacteria 1329
288 Ga0068858_100003461 3300005842 Bacteria 15658
289 Ga0068858_100003717 3300005842 Bacteria 15112
290 Ga0068858_100013269 3300005842 Bacteria 7766
291 Ga0068858_100016285 3300005842 Bacteria 6984
292 Ga0068858_100027724 3300005842 Bacteria 5263
293 Ga0068858_100058281 3300005842 Bacteria 3570
294 Ga0068858_100079638 3300005842 Bacteria 3044
295 Ga0068858_100083717 3300005842 Bacteria 2966
296 Ga0068860_100000204 3300005843 Bacteria 93995
297 Ga0068860_100005966 3300005843 Bacteria 12257
298 Ga0068860_100010922 3300005843 Bacteria 8952
299 Ga0068860_100033041 3300005843 Bacteria 4967
300 Ga0068860_100037867 3300005843 Bacteria 4616
301 Ga0068860_100050305 3300005843 Bacteria 3968
302 Ga0068860_100118701 3300005843 Bacteria 2532
303 Ga0068860_100190721 3300005843 Bacteria 1984
304 Ga0068860_100256811 3300005843 Bacteria 1703
305 Ga0068862_100001725 3300005844 Bacteria 19766
306 Ga0068862_100003158 3300005844 Bacteria 14322
307 Ga0068862_100005698 3300005844 Bacteria 10394
308 Ga0068862_100006125 3300005844 Bacteria 10010
309 Ga0068862_100010475 3300005844 Bacteria 7655
310 Ga0068862_100016150 3300005844 Bacteria 6210
311 Ga0068862_100111357 3300005844 Bacteria 2403
312 Ga0068862_100116776 3300005844 Bacteria 2348
313 Ga0068862_100209099 3300005844 Bacteria 1763
314 Ga0081455_10000079 3300005937 Bacteria 104277
315 Ga0081455_10005314 3300005937 Bacteria 14141
316 Ga0081455_10006837 3300005937 Bacteria 12151
317 Ga0081455_10023011 3300005937 Bacteria 5809
318 Ga0081455_10061401 3300005937 Bacteria 3163
319 Ga0081455_10069059 3300005937 Bacteria 2940
320 Ga0081538_10009083 3300005981 Bacteria 8339
321 Ga0081538_10017391 3300005981 Bacteria 5460
322 Ga0081538_10048270 3300005981 Bacteria 2599
323 Ga0081540_1000050 3300005983 Bacteria 126528
324 Ga0081540_1035798 3300005983 Bacteria 2657
325 Ga0081540_1041443 3300005983 Bacteria 2387
326 Ga0081540_1059139 3300005983 Bacteria 1842
327 Ga0081539_10021261 3300005985 Bacteria 4343
328 Ga0081539_10032848 3300005985 Bacteria 3171
329 Ga0081539_10071716 3300005985 Bacteria 1854
330 Ga0070717_10002293 3300006028 Bacteria 13425
331 Ga0070717_10048307 3300006028 Bacteria 3490
332 Ga0070717_10136784 3300006028 Bacteria 2111
333 Ga0075365_10022326 3300006038 Bacteria 3964
334 Ga0075365_10028129 3300006038 Bacteria 3583
335 Ga0075365_10357531 3300006038 Bacteria 1029
336 Ga0075368_10000312 3300006042 Bacteria 14157
337 Ga0075368_10073549 3300006042 Bacteria 1383
338 Ga0075364_10001636 3300006051 Bacteria 12288
339 Ga0075432_10004896 3300006058 Bacteria 4560
340 Ga0070715_10002897 3300006163 Bacteria 5354
341 Ga0070715_10074248 3300006163 Bacteria 1527
342 Ga0070716_100001803 3300006173 Bacteria 9707
343 Ga0070716_100094614 3300006173 Bacteria 1817
344 Ga0070712_100000383 3300006175 Bacteria 25258
345 Ga0070712_100006161 3300006175 Bacteria 7421
346 Ga0070712_100010231 3300006175 Bacteria 5914
347 Ga0070712_100020920 3300006175 Bacteria 4288
348 Ga0070712_100031069 3300006175 Bacteria 3595
349 Ga0070712_100142181 3300006175 Bacteria 1833
350 Ga0070712_100230091 3300006175 Bacteria 1472
351 Ga0070712_100299634 3300006175 Bacteria 1301
352 Ga0075367_10004476 3300006178 Bacteria 6830
353 Ga0075367_10149247 3300006178 Bacteria 1450
354 Ga0075369_10052667 3300006186 Bacteria 1765
355 Ga0075366_10004615 3300006195 Bacteria 7401
356 Ga0075366_10017262 3300006195 Bacteria 4152
357 Ga0075366_10102301 3300006195 Bacteria 1720
358 Ga0075366_10146814 3300006195 Bacteria 1427
359 Ga0097621_100001072 3300006237 Bacteria 19118
360 Ga0097621_100028215 3300006237 Bacteria 4423
361 Ga0097621_100097324 3300006237 Bacteria 2471
362 Ga0097621_100231902 3300006237 Bacteria 1612
363 Ga0075370_10022473 3300006353 Bacteria 3463
364 Ga0075370_10176237 3300006353 Bacteria 1257
365 Ga0075370_10182164 3300006353 Bacteria 1236
366 Ga0068871_100001473 3300006358 Bacteria 15779
367 Ga0068871_100043773 3300006358 Bacteria 3598
368 Ga0068871_100088418 3300006358 Bacteria 2578
369 Ga0068871_100175630 3300006358 Bacteria 1839
370 Ga0068871_100255378 3300006358 Bacteria 1528
371 Ga0068871_100282832 3300006358 Bacteria 1451
372 Ga0068871_100364323 3300006358 Bacteria 1281
373 Ga0068871_100373318 3300006358 Bacteria 1265
374 Ga0075428_100051198 3300006844 Bacteria 4528
375 Ga0075428_100059608 3300006844 Bacteria 4179
376 Ga0075428_100064681 3300006844 Bacteria 4006
377 Ga0075428_100303396 3300006844 Bacteria 1717
378 Ga0075430_100025541 3300006846 Bacteria 5026
379 Ga0075430_100265128 3300006846 Bacteria 1422
380 Ga0075430_100318100 3300006846 Bacteria 1287
381 Ga0075431_100000648 3300006847 Bacteria 29516
382 Ga0075431_100001586 3300006847 Bacteria 21155
383 Ga0075431_100007581 3300006847 Bacteria 10805
384 Ga0075431_100189193 3300006847 Bacteria 2110
385 Ga0075431_100195411 3300006847 Bacteria 2071
386 Ga0075433_10003756 3300006852 Bacteria 11752
387 Ga0075433_10458236 3300006852 Bacteria 1124
388 Ga0075434_100001044 3300006871 Bacteria 22598
389 Ga0075434_100100013 3300006871 Bacteria 2905
390 Ga0075434_100144691 3300006871 Bacteria 2397
391 Ga0075429_100020344 3300006880 Bacteria 5757
392 Ga0075429_100045703 3300006880 Bacteria 3810
393 Ga0068865_100000177 3300006881 Bacteria 35260
394 Ga0068865_100004452 3300006881 Bacteria 8451
395 Ga0068865_100006191 3300006881 Bacteria 7293
396 Ga0068865_100029061 3300006881 Bacteria 3664
397 Ga0068865_100107070 3300006881 Bacteria 2056
398 Ga0068865_100116560 3300006881 Bacteria 1979
399 Ga0068865_100131928 3300006881 Bacteria 1873
400 Ga0075436_100004207 3300006914 Bacteria 9876
401 Ga0075436_100076590 3300006914 Bacteria 2316
402 Ga0075436_100261535 3300006914 Bacteria 1234
403 Ga0097620_100000168 3300006931 Bacteria 63325
404 Ga0097620_100004644 3300006931 Bacteria 13994
405 Ga0097620_100008510 3300006931 Bacteria 10381
406 Ga0097620_100012300 3300006931 Bacteria 8610
407 Ga0097620_100450150 3300006931 Bacteria 1384
408 Ga0075435_100022950 3300007076 Bacteria 4817
409 Ga0075435_100115908 3300007076 Bacteria 2231
410 Ga0075435_100193038 3300007076 Bacteria 1724
411 Ga0099795_10006747 3300007788 Bacteria 3152
412 Ga0099795_10019485 3300007788 Bacteria 2197
413 Ga0105250_10031425 3300009092 Bacteria 2132
414 Ga0105240_10000528 3300009093 Bacteria 70421
415 Ga0105240_10000593 3300009093 Bacteria 67263
416 Ga0105240_10006394 3300009093 Bacteria 17331
417 Ga0105240_10008432 3300009093 Bacteria 14744
418 Ga0105240_10016124 3300009093 Bacteria 10125
419 Ga0105240_10025200 3300009093 Bacteria 7822
420 Ga0105240_10030187 3300009093 Bacteria 7049
421 Ga0105240_10041737 3300009093 Bacteria 5851
422 Ga0105240_10161384 3300009093 Bacteria 2662
423 Ga0105240_10169459 3300009093 Bacteria 2587
424 Ga0105240_10171001 3300009093 Bacteria 2574
425 Ga0105240_10203267 3300009093 Bacteria 2320
426 Ga0105240_10221614 3300009093 Bacteria 2203
427 Ga0105240_10442648 3300009093 Bacteria 1456
428 Ga0105240_10572948 3300009093 Bacteria 1246
429 Ga0105240_10658809 3300009093 Bacteria 1147
430 Ga0111539_10007102 3300009094 Bacteria 14352
431 Ga0111539_10011351 3300009094 Bacteria 11187
432 Ga0111539_10095254 3300009094 Bacteria 3497
433 Ga0111539_10317384 3300009094 Bacteria 1813
434 Ga0105245_10000591 3300009098 Bacteria 32882
435 Ga0105245_10067399 3300009098 Bacteria 3242
436 Ga0105245_10095809 3300009098 Bacteria 2738
437 Ga0105245_10200417 3300009098 Bacteria 1916
438 Ga0105245_10253142 3300009098 Bacteria 1712
439 Ga0105245_10273536 3300009098 Bacteria 1648
440 Ga0105247_10000361 3300009101 Bacteria 38770
441 Ga0105247_10060893 3300009101 Bacteria 2340
442 Ga0105247_10108926 3300009101 Bacteria 1780
443 Ga0114129_10065174 3300009147 Bacteria 5085
444 Ga0114129_10325523 3300009147 Bacteria 2042
445 Ga0105243_10003277 3300009148 Bacteria 13153
446 Ga0105243_10102489 3300009148 Bacteria 2378
447 Ga0105243_10643635 3300009148 Bacteria 1026
448 Ga0105241_10000699 3300009174 Bacteria 25341
449 Ga0105241_10006171 3300009174 Bacteria 8841
450 Ga0105241_10007803 3300009174 Bacteria 7868
451 Ga0105241_10087402 3300009174 Bacteria 2454
452 Ga0105241_10260395 3300009174 Bacteria 1474
453 Ga0105241_10264120 3300009174 Bacteria 1464
454 Ga0105241_10596766 3300009174 Bacteria 997
455 Ga0105242_10008014 3300009176 Bacteria 8137
456 Ga0105242_10071387 3300009176 Bacteria 2881
457 Ga0105242_10091262 3300009176 Bacteria 2564
458 Ga0105242_10134833 3300009176 Bacteria 2136
459 Ga0105242_10586647 3300009176 Bacteria 1074
460 Ga0105248_10000001 3300009177 Bacteria 1881304
461 Ga0105248_10000097 3300009177 Bacteria 97424
462 Ga0105248_10000586 3300009177 Bacteria 41465
463 Ga0105248_10014989 3300009177 Bacteria 8533
464 Ga0105248_10018673 3300009177 Bacteria 7665
465 Ga0105248_10039694 3300009177 Bacteria 5276
466 Ga0105248_10127670 3300009177 Bacteria 2869
467 Ga0105248_10220265 3300009177 Bacteria 2137
468 Ga0105248_10242825 3300009177 Bacteria 2027
469 Ga0105237_10005447 3300009545 Bacteria 14353
470 Ga0105237_10028604 3300009545 Bacteria 5675
471 Ga0105237_10136315 3300009545 Bacteria 2449
472 Ga0105237_10509890 3300009545 Bacteria 1209
473 Ga0105237_10599801 3300009545 Bacteria 1108
474 Ga0105237_10729863 3300009545 Bacteria 997
475 Ga0105238_10000280 3300009551 Bacteria 56545
476 Ga0105238_10012925 3300009551 Bacteria 8424
477 Ga0105238_10036658 3300009551 Bacteria 4986
478 Ga0105238_10109372 3300009551 Bacteria 2745
479 Ga0105238_10144770 3300009551 Bacteria 2353
480 Ga0105238_10316597 3300009551 Bacteria 1546
481 Ga0105238_10324754 3300009551 Bacteria 1525
482 Ga0105249_10000757 3300009553 Bacteria 29073
483 Ga0105249_10000842 3300009553 Bacteria 27469
484 Ga0105249_10014651 3300009553 Bacteria 6930
485 Ga0105249_10033566 3300009553 Bacteria 4647
486 Ga0105249_10120026 3300009553 Bacteria 2497
487 Ga0105249_10243034 3300009553 Bacteria 1781
488 Ga0105249_10746619 3300009553 Bacteria 1041
489 Ga0105239_10001117 3300010375 Bacteria 37006
490 Ga0105239_10010033 3300010375 Bacteria 10618
491 Ga0105239_10012366 3300010375 Bacteria 9505
492 Ga0105239_10287673 3300010375 Bacteria 1851
493 Ga0105239_10343260 3300010375 Bacteria 1685
494 Ga0105239_10364068 3300010375 Bacteria 1633
495 Ga0105239_10391941 3300010375 Bacteria 1571
496 Ga0105239_10640776 3300010375 Bacteria 1213
497 Ga0105246_10005577 3300011119 Bacteria 7675
498 Ga0105246_10097725 3300011119 Bacteria 2131
499 Ga0105246_10146435 3300011119 Bacteria 1783
500 Ga0105246_10255375 3300011119 Bacteria 1393
501 Ga0157373_10020122 3300013100 Bacteria 4855
502 Ga0157373_10021937 3300013100 Bacteria 4633
503 Ga0157373_10030236 3300013100 Bacteria 3897
504 Ga0157373_10161967 3300013100 Bacteria 1574
505 Ga0157371_10009119 3300013102 Bacteria 7838
506 Ga0157371_10024313 3300013102 Bacteria 4425
507 Ga0157371_10097896 3300013102 Bacteria 2080
508 Ga0157370_10024495 3300013104 Bacteria 5978
509 Ga0157370_10060452 3300013104 Bacteria 3597
510 Ga0157370_10101646 3300013104 Bacteria 2693
511 Ga0157370_10123487 3300013104 Bacteria 2418
512 Ga0157370_10126413 3300013104 Bacteria 2386
513 Ga0157370_10216987 3300013104 Bacteria 1773
514 Ga0157370_10633939 3300013104 Bacteria 977
515 Ga0157369_10003360 3300013105 Bacteria 18997
516 Ga0157369_10006431 3300013105 Bacteria 13619
517 Ga0157369_10019553 3300013105 Bacteria 7578
518 Ga0157369_10052011 3300013105 Bacteria 4432
519 Ga0157369_10226294 3300013105 Bacteria 1956
520 Ga0157369_10428098 3300013105 Bacteria 1372
521 Ga0157374_10000592 3300013296 Bacteria 32031
522 Ga0157374_10086021 3300013296 Bacteria 2990
523 Ga0157374_10105614 3300013296 Bacteria 2705
524 Ga0157374_10113836 3300013296 Bacteria 2604
525 Ga0157374_10156142 3300013296 Bacteria 2221
526 Ga0157374_10208164 3300013296 Bacteria 1917
527 Ga0157378_10000401 3300013297 Bacteria 42628
528 Ga0157378_10000452 3300013297 Bacteria 39237
529 Ga0157378_10033741 3300013297 Bacteria 4526
530 Ga0157378_10038103 3300013297 Bacteria 4260
531 Ga0157378_10120994 3300013297 Bacteria 2413
532 Ga0157378_10161106 3300013297 Bacteria 2098
533 Ga0157378_10199414 3300013297 Bacteria 1892
534 Ga0157378_10208375 3300013297 Bacteria 1853
535 Ga0157378_10233485 3300013297 Bacteria 1754
536 Ga0163162_10005348 3300013306 Bacteria 12394
537 Ga0163162_10008105 3300013306 Bacteria 10252
538 Ga0163162_10082532 3300013306 Bacteria 3286
539 Ga0163162_10170630 3300013306 Bacteria 2300
540 Ga0163162_10306368 3300013306 Bacteria 1721
541 Ga0157372_10000528 3300013307 Bacteria 42366
542 Ga0157372_10000529 3300013307 Bacteria 42341
543 Ga0157372_10012635 3300013307 Bacteria 8995
544 Ga0157372_10033013 3300013307 Bacteria 5682
545 Ga0157372_10219556 3300013307 Bacteria 2204
546 Ga0157372_10586118 3300013307 Bacteria 1300
547 Ga0157372_10596319 3300013307 Bacteria 1288
548 Ga0157375_10000739 3300013308 Bacteria 28688
549 Ga0157375_10002597 3300013308 Bacteria 15678
550 Ga0157375_10267049 3300013308 Bacteria 1873
551 Ga0163163_10000004 3300014325 Bacteria 416569
552 Ga0163163_10016192 3300014325 Bacteria 6922
553 Ga0163163_10038829 3300014325 Bacteria 4642
554 Ga0163163_10122028 3300014325 Bacteria 2640
555 Ga0163163_10143263 3300014325 Bacteria 2432
556 Ga0163163_10385476 3300014325 Bacteria 1459
557 Ga0163163_10605586 3300014325 Bacteria 1159
558 Ga0157380_10015122 3300014326 Bacteria 5663
559 Ga0157380_10025451 3300014326 Bacteria 4487
560 Ga0157380_10028596 3300014326 Bacteria 4252
561 Ga0157380_10290042 3300014326 Bacteria 1502
562 Ga0157377_10003058 3300014745 Bacteria 7503
563 Ga0157377_10118821 3300014745 Bacteria 1599
564 Ga0157379_10000889 3300014968 Bacteria 24172
565 Ga0157379_10003386 3300014968 Bacteria 13488
566 Ga0157379_10003905 3300014968 Bacteria 12707
567 Ga0157379_10017982 3300014968 Bacteria 6230
568 Ga0157379_10038754 3300014968 Bacteria 4251
569 Ga0157379_10046028 3300014968 Bacteria 3895
570 Ga0157379_10080593 3300014968 Bacteria 2916
571 Ga0157379_10092652 3300014968 Bacteria 2711
572 Ga0157379_10101613 3300014968 Bacteria 2580
573 Ga0157379_10116547 3300014968 Bacteria 2402
574 Ga0157379_10138128 3300014968 Bacteria 2197
575 Ga0157379_10187561 3300014968 Bacteria 1869
576 Ga0157379_10267865 3300014968 Bacteria 1553
577 Ga0157379_10496408 3300014968 Bacteria 1131
578 Ga0157376_10000548 3300014969 Bacteria 24147
579 Ga0157376_10065610 3300014969 Bacteria 3066
580 Ga0157376_10099615 3300014969 Bacteria 2536
581 Ga0157376_10184750 3300014969 Bacteria 1908
582 Ga0157376_10386640 3300014969 Bacteria 1349
583 Ga0183365_10001 3300015684 Bacteria 2090444
584 Ga0163161_10000549 3300017792 Bacteria 30479
585 Ga0163161_10004033 3300017792 Bacteria 10275
586 Ga0163161_10182406 3300017792 Bacteria 1610
587 Ga0206356_11633707 3300020070 Bacteria 1231
588 Ga0206352_10567578 3300020078 Bacteria 2176
589 Ga0213873_10024643 3300021358 Bacteria 1446
590 Ga0213872_10053344 3300021361 Bacteria 1834
591 Ga0213872_10108917 3300021361 Bacteria 1231
592 Ga0213874_10003223 3300021377 Bacteria 3599
593 Ga0213874_10007462 3300021377 Bacteria 2626
594 Ga0213874_10036580 3300021377 Bacteria 1448
595 Ga0213876_10000257 3300021384 Bacteria 49797
596 Ga0213876_10000423 3300021384 Bacteria 35276
597 Ga0213876_10008949 3300021384 Bacteria 5400
598 Ga0213876_10013999 3300021384 Bacteria 4252
599 Ga0213876_10039306 3300021384 Bacteria 2499
600 Ga0213876_10132363 3300021384 Bacteria 1326
601 Ga0213875_10000175 3300021388 Bacteria 67639
602 Ga0213875_10000580 3300021388 Bacteria 29736
603 Ga0213875_10001523 3300021388 Bacteria 14897
604 Ga0213875_10013115 3300021388 Bacteria 4076
605 Ga0213875_10041498 3300021388 Bacteria 2165
606 Ga0213871_10010846 3300021441 Bacteria 2077
607 Ga0209026_1009205 3300025250 Bacteria 1965
608 Ga0209026_1013307 3300025250 Bacteria 1405
609 Ga0209233_1000006 3300025261 Bacteria 1473685
610 Ga0209233_1034431 3300025261 Bacteria 1153
611 Ga0209565_1000065 3300025263 Bacteria 178266
612 Ga0209673_1001051 3300025273 Bacteria 31913
613 Ga0209675_1001154 3300025291 Bacteria 16072
614 Ga0209676_1000043 3300025292 Bacteria 418680
615 Ga0209676_1000928 3300025292 Bacteria 36206
616 Ga0209676_1004405 3300025292 Bacteria 7861
617 Ga0209564_1022616 3300025295 Bacteria 2214
618 Ga0209758_1000008 3300025297 Bacteria 1215263
619 Ga0209758_1001776 3300025297 Bacteria 23900
620 Ga0209758_1002436 3300025297 Bacteria 18990
621 Ga0209758_1003522 3300025297 Bacteria 14112
622 Ga0209050_1000095 3300025298 Bacteria 242722
623 Ga0209050_1000729 3300025298 Bacteria 47913
624 Ga0209050_1001088 3300025298 Bacteria 33087
625 Ga0209256_1001303 3300025299 Bacteria 26860
626 Ga0209256_1016688 3300025299 Bacteria 2485
627 Ga0209051_1001677 3300025303 Bacteria 17853
628 Ga0209257_1000036 3300025304 Bacteria 616006
629 Ga0209257_1000106 3300025304 Bacteria 242634
630 Ga0209257_1000184 3300025304 Bacteria 156438
631 Ga0209257_1000641 3300025304 Bacteria 55911
632 Ga0209257_1000979 3300025304 Bacteria 38834
633 Ga0207656_10015952 3300025321 Bacteria 2916
634 Ga0207696_1020376 3300025711 Bacteria 2141
635 Ga0207692_10007515 3300025898 Bacteria 4470
636 Ga0207692_10027461 3300025898 Bacteria 2682
637 Ga0207642_10190451 3300025899 Bacteria 1125
638 Ga0207710_10011535 3300025900 Bacteria 3719
639 Ga0207710_10020485 3300025900 Bacteria 2828
640 Ga0207710_10151745 3300025900 Bacteria 1124
641 Ga0207680_10000548 3300025903 Bacteria 17845
642 Ga0207680_10079277 3300025903 Bacteria 2059
643 Ga0207647_10030560 3300025904 Bacteria 3472
644 Ga0207685_10004123 3300025905 Bacteria 3646
645 Ga0207699_10046469 3300025906 Bacteria 2540
646 Ga0207699_10058059 3300025906 Bacteria 2313
647 Ga0207699_10061156 3300025906 Bacteria 2265
648 Ga0207699_10093545 3300025906 Bacteria 1892
649 Ga0207699_10206866 3300025906 Bacteria 1333
650 Ga0207645_10005726 3300025907 Bacteria 8965
651 Ga0207645_10039453 3300025907 Bacteria 3026
652 Ga0207645_10076314 3300025907 Bacteria 2146
653 Ga0207645_10284481 3300025907 Bacteria 1099
654 Ga0207643_10092736 3300025908 Bacteria 1762
655 Ga0207643_10178774 3300025908 Bacteria 1283
656 Ga0207705_10000039 3300025909 Bacteria 193592
657 Ga0207705_10002551 3300025909 Bacteria 14004
658 Ga0207705_10010984 3300025909 Bacteria 6576
659 Ga0207705_10042110 3300025909 Bacteria 3278
660 Ga0207705_10050295 3300025909 Bacteria 3000
661 Ga0207705_10059985 3300025909 Bacteria 2747
662 Ga0207705_10114476 3300025909 Bacteria 1995
663 Ga0207705_10132004 3300025909 Bacteria 1859
664 Ga0207684_10092116 3300025910 Bacteria 2583
665 Ga0207654_10088255 3300025911 Bacteria 1884
666 Ga0207654_10107385 3300025911 Bacteria 1730
667 Ga0207654_10117887 3300025911 Bacteria 1662
668 Ga0207707_10000001 3300025912 Bacteria 1212482
669 Ga0207707_10010788 3300025912 Bacteria 7939
670 Ga0207707_10019058 3300025912 Bacteria 5987
671 Ga0207707_10030735 3300025912 Bacteria 4698
672 Ga0207707_10039792 3300025912 Bacteria 4108
673 Ga0207707_10041161 3300025912 Bacteria 4035
674 Ga0207707_10055055 3300025912 Bacteria 3461
675 Ga0207707_10106410 3300025912 Bacteria 2452
676 Ga0207707_10133498 3300025912 Bacteria 2171
677 Ga0207707_10162139 3300025912 Bacteria 1955
678 Ga0207707_10269466 3300025912 Bacteria 1476
679 Ga0207707_10295316 3300025912 Bacteria 1402
680 Ga0207707_10436937 3300025912 Bacteria 1120
681 Ga0207695_10000012 3300025913 Bacteria 840961
682 Ga0207695_10001649 3300025913 Bacteria 35962
683 Ga0207695_10016276 3300025913 Bacteria 8711
684 Ga0207695_10034422 3300025913 Bacteria 5509
685 Ga0207695_10085020 3300025913 Bacteria 3193
686 Ga0207695_10086922 3300025913 Bacteria 3151
687 Ga0207695_10099655 3300025913 Bacteria 2903
688 Ga0207695_10142285 3300025913 Bacteria 2346
689 Ga0207695_10154775 3300025913 Bacteria 2228
690 Ga0207695_10169773 3300025913 Bacteria 2107
691 Ga0207695_10175181 3300025913 Bacteria 2068
692 Ga0207695_10553224 3300025913 Bacteria 1032
693 Ga0207671_10023167 3300025914 Bacteria 4684
694 Ga0207671_10136664 3300025914 Bacteria 1885
695 Ga0207671_10361075 3300025914 Bacteria 1153
696 Ga0207693_10000127 3300025915 Bacteria 68379
697 Ga0207693_10000247 3300025915 Bacteria 50003
698 Ga0207693_10003312 3300025915 Bacteria 13783
699 Ga0207693_10036417 3300025915 Bacteria 3879
700 Ga0207693_10126511 3300025915 Bacteria 2009
701 Ga0207693_10155944 3300025915 Bacteria 1796
702 Ga0207663_10145553 3300025916 Bacteria 1656
703 Ga0207663_10208513 3300025916 Bacteria 1415
704 Ga0207660_10001305 3300025917 Bacteria 16649
705 Ga0207660_10006328 3300025917 Bacteria 7676
706 Ga0207660_10015367 3300025917 Bacteria 5050
707 Ga0207660_10016006 3300025917 Bacteria 4958
708 Ga0207660_10072410 3300025917 Bacteria 2510
709 Ga0207660_10113135 3300025917 Bacteria 2046
710 Ga0207660_10122663 3300025917 Bacteria 1970
711 Ga0207662_10000924 3300025918 Bacteria 13610
712 Ga0207662_10239392 3300025918 Bacteria 1188
713 Ga0207657_10000257 3300025919 Bacteria 56368
714 Ga0207657_10007684 3300025919 Bacteria 11019
715 Ga0207657_10020778 3300025919 Bacteria 6197
716 Ga0207657_10025453 3300025919 Bacteria 5457
717 Ga0207657_10144002 3300025919 Bacteria 1945
718 Ga0207657_10465423 3300025919 Bacteria 992
719 Ga0207649_10000060 3300025920 Bacteria 99202
720 Ga0207649_10013244 3300025920 Bacteria 4600
721 Ga0207652_10000141 3300025921 Bacteria 76698
722 Ga0207652_10008279 3300025921 Bacteria 8360
723 Ga0207652_10019939 3300025921 Bacteria 5521
724 Ga0207652_10023480 3300025921 Bacteria 5110
725 Ga0207652_10040057 3300025921 Bacteria 3978
726 Ga0207652_10050093 3300025921 Bacteria 3577
727 Ga0207652_10133162 3300025921 Bacteria 2218
728 Ga0207652_10176071 3300025921 Bacteria 1921
729 Ga0207652_10183561 3300025921 Bacteria 1880
730 Ga0207652_10193823 3300025921 Bacteria 1828
731 Ga0207652_10585044 3300025921 Bacteria 1002
732 Ga0207646_10007200 3300025922 Bacteria 11354
733 Ga0207681_10027103 3300025923 Bacteria 3702
734 Ga0207681_10032279 3300025923 Bacteria 3427
735 Ga0207681_10045401 3300025923 Bacteria 2950
736 Ga0207694_10000006 3300025924 Bacteria 631109
737 Ga0207694_10001089 3300025924 Bacteria 23548
738 Ga0207694_10009327 3300025924 Bacteria 7403
739 Ga0207694_10021936 3300025924 Bacteria 4842
740 Ga0207694_10033316 3300025924 Bacteria 3946
741 Ga0207694_10070457 3300025924 Bacteria 2731
742 Ga0207694_10076221 3300025924 Bacteria 2626
743 Ga0207694_10272507 3300025924 Bacteria 1388
744 Ga0207650_10000030 3300025925 Bacteria 235824
745 Ga0207650_10002093 3300025925 Bacteria 13957
746 Ga0207650_10020912 3300025925 Bacteria 4623
747 Ga0207650_10143668 3300025925 Bacteria 1878
748 Ga0207650_10171248 3300025925 Bacteria 1726
749 Ga0207659_10235418 3300025926 Bacteria 1479
750 Ga0207659_10413649 3300025926 Bacteria 1130
751 Ga0207687_10015151 3300025927 Bacteria 5053
752 Ga0207687_10026527 3300025927 Bacteria 3880
753 Ga0207687_10057986 3300025927 Bacteria 2722
754 Ga0207687_10126975 3300025927 Bacteria 1916
755 Ga0207687_10192576 3300025927 Bacteria 1588
756 Ga0207687_10531749 3300025927 Bacteria 984
757 Ga0207700_10002798 3300025928 Bacteria 10046
758 Ga0207700_10025473 3300025928 Bacteria 4108
759 Ga0207700_10088283 3300025928 Bacteria 2441
760 Ga0207700_10126616 3300025928 Bacteria 2079
761 Ga0207700_10163008 3300025928 Bacteria 1853
762 Ga0207664_10036901 3300025929 Bacteria 3780
763 Ga0207664_10150050 3300025929 Bacteria 1979
764 Ga0207664_10179688 3300025929 Bacteria 1816
765 Ga0207664_10285742 3300025929 Bacteria 1448
766 Ga0207644_10008376 3300025931 Bacteria 6767
767 Ga0207644_10026216 3300025931 Bacteria 4014
768 Ga0207644_10027526 3300025931 Bacteria 3927
769 Ga0207644_10136397 3300025931 Bacteria 1884
770 Ga0207644_10212491 3300025931 Bacteria 1530
771 Ga0207644_10417894 3300025931 Bacteria 1098
772 Ga0207690_10007048 3300025932 Bacteria 6669
773 Ga0207690_10014732 3300025932 Bacteria 4728
774 Ga0207690_10026365 3300025932 Bacteria 3659
775 Ga0207690_10156836 3300025932 Bacteria 1693
776 Ga0207690_10286902 3300025932 Bacteria 1283
777 Ga0207706_10000295 3300025933 Bacteria 54132
778 Ga0207706_10109953 3300025933 Bacteria 2425
779 Ga0207706_10176226 3300025933 Bacteria 1878
780 Ga0207686_10069922 3300025934 Bacteria 2253
781 Ga0207686_10077146 3300025934 Bacteria 2163
782 Ga0207686_10082644 3300025934 Bacteria 2100
783 Ga0207686_10224063 3300025934 Bacteria 1359
784 Ga0207709_10013293 3300025935 Bacteria 4542
785 Ga0207709_10015111 3300025935 Bacteria 4277
786 Ga0207709_10141093 3300025935 Bacteria 1656
787 Ga0207669_10004332 3300025937 Bacteria 6236
788 Ga0207669_10039227 3300025937 Bacteria 2734
789 Ga0207704_10004157 3300025938 Bacteria 6600
790 Ga0207704_10016025 3300025938 Bacteria 3840
791 Ga0207704_10018903 3300025938 Bacteria 3608
792 Ga0207704_10120333 3300025938 Bacteria 1795
793 Ga0207704_10184588 3300025938 Bacteria 1511
794 Ga0207665_10000664 3300025939 Bacteria 23168
795 Ga0207665_10105406 3300025939 Bacteria 1974
796 Ga0207665_10302314 3300025939 Bacteria 1196
797 Ga0207691_10005624 3300025940 Bacteria 12115
798 Ga0207711_10000001 3300025941 Bacteria 1325674
799 Ga0207711_10000267 3300025941 Bacteria 56315
800 Ga0207711_10000919 3300025941 Bacteria 28369
801 Ga0207711_10011983 3300025941 Bacteria 7206
802 Ga0207711_10028457 3300025941 Bacteria 4703
803 Ga0207711_10070867 3300025941 Bacteria 3023
804 Ga0207711_10173241 3300025941 Bacteria 1959
805 Ga0207711_10210179 3300025941 Bacteria 1777
806 Ga0207711_10442267 3300025941 Bacteria 1210
807 Ga0207689_10005479 3300025942 Bacteria 11358
808 Ga0207689_10141879 3300025942 Bacteria 1979
809 Ga0207661_10224630 3300025944 Bacteria 1661
810 Ga0207661_10446046 3300025944 Bacteria 1178
811 Ga0207679_10004900 3300025945 Bacteria 8344
812 Ga0207679_10015049 3300025945 Bacteria 5100
813 Ga0207679_10111870 3300025945 Bacteria 2157
814 Ga0207679_10479158 3300025945 Bacteria 1107
815 Ga0207667_10034948 3300025949 Bacteria 5394
816 Ga0207667_10053661 3300025949 Bacteria 4241
817 Ga0207667_10087961 3300025949 Bacteria 3213
818 Ga0207667_10088796 3300025949 Bacteria 3196
819 Ga0207667_10100708 3300025949 Bacteria 2980
820 Ga0207667_10123750 3300025949 Bacteria 2664
821 Ga0207667_10133802 3300025949 Bacteria 2553
822 Ga0207667_10174150 3300025949 Bacteria 2211
823 Ga0207667_10304577 3300025949 Bacteria 1628
824 Ga0207667_10421216 3300025949 Bacteria 1359
825 Ga0207651_10015625 3300025960 Bacteria 4418
826 Ga0207651_10164882 3300025960 Bacteria 1741
827 Ga0207651_10353907 3300025960 Bacteria 1237
828 Ga0207712_10000683 3300025961 Bacteria 26236
829 Ga0207712_10002026 3300025961 Bacteria 13297
830 Ga0207712_10008618 3300025961 Bacteria 6448
831 Ga0207712_10025416 3300025961 Bacteria 3934
832 Ga0207712_10168464 3300025961 Bacteria 1710
833 Ga0207712_10172836 3300025961 Bacteria 1690
834 Ga0207712_10271074 3300025961 Bacteria 1381
835 Ga0207712_10333127 3300025961 Bacteria 1256
836 Ga0207668_10000010 3300025972 Bacteria 185249
837 Ga0207668_10000152 3300025972 Bacteria 47686
838 Ga0207668_10001656 3300025972 Bacteria 13009
839 Ga0207668_10006351 3300025972 Bacteria 6989
840 Ga0207668_10014968 3300025972 Bacteria 4811
841 Ga0207668_10141138 3300025972 Bacteria 1853
842 Ga0207668_10513245 3300025972 Bacteria 1033
843 Ga0207658_10000211 3300025986 Bacteria 60993
844 Ga0207658_10003894 3300025986 Bacteria 10503
845 Ga0207658_10006609 3300025986 Bacteria 7902
846 Ga0207658_10007025 3300025986 Bacteria 7663
847 Ga0207658_10034901 3300025986 Bacteria 3598
848 Ga0207658_10300139 3300025986 Bacteria 1383
849 Ga0207658_10489243 3300025986 Bacteria 1094
850 Ga0207677_10078267 3300026023 Bacteria 2361
851 Ga0207703_10000049 3300026035 Bacteria 149817
852 Ga0207703_10002309 3300026035 Bacteria 16642
853 Ga0207703_10002704 3300026035 Bacteria 15188
854 Ga0207703_10008329 3300026035 Bacteria 8193
855 Ga0207703_10064876 3300026035 Bacteria 2999
856 Ga0207703_10075251 3300026035 Bacteria 2798
857 Ga0207703_10437586 3300026035 Bacteria 1219
858 Ga0207639_10002055 3300026041 Bacteria 13572
859 Ga0207639_10010332 3300026041 Bacteria 6463
860 Ga0207639_10014521 3300026041 Bacteria 5543
861 Ga0207639_10075771 3300026041 Bacteria 2647
862 Ga0207639_10185022 3300026041 Bacteria 1775
863 Ga0207678_10000401 3300026067 Bacteria 39431
864 Ga0207678_10002715 3300026067 Bacteria 16044
865 Ga0207678_10003650 3300026067 Bacteria 13834
866 Ga0207678_10164574 3300026067 Bacteria 1894
867 Ga0207708_10000535 3300026075 Bacteria 29316
868 Ga0207708_10009632 3300026075 Bacteria 7164
869 Ga0207708_10064750 3300026075 Bacteria 2793
870 Ga0207708_10074469 3300026075 Bacteria 2602
871 Ga0207708_10141177 3300026075 Bacteria 1890
872 Ga0207708_10163300 3300026075 Bacteria 1760
873 Ga0207708_10192079 3300026075 Bacteria 1626
874 Ga0207708_10365733 3300026075 Bacteria 1186
875 Ga0207708_10398335 3300026075 Bacteria 1138
876 Ga0207702_10014870 3300026078 Bacteria 6456
877 Ga0207702_10062519 3300026078 Bacteria 3180
878 Ga0207702_10076898 3300026078 Bacteria 2885
879 Ga0207702_10160480 3300026078 Bacteria 2053
880 Ga0207702_10196741 3300026078 Bacteria 1866
881 Ga0207702_10259219 3300026078 Bacteria 1636
882 Ga0207641_10000011 3300026088 Bacteria 384362
883 Ga0207641_10001161 3300026088 Bacteria 26478
884 Ga0207641_10001597 3300026088 Bacteria 22136
885 Ga0207641_10044489 3300026088 Bacteria 3734
886 Ga0207641_10059513 3300026088 Bacteria 3253
887 Ga0207641_10275747 3300026088 Bacteria 1580
888 Ga0207641_10311955 3300026088 Bacteria 1489
889 Ga0207648_10007860 3300026089 Bacteria 10406
890 Ga0207648_10010475 3300026089 Bacteria 8784
891 Ga0207648_10042402 3300026089 Bacteria 3994
892 Ga0207676_10000095 3300026095 Bacteria 80405
893 Ga0207676_10003207 3300026095 Bacteria 11654
894 Ga0207676_10040508 3300026095 Bacteria 3570
895 Ga0207676_10063775 3300026095 Bacteria 2927
896 Ga0207676_10195228 3300026095 Bacteria 1784
897 Ga0207676_10215556 3300026095 Bacteria 1706
898 Ga0207674_10000524 3300026116 Bacteria 50350
899 Ga0207674_10001583 3300026116 Bacteria 29309
900 Ga0207674_10087264 3300026116 Bacteria 3114
901 Ga0207674_10092167 3300026116 Bacteria 3020
902 Ga0207674_10117784 3300026116 Bacteria 2626
903 Ga0207674_10184938 3300026116 Bacteria 2034
904 Ga0207675_100012361 3300026118 Bacteria 7974
905 Ga0207675_100042871 3300026118 Bacteria 4225
906 Ga0207675_100074800 3300026118 Bacteria 3170
907 Ga0207675_100136906 3300026118 Bacteria 2325
908 Ga0207675_100148779 3300026118 Bacteria 2228
909 Ga0207675_100203997 3300026118 Bacteria 1899
910 Ga0207675_100210459 3300026118 Bacteria 1870
911 Ga0207675_100302991 3300026118 Bacteria 1557
912 Ga0207683_10000416 3300026121 Bacteria 39377
913 Ga0207683_10006084 3300026121 Bacteria 10333
914 Ga0207683_10008739 3300026121 Bacteria 8648
915 Ga0207683_10013120 3300026121 Bacteria 7067
916 Ga0207683_10074459 3300026121 Bacteria 3004
917 Ga0207698_10090286 3300026142 Bacteria 2505
918 Ga0207698_10115779 3300026142 Bacteria 2258
919 Ga0209981_1000228 3300027378 Bacteria 7188
920 Ga0209984_1017703 3300027424 Bacteria 959
921 Ga0210000_1004649 3300027462 Bacteria 1980
922 Ga0209983_1009790 3300027665 Bacteria 1959
923 Ga0209813_10000327 3300027866 Bacteria 12478
924 Ga0209813_10016463 3300027866 Bacteria 2018
925 Ga0209974_10042379 3300027876 Bacteria 1515
926 Ga0207428_10000235 3300027907 Bacteria 75923
927 Ga0207428_10004815 3300027907 Bacteria 12744
928 Ga0207428_10026155 3300027907 Bacteria 4873
929 Ga0207428_10040270 3300027907 Bacteria 3792
930 Ga0207428_10054598 3300027907 Bacteria 3181
931 Ga0268266_10000453 3300028379 Bacteria 60062
932 Ga0268266_10000551 3300028379 Bacteria 52218
933 Ga0268266_10000621 3300028379 Bacteria 48218
934 Ga0268266_10001015 3300028379 Bacteria 35377
935 Ga0268266_10032142 3300028379 Bacteria 4458
936 Ga0268266_10039501 3300028379 Bacteria 4020
937 Ga0268266_10040576 3300028379 Bacteria 3967
938 Ga0268266_10048617 3300028379 Bacteria 3636
939 Ga0268266_10057032 3300028379 Bacteria 3360
940 Ga0268266_10073664 3300028379 Bacteria 2964
941 Ga0268266_10101247 3300028379 Bacteria 2539
942 Ga0268266_10299680 3300028379 Bacteria 1499
943 Ga0268265_10001201 3300028380 Bacteria 22545
944 Ga0268265_10003906 3300028380 Bacteria 10506
945 Ga0268265_10013342 3300028380 Bacteria 5582
946 Ga0268265_10041738 3300028380 Bacteria 3398
947 Ga0268265_10076488 3300028380 Bacteria 2626
948 Ga0268265_10085941 3300028380 Bacteria 2498
949 Ga0268264_10000125 3300028381 Bacteria 186416
950 Ga0268264_10004262 3300028381 Bacteria 12211
951 Ga0268264_10025320 3300028381 Bacteria 4847
952 Ga0268264_10027689 3300028381 Bacteria 4633
953 Ga0268264_10047913 3300028381 Bacteria 3554
954 Ga0268264_10094662 3300028381 Bacteria 2583
955 Ga0268264_10299038 3300028381 Bacteria 1514
956 Ga0268264_10300407 3300028381 Bacteria 1511
957 Ga0268264_10304859 3300028381 Bacteria 1500
958 Ga0265337_1001829 3300028556 Bacteria 10205
959 Ga0265334_10010903 3300028573 Bacteria 3836
960 Ga0265334_10016579 3300028573 Bacteria 3046
961 Ga0265318_10000235 3300028577 Bacteria 48102
962 Ga0265318_10002471 3300028577 Bacteria 9872
963 Ga0307517_10000835 3300028786 Bacteria 53001
964 Ga0307517_10231575 3300028786 Bacteria 1108
965 Ga0307515_10066324 3300028794 Bacteria 5003
966 Ga0307515_10106806 3300028794 Bacteria 3316
967 Ga0307515_10259688 3300028794 Bacteria 1475
968 Ga0265338_10000043 3300028800 Bacteria 226293
969 Ga0265338_10005705 3300028800 Bacteria 16099
970 Ga0265338_10015424 3300028800 Bacteria 8394
971 Ga0265338_10020630 3300028800 Bacteria 6920
972 Ga0265338_10035573 3300028800 Bacteria 4784
973 Ga0265338_10039574 3300028800 Bacteria 4445
974 Ga0265338_10040541 3300028800 Bacteria 4372
975 Ga0265338_10082092 3300028800 Bacteria 2700
976 Ga0265338_10084214 3300028800 Bacteria 2655
977 Ga0265338_10128440 3300028800 Bacteria 2006
978 Ga0265338_10152077 3300028800 Bacteria 1797
979 Ga0265338_10192370 3300028800 Bacteria 1545
980 Ga0310981_1042390 3300029285 Bacteria 1353
981 Ga0307511_10033370 3300030521 Bacteria 4546
982 Ga0265760_10038615 3300031090 Bacteria 1420
983 Ga0265330_10002470 3300031235 Bacteria 10054
984 Ga0265330_10024699 3300031235 Bacteria 2725
985 Ga0265332_10011270 3300031238 Bacteria 3975
986 Ga0265332_10033467 3300031238 Bacteria 2237
987 Ga0265332_10088810 3300031238 Bacteria 1308
988 Ga0265328_10118179 3300031239 Bacteria 988
989 Ga0265320_10074813 3300031240 Bacteria 1590
990 Ga0265325_10000002 3300031241 Bacteria 396758
991 Ga0265325_10001880 3300031241 Bacteria 14490
992 Ga0265325_10002687 3300031241 Bacteria 11897
993 Ga0265325_10070773 3300031241 Bacteria 1752
994 Ga0265340_10000353 3300031247 Bacteria 24451
995 Ga0265340_10001830 3300031247 Bacteria 12157
996 Ga0265340_10003755 3300031247 Bacteria 8545
997 Ga0265340_10086389 3300031247 Bacteria 1471
998 Ga0265340_10134287 3300031247 Bacteria 1134
999 Ga0265339_10000313 3300031249 Bacteria 39589
1000 Ga0265339_10000763 3300031249 Bacteria 24917
1001 Ga0265339_10018271 3300031249 Bacteria 4136
1002 Ga0265339_10023677 3300031249 Bacteria 3547
1003 Ga0265339_10106100 3300031249 Bacteria 1458
1004 Ga0265339_10110046 3300031249 Bacteria 1426
1005 Ga0265339_10131887 3300031249 Bacteria 1277
1006 Ga0265331_10000049 3300031250 Bacteria 182618
1007 Ga0265331_10000250 3300031250 Bacteria 63883
1008 Ga0265331_10001017 3300031250 Bacteria 21939
1009 Ga0265331_10002339 3300031250 Bacteria 12884
1010 Ga0265331_10007204 3300031250 Bacteria 6461
1011 Ga0265331_10011352 3300031250 Bacteria 4883
1012 Ga0265331_10022694 3300031250 Bacteria 3200
1013 Ga0265331_10052331 3300031250 Bacteria 1951
1014 Ga0265331_10085035 3300031250 Bacteria 1466
1015 Ga0265331_10106605 3300031250 Bacteria 1287
1016 Ga0265327_10000007 3300031251 Bacteria 678515
1017 Ga0265327_10000280 3300031251 Bacteria 100757
1018 Ga0265327_10000771 3300031251 Bacteria 49408
1019 Ga0265327_10004124 3300031251 Bacteria 13125
1020 Ga0265327_10080192 3300031251 Bacteria 1614
1021 Ga0265316_10007569 3300031344 Bacteria 10219
1022 Ga0265316_10017960 3300031344 Bacteria 6095
1023 Ga0265316_10041506 3300031344 Bacteria 3682
1024 Ga0265316_10051397 3300031344 Bacteria 3238
1025 Ga0265316_10066867 3300031344 Bacteria 2780
1026 Ga0265316_10110083 3300031344 Bacteria 2086
1027 Ga0265316_10168435 3300031344 Bacteria 1635
1028 Ga0265316_10173466 3300031344 Bacteria 1608
1029 Ga0307513_10001002 3300031456 Bacteria 40842
1030 Ga0307513_10003622 3300031456 Bacteria 20908
1031 Ga0307513_10013077 3300031456 Bacteria 10204
1032 Ga0307513_10016442 3300031456 Bacteria 8920
1033 Ga0307408_100038619 3300031548 Bacteria 3370
1034 Ga0307408_100130898 3300031548 Bacteria 1957
1035 Ga0307408_100196031 3300031548 Bacteria 1631
1036 Ga0265313_10000665 3300031595 Bacteria 35397
1037 Ga0265313_10001152 3300031595 Bacteria 25241
1038 Ga0265313_10001900 3300031595 Bacteria 18950
1039 Ga0265313_10001912 3300031595 Bacteria 18889
1040 Ga0265313_10005546 3300031595 Bacteria 9249
1041 Ga0265313_10009355 3300031595 Bacteria 6369
1042 Ga0265313_10017490 3300031595 Bacteria 4073
1043 Ga0265313_10023056 3300031595 Bacteria 3360
1044 Ga0316575_10028152 3300031665 Bacteria 2189
1045 Ga0316579_10018453 3300031691 Bacteria 3072
1046 Ga0316579_10042471 3300031691 Bacteria 2112
1047 Ga0316579_10066877 3300031691 Bacteria 1697
1048 Ga0265314_10000624 3300031711 Bacteria 43582
1049 Ga0265314_10003187 3300031711 Bacteria 16061
1050 Ga0265314_10004046 3300031711 Bacteria 13848
1051 Ga0265314_10013133 3300031711 Bacteria 6709
1052 Ga0265314_10014558 3300031711 Bacteria 6284
1053 Ga0265314_10015300 3300031711 Bacteria 6092
1054 Ga0265314_10017417 3300031711 Bacteria 5641
1055 Ga0265314_10089190 3300031711 Bacteria 2012
1056 Ga0265314_10130186 3300031711 Bacteria 1571
1057 Ga0265342_10013377 3300031712 Bacteria 5510
1058 Ga0265342_10014194 3300031712 Bacteria 5298
1059 Ga0265342_10030469 3300031712 Bacteria 3343
1060 Ga0265342_10030996 3300031712 Bacteria 3309
1061 Ga0265342_10052553 3300031712 Bacteria 2428
1062 Ga0316576_10007695 3300031727 Bacteria 6796
1063 Ga0316576_10016330 3300031727 Bacteria 5010
1064 Ga0316576_10023907 3300031727 Bacteria 4262
1065 Ga0316576_10035120 3300031727 Bacteria 3577
1066 Ga0316576_10045230 3300031727 Bacteria 3182
1067 Ga0316576_10146856 3300031727 Bacteria 1776
1068 Ga0316578_10003781 3300031728 Bacteria 7004
1069 Ga0316578_10016134 3300031728 Bacteria 4035
1070 Ga0316578_10113747 3300031728 Bacteria 1626
1071 Ga0307516_10013152 3300031730 Bacteria 8843
1072 Ga0307516_10046918 3300031730 Bacteria 4260
1073 Ga0307405_10422349 3300031731 Bacteria 1050
1074 Ga0316577_10007617 3300031733 Bacteria 5777
1075 Ga0316577_10053591 3300031733 Bacteria 2251
1076 Ga0316577_10094327 3300031733 Bacteria 1676
1077 Ga0316577_10100688 3300031733 Bacteria 1619
1078 Ga0307413_10082170 3300031824 Bacteria 2068
1079 Ga0307413_10148596 3300031824 Bacteria 1630
1080 Ga0307410_10143194 3300031852 Bacteria 1771
1081 Ga0307406_10000448 3300031901 Bacteria 24069
1082 Ga0307406_10148259 3300031901 Bacteria 1670
1083 Ga0307407_10056838 3300031903 Bacteria 2268
1084 Ga0307412_10210208 3300031911 Bacteria 1484
1085 Ga0307412_10272581 3300031911 Bacteria 1325
1086 Ga0307409_100038917 3300031995 Bacteria 3523
1087 Ga0307416_100191680 3300032002 Bacteria 1929
1088 Ga0307416_100705342 3300032002 Bacteria 1098
1089 Ga0316585_10006235 3300032137 Bacteria 3400
1090 Ga0316585_10034545 3300032137 Bacteria 1598
1091 Ga0316580_10004852 3300032139 Bacteria 3910
1092 Ga0316580_10015818 3300032139 Bacteria 2310
1093 Ga0307510_10019906 3300033180 Bacteria 7860
1094 Ga0316592_1011005 3300033524 Bacteria 1832
1095 Ga0316596_1001927 3300033541 Bacteria 4349
1096 Ga0373930_0038171 3300034816 Bacteria 1014
1097 Ga0373948_0027857 3300034817 Bacteria 1122
1098 Ga0373938_0008082 3300034957 Bacteria 1871
1099 Ga0373934_0022896 3300035086 Bacteria 2412
1100 Ga0373934_0040695 3300035086 Bacteria 1834
1101 Ga0373934_0159156 3300035086 Bacteria 926
1102 Ga0373923_0033188 3300035111 Bacteria 2089
1103 Ga0373932_0006725 3300035112 Bacteria 2727
1104 Ga0373936_0014842 3300035113 Bacteria 2982
1105 Ga0373941_0006359 3300035115 Bacteria 2843
1106 Ga0373945_0052781 3300035116 Bacteria 1499
1107 Ga0373945_0061247 3300035116 Bacteria 1405
1108 Ga0373954_0019886 3300035118 Bacteria 3031
1109 Ga0373956_0055627 3300035119 Bacteria 1785
1110 Ga0373956_0075914 3300035119 Bacteria 1537
1111 Ga0373960_0010106 3300035121 Bacteria 2300
1112 Ga0373960_0021937 3300035121 Bacteria 1704
1113 Ga0373943_0012466 3300035170 Bacteria 3829
1114 Ga0373943_0038009 3300035170 Bacteria 2312
1115 Ga0373955_0015773 3300035172 Bacteria 3707
1116 Ga0373942_0036883 3300035207 Bacteria 1319
1117 Ga0373961_0017262 3300035241 Bacteria 1870
1118 Ga0373961_0043369 3300035241 Bacteria 1308
1119 Ga0373962_0009720 3300035242 Bacteria 2388
1120 Ga0316574_0028279 3300035398 Bacteria 3380
1121 Ga0316574_0090702 3300035398 Bacteria 1948
1122 Ga0373931_0001346 3300035691 Bacteria 10513
1123 Ga0373931_0001932 3300035691 Bacteria 9081
1124 Ga0373931_0002117 3300035691 Bacteria 8744
1125 Ga0373931_0005624 3300035691 Bacteria 5814
1126 Ga0373935_0149843 3300035692 Bacteria 1582
1127 Ga0373935_0152573 3300035692 Bacteria 1569
1128 Ga0373935_0309551 3300035692 Bacteria 1118
1129 Ga0373927_0000731 3300035695 Bacteria 25089
1130 Ga0373927_0013684 3300035695 Bacteria 5387
1131 Ga0373927_0015215 3300035695 Bacteria 5085
1132 Ga0373927_0037518 3300035695 Bacteria 3149
1133 Ga0373927_0070795 3300035695 Bacteria 2257
1134 Ga0373933_0017460 3300035724 Bacteria 4025
1135 Ga0373933_0034003 3300035724 Bacteria 2968
1136 Ga0373933_0066885 3300035724 Bacteria 2179
1137 Ga0373947_0018153 3300035725 Bacteria 4048
1138 Ga0373947_0062984 3300035725 Bacteria 2258
1139 Ga0373947_0096239 3300035725 Bacteria 1853
1140 Ga0373947_0155237 3300035725 Bacteria 1477
1141 Ga0373947_0274113 3300035725 Bacteria 1120
1142 Ga0373937_0001423 3300036401 Bacteria 19994
1143 Ga0373937_0002342 3300036401 Bacteria 15788
1144 Ga0373937_0002962 3300036401 Bacteria 14207
1145 Ga0373937_0003675 3300036401 Bacteria 12955
1146 Ga0373937_0026345 3300036401 Bacteria 5254
1147 Ga0373937_0061345 3300036401 Bacteria 3456
1148 Ga0373937_0115599 3300036401 Bacteria 2498
1149 Ga0373937_0121846 3300036401 Bacteria 2431
1150 Ga0373937_0131952 3300036401 Bacteria 2333
1151 Ga0373937_0154255 3300036401 Bacteria 2152
1152 Ga0373937_0367853 3300036401 Bacteria 1363
1153 Ga0373937_0662347 3300036401 Bacteria 990
1154 Ga0373937_0663393 3300036401 Bacteria 989
1155 Ga0316582_0012360 3300036647 Bacteria 4761
1156 Ga0316582_0052854 3300036647 Bacteria 2583
1157 Ga0316582_0115571 3300036647 Bacteria 1790
1158 Ga0316582_0147545 3300036647 Bacteria 1589
1159 Ga0316582_0213057 3300036647 Bacteria 1320
1160 Ga0316584_0000315 3300036712 Bacteria 24865
1161 Ga0316584_0028549 3300036712 Bacteria 4116
1162 Ga0316584_0033689 3300036712 Bacteria 3794
1163 Ga0316584_0044380 3300036712 Bacteria 3314
1164 Ga0316584_0169650 3300036712 Bacteria 1619
1165 Ga0373925_0000049 3300037068 Bacteria 128065
1166 Ga0373925_0020859 3300037068 Bacteria 4775
1167 Ga0373925_0034949 3300037068 Bacteria 3706
1168 Ga0373925_0055440 3300037068 Bacteria 2967
1169 Ga0373925_0063554 3300037068 Bacteria 2777
1170 Ga0373925_0196098 3300037068 Bacteria 1604
1171 Ga0373925_0216804 3300037068 Bacteria 1526
1172 Ga0373925_0373098 3300037068 Bacteria 1161
1173 Ga0395899_0000018 3300037312 Bacteria 423194
1174 Ga0395899_0001404 3300037312 Bacteria 20645
1175 Ga0395899_0027182 3300037312 Bacteria 4315
1176 Ga0395899_0034035 3300037312 Bacteria 3825
1177 Ga0395899_0036915 3300037312 Bacteria 3664
1178 Ga0395899_0117030 3300037312 Bacteria 1912
1179 Ga0395899_0150529 3300037312 Bacteria 1649
1180 Ga0395900_0000072 3300037418 Bacteria 187428
1181 Ga0395900_0007333 3300037418 Bacteria 11410
1182 Ga0395900_0013029 3300037418 Bacteria 8497
1183 Ga0395900_0032387 3300037418 Bacteria 5376
1184 Ga0395900_0041435 3300037418 Bacteria 4747
1185 Ga0395900_0044633 3300037418 Bacteria 4566
1186 Ga0395900_0054353 3300037418 Bacteria 4123
1187 Ga0395900_0171116 3300037418 Bacteria 2211
1188 Ga0395900_0212715 3300037418 Bacteria 1952
1189 Ga0395900_0230183 3300037418 Bacteria 1864
1190 Ga0395898_0013476 3300037466 Bacteria 8418
1191 Ga0395898_0017819 3300037466 Bacteria 7246
1192 Ga0395898_0017968 3300037466 Bacteria 7215
1193 Ga0395898_0022634 3300037466 Bacteria 6363
1194 Ga0395898_0033282 3300037466 Bacteria 5145
1195 Ga0395898_0052976 3300037466 Bacteria 3963
1196 Ga0395898_0143321 3300037466 Bacteria 2287
1197 Ga0395898_0149035 3300037466 Bacteria 2239
1198 Ga0395898_0180037 3300037466 Bacteria 2020
1199 Ga0395898_0317207 3300037466 Bacteria 1487
1200 Ga0395905_0002499 3300037471 Bacteria 20331
1201 Ga0395905_0003717 3300037471 Bacteria 16167
1202 Ga0395905_0025761 3300037471 Bacteria 5545
1203 Ga0395905_0033855 3300037471 Bacteria 4799
1204 Ga0395905_0050626 3300037471 Bacteria 3891
1205 Ga0395905_0131441 3300037471 Bacteria 2354
1206 Ga0436364_0086082 3300037853 Bacteria 1030
1207 Ga0436364_0160208 3300037853 Bacteria 27808
1208 Ga0436364_0167282 3300037853 Bacteria 8800
1209 Ga0436364_0210663 3300037853 Bacteria 9471
1210 Ga0436364_0534280 3300037853 Bacteria 2202
1211 Ga0436364_0595239 3300037853 Bacteria 105667
1212 Ga0436364_0711284 3300037853 Bacteria 2364
1213 Ga0436364_0727525 3300037853 Bacteria 12494
1214 Ga0436364_0783603 3300037853 Bacteria 20633
1215 Ga0436364_1216533 3300037853 Bacteria 1066
1216 Ga0436364_1348565 3300037853 Bacteria 28540
1217 Ga0436364_1376752 3300037853 Bacteria 12366
1218 Ga0436364_1490963 3300037853 Bacteria 3520
1219 Ga0395901_0006683 3300038443 Bacteria 11656
1220 Ga0395901_0015122 3300038443 Bacteria 7848
1221 Ga0395901_0075498 3300038443 Bacteria 3516
1222 Ga0395901_0161651 3300038443 Bacteria 2352
1223 Ga0395901_0188810 3300038443 Bacteria 2161
1224 Ga0395901_0390296 3300038443 Bacteria 1431
1225 Ga0400485_11815 3300038735 Bacteria 1777
1226 Ga0400483_032686 3300039062 Bacteria 4131
1227 Ga0400483_140078 3300039062 Bacteria 2956
1228 Ga0400483_173548 3300039062 Bacteria 3143
1229 Ga0400483_203337 3300039062 Bacteria 3958
1230 Ga0400483_277787 3300039062 Bacteria 33179
1231 Ga0400487_06748 3300039110 Bacteria 2782
1232 Ga0436365_0120856 3300039437 Bacteria 4697
1233 Ga0436365_0298223 3300039437 Bacteria 74249
1234 Ga0436365_0364034 3300039437 Bacteria 67701
1235 Ga0436365_0422279 3300039437 Bacteria 1047
1236 Ga0436365_0439594 3300039437 Bacteria 58263
1237 Ga0436365_0458221 3300039437 Bacteria 1009
1238 Ga0436365_0486465 3300039437 Bacteria 4086
1239 Ga0436365_0588205 3300039437 Bacteria 2792
1240 Ga0436365_0653853 3300039437 Bacteria 26654
1241 Ga0436365_0994541 3300039437 Bacteria 5371
1242 Ga0436365_1478328 3300039437 Bacteria 5118
1243 Ga0436365_1638122 3300039437 Bacteria 3854
1244 Ga0436360_0305107 3300039438 Bacteria 1584
1245 Ga0436360_0670466 3300039438 Bacteria 1371
1246 Ga0436360_0771010 3300039438 Bacteria 2211
1247 Ga0436360_0787345 3300039438 Bacteria 1186
1248 Ga0436360_0808839 3300039438 Bacteria 4547
1249 Ga0436360_1157040 3300039438 Bacteria 1085
1250 Ga0436361_0077926 3300039447 Bacteria 1883
1251 Ga0436361_0382143 3300039447 Bacteria 1996
1252 Ga0436361_0455600 3300039447 Bacteria 2616
1253 Ga0436361_0458313 3300039447 Bacteria 2027
1254 Ga0436361_0468973 3300039447 Bacteria 5347
1255 Ga0436361_0553807 3300039447 Bacteria 20297
1256 Ga0436361_0623924 3300039447 Bacteria 2902
1257 Ga0436361_0643175 3300039447 Bacteria 6771
1258 Ga0436361_0714426 3300039447 Bacteria 2008
1259 Ga0436363_0221619 3300039450 Bacteria 5095
1260 Ga0436363_0261799 3300039450 Bacteria 3335
1261 Ga0436363_0407094 3300039450 Bacteria 1169
1262 Ga0436363_0434034 3300039450 Bacteria 20695
1263 Ga0436363_0908068 3300039450 Bacteria 1667
1264 Ga0436363_1083955 3300039450 Bacteria 1195
1265 Ga0436363_1184338 3300039450 Bacteria 22162
1266 Ga0436363_1589623 3300039450 Bacteria 18680
1267 Ga0436363_1639159 3300039450 Bacteria 3358
1268 Ga0436362_0132298 3300039453 Bacteria 2223
1269 Ga0436362_0706265 3300039453 Bacteria 1206
1270 Ga0436362_1295071 3300039453 Bacteria 3317
1271 Ga0439431_0043840 3300041997 Bacteria 1146
1272 Ga0439441_027275 3300042001 Bacteria 1089
1273 Ga0439458_0036343 3300042157 Bacteria 1186
1274 Ga0439435_0037066 3300042436 Bacteria 1350
1275 Ga0439459_0036595 3300042438 Bacteria 1025
1276 Ga0450916_006125 3300042530 Bacteria 1408
1277 Ga0450901_003488 3300042533 Bacteria 1639
1278 Ga0451577_0022138 3300042876 Bacteria 5805
1279 Ga0451577_0420130 3300042876 Bacteria 1214
1280 Ga0466969_0000722 3300044656 Bacteria 17863
1281 Ga0466966_0050018 3300044684 Bacteria 2660
1282 Ga0466961_0001425 3300044693 Bacteria 14831
1283 Ga0466963_0057966 3300044694 Bacteria 2581
1284 Ga0466963_0062811 3300044694 Bacteria 2485
1285 Ga0453684_0043324 3300044712 Bacteria 6050
1286 Ga0466971_0009671 3300044719 Bacteria 4207
1287 Ga0466970_0009156 3300044765 Bacteria 4995
1288 Ga0466957_0031207 3300044842 Bacteria 3183
1289 Ga0466960_0035913 3300044901 Bacteria 2319
1290 Ga0466959_0000040 3300045049 Bacteria 101109
1291 Ga0466959_0153490 3300045049 Bacteria 1622
1292 Ga0451576_0000537 3300045051 Bacteria 81691
1293 Ga0451576_0005502 3300045051 Bacteria 15834
1294 Ga0451576_0047456 3300045051 Bacteria 4515
1295 Ga0451576_0408413 3300045051 Bacteria 1424
1296 Ga0466958_0026837 3300045836 Bacteria 3404
1297 Ga0466967_0041270 3300045976 Bacteria 3977
1298 Ga0466967_0127232 3300045976 Bacteria 2361
1299 Ga0466967_0270461 3300045976 Bacteria 1628
1300 Ga0495627_004351 3300046453 Bacteria 5946
1301 Ga0495592_0017429 3300046454 Bacteria 5457
1302 Ga0495603_0001208 3300046455 Bacteria 15085
1303 Ga0495603_0044314 3300046455 Bacteria 2655
1304 Ga0495590_0000622 3300046457 Bacteria 16501
1305 Ga0495629_0018635 3300046459 Bacteria 4962
1306 Ga0495629_0046189 3300046459 Bacteria 3054
1307 Ga0495638_0000147 3300046460 Bacteria 110817
1308 Ga0495638_0004669 3300046460 Bacteria 10359
1309 Ga0495638_0005127 3300046460 Bacteria 9811
1310 Ga0495638_0016403 3300046460 Bacteria 4962
1311 Ga0495638_0082840 3300046460 Bacteria 1944
1312 Ga0495641_0013557 3300046461 Bacteria 4468
1313 Ga0495651_0046441 3300046462 Bacteria 3361
1314 Ga0495651_0220274 3300046462 Bacteria 1314
1315 Ga0495651_0307631 3300046462 Bacteria 1061
1316 Ga0495650_0000045 3300046471 Bacteria 346204
1317 Ga0495580_0000261 3300046472 Bacteria 42129
1318 Ga0495582_0002712 3300046473 Bacteria 9886
1319 Ga0495582_0294715 3300046473 Bacteria 932
1320 Ga0495639_0011317 3300046475 Bacteria 3845
1321 Ga0495664_0030612 3300046477 Bacteria 3153
1322 Ga0495664_0116888 3300046477 Bacteria 1612
1323 Ga0495664_0213607 3300046477 Bacteria 1168
1324 Ga0495594_0001016 3300046499 Bacteria 14638
1325 Ga0495594_0073681 3300046499 Bacteria 1901
1326 Ga0495607_0192119 3300046501 Bacteria 1016
1327 Ga0495583_0000005 3300046506 Bacteria 636894
1328 Ga0495583_0048378 3300046506 Bacteria 1952
1329 Ga0495606_0004052 3300046507 Bacteria 14934
1330 Ga0495606_0117612 3300046507 Bacteria 1595
1331 Ga0495608_0037550 3300046511 Bacteria 3257
1332 Ga0495610_0000101 3300046512 Bacteria 99012
1333 Ga0495616_0000905 3300046513 Bacteria 21388
1334 Ga0495620_0088411 3300046515 Bacteria 1245
1335 Ga0495628_0053545 3300046516 Bacteria 3184
1336 Ga0495630_0196782 3300046517 Bacteria 1538
1337 Ga0495631_0002661 3300046518 Bacteria 9960
1338 Ga0495637_0007923 3300046520 Bacteria 5234
1339 Ga0495637_0053066 3300046520 Bacteria 1689
1340 Ga0495648_0000575 3300046524 Bacteria 39312
1341 Ga0495642_0001834 3300046528 Bacteria 9098
1342 Ga0495652_0058906 3300046529 Bacteria 3251
1343 Ga0495652_0129079 3300046529 Bacteria 2004
1344 Ga0495652_0167787 3300046529 Bacteria 1697
1345 Ga0495652_0172039 3300046529 Bacteria 1671
1346 Ga0495654_0000018 3300046530 Bacteria 293124
1347 Ga0495665_0005634 3300046531 Bacteria 6753
1348 Ga0495640_0122730 3300046533 Bacteria 1687
1349 Ga0495640_0165127 3300046533 Bacteria 1417
1350 Ga0495640_0187228 3300046533 Bacteria 1317
1351 Ga0495586_0148968 3300046535 Bacteria 1316
1352 Ga0495609_0035053 3300046538 Bacteria 2273
1353 Ga0495597_0012047 3300046542 Bacteria 4179
1354 Ga0495645_0001337 3300046543 Bacteria 16682
1355 Ga0495645_0102392 3300046543 Bacteria 2035
1356 Ga0495622_0003259 3300046557 Bacteria 7679
1357 Ga0495622_0024063 3300046557 Bacteria 2842
1358 Ga0495633_0000314 3300046558 Bacteria 55070
1359 Ga0495633_0086677 3300046558 Bacteria 1456
1360 Ga0495667_0006560 3300046559 Bacteria 7897
1361 Ga0495668_0000061 3300046616 Bacteria 192499
1362 Ga0495668_0005125 3300046616 Bacteria 9010
1363 Ga0495668_0007234 3300046616 Bacteria 7123
1364 Ga0495668_0016736 3300046616 Bacteria 4262
1365 Ga0495668_0044770 3300046616 Bacteria 2459
1366 Ga0495668_0063383 3300046616 Bacteria 2036
1367 Ga0495668_0096547 3300046616 Bacteria 1617
1368 Ga0495668_0188062 3300046616 Bacteria 1131
1369 Ga0495634_0009907 3300046642 Bacteria 7005
1370 Ga0495611_0116876 3300046648 Bacteria 1243
1371 Ga0495625_0004160 3300046660 Bacteria 13789
1372 Ga0495625_0005790 3300046660 Bacteria 11163
1373 Ga0495625_0006681 3300046660 Bacteria 10232
1374 Ga0495625_0009050 3300046660 Bacteria 8404
1375 Ga0495625_0024749 3300046660 Bacteria 4562
1376 Ga0495635_0027669 3300046663 Bacteria 3943
1377 Ga0495635_0065013 3300046663 Bacteria 2503
1378 Ga0495635_0118428 3300046663 Bacteria 1807
1379 Ga0495635_0189477 3300046663 Bacteria 1397
1380 Ga0495635_0249315 3300046663 Bacteria 1197
1381 Ga0495588_0013850 3300046674 Bacteria 3849
1382 Ga0495647_0007552 3300046681 Bacteria 3647
1383 Ga0495658_0004453 3300046683 Bacteria 6896
1384 Ga0495658_0030155 3300046683 Bacteria 2943
1385 Ga0495658_0103244 3300046683 Bacteria 1705
1386 Ga0495658_0116266 3300046683 Bacteria 1613
1387 Ga0495669_0000002 3300046684 Bacteria 282777
1388 Ga0495669_0000369 3300046684 Bacteria 22928
1389 Ga0495613_0000707 3300046689 Bacteria 26213
1390 Ga0495613_0003535 3300046689 Bacteria 11714
1391 Ga0495649_0000627 3300046694 Bacteria 29078
1392 Ga0495589_0130981 3300046794 Bacteria 1204
1393 Ga0495660_0004741 3300046810 Bacteria 8211
1394 Ga0495581_0000368 3300047315 Bacteria 22619
1395 Ga0495581_0021429 3300047315 Bacteria 3747
1396 Ga0495604_0137403 3300047317 Bacteria 1750
1397 Ga0495604_0202824 3300047317 Bacteria 1375
1398 Ga0495674_0126448 3300047319 Bacteria 2156
1399 Ga0495672_0001490 3300047320 Bacteria 22961
1400 Ga0495672_0007884 3300047320 Bacteria 7945
1401 Ga0495683_0059907 3300047323 Bacteria 1888
1402 Ga0495687_013678 3300047443 Bacteria 4218
1403 Ga0495673_0000119 3300047469 Bacteria 145179
1404 Ga0495673_0000264 3300047469 Bacteria 72931
1405 Ga0495681_0124370 3300047470 Bacteria 1104
1406 Ga0495684_0061528 3300047471 Bacteria 2856
1407 Ga0495684_0100602 3300047471 Bacteria 2186
1408 Ga0495684_0263219 3300047471 Bacteria 1250
1409 Ga0495686_0000096 3300047472 Bacteria 184611
1410 Ga0495686_0001221 3300047472 Bacteria 29433
1411 Ga0495686_0003784 3300047472 Bacteria 12856
1412 Ga0495686_0026999 3300047472 Bacteria 3752
1413 Ga0495686_0027289 3300047472 Bacteria 3730
1414 Ga0495686_0049096 3300047472 Bacteria 2656
1415 Ga0495686_0112000 3300047472 Bacteria 1635
1416 Ga0495593_0003713 3300047673 Bacteria 9117
1417 Ga0495593_0188398 3300047673 Bacteria 1038
1418 Ga0495602_0011229 3300048088 Bacteria 9262
1419 Ga0495602_0362417 3300048088 Bacteria 1043
1420 Ga0495614_0011074 3300048089 Bacteria 3968
1421 Ga0496100_0000888 3300048903 Bacteria 14273
1422 Ga0496100_0016389 3300048903 Bacteria 4351
1423 Ga0496100_0214973 3300048903 Bacteria 1408
1424 Ga0496101_0005049 3300048904 Bacteria 8391
1425 Ga0496101_0025576 3300048904 Bacteria 4097
1426 Ga0496101_0086661 3300048904 Bacteria 2323
1427 Ga0496101_0159197 3300048904 Bacteria 1731
1428 Ga0496102_0014500 3300048905 Bacteria 6847
1429 Ga0496102_0044401 3300048905 Bacteria 4033
1430 Ga0496102_0045269 3300048905 Bacteria 3995
1431 Ga0496102_0057144 3300048905 Bacteria 3561
1432 Ga0496102_0129891 3300048905 Bacteria 2357
1433 Ga0496102_0358026 3300048905 Bacteria 1374
1434 Ga0496103_0051190 3300048906 Bacteria 2556
1435 Ga0496104_0000175 3300048907 Bacteria 56916
1436 Ga0496104_0007205 3300048907 Bacteria 9808
1437 Ga0496104_0032624 3300048907 Bacteria 4848
1438 Ga0496104_0045404 3300048907 Bacteria 4132
1439 Ga0496104_0076235 3300048907 Bacteria 3194
1440 Ga0496104_0128702 3300048907 Bacteria 2432
1441 Ga0496104_0198346 3300048907 Bacteria 1919
1442 Ga0496104_0294277 3300048907 Bacteria 1536
1443 Ga0496105_0010602 3300048908 Bacteria 7251
1444 Ga0496105_0014060 3300048908 Bacteria 6369
1445 Ga0496105_0016830 3300048908 Bacteria 5846
1446 Ga0496105_0048042 3300048908 Bacteria 3523
1447 Ga0496105_0324425 3300048908 Bacteria 1233
1448 Ga0496106_0007110 3300048909 Bacteria 8272
1449 Ga0496106_0007877 3300048909 Bacteria 7875
1450 Ga0496106_0012041 3300048909 Bacteria 6383
1451 Ga0496106_0020304 3300048909 Bacteria 4930
1452 Ga0496106_0159017 3300048909 Bacteria 1786
1453 Ga0496107_0001574 3300048910 Bacteria 14192
1454 Ga0496107_0006517 3300048910 Bacteria 8029
1455 Ga0496107_0022536 3300048910 Bacteria 4450
1456 Ga0496107_0097844 3300048910 Bacteria 2149
1457 Ga0496107_0341440 3300048910 Bacteria 1114
1458 Ga0496107_0500874 3300048910 Bacteria 901
1459 Ga0496108_0006491 3300048911 Bacteria 9488
1460 Ga0496108_0016024 3300048911 Bacteria 6111
1461 Ga0496108_0047229 3300048911 Bacteria 3599
1462 Ga0496108_0064110 3300048911 Bacteria 3095
1463 Ga0496108_0513180 3300048911 Bacteria 1047
1464 Ga0496109_0003143 3300048912 Bacteria 13775
1465 Ga0496109_0028937 3300048912 Bacteria 4960
1466 Ga0496109_0041855 3300048912 Bacteria 4150
1467 Ga0496109_0200967 3300048912 Bacteria 1873
1468 Ga0496109_0297055 3300048912 Bacteria 1523
1469 Ga0496110_0000549 3300048913 Bacteria 25571
1470 Ga0496110_0007751 3300048913 Bacteria 8596
1471 Ga0496110_0082000 3300048913 Bacteria 2876
1472 Ga0496110_0162415 3300048913 Bacteria 2025
1473 Ga0496110_0203572 3300048913 Bacteria 1798
1474 Ga0496111_0006678 3300048914 Bacteria 7505
1475 Ga0496111_0025793 3300048914 Bacteria 4147
1476 Ga0496111_0138676 3300048914 Bacteria 1802
1477 Ga0496111_0328516 3300048914 Bacteria 1132
1478 Ga0496111_0415729 3300048914 Bacteria 993
1479 Ga0496112_0010229 3300048915 Bacteria 8504
1480 Ga0496112_0015256 3300048915 Bacteria 7163
1481 Ga0496112_0037705 3300048915 Bacteria 4718
1482 Ga0496112_0041350 3300048915 Bacteria 4510
1483 Ga0496112_0045837 3300048915 Bacteria 4286
1484 Ga0496112_0079257 3300048915 Bacteria 3249
1485 Ga0496112_0108721 3300048915 Bacteria 2743
1486 Ga0496112_0396084 3300048915 Bacteria 1321
1487 Ga0496113_0004354 3300048916 Bacteria 8680
1488 Ga0496113_0029421 3300048916 Bacteria 3966
1489 Ga0496113_0048824 3300048916 Bacteria 3150
1490 Ga0496113_0282940 3300048916 Bacteria 1326
1491 Ga0496114_0000794 3300048917 Bacteria 23623
1492 Ga0496114_0007626 3300048917 Bacteria 8558
1493 Ga0496114_0420852 3300048917 Bacteria 1183
1494 Ga0496115_0000050 3300048918 Bacteria 109402
1495 Ga0496115_0000862 3300048918 Bacteria 22030
1496 Ga0496115_0008977 3300048918 Bacteria 7411
1497 Ga0496115_0010603 3300048918 Bacteria 6892
1498 Ga0496115_0010863 3300048918 Bacteria 6814
1499 Ga0496115_0033370 3300048918 Bacteria 4064
1500 Ga0496115_0266317 3300048918 Bacteria 1409
1501 Ga0496115_0368245 3300048918 Bacteria 1170
1502 Ga0496118_0012536 3300048921 Bacteria 8124
1503 Ga0496119_0031855 3300048922 Bacteria 3525
1504 Ga0496121_0000397 3300048924 Bacteria 87422
1505 Ga0496121_0001859 3300048924 Bacteria 33884
1506 Ga0496121_0004198 3300048924 Bacteria 19675
1507 Ga0496121_0115248 3300048924 Bacteria 2041
1508 Ga0496121_0228241 3300048924 Bacteria 1306
1509 Ga0496122_0251081 3300048925 Bacteria 989
1510 Ga0496123_0001218 3300048926 Bacteria 37586
1511 Ga0496124_0018292 3300048927 Bacteria 6566
1512 Ga0496126_0002022 3300048929 Bacteria 28683
1513 Ga0495678_001567 3300049459 Bacteria 17566
1514 Ga0495682_0001979 3300049460 Bacteria 10130
1515 Ga0495682_0009967 3300049460 Bacteria 3696
1516 Ga0501031_0020902 3300049568 Bacteria 4268
1517 Ga0501031_0050146 3300049568 Bacteria 2720
1518 Ga0501031_0063777 3300049568 Bacteria 2400
1519 Ga0501031_0103794 3300049568 Bacteria 1855
1520 Ga0501031_0161821 3300049568 Bacteria 1463
1521 Ga0501032_0000393 3300049569 Bacteria 36019
1522 Ga0501032_0001085 3300049569 Bacteria 21700
1523 Ga0501032_0009467 3300049569 Bacteria 7062
1524 Ga0501032_0099046 3300049569 Bacteria 1931
1525 Ga0501033_0003745 3300049570 Bacteria 12362
1526 Ga0501033_0021039 3300049570 Bacteria 4924
1527 Ga0501033_0069486 3300049570 Bacteria 2588
1528 Ga0501033_0100456 3300049570 Bacteria 2111
1529 Ga0501033_0116310 3300049570 Bacteria 1943
1530 Ga0501033_0213882 3300049570 Bacteria 1374
1531 Ga0501033_0350485 3300049570 Bacteria 1034
1532 Ga0501034_0000166 3300049571 Bacteria 122782
1533 Ga0501034_0000293 3300049571 Bacteria 88978
1534 Ga0501034_0002384 3300049571 Bacteria 22822
1535 Ga0501034_0009371 3300049571 Bacteria 10258
1536 Ga0501034_0022687 3300049571 Bacteria 6394
1537 Ga0501034_0024173 3300049571 Bacteria 6180
1538 Ga0501034_0036607 3300049571 Bacteria 4970
1539 Ga0501034_0036636 3300049571 Bacteria 4967
1540 Ga0501034_0042735 3300049571 Bacteria 4588
1541 Ga0501034_0061556 3300049571 Bacteria 3769
1542 Ga0501034_0065142 3300049571 Bacteria 3656
1543 Ga0501034_0077613 3300049571 Bacteria 3327
1544 Ga0501034_0188727 3300049571 Bacteria 2024
1545 Ga0501034_0350030 3300049571 Bacteria 1406
1546 Ga0501034_0373545 3300049571 Bacteria 1352
1547 Ga0501034_0524502 3300049571 Bacteria 1096
1548 Ga0501034_0599294 3300049571 Bacteria 1007
1549 Ga0501036_0000573 3300049572 Bacteria 26478
1550 Ga0501036_0019277 3300049572 Bacteria 5725
1551 Ga0501036_0056835 3300049572 Bacteria 3315
1552 Ga0501036_0059651 3300049572 Bacteria 3233
1553 Ga0501036_0089297 3300049572 Bacteria 2604
1554 Ga0501036_0092941 3300049572 Bacteria 2549
1555 Ga0501036_0166261 3300049572 Bacteria 1859
1556 Ga0501036_0223847 3300049572 Bacteria 1579
1557 Ga0501037_0001135 3300049573 Bacteria 19731
1558 Ga0501037_0019417 3300049573 Bacteria 5013
1559 Ga0501037_0042986 3300049573 Bacteria 3321
1560 Ga0501037_0133980 3300049573 Bacteria 1775
1561 Ga0501037_0287301 3300049573 Bacteria 1145
1562 Ga0501038_0020349 3300049574 Bacteria 5966
1563 Ga0501038_0033540 3300049574 Bacteria 4522
1564 Ga0501038_0074234 3300049574 Bacteria 2878
1565 Ga0501038_0285909 3300049574 Bacteria 1297
1566 Ga0501039_0000452 3300049575 Bacteria 29793
1567 Ga0501039_0034178 3300049575 Bacteria 3923
1568 Ga0501039_0079424 3300049575 Bacteria 2552
1569 Ga0501039_0090104 3300049575 Bacteria 2390
1570 Ga0501039_0178252 3300049575 Bacteria 1671
1571 Ga0501039_0359488 3300049575 Bacteria 1144
1572 Ga0501040_0000753 3300049576 Bacteria 20096
1573 Ga0501040_0004689 3300049576 Bacteria 8870
1574 Ga0501040_0025592 3300049576 Bacteria 3968
1575 Ga0501040_0042041 3300049576 Bacteria 3113
1576 Ga0501040_0132240 3300049576 Bacteria 1755
1577 Ga0501040_0296136 3300049576 Bacteria 1156
1578 Ga0501041_0015930 3300049577 Bacteria 4467
1579 Ga0501041_0019141 3300049577 Bacteria 4084
1580 Ga0501041_0164405 3300049577 Bacteria 1388
1581 Ga0501042_0014718 3300049578 Bacteria 5341
1582 Ga0501042_0085769 3300049578 Bacteria 2258
1583 Ga0501042_0117858 3300049578 Bacteria 1911
1584 Ga0501042_0218263 3300049578 Bacteria 1375
1585 Ga0501042_0258461 3300049578 Bacteria 1257
1586 Ga0501043_0009819 3300049579 Bacteria 7503
1587 Ga0501043_0014748 3300049579 Bacteria 6118
1588 Ga0501043_0033540 3300049579 Bacteria 4040
1589 Ga0501043_0060434 3300049579 Bacteria 2975
1590 Ga0501043_0077234 3300049579 Bacteria 2616
1591 Ga0501043_0078731 3300049579 Bacteria 2590
1592 Ga0501043_0115030 3300049579 Bacteria 2111
1593 Ga0501043_0116875 3300049579 Bacteria 2093
1594 Ga0501043_0257498 3300049579 Bacteria 1343
1595 Ga0501043_0339544 3300049579 Bacteria 1143
1596 Ga0501046_0000224 3300049580 Bacteria 58986
1597 Ga0501046_0001372 3300049580 Bacteria 23445
1598 Ga0501046_0003178 3300049580 Bacteria 15162
1599 Ga0501046_0014585 3300049580 Bacteria 6622
1600 Ga0501046_0034673 3300049580 Bacteria 4071
1601 Ga0501046_0040933 3300049580 Bacteria 3700
1602 Ga0501046_0073657 3300049580 Bacteria 2650
1603 Ga0501046_0203757 3300049580 Bacteria 1471
1604 Ga0501047_0000283 3300049581 Bacteria 58613
1605 Ga0501047_0000643 3300049581 Bacteria 36707
1606 Ga0501047_0002385 3300049581 Bacteria 17961
1607 Ga0501047_0012475 3300049581 Bacteria 8048
1608 Ga0501047_0017227 3300049581 Bacteria 6917
1609 Ga0501047_0026443 3300049581 Bacteria 5583
1610 Ga0501047_0026914 3300049581 Bacteria 5537
1611 Ga0501047_0029202 3300049581 Bacteria 5318
1612 Ga0501047_0041630 3300049581 Bacteria 4439
1613 Ga0501047_0068585 3300049581 Bacteria 3415
1614 Ga0501047_0073181 3300049581 Bacteria 3299
1615 Ga0501047_0372289 3300049581 Bacteria 1263
1616 Ga0501048_0000649 3300049582 Bacteria 25020
1617 Ga0501048_0017618 3300049582 Bacteria 5259
1618 Ga0501048_0126057 3300049582 Bacteria 1810
1619 Ga0501048_0139986 3300049582 Bacteria 1711
1620 Ga0501048_0143658 3300049582 Bacteria 1687
1621 Ga0501067_0000034 3300049583 Bacteria 84068
1622 Ga0501067_0001137 3300049583 Bacteria 14411
1623 Ga0501067_0001833 3300049583 Bacteria 11681
1624 Ga0501067_0007840 3300049583 Bacteria 5936
1625 Ga0501067_0010141 3300049583 Bacteria 5210
1626 Ga0501068_0027576 3300049584 Bacteria 3354
1627 Ga0501068_0078899 3300049584 Bacteria 2018
1628 Ga0501068_0174240 3300049584 Bacteria 1359
1629 Ga0501068_0180178 3300049584 Bacteria 1336
1630 Ga0501069_0005268 3300049585 Bacteria 6718
1631 Ga0501069_0017674 3300049585 Bacteria 3843
1632 Ga0501069_0020008 3300049585 Bacteria 3623
1633 Ga0501069_0031051 3300049585 Bacteria 2936
1634 Ga0501070_0006852 3300049586 Bacteria 9696
1635 Ga0501070_0013555 3300049586 Bacteria 6871
1636 Ga0501070_0042188 3300049586 Bacteria 3800
1637 Ga0501070_0052496 3300049586 Bacteria 3384
1638 Ga0501070_0185107 3300049586 Bacteria 1713
1639 Ga0501071_0022728 3300049587 Bacteria 4373
1640 Ga0501071_0086866 3300049587 Bacteria 2294
1641 Ga0501071_0111696 3300049587 Bacteria 2020
1642 Ga0501071_0142669 3300049587 Bacteria 1784
1643 Ga0501071_0220018 3300049587 Bacteria 1429
1644 Ga0501071_0289678 3300049587 Bacteria 1240
1645 Ga0501072_0017631 3300049588 Bacteria 5491
1646 Ga0501072_0026088 3300049588 Bacteria 4553
1647 Ga0501072_0032705 3300049588 Bacteria 4073
1648 Ga0501072_0041455 3300049588 Bacteria 3616
1649 Ga0501072_0041762 3300049588 Bacteria 3602
1650 Ga0501072_0069545 3300049588 Bacteria 2780
1651 Ga0501072_0088646 3300049588 Bacteria 2455
1652 Ga0501072_0109945 3300049588 Bacteria 2194
1653 Ga0501072_0114876 3300049588 Bacteria 2143
1654 Ga0501072_0173038 3300049588 Bacteria 1723
1655 Ga0501072_0262635 3300049588 Bacteria 1374
1656 Ga0501072_0377622 3300049588 Bacteria 1125
1657 Ga0501073_0000013 3300049589 Bacteria 160591
1658 Ga0501073_0001616 3300049589 Bacteria 16696
1659 Ga0501073_0013717 3300049589 Bacteria 5894
1660 Ga0501073_0022747 3300049589 Bacteria 4510
1661 Ga0501073_0066687 3300049589 Bacteria 2509
1662 Ga0501073_0146604 3300049589 Bacteria 1636
1663 Ga0501073_0149174 3300049589 Bacteria 1620
1664 Ga0501073_0244677 3300049589 Bacteria 1238
1665 Ga0501073_0282778 3300049589 Bacteria 1145
1666 Ga0501074_0022336 3300049590 Bacteria 4596
1667 Ga0501074_0069593 3300049590 Bacteria 2530
1668 Ga0501074_0141173 3300049590 Bacteria 1723
1669 Ga0501074_0219711 3300049590 Bacteria 1353
1670 Ga0501074_0264619 3300049590 Bacteria 1222
1671 Ga0501074_0312973 3300049590 Bacteria 1115
1672 Ga0501075_0001958 3300049591 Bacteria 13583
1673 Ga0501075_0007759 3300049591 Bacteria 7447
1674 Ga0501075_0035010 3300049591 Bacteria 3743
1675 Ga0501075_0037459 3300049591 Bacteria 3624
1676 Ga0501075_0071646 3300049591 Bacteria 2620
1677 Ga0501075_0077203 3300049591 Bacteria 2520
1678 Ga0501075_0180931 3300049591 Bacteria 1608
1679 Ga0501076_0002771 3300049592 Bacteria 12131
1680 Ga0501076_0076938 3300049592 Bacteria 2676
1681 Ga0501076_0078153 3300049592 Bacteria 2655
1682 Ga0501076_0103508 3300049592 Bacteria 2296
1683 Ga0501076_0113893 3300049592 Bacteria 2188
1684 Ga0501076_0343798 3300049592 Bacteria 1225
1685 Ga0501076_0391467 3300049592 Bacteria 1142
1686 Ga0501077_0000032 3300049593 Bacteria 69728
1687 Ga0501077_0003508 3300049593 Bacteria 9414
1688 Ga0501077_0048318 3300049593 Bacteria 2703
1689 Ga0501077_0051285 3300049593 Bacteria 2622
1690 Ga0501077_0057879 3300049593 Bacteria 2461
1691 Ga0501077_0069657 3300049593 Bacteria 2229
1692 Ga0501077_0072007 3300049593 Bacteria 2190
1693 Ga0501077_0149333 3300049593 Bacteria 1483
1694 Ga0501077_0201904 3300049593 Bacteria 1263
1695 Ga0501077_0309142 3300049593 Bacteria 1007
1696 Ga0501079_0001097 3300049741 Bacteria 18812
1697 Ga0501079_0012147 3300049741 Bacteria 6575
1698 Ga0501079_0075110 3300049741 Bacteria 2613
1699 Ga0501079_0076925 3300049741 Bacteria 2581
1700 Ga0501079_0077944 3300049741 Bacteria 2563
1701 Ga0501079_0101057 3300049741 Bacteria 2236
1702 Ga0501079_0140582 3300049741 Bacteria 1881
1703 Ga0501079_0356933 3300049741 Bacteria 1145
1704 Ga0501080_0000315 3300049742 Bacteria 37063
1705 Ga0501080_0002921 3300049742 Bacteria 15015
1706 Ga0501080_0004237 3300049742 Bacteria 12723
1707 Ga0501080_0006226 3300049742 Bacteria 10708
1708 Ga0501080_0024099 3300049742 Bacteria 5641
1709 Ga0501080_0025399 3300049742 Bacteria 5497
1710 Ga0501080_0070328 3300049742 Bacteria 3255
1711 Ga0501080_0083070 3300049742 Bacteria 2976
1712 Ga0501080_0122642 3300049742 Bacteria 2407
1713 Ga0501080_0126788 3300049742 Bacteria 2364
1714 Ga0501080_0182576 3300049742 Bacteria 1930
1715 Ga0501080_0248969 3300049742 Bacteria 1620
1716 Ga0501080_0250153 3300049742 Bacteria 1616
1717 Ga0501080_0447353 3300049742 Bacteria 1158
1718 Ga0501080_0511549 3300049742 Bacteria 1072
1719 Ga0501081_0000197 3300049743 Bacteria 29348
1720 Ga0501081_0004838 3300049743 Bacteria 8654
1721 Ga0501081_0006179 3300049743 Bacteria 7757
1722 Ga0501081_0014493 3300049743 Bacteria 5200
1723 Ga0501081_0048475 3300049743 Bacteria 2923
1724 Ga0501081_0068946 3300049743 Bacteria 2463
1725 Ga0501081_0156971 3300049743 Bacteria 1637
1726 Ga0501081_0256298 3300049743 Bacteria 1278
1727 Ga0501083_0006676 3300049744 Bacteria 8186
1728 Ga0501083_0010086 3300049744 Bacteria 6658
1729 Ga0501083_0022332 3300049744 Bacteria 4392
1730 Ga0501083_0083400 3300049744 Bacteria 2117
1731 Ga0501083_0083409 3300049744 Bacteria 2117
1732 Ga0501083_0101529 3300049744 Bacteria 1896
1733 Ga0501083_0266516 3300049744 Bacteria 1114
1734 Ga0501083_0398461 3300049744 Bacteria 895
1735 Ga0501035_0000084 3300049822 Bacteria 116222
1736 Ga0501035_0004157 3300049822 Bacteria 13760
1737 Ga0501035_0017251 3300049822 Bacteria 6656
1738 Ga0501035_0019450 3300049822 Bacteria 6245
1739 Ga0501035_0034636 3300049822 Bacteria 4587
1740 Ga0501035_0063808 3300049822 Bacteria 3275
1741 Ga0501035_0089729 3300049822 Bacteria 2707
1742 Ga0501035_0093460 3300049822 Bacteria 2646
1743 Ga0501035_0143575 3300049822 Bacteria 2074
1744 Ga0501035_0167887 3300049822 Bacteria 1897
1745 Ga0501035_0179237 3300049822 Bacteria 1826
1746 Ga0501035_0180239 3300049822 Bacteria 1820
1747 Ga0501044_0000073 3300049823 Bacteria 122507
1748 Ga0501044_0002338 3300049823 Bacteria 21619
1749 Ga0501044_0006073 3300049823 Bacteria 13326
1750 Ga0501044_0013504 3300049823 Bacteria 8832
1751 Ga0501044_0015609 3300049823 Bacteria 8181
1752 Ga0501044_0016919 3300049823 Bacteria 7823
1753 Ga0501044_0024961 3300049823 Bacteria 6338
1754 Ga0501044_0031208 3300049823 Bacteria 5609
1755 Ga0501044_0047398 3300049823 Bacteria 4444
1756 Ga0501044_0068731 3300049823 Bacteria 3608
1757 Ga0501044_0092258 3300049823 Bacteria 3054
1758 Ga0501044_0170850 3300049823 Bacteria 2146
1759 Ga0501044_0211874 3300049823 Bacteria 1891
1760 Ga0501044_0306815 3300049823 Bacteria 1514
1761 Ga0501044_0332239 3300049823 Bacteria 1442
1762 Ga0501045_0008028 3300049824 Bacteria 7350
1763 Ga0501045_0024337 3300049824 Bacteria 4347
1764 Ga0501045_0090001 3300049824 Bacteria 2267
1765 Ga0501045_0104102 3300049824 Bacteria 2102
1766 Ga0501045_0105664 3300049824 Bacteria 2086
1767 Ga0501045_0157645 3300049824 Bacteria 1689
1768 Ga0501045_0186813 3300049824 Bacteria 1544
1769 Ga0501045_0196881 3300049824 Bacteria 1502
1770 Ga0501045_0244115 3300049824 Bacteria 1337
1771 nmdc:mga03683_134274_c1 3300050489 Bacteria 1109
1772 nmdc:mga03683_67370_c1 3300050489 Bacteria 1524
1773 nmdc:mga00v17_263953_c1 3300050491 Bacteria 1117
1774 nmdc:mga00v17_509_c1 3300050491 Bacteria 21768
1775 nmdc:mga00v17_54865_c1 3300050491 Bacteria 2432
1776 nmdc:mga0yw44_63019_c1 3300050492 Bacteria 2279
1777 nmdc:mga0yw44_8358_c1 3300050492 Bacteria 5151
1778 nmdc:mga0k408_142329_c1 3300050493 Bacteria 1427
1779 nmdc:mga0k408_42496_c1 3300050493 Bacteria 2618
1780 nmdc:mga0k408_77846_c1 3300050493 Bacteria 1939
1781 nmdc:mga06z11_2382_c1 3300050494 Bacteria 7160
1782 nmdc:mga06z11_7594_c1 3300050494 Bacteria 4474
1783 nmdc:mga04h51_230_c1 3300050495 Bacteria 14875
1784 nmdc:mga04h51_2815_c1 3300050495 Bacteria 4159
1785 nmdc:mga04h51_30937_c1 3300050495 Bacteria 1688
1786 nmdc:mga07m45_159056_c1 3300050496 Bacteria 1311
1787 nmdc:mga05p37_14898_c1 3300050507 Bacteria 9336
1788 nmdc:mga05p37_424127_c1 3300050507 Bacteria 1547
1789 nmdc:mga05p37_475407_c1 3300050507 Bacteria 1441
1790 nmdc:mga05p37_59194_c1 3300050507 Bacteria 4718
1791 nmdc:mga09592_19535_c1 3300050508 Bacteria 5565
1792 nmdc:mga09592_565933_c1 3300050508 Bacteria 975
1793 nmdc:mga0qj67_21702_c1 3300050509 Bacteria 4927
1794 nmdc:mga06r32_14451_c1 3300050510 Bacteria 7166
1795 nmdc:mga06r32_25520_c1 3300050510 Bacteria 5498
1796 nmdc:mga06r32_67460_c1 3300050510 Bacteria 3454
1797 nmdc:mga06r32_70210_c1 3300050510 Bacteria 3387
1798 nmdc:mga08y16_175_c1 3300050511 Bacteria 56460
1799 nmdc:mga08y16_198871_c1 3300050511 Bacteria 2077
1800 nmdc:mga08y16_211052_c1 3300050511 Bacteria 2011
1801 nmdc:mga08y16_247928_c1 3300050511 Bacteria 1840
1802 nmdc:mga08y16_368635_c1 3300050511 Bacteria 1473
1803 nmdc:mga08y16_83478_c1 3300050511 Bacteria 3330
1804 nmdc:mga0n895_159904_c1 3300050512 Bacteria 2284
1805 nmdc:mga0n895_182774_c1 3300050512 Bacteria 2128
1806 nmdc:mga0n895_295439_c1 3300050512 Bacteria 1642
1807 nmdc:mga0n895_6848_c1 3300050512 Bacteria 9735
1808 nmdc:mga0n895_97053_c1 3300050512 Bacteria 2953
1809 nmdc:mga0rr50_13712_c2 3300050513 Bacteria 1701
1810 nmdc:mga0rr50_17190_c1 3300050513 Bacteria 4823
1811 nmdc:mga0rr50_251206_c1 3300050513 Bacteria 1469
1812 nmdc:mga08x19_165366_c1 3300050514 Bacteria 1504
1813 nmdc:mga08x19_3036_c1 3300050514 Bacteria 10089
1814 nmdc:mga08x19_35621_c1 3300050514 Bacteria 3150
1815 nmdc:mga0a205_169862_c1 3300050515 Bacteria 2077
1816 nmdc:mga0a205_227977_c1 3300050515 Bacteria 1747
1817 nmdc:mga0a205_3040_c1 3300050515 Bacteria 14873
1818 nmdc:mga0sz30_5290_c1 3300050516 Bacteria 4728
1819 Ga0495601_0002642 3300053077 Bacteria 10172
1820 Ga0495601_0004037 3300053077 Bacteria 8456
1821 Ga0495612_0012290 3300053078 Bacteria 3451
1822 Ga0495612_0029221 3300053078 Bacteria 2220
1823 Ga0500635_0000216 3300053080 Bacteria 27202
1824 Ga0500635_0002546 3300053080 Bacteria 4534
1825 Ga0495595_0007562 3300053084 Bacteria 4448
1826 Ga0495595_0026766 3300053084 Bacteria 2564
1827 Ga0495595_0107670 3300053084 Bacteria 1349
1828 Ga0495619_0014082 3300053085 Bacteria 5047
1829 Ga0495619_0018044 3300053085 Bacteria 4474
1830 Ga0495619_0077400 3300053085 Bacteria 2234
1831 Ga0495619_0180851 3300053085 Bacteria 1459
1832 Ga0500578_0000070 3300053086 Bacteria 113202
1833 Ga0500643_000017 3300053087 Bacteria 305781
1834 Ga0500643_000374 3300053087 Bacteria 34998
1835 Ga0500643_007339 3300053087 Bacteria 4465
1836 Ga0500643_041485 3300053087 Bacteria 1351
1837 Ga0500644_0000087 3300053088 Bacteria 56947
1838 Ga0500644_0002225 3300053088 Bacteria 4893
1839 Ga0500644_0006658 3300053088 Bacteria 2973
1840 Ga0500647_0012142 3300053091 Bacteria 3869
1841 Ga0500651_0011452 3300053093 Bacteria 5349
1842 Ga0500651_0038466 3300053093 Bacteria 3013
1843 Ga0500641_0001055 3300053096 Bacteria 9831
1844 Ga0500641_0066799 3300053096 Bacteria 1506
1845 Ga0500641_0083496 3300053096 Bacteria 1358
1846 Ga0500555_008402 3300053103 Bacteria 2941
1847 Ga0500556_0000379 3300053104 Bacteria 32454
1848 Ga0500556_0001645 3300053104 Bacteria 8735
1849 Ga0500556_0006342 3300053104 Bacteria 3355
1850 Ga0500562_005578 3300053108 Bacteria 3163
1851 Ga0500562_010000 3300053108 Bacteria 2400
1852 Ga0500562_010799 3300053108 Bacteria 2316
1853 Ga0500569_000301 3300053109 Bacteria 7900
1854 Ga0500572_000259 3300053111 Bacteria 19013
1855 Ga0500594_0000146 3300053118 Bacteria 19223
1856 Ga0500595_000630 3300053119 Bacteria 21144
1857 Ga0500595_003016 3300053119 Bacteria 8013
1858 Ga0500595_003866 3300053119 Bacteria 6877
1859 Ga0500595_006380 3300053119 Bacteria 5006
1860 Ga0500595_011880 3300053119 Bacteria 3389
1861 Ga0500595_033925 3300053119 Bacteria 1691
1862 Ga0500608_000048 3300053122 Bacteria 55108
1863 Ga0500608_008519 3300053122 Bacteria 4317
1864 Ga0500618_000336 3300053125 Bacteria 33703
1865 Ga0500652_091300 3300053131 Bacteria 1272
1866 Ga0500655_033196 3300053133 Bacteria 998
1867 Ga0500559_0000039 3300053136 Bacteria 109430
1868 Ga0500559_0000070 3300053136 Bacteria 82088
1869 Ga0500559_0006751 3300053136 Bacteria 5155
1870 Ga0500564_000023 3300053138 Bacteria 45842
1871 Ga0500573_0000026 3300053140 Bacteria 144363
1872 Ga0500590_008718 3300053148 Bacteria 5074
1873 Ga0500616_0002568 3300053153 Bacteria 14953
1874 Ga0500616_0004681 3300053153 Bacteria 9646
1875 Ga0500616_0016403 3300053153 Bacteria 4217
1876 Ga0500616_0017981 3300053153 Bacteria 4002
1877 Ga0500616_0048493 3300053153 Bacteria 2252
1878 Ga0500616_0055550 3300053153 Bacteria 2070
1879 Ga0500622_0002894 3300053156 Bacteria 11972
1880 Ga0500622_0010072 3300053156 Bacteria 5207
1881 Ga0500622_0015184 3300053156 Bacteria 4129
1882 Ga0500622_0019007 3300053156 Bacteria 3650
1883 Ga0500638_015003 3300053162 Bacteria 3546
1884 Ga0500636_0039430 3300053177 Bacteria 2794
1885 Ga0500636_0056950 3300053177 Bacteria 2288
1886 Ga0500637_0053907 3300053178 Bacteria 2295
1887 Ga0500637_0059374 3300053178 Bacteria 2189
1888 Ga0500645_000674 3300053730 Bacteria 21414
1889 Ga0500645_001836 3300053730 Bacteria 10179
1890 Ga0500645_001866 3300053730 Bacteria 10084
1891 Ga0500645_039783 3300053730 Bacteria 1392
1892 Ga0500609_000122 3300053731 Bacteria 10340
1893 Ga0500552_003643 3300053733 Bacteria 1577
1894 Ga0501084_0004473 3300054114 Bacteria 11417
1895 Ga0501084_0005188 3300054114 Bacteria 10657
1896 Ga0501084_0007894 3300054114 Bacteria 8760
1897 Ga0501084_0008308 3300054114 Bacteria 8567
1898 Ga0501084_0008886 3300054114 Bacteria 8313
1899 Ga0501084_0011060 3300054114 Bacteria 7473
1900 Ga0501084_0011078 3300054114 Bacteria 7468
1901 Ga0501084_0011118 3300054114 Bacteria 7454
1902 Ga0501084_0018253 3300054114 Bacteria 5842
1903 Ga0501084_0049411 3300054114 Bacteria 3521
1904 Ga0501082_0000168 3300060353 Bacteria 56207
1905 Ga0501082_0006709 3300060353 Bacteria 9956
1906 Ga0501082_0019419 3300060353 Bacteria 5858
1907 Ga0501082_0034493 3300060353 Bacteria 4362
1908 Ga0501082_0037495 3300060353 Bacteria 4178
1909 Ga0501082_0052842 3300060353 Bacteria 3503
1910 Ga0501082_0109853 3300060353 Bacteria 2387
1911 Ga0501082_0126507 3300060353 Bacteria 2216
1912 Ga0501082_0139236 3300060353 Bacteria 2106
1913 Ga0501082_0236104 3300060353 Bacteria 1591
1914 Ga0501082_0248180 3300060353 Bacteria 1549
1915 Ga0501082_0267505 3300060353 Bacteria 1488
1916 Ga0501082_0293947 3300060353 Bacteria 1414
1917 Ga0466962_0000450 3300061719 Bacteria 17837
1918 Ga0530510_0007936 3300061734 Bacteria 7405
1919 Ga0530510_0012177 3300061734 Bacteria 6038
1920 Ga0530510_0056191 3300061734 Bacteria 2843
1921 Ga0530510_0059805 3300061734 Bacteria 2757
1922 Ga0530510_0061070 3300061734 Bacteria 2729
1923 Ga0530510_0153927 3300061734 Bacteria 1698
1924 Ga0530510_0246838 3300061734 Bacteria 1330
1925 Ga0530510_0319349 3300061734 Bacteria 1164
1926 Ga0530510_0332454 3300061734 Bacteria 1140
1927 Ga0530510_0339818 3300061734 Bacteria 1127
1928 2511122101 2510917020 Bacteria 5657507
1929 2512035755 2511231221 Bacteria 6846400
1930 2523108112 2522572158 Bacteria 6514390
1931 2524609465 2524023250 Bacteria 5457705
1932 2545673161 2545555834 Bacteria 8130841
1933 2585146612 2582581279 Bacteria 4980720
1934 2585152378 2582581280 Bacteria 5994497
1935 2585199028 2582581293 Bacteria 5907401
1936 2587917752 2585428106 Bacteria 5179711
1937 2596373405 2595698237 Bacteria 6712432
1938 2599105835 2597490356 Bacteria 7030811
1939 2643750097 2643221545 Bacteria 5083237
1940 2643782483 2643221552 Bacteria 5708754
1941 2643882351 2643221574 Bacteria 2789653
1942 2643924262 2643221583 Bacteria 5218014
1943 2643928692 2643221584 Bacteria 5511711
1944 2643998845 2643221598 Bacteria 4578346
1945 2644087127 2643221614 Bacteria 4260023
1946 2644226728 2643221640 Bacteria 5258820
1947 2644233802 2643221642 Bacteria 5357871
1948 2644342081 2643221661 Bacteria 4267604
1949 2644353564 2643221663 Bacteria 3425771
1950 2644368368 2643221666 Bacteria 4265935
1951 2644510747 2643221691 Bacteria 5093099
1952 2644548659 2643221699 Bacteria 5731501
1953 2644549376 2643221699 Bacteria 5731501
1954 2671695435 2671180139 Bacteria 4196045
1955 2715501371 2713897090 Bacteria 3353799
1956 2738743187 2738541281 Bacteria 5112672
1957 2739352804 2738543032 Bacteria 5115625
1958 2739792463 2739367756 Bacteria 4553612
1959 2757570352 2757320392 Bacteria 3737298
1960 2774873043 2773857925 Bacteria 6472445
1961 2792462957 2791355048 Bacteria 5832535
1962 2819537309 2818991435 Bacteria 5433759
1963 2819646629 2818991454 Bacteria 5563326
1964 2840880697 2840878972 Bacteria 5483153
1965 2842700468 2842698319 Bacteria 5190321
1966 2843746505 2843744320 Bacteria 5659202
1967 2846955617 2846952575 Bacteria 6587527
1968 2848862395 2848858292 Bacteria 7391279
1969 2849561782 2849560528 Bacteria 5393480
1970 2849574155 2849573788 Bacteria 5421256
1971 2851157833 2851153111 Bacteria 5542585
1972 2854683035 2854681122 Bacteria 4548679
1973 2855021455 2855020534 Bacteria 3204685
1974 2857507009 2857504554 Bacteria 5369913
1975 2882461349 2882456835 Bacteria 6863978
1976 2884961658 2884960567 Bacteria 5437054
1977 2889307847 2889306138 Bacteria 6358934
1978 2889793135 2889790730 Bacteria 5689708
1979 2889917633 2889914905 Bacteria 5702301
1980 2897804453 2897803580 Bacteria 7000062
1981 2898332520 2898329390 Bacteria 5168154
1982 2898797796 2898795034 Bacteria 4294459
1983 2899262033 2899259804 Bacteria 3320927
1984 2899277373 2899275550 Bacteria 3958688
1985 2902336623 2902330777 Bacteria 6395352
1986 2902406894 2902405164 Bacteria 6784948
1987 2917554441 2917554339 Bacteria 4987857
1988 2919679334 2919679072 Bacteria 4629602
1989 2928127069 2928125067 Bacteria 5937560
1990 2928531402 2928531327 Bacteria 5101314
1991 2928974321 2928972540 Bacteria 3058286
1992 2937845332 2937843397 Bacteria 5256375
1993 2939673994 2939669807 Bacteria 5028511
1994 2977243244 2977240413 Bacteria 3191065
1995 2989771371 2989771324 Bacteria 5605128
1996 3000019371 3000017691 Bacteria 3772574
1997 3000406591 3000405567 Bacteria 3779330
1998 3003666057 3003665799 Bacteria 7279786
1999 641642235 641522639 Bacteria 7737025
2000 643598241 643348564 Bacteria 8839022
2001 8054007928 8054002106 Bacteria 7987183
2002 8054561364 8054558443 Bacteria 5204801
2003 8057134478 8057132660 Bacteria 4061191
2004 Ga0105249_10359236
2005 JGI24750J21931_1001757
2006 JGI24751J29686_10002743
2007 JGI25153J46596_10000269
2008 JGI25153J46596_10009271
2009 rootH2_10154904
2010 Ga0006562J51391_1051836
2011 Ga0055537_1005976
2012 Ga0055528_1003083
2013 Ga0055530_10000337
2014 Ga0055531_10000505
2015 Ga0055531_10001046
2016 Ga0055531_10029211
2017 Ga0058861_11804934
2018 Ga0058862_12801645
2019 Ga0065165_1000171
2020 Ga0065165_1001427
2021 Ga0065165_1009793
2022 Ga0070658_10003145
2023 Ga0070658_10009756
2024 Ga0070658_10034673
2025 Ga0070658_10062470
2026 Ga0070676_10002225
2027 Ga0070676_10054739
2028 Ga0070690_100000232
2029 Ga0070690_100015621
2030 Ga0070690_100051588
2031 Ga0070690_100122975
2032 Ga0070670_100000007
2033 Ga0070670_100000734
2034 Ga0070670_100025548
2035 Ga0068869_100034099
2036 Ga0068869_100100619
2037 Ga0070666_10000492
2038 Ga0070666_10007495
2039 Ga0070666_10008767
2040 Ga0070666_10017934
2041 Ga0070666_10096676
2042 Ga0070666_10142819
2043 Ga0070680_100001128
2044 Ga0070680_100005807
2045 Ga0070680_100021694
2046 Ga0070680_100025975
2047 Ga0070680_100027952
2048 Ga0070680_100029781
2049 Ga0070680_100048827
2050 Ga0070680_100087886
2051 Ga0070682_100003540
2052 Ga0070682_100003799
2053 Ga0070682_100133320
2054 Ga0068868_100001553
2055 Ga0068868_100037465
2056 Ga0068868_100103220
2057 Ga0070660_100001176
2058 Ga0070660_100012151
2059 Ga0070660_100023133
2060 Ga0070660_100032791
2061 Ga0070660_100045240
2062 Ga0070689_100000219
2063 Ga0070689_100037387
2064 Ga0070691_10004358
2065 Ga0070691_10020286
2066 Ga0070691_10033353
2067 Ga0070691_10067542
2068 Ga0070691_10093063
2069 Ga0070691_10100110
2070 Ga0070687_100000891
2071 Ga0070661_100002101
2072 Ga0070661_100034920
2073 Ga0070661_100068524
2074 Ga0070661_100307803
2075 Ga0070692_10000095
2076 Ga0070668_100000810
2077 Ga0070668_100002588
2078 Ga0070668_100002594
2079 Ga0070668_100017223
2080 Ga0070668_100039267
2081 Ga0070668_100040268
2082 Ga0070668_100381397
2083 Ga0070669_100000854
2084 Ga0070669_100003901
2085 Ga0070669_100006542
2086 Ga0070669_100060216
2087 Ga0070675_100037643
2088 Ga0070675_100228917
2089 Ga0070671_100007574
2090 Ga0070671_100008771
2091 Ga0070671_100122297
2092 Ga0070671_100272149
2093 Ga0070671_100557481
2094 Ga0070674_100001983
2095 Ga0070674_100004537
2096 Ga0070674_100038016
2097 Ga0070673_100002867
2098 Ga0070673_100075833
2099 Ga0070673_100528258
2100 Ga0070688_100000552
2101 Ga0070688_100148926
2102 Ga0070659_100001675
2103 Ga0070659_100027251
2104 Ga0070659_100034835
2105 Ga0070659_100057134
2106 Ga0070659_100464665
2107 Ga0070667_100001267
2108 Ga0070667_100010421
2109 Ga0070667_100012674
2110 Ga0070667_100012745
2111 Ga0070667_100054065
2112 Ga0070667_100087631
2113 Ga0070667_100177344
2114 Ga0070667_100204043
2115 Ga0070703_10002510
2116 Ga0070709_10003641
2117 Ga0070709_10017337
2118 Ga0070709_10084634
2119 Ga0070714_100042364
2120 Ga0070714_100044290
2121 Ga0070714_100050098
2122 Ga0070714_100160830
2123 Ga0070713_100116518
2124 Ga0070713_100222337
2125 Ga0070713_100249782
2126 Ga0070713_100250895
2127 Ga0070713_100401356
2128 Ga0070713_100432234
2129 Ga0070710_10053669
2130 Ga0070710_10117397
2131 Ga0070701_10000263
2132 Ga0070711_100000201
2133 Ga0070705_100000751
2134 Ga0070705_100001721
2135 Ga0070705_100014535
2136 Ga0070700_100005030
2137 Ga0070700_100016215
2138 Ga0070700_100214686
2139 Ga0070700_100289699
2140 Ga0070694_100014968
2141 Ga0070694_100062723
2142 Ga0070694_100093835
2143 Ga0070708_100051101
2144 Ga0070663_100001331
2145 Ga0070663_100009128
2146 Ga0070663_100139086
2147 Ga0070663_100212961
2148 Ga0070678_100000963
2149 Ga0070678_100051658
2150 Ga0070678_100239128
2151 Ga0070678_100287767
2152 Ga0070662_100092341
2153 Ga0070662_100149364
2154 Ga0070681_10000057
2155 Ga0070681_10002960
2156 Ga0070681_10005511
2157 Ga0070681_10037851
2158 Ga0070681_10040784
2159 Ga0070681_10048272
2160 Ga0070681_10050025
2161 Ga0070681_10080219
2162 Ga0070681_10281442
2163 Ga0070681_10299394
2164 Ga0070681_10563842
2165 Ga0068867_100021656
2166 Ga0068867_100029714
2167 Ga0068867_100135279
2168 Ga0070685_10007261
2169 Ga0070685_10227484
2170 Ga0070707_100015874
2171 Ga0070698_100007183
2172 Ga0070698_100009690
2173 Ga0070698_100154498
2174 Ga0070698_100156902
2175 Ga0070699_100005628
2176 Ga0070699_100157206
2177 Ga0070699_100158442
2178 Ga0070699_100217575
2179 Ga0070699_100295559
2180 Ga0070699_100389231
2181 Ga0070679_100000043
2182 Ga0070679_100005852
2183 Ga0070679_100027144
2184 Ga0070679_100028853
2185 Ga0070679_100044488
2186 Ga0070679_100061454
2187 Ga0070679_100077998
2188 Ga0070679_100222634
2189 Ga0070679_100287381
2190 Ga0070679_100453202
2191 Ga0070697_100040258
2192 Ga0070697_100069957
2193 Ga0070697_100200373
2194 Ga0070697_100391711
2195 Ga0070697_100626005
2196 Ga0068853_100002414
2197 Ga0068853_100002623
2198 Ga0068853_100003695
2199 Ga0068853_100015377
2200 Ga0068853_100030383
2201 Ga0068853_100085814
2202 Ga0068853_100097370
2203 Ga0068853_100264669
2204 Ga0070672_100003597
2205 Ga0070672_100465139
2206 Ga0070686_100000306
2207 Ga0070695_100000339
2208 Ga0070695_100006239
2209 Ga0070695_100063474
2210 Ga0070695_100080306
2211 Ga0070696_100001139
2212 Ga0070696_100005852
2213 Ga0070693_100002939
2214 Ga0070693_100115713
2215 Ga0070665_100000622
2216 Ga0070665_100001034
2217 Ga0070665_100001485
2218 Ga0070665_100002299
2219 Ga0070665_100003432
2220 Ga0070665_100016813
2221 Ga0070665_100046308
2222 Ga0070665_100084446
2223 Ga0070665_100096343
2224 Ga0070665_100111686
2225 Ga0070665_100114044
2226 Ga0070704_100148977
2227 Ga0068855_100007530
2228 Ga0068855_100032390
2229 Ga0068855_100059685
2230 Ga0068855_100073014
2231 Ga0068855_100099535
2232 Ga0068855_100105516
2233 Ga0068855_100117930
2234 Ga0068855_100173895
2235 Ga0068855_100187622
2236 Ga0068855_100209738
2237 Ga0068855_100219640
2238 Ga0068855_100245096
2239 Ga0068855_100327487
2240 Ga0068855_100524430
2241 Ga0070664_100003361
2242 Ga0070664_100008403
2243 Ga0070664_100043907
2244 Ga0070664_100127552
2245 Ga0070664_100285916
2246 Ga0068857_100000318
2247 Ga0068857_100011253
2248 Ga0068857_100039479
2249 Ga0068857_100152727
2250 Ga0068857_100161737
2251 Ga0068856_100006661
2252 Ga0068856_100008386
2253 Ga0068856_100196188
2254 Ga0068856_100301959
2255 Ga0068856_100353209
2256 Ga0068856_100522915
2257 Ga0070702_100000103
2258 Ga0070702_100057836
2259 Ga0070702_100135243
2260 Ga0070702_100298918
2261 Ga0068852_100003609
2262 Ga0068852_100115642
2263 Ga0068852_100145653
2264 Ga0068852_100165739
2265 Ga0068852_100183035
2266 Ga0068852_100356401
2267 Ga0068859_100000168
2268 Ga0068859_100004644
2269 Ga0068859_100008510
2270 Ga0068859_100012300
2271 Ga0068859_100450106
2272 Ga0068864_100000093
2273 Ga0068864_100000095
2274 Ga0068864_100004875
2275 Ga0068864_100041566
2276 Ga0068864_100054856
2277 Ga0068864_100060013
2278 Ga0068864_100214215
2279 Ga0068864_100264675
2280 Ga0068866_10011490
2281 Ga0068861_100119060
2282 Ga0068851_10053516
2283 Ga0068851_10198081
2284 Ga0068870_10112291
2285 Ga0068863_100000045
2286 Ga0068863_100007895
2287 Ga0068863_100014537
2288 Ga0068863_100027933
2289 Ga0068863_100078015
2290 Ga0068863_100408496
2291 Ga0068858_100003461
2292 Ga0068858_100003717
2293 Ga0068858_100013269
2294 Ga0068858_100016285
2295 Ga0068858_100027724
2296 Ga0068858_100058281
2297 Ga0068858_100079638
2298 Ga0068858_100083717
2299 Ga0068860_100000204
2300 Ga0068860_100005966
2301 Ga0068860_100010922
2302 Ga0068860_100033041
2303 Ga0068860_100037867
2304 Ga0068860_100050305
2305 Ga0068860_100118701
2306 Ga0068860_100190721
2307 Ga0068860_100256811
2308 Ga0068862_100001725
2309 Ga0068862_100003158
2310 Ga0068862_100005698
2311 Ga0068862_100006125
2312 Ga0068862_100010475
2313 Ga0068862_100016150
2314 Ga0068862_100111357
2315 Ga0068862_100116776
2316 Ga0068862_100209099
2317 Ga0081455_10000079
2318 Ga0081455_10005314
2319 Ga0081455_10006837
2320 Ga0081455_10023011
2321 Ga0081455_10061401
2322 Ga0081455_10069059
2323 Ga0081538_10009083
2324 Ga0081538_10017391
2325 Ga0081538_10048270
2326 Ga0081540_1000050
2327 Ga0081540_1035798
2328 Ga0081540_1041443
2329 Ga0081540_1059139
2330 Ga0081539_10021261
2331 Ga0081539_10032848
2332 Ga0081539_10071716
2333 Ga0070717_10002293
2334 Ga0070717_10048307
2335 Ga0070717_10136784
2336 Ga0075365_10022326
2337 Ga0075365_10028129
2338 Ga0075365_10357531
2339 Ga0075368_10000312
2340 Ga0075368_10073549
2341 Ga0075364_10001636
2342 Ga0075432_10004896
2343 Ga0070715_10002897
2344 Ga0070715_10074248
2345 Ga0070716_100001803
2346 Ga0070716_100094614
2347 Ga0070712_100000383
2348 Ga0070712_100006161
2349 Ga0070712_100010231
2350 Ga0070712_100020920
2351 Ga0070712_100031069
2352 Ga0070712_100142181
2353 Ga0070712_100230091
2354 Ga0070712_100299634
2355 Ga0075367_10004476
2356 Ga0075367_10149247
2357 Ga0075369_10052667
2358 Ga0075366_10004615
2359 Ga0075366_10017262
2360 Ga0075366_10102301
2361 Ga0075366_10146814
2362 Ga0097621_100001072
2363 Ga0097621_100028215
2364 Ga0097621_100097324
2365 Ga0097621_100231902
2366 Ga0075370_10022473
2367 Ga0075370_10176237
2368 Ga0075370_10182164
2369 Ga0068871_100001473
2370 Ga0068871_100043773
2371 Ga0068871_100088418
2372 Ga0068871_100175630
2373 Ga0068871_100255378
2374 Ga0068871_100282832
2375 Ga0068871_100364323
2376 Ga0068871_100373318
2377 Ga0075428_100051198
2378 Ga0075428_100059608
2379 Ga0075428_100064681
2380 Ga0075428_100303396
2381 Ga0075430_100025541
2382 Ga0075430_100265128
2383 Ga0075430_100318100
2384 Ga0075431_100000648
2385 Ga0075431_100001586
2386 Ga0075431_100007581
2387 Ga0075431_100189193
2388 Ga0075431_100195411
2389 Ga0075433_10003756
2390 Ga0075433_10458236
2391 Ga0075434_100001044
2392 Ga0075434_100100013
2393 Ga0075434_100144691
2394 Ga0075429_100020344
2395 Ga0075429_100045703
2396 Ga0068865_100000177
2397 Ga0068865_100004452
2398 Ga0068865_100006191
2399 Ga0068865_100029061
2400 Ga0068865_100107070
2401 Ga0068865_100116560
2402 Ga0068865_100131928
2403 Ga0075436_100004207
2404 Ga0075436_100076590
2405 Ga0075436_100261535
2406 Ga0097620_100000168
2407 Ga0097620_100004644
2408 Ga0097620_100008510
2409 Ga0097620_100012300
2410 Ga0097620_100450150
2411 Ga0075435_100022950
2412 Ga0075435_100115908
2413 Ga0075435_100193038
2414 Ga0099795_10006747
2415 Ga0099795_10019485
2416 Ga0105250_10031425
2417 Ga0105240_10000528
2418 Ga0105240_10000593
2419 Ga0105240_10006394
2420 Ga0105240_10008432
2421 Ga0105240_10016124
2422 Ga0105240_10025200
2423 Ga0105240_10030187
2424 Ga0105240_10041737
2425 Ga0105240_10161384
2426 Ga0105240_10169459
2427 Ga0105240_10171001
2428 Ga0105240_10203267
2429 Ga0105240_10221614
2430 Ga0105240_10442648
2431 Ga0105240_10572948
2432 Ga0105240_10658809
2433 Ga0111539_10007102
2434 Ga0111539_10011351
2435 Ga0111539_10095254
2436 Ga0111539_10317384
2437 Ga0105245_10000591
2438 Ga0105245_10067399
2439 Ga0105245_10095809
2440 Ga0105245_10200417
2441 Ga0105245_10253142
2442 Ga0105245_10273536
2443 Ga0105247_10000361
2444 Ga0105247_10060893
2445 Ga0105247_10108926
2446 Ga0114129_10065174
2447 Ga0114129_10325523
2448 Ga0105243_10003277
2449 Ga0105243_10102489
2450 Ga0105243_10643635
2451 Ga0105241_10000699
2452 Ga0105241_10006171
2453 Ga0105241_10007803
2454 Ga0105241_10087402
2455 Ga0105241_10260395
2456 Ga0105241_10264120
2457 Ga0105241_10596766
2458 Ga0105242_10008014
2459 Ga0105242_10071387
2460 Ga0105242_10091262
2461 Ga0105242_10134833
2462 Ga0105242_10586647
2463 Ga0105248_10000001
2464 Ga0105248_10000097
2465 Ga0105248_10000586
2466 Ga0105248_10014989
2467 Ga0105248_10018673
2468 Ga0105248_10039694
2469 Ga0105248_10127670
2470 Ga0105248_10220265
2471 Ga0105248_10242825
2472 Ga0105237_10005447
2473 Ga0105237_10028604
2474 Ga0105237_10136315
2475 Ga0105237_10509890
2476 Ga0105237_10599801
2477 Ga0105237_10729863
2478 Ga0105238_10000280
2479 Ga0105238_10012925
2480 Ga0105238_10036658
2481 Ga0105238_10109372
2482 Ga0105238_10144770
2483 Ga0105238_10316597
2484 Ga0105238_10324754
2485 Ga0105249_10000757
2486 Ga0105249_10000842
2487 Ga0105249_10014651
2488 Ga0105249_10033566
2489 Ga0105249_10120026
2490 Ga0105249_10243034
2491 Ga0105249_10746619
2492 Ga0105239_10001117
2493 Ga0105239_10010033
2494 Ga0105239_10012366
2495 Ga0105239_10287673
2496 Ga0105239_10343260
2497 Ga0105239_10364068
2498 Ga0105239_10391941
2499 Ga0105239_10640776
2500 Ga0105246_10005577
2501 Ga0105246_10097725
2502 Ga0105246_10146435
2503 Ga0105246_10255375
2504 Ga0157373_10020122
2505 Ga0157373_10021937
2506 Ga0157373_10030236
2507 Ga0157373_10161967
2508 Ga0157371_10009119
2509 Ga0157371_10024313
2510 Ga0157371_10097896
2511 Ga0157370_10024495
2512 Ga0157370_10060452
2513 Ga0157370_10101646
2514 Ga0157370_10123487
2515 Ga0157370_10126413
2516 Ga0157370_10216987
2517 Ga0157370_10633939
2518 Ga0157369_10003360
2519 Ga0157369_10006431
2520 Ga0157369_10019553
2521 Ga0157369_10052011
2522 Ga0157369_10226294
2523 Ga0157369_10428098
2524 Ga0157374_10000592
2525 Ga0157374_10086021
2526 Ga0157374_10105614
2527 Ga0157374_10113836
2528 Ga0157374_10156142
2529 Ga0157374_10208164
2530 Ga0157378_10000401
2531 Ga0157378_10000452
2532 Ga0157378_10033741
2533 Ga0157378_10038103
2534 Ga0157378_10120994
2535 Ga0157378_10161106
2536 Ga0157378_10199414
2537 Ga0157378_10208375
2538 Ga0157378_10233485
2539 Ga0163162_10005348
2540 Ga0163162_10008105
2541 Ga0163162_10082532
2542 Ga0163162_10170630
2543 Ga0163162_10306368
2544 Ga0157372_10000528
2545 Ga0157372_10000529
2546 Ga0157372_10012635
2547 Ga0157372_10033013
2548 Ga0157372_10219556
2549 Ga0157372_10586118
2550 Ga0157372_10596319
2551 Ga0157375_10000739
2552 Ga0157375_10002597
2553 Ga0157375_10267049
2554 Ga0163163_10000004
2555 Ga0163163_10016192
2556 Ga0163163_10038829
2557 Ga0163163_10122028
2558 Ga0163163_10143263
2559 Ga0163163_10385476
2560 Ga0163163_10605586
2561 Ga0157380_10015122
2562 Ga0157380_10025451
2563 Ga0157380_10028596
2564 Ga0157380_10290042
2565 Ga0157377_10003058
2566 Ga0157377_10118821
2567 Ga0157379_10000889
2568 Ga0157379_10003386
2569 Ga0157379_10003905
2570 Ga0157379_10017982
2571 Ga0157379_10038754
2572 Ga0157379_10046028
2573 Ga0157379_10080593
2574 Ga0157379_10092652
2575 Ga0157379_10101613
2576 Ga0157379_10116547
2577 Ga0157379_10138128
2578 Ga0157379_10187561
2579 Ga0157379_10267865
2580 Ga0157379_10496408
2581 Ga0157376_10000548
2582 Ga0157376_10065610
2583 Ga0157376_10099615
2584 Ga0157376_10184750
2585 Ga0157376_10386640
2586 Ga0183365_10001
2587 Ga0163161_10000549
2588 Ga0163161_10004033
2589 Ga0163161_10182406
2590 Ga0206356_11633707
2591 Ga0206352_10567578
2592 Ga0213873_10024643
2593 Ga0213872_10053344
2594 Ga0213872_10108917
2595 Ga0213874_10003223
2596 Ga0213874_10007462
2597 Ga0213874_10036580
2598 Ga0213876_10000257
2599 Ga0213876_10000423
2600 Ga0213876_10008949
2601 Ga0213876_10013999
2602 Ga0213876_10039306
2603 Ga0213876_10132363
2604 Ga0213875_10000175
2605 Ga0213875_10000580
2606 Ga0213875_10001523
2607 Ga0213875_10013115
2608 Ga0213875_10041498
2609 Ga0213871_10010846
2610 Ga0209026_1009205
2611 Ga0209026_1013307
2612 Ga0209233_1000006
2613 Ga0209233_1034431
2614 Ga0209565_1000065
2615 Ga0209673_1001051
2616 Ga0209675_1001154
2617 Ga0209676_1000043
2618 Ga0209676_1000928
2619 Ga0209676_1004405
2620 Ga0209564_1022616
2621 Ga0209758_1000008
2622 Ga0209758_1001776
2623 Ga0209758_1002436
2624 Ga0209758_1003522
2625 Ga0209050_1000095
2626 Ga0209050_1000729
2627 Ga0209050_1001088
2628 Ga0209256_1001303
2629 Ga0209256_1016688
2630 Ga0209051_1001677
2631 Ga0209257_1000036
2632 Ga0209257_1000106
2633 Ga0209257_1000184
2634 Ga0209257_1000641
2635 Ga0209257_1000979
2636 Ga0207656_10015952
2637 Ga0207696_1020376
2638 Ga0207692_10007515
2639 Ga0207692_10027461
2640 Ga0207642_10190451
2641 Ga0207710_10011535
2642 Ga0207710_10020485
2643 Ga0207710_10151745
2644 Ga0207680_10000548
2645 Ga0207680_10079277
2646 Ga0207647_10030560
2647 Ga0207685_10004123
2648 Ga0207699_10046469
2649 Ga0207699_10058059
2650 Ga0207699_10061156
2651 Ga0207699_10093545
2652 Ga0207699_10206866
2653 Ga0207645_10005726
2654 Ga0207645_10039453
2655 Ga0207645_10076314
2656 Ga0207645_10284481
2657 Ga0207643_10092736
2658 Ga0207643_10178774
2659 Ga0207705_10000039
2660 Ga0207705_10002551
2661 Ga0207705_10010984
2662 Ga0207705_10042110
2663 Ga0207705_10050295
2664 Ga0207705_10059985
2665 Ga0207705_10114476
2666 Ga0207705_10132004
2667 Ga0207684_10092116
2668 Ga0207654_10088255
2669 Ga0207654_10107385
2670 Ga0207654_10117887
2671 Ga0207707_10000001
2672 Ga0207707_10010788
2673 Ga0207707_10019058
2674 Ga0207707_10030735
2675 Ga0207707_10039792
2676 Ga0207707_10041161
2677 Ga0207707_10055055
2678 Ga0207707_10106410
2679 Ga0207707_10133498
2680 Ga0207707_10162139
2681 Ga0207707_10269466
2682 Ga0207707_10295316
2683 Ga0207707_10436937
2684 Ga0207695_10000012
2685 Ga0207695_10001649
2686 Ga0207695_10016276
2687 Ga0207695_10034422
2688 Ga0207695_10085020
2689 Ga0207695_10086922
2690 Ga0207695_10099655
2691 Ga0207695_10142285
2692 Ga0207695_10154775
2693 Ga0207695_10169773
2694 Ga0207695_10175181
2695 Ga0207695_10553224
2696 Ga0207671_10023167
2697 Ga0207671_10136664
2698 Ga0207671_10361075
2699 Ga0207693_10000127
2700 Ga0207693_10000247
2701 Ga0207693_10003312
2702 Ga0207693_10036417
2703 Ga0207693_10126511
2704 Ga0207693_10155944
2705 Ga0207663_10145553
2706 Ga0207663_10208513
2707 Ga0207660_10001305
2708 Ga0207660_10006328
2709 Ga0207660_10015367
2710 Ga0207660_10016006
2711 Ga0207660_10072410
2712 Ga0207660_10113135
2713 Ga0207660_10122663
2714 Ga0207662_10000924
2715 Ga0207662_10239392
2716 Ga0207657_10000257
2717 Ga0207657_10007684
2718 Ga0207657_10020778
2719 Ga0207657_10025453
2720 Ga0207657_10144002
2721 Ga0207657_10465423
2722 Ga0207649_10000060
2723 Ga0207649_10013244
2724 Ga0207652_10000141
2725 Ga0207652_10008279
2726 Ga0207652_10019939
2727 Ga0207652_10023480
2728 Ga0207652_10040057
2729 Ga0207652_10050093
2730 Ga0207652_10133162
2731 Ga0207652_10176071
2732 Ga0207652_10183561
2733 Ga0207652_10193823
2734 Ga0207652_10585044
2735 Ga0207646_10007200
2736 Ga0207681_10027103
2737 Ga0207681_10032279
2738 Ga0207681_10045401
2739 Ga0207694_10000006
2740 Ga0207694_10001089
2741 Ga0207694_10009327
2742 Ga0207694_10021936
2743 Ga0207694_10033316
2744 Ga0207694_10070457
2745 Ga0207694_10076221
2746 Ga0207694_10272507
2747 Ga0207650_10000030
2748 Ga0207650_10002093
2749 Ga0207650_10020912
2750 Ga0207650_10143668
2751 Ga0207650_10171248
2752 Ga0207659_10235418
2753 Ga0207659_10413649
2754 Ga0207687_10015151
2755 Ga0207687_10026527
2756 Ga0207687_10057986
2757 Ga0207687_10126975
2758 Ga0207687_10192576
2759 Ga0207687_10531749
2760 Ga0207700_10002798
2761 Ga0207700_10025473
2762 Ga0207700_10088283
2763 Ga0207700_10126616
2764 Ga0207700_10163008
2765 Ga0207664_10036901
2766 Ga0207664_10150050
2767 Ga0207664_10179688
2768 Ga0207664_10285742
2769 Ga0207644_10008376
2770 Ga0207644_10026216
2771 Ga0207644_10027526
2772 Ga0207644_10136397
2773 Ga0207644_10212491
2774 Ga0207644_10417894
2775 Ga0207690_10007048
2776 Ga0207690_10014732
2777 Ga0207690_10026365
2778 Ga0207690_10156836
2779 Ga0207690_10286902
2780 Ga0207706_10000295
2781 Ga0207706_10109953
2782 Ga0207706_10176226
2783 Ga0207686_10069922
2784 Ga0207686_10077146
2785 Ga0207686_10082644
2786 Ga0207686_10224063
2787 Ga0207709_10013293
2788 Ga0207709_10015111
2789 Ga0207709_10141093
2790 Ga0207669_10004332
2791 Ga0207669_10039227
2792 Ga0207704_10004157
2793 Ga0207704_10016025
2794 Ga0207704_10018903
2795 Ga0207704_10120333
2796 Ga0207704_10184588
2797 Ga0207665_10000664
2798 Ga0207665_10105406
2799 Ga0207665_10302314
2800 Ga0207691_10005624
2801 Ga0207711_10000001
2802 Ga0207711_10000267
2803 Ga0207711_10000919
2804 Ga0207711_10011983
2805 Ga0207711_10028457
2806 Ga0207711_10070867
2807 Ga0207711_10173241
2808 Ga0207711_10210179
2809 Ga0207711_10442267
2810 Ga0207689_10005479
2811 Ga0207689_10141879
2812 Ga0207661_10224630
2813 Ga0207661_10446046
2814 Ga0207679_10004900
2815 Ga0207679_10015049
2816 Ga0207679_10111870
2817 Ga0207679_10479158
2818 Ga0207667_10034948
2819 Ga0207667_10053661
2820 Ga0207667_10087961
2821 Ga0207667_10088796
2822 Ga0207667_10100708
2823 Ga0207667_10123750
2824 Ga0207667_10133802
2825 Ga0207667_10174150
2826 Ga0207667_10304577
2827 Ga0207667_10421216
2828 Ga0207651_10015625
2829 Ga0207651_10164882
2830 Ga0207651_10353907
2831 Ga0207712_10000683
2832 Ga0207712_10002026
2833 Ga0207712_10008618
2834 Ga0207712_10025416
2835 Ga0207712_10168464
2836 Ga0207712_10172836
2837 Ga0207712_10271074
2838 Ga0207712_10333127
2839 Ga0207668_10000010
2840 Ga0207668_10000152
2841 Ga0207668_10001656
2842 Ga0207668_10006351
2843 Ga0207668_10014968
2844 Ga0207668_10141138
2845 Ga0207668_10513245
2846 Ga0207658_10000211
2847 Ga0207658_10003894
2848 Ga0207658_10006609
2849 Ga0207658_10007025
2850 Ga0207658_10034901
2851 Ga0207658_10300139
2852 Ga0207658_10489243
2853 Ga0207677_10078267
2854 Ga0207703_10000049
2855 Ga0207703_10002309
2856 Ga0207703_10002704
2857 Ga0207703_10008329
2858 Ga0207703_10064876
2859 Ga0207703_10075251
2860 Ga0207703_10437586
2861 Ga0207639_10002055
2862 Ga0207639_10010332
2863 Ga0207639_10014521
2864 Ga0207639_10075771
2865 Ga0207639_10185022
2866 Ga0207678_10000401
2867 Ga0207678_10002715
2868 Ga0207678_10003650
2869 Ga0207678_10164574
2870 Ga0207708_10000535
2871 Ga0207708_10009632
2872 Ga0207708_10064750
2873 Ga0207708_10074469
2874 Ga0207708_10141177
2875 Ga0207708_10163300
2876 Ga0207708_10192079
2877 Ga0207708_10365733
2878 Ga0207708_10398335
2879 Ga0207702_10014870
2880 Ga0207702_10062519
2881 Ga0207702_10076898
2882 Ga0207702_10160480
2883 Ga0207702_10196741
2884 Ga0207702_10259219
2885 Ga0207641_10000011
2886 Ga0207641_10001161
2887 Ga0207641_10001597
2888 Ga0207641_10044489
2889 Ga0207641_10059513
2890 Ga0207641_10275747
2891 Ga0207641_10311955
2892 Ga0207648_10007860
2893 Ga0207648_10010475
2894 Ga0207648_10042402
2895 Ga0207676_10000095
2896 Ga0207676_10003207
2897 Ga0207676_10040508
2898 Ga0207676_10063775
2899 Ga0207676_10195228
2900 Ga0207676_10215556
2901 Ga0207674_10000524
2902 Ga0207674_10001583
2903 Ga0207674_10087264
2904 Ga0207674_10092167
2905 Ga0207674_10117784
2906 Ga0207674_10184938
2907 Ga0207675_100012361
2908 Ga0207675_100042871
2909 Ga0207675_100074800
2910 Ga0207675_100136906
2911 Ga0207675_100148779
2912 Ga0207675_100203997
2913 Ga0207675_100210459
2914 Ga0207675_100302991
2915 Ga0207683_10000416
2916 Ga0207683_10006084
2917 Ga0207683_10008739
2918 Ga0207683_10013120
2919 Ga0207683_10074459
2920 Ga0207698_10090286
2921 Ga0207698_10115779
2922 Ga0209981_1000228
2923 Ga0209984_1017703
2924 Ga0210000_1004649
2925 Ga0209983_1009790
2926 Ga0209813_10000327
2927 Ga0209813_10016463
2928 Ga0209974_10042379
2929 Ga0207428_10000235
2930 Ga0207428_10004815
2931 Ga0207428_10026155
2932 Ga0207428_10040270
2933 Ga0207428_10054598
2934 Ga0268266_10000453
2935 Ga0268266_10000551
2936 Ga0268266_10000621
2937 Ga0268266_10001015
2938 Ga0268266_10032142
2939 Ga0268266_10039501
2940 Ga0268266_10040576
2941 Ga0268266_10048617
2942 Ga0268266_10057032
2943 Ga0268266_10073664
2944 Ga0268266_10101247
2945 Ga0268266_10299680
2946 Ga0268265_10001201
2947 Ga0268265_10003906
2948 Ga0268265_10013342
2949 Ga0268265_10041738
2950 Ga0268265_10076488
2951 Ga0268265_10085941
2952 Ga0268264_10000125
2953 Ga0268264_10004262
2954 Ga0268264_10025320
2955 Ga0268264_10027689
2956 Ga0268264_10047913
2957 Ga0268264_10094662
2958 Ga0268264_10299038
2959 Ga0268264_10300407
2960 Ga0268264_10304859
2961 Ga0265337_1001829
2962 Ga0265334_10010903
2963 Ga0265334_10016579
2964 Ga0265318_10000235
2965 Ga0265318_10002471
2966 Ga0307517_10000835
2967 Ga0307517_10231575
2968 Ga0307515_10066324
2969 Ga0307515_10106806
2970 Ga0307515_10259688
2971 Ga0265338_10000043
2972 Ga0265338_10005705
2973 Ga0265338_10015424
2974 Ga0265338_10020630
2975 Ga0265338_10035573
2976 Ga0265338_10039574
2977 Ga0265338_10040541
2978 Ga0265338_10082092
2979 Ga0265338_10084214
2980 Ga0265338_10128440
2981 Ga0265338_10152077
2982 Ga0265338_10192370
2983 Ga0310981_1042390
2984 Ga0307511_10033370
2985 Ga0265760_10038615
2986 Ga0265330_10002470
2987 Ga0265330_10024699
2988 Ga0265332_10011270
2989 Ga0265332_10033467
2990 Ga0265332_10088810
2991 Ga0265328_10118179
2992 Ga0265320_10074813
2993 Ga0265325_10000002
2994 Ga0265325_10001880
2995 Ga0265325_10002687
2996 Ga0265325_10070773
2997 Ga0265340_10000353
2998 Ga0265340_10001830
2999 Ga0265340_10003755
3000 Ga0265340_10086389
3001 Ga0265340_10134287
3002 Ga0265339_10000313
3003 Ga0265339_10000763
3004 Ga0265339_10018271
3005 Ga0265339_10023677
3006 Ga0265339_10106100
3007 Ga0265339_10110046
3008 Ga0265339_10131887
3009 Ga0265331_10000049
3010 Ga0265331_10000250
3011 Ga0265331_10001017
3012 Ga0265331_10002339
3013 Ga0265331_10007204
3014 Ga0265331_10011352
3015 Ga0265331_10022694
3016 Ga0265331_10052331
3017 Ga0265331_10085035
3018 Ga0265331_10106605
3019 Ga0265327_10000007
3020 Ga0265327_10000280
3021 Ga0265327_10000771
3022 Ga0265327_10004124
3023 Ga0265327_10080192
3024 Ga0265316_10007569
3025 Ga0265316_10017960
3026 Ga0265316_10041506
3027 Ga0265316_10051397
3028 Ga0265316_10066867
3029 Ga0265316_10110083
3030 Ga0265316_10168435
3031 Ga0265316_10173466
3032 Ga0307513_10001002
3033 Ga0307513_10003622
3034 Ga0307513_10013077
3035 Ga0307513_10016442
3036 Ga0307408_100038619
3037 Ga0307408_100130898
3038 Ga0307408_100196031
3039 Ga0265313_10000665
3040 Ga0265313_10001152
3041 Ga0265313_10001900
3042 Ga0265313_10001912
3043 Ga0265313_10005546
3044 Ga0265313_10009355
3045 Ga0265313_10017490
3046 Ga0265313_10023056
3047 Ga0316575_10028152
3048 Ga0316579_10018453
3049 Ga0316579_10042471
3050 Ga0316579_10066877
3051 Ga0265314_10000624
3052 Ga0265314_10003187
3053 Ga0265314_10004046
3054 Ga0265314_10013133
3055 Ga0265314_10014558
3056 Ga0265314_10015300
3057 Ga0265314_10017417
3058 Ga0265314_10089190
3059 Ga0265314_10130186
3060 Ga0265342_10013377
3061 Ga0265342_10014194
3062 Ga0265342_10030469
3063 Ga0265342_10030996
3064 Ga0265342_10052553
3065 Ga0316576_10007695
3066 Ga0316576_10016330
3067 Ga0316576_10023907
3068 Ga0316576_10035120
3069 Ga0316576_10045230
3070 Ga0316576_10146856
3071 Ga0316578_10003781
3072 Ga0316578_10016134
3073 Ga0316578_10113747
3074 Ga0307516_10013152
3075 Ga0307516_10046918
3076 Ga0307405_10422349
3077 Ga0316577_10007617
3078 Ga0316577_10053591
3079 Ga0316577_10094327
3080 Ga0316577_10100688
3081 Ga0307413_10082170
3082 Ga0307413_10148596
3083 Ga0307410_10143194
3084 Ga0307406_10000448
3085 Ga0307406_10148259
3086 Ga0307407_10056838
3087 Ga0307412_10210208
3088 Ga0307412_10272581
3089 Ga0307409_100038917
3090 Ga0307416_100191680
3091 Ga0307416_100705342
3092 Ga0316585_10006235
3093 Ga0316585_10034545
3094 Ga0316580_10004852
3095 Ga0316580_10015818
3096 Ga0307510_10019906
3097 Ga0316592_1011005
3098 Ga0316596_1001927
3099 Ga0373930_0038171
3100 Ga0373948_0027857
3101 Ga0373938_0008082
3102 Ga0373934_0022896
3103 Ga0373934_0040695
3104 Ga0373934_0159156
3105 Ga0373923_0033188
3106 Ga0373932_0006725
3107 Ga0373936_0014842
3108 Ga0373941_0006359
3109 Ga0373945_0052781
3110 Ga0373945_0061247
3111 Ga0373954_0019886
3112 Ga0373956_0055627
3113 Ga0373956_0075914
3114 Ga0373960_0010106
3115 Ga0373960_0021937
3116 Ga0373943_0012466
3117 Ga0373943_0038009
3118 Ga0373955_0015773
3119 Ga0373942_0036883
3120 Ga0373961_0017262
3121 Ga0373961_0043369
3122 Ga0373962_0009720
3123 Ga0316574_0028279
3124 Ga0316574_0090702
3125 Ga0373931_0001346
3126 Ga0373931_0001932
3127 Ga0373931_0002117
3128 Ga0373931_0005624
3129 Ga0373935_0149843
3130 Ga0373935_0152573
3131 Ga0373935_0309551
3132 Ga0373927_0000731
3133 Ga0373927_0013684
3134 Ga0373927_0015215
3135 Ga0373927_0037518
3136 Ga0373927_0070795
3137 Ga0373933_0017460
3138 Ga0373933_0034003
3139 Ga0373933_0066885
3140 Ga0373947_0018153
3141 Ga0373947_0062984
3142 Ga0373947_0096239
3143 Ga0373947_0155237
3144 Ga0373947_0274113
3145 Ga0373937_0001423
3146 Ga0373937_0002342
3147 Ga0373937_0002962
3148 Ga0373937_0003675
3149 Ga0373937_0026345
3150 Ga0373937_0061345
3151 Ga0373937_0115599
3152 Ga0373937_0121846
3153 Ga0373937_0131952
3154 Ga0373937_0154255
3155 Ga0373937_0367853
3156 Ga0373937_0662347
3157 Ga0373937_0663393
3158 Ga0316582_0012360
3159 Ga0316582_0052854
3160 Ga0316582_0115571
3161 Ga0316582_0147545
3162 Ga0316582_0213057
3163 Ga0316584_0000315
3164 Ga0316584_0028549
3165 Ga0316584_0033689
3166 Ga0316584_0044380
3167 Ga0316584_0169650
3168 Ga0373925_0000049
3169 Ga0373925_0020859
3170 Ga0373925_0034949
3171 Ga0373925_0055440
3172 Ga0373925_0063554
3173 Ga0373925_0196098
3174 Ga0373925_0216804
3175 Ga0373925_0373098
3176 Ga0395899_0000018
3177 Ga0395899_0001404
3178 Ga0395899_0027182
3179 Ga0395899_0034035
3180 Ga0395899_0036915
3181 Ga0395899_0117030
3182 Ga0395899_0150529
3183 Ga0395900_0000072
3184 Ga0395900_0007333
3185 Ga0395900_0013029
3186 Ga0395900_0032387
3187 Ga0395900_0041435
3188 Ga0395900_0044633
3189 Ga0395900_0054353
3190 Ga0395900_0171116
3191 Ga0395900_0212715
3192 Ga0395900_0230183
3193 Ga0395898_0013476
3194 Ga0395898_0017819
3195 Ga0395898_0017968
3196 Ga0395898_0022634
3197 Ga0395898_0033282
3198 Ga0395898_0052976
3199 Ga0395898_0143321
3200 Ga0395898_0149035
3201 Ga0395898_0180037
3202 Ga0395898_0317207
3203 Ga0395905_0002499
3204 Ga0395905_0003717
3205 Ga0395905_0025761
3206 Ga0395905_0033855
3207 Ga0395905_0050626
3208 Ga0395905_0131441
3209 Ga0436364_0086082
3210 Ga0436364_0160208
3211 Ga0436364_0167282
3212 Ga0436364_0210663
3213 Ga0436364_0534280
3214 Ga0436364_0595239
3215 Ga0436364_0711284
3216 Ga0436364_0727525
3217 Ga0436364_0783603
3218 Ga0436364_1216533
3219 Ga0436364_1348565
3220 Ga0436364_1376752
3221 Ga0436364_1490963
3222 Ga0395901_0006683
3223 Ga0395901_0015122
3224 Ga0395901_0075498
3225 Ga0395901_0161651
3226 Ga0395901_0188810
3227 Ga0395901_0390296
3228 Ga0400485_11815
3229 Ga0400483_032686
3230 Ga0400483_140078
3231 Ga0400483_173548
3232 Ga0400483_203337
3233 Ga0400483_277787
3234 Ga0400487_06748
3235 Ga0436365_0120856
3236 Ga0436365_0298223
3237 Ga0436365_0364034
3238 Ga0436365_0422279
3239 Ga0436365_0439594
3240 Ga0436365_0458221
3241 Ga0436365_0486465
3242 Ga0436365_0588205
3243 Ga0436365_0653853
3244 Ga0436365_0994541
3245 Ga0436365_1478328
3246 Ga0436365_1638122
3247 Ga0436360_0305107
3248 Ga0436360_0670466
3249 Ga0436360_0771010
3250 Ga0436360_0787345
3251 Ga0436360_0808839
3252 Ga0436360_1157040
3253 Ga0436361_0077926
3254 Ga0436361_0382143
3255 Ga0436361_0455600
3256 Ga0436361_0458313
3257 Ga0436361_0468973
3258 Ga0436361_0553807
3259 Ga0436361_0623924
3260 Ga0436361_0643175
3261 Ga0436361_0714426
3262 Ga0436363_0221619
3263 Ga0436363_0261799
3264 Ga0436363_0407094
3265 Ga0436363_0434034
3266 Ga0436363_0908068
3267 Ga0436363_1083955
3268 Ga0436363_1184338
3269 Ga0436363_1589623
3270 Ga0436363_1639159
3271 Ga0436362_0132298
3272 Ga0436362_0706265
3273 Ga0436362_1295071
3274 Ga0439431_0043840
3275 Ga0439441_027275
3276 Ga0439458_0036343
3277 Ga0439435_0037066
3278 Ga0439459_0036595
3279 Ga0450916_006125
3280 Ga0450901_003488
3281 Ga0451577_0022138
3282 Ga0451577_0420130
3283 Ga0466969_0000722
3284 Ga0466966_0050018
3285 Ga0466961_0001425
3286 Ga0466963_0057966
3287 Ga0466963_0062811
3288 Ga0453684_0043324
3289 Ga0466971_0009671
3290 Ga0466970_0009156
3291 Ga0466957_0031207
3292 Ga0466960_0035913
3293 Ga0466959_0000040
3294 Ga0466959_0153490
3295 Ga0451576_0000537
3296 Ga0451576_0005502
3297 Ga0451576_0047456
3298 Ga0451576_0408413
3299 Ga0466958_0026837
3300 Ga0466967_0041270
3301 Ga0466967_0127232
3302 Ga0466967_0270461
3303 Ga0495627_004351
3304 Ga0495592_0017429
3305 Ga0495603_0001208
3306 Ga0495603_0044314
3307 Ga0495590_0000622
3308 Ga0495629_0018635
3309 Ga0495629_0046189
3310 Ga0495638_0000147
3311 Ga0495638_0004669
3312 Ga0495638_0005127
3313 Ga0495638_0016403
3314 Ga0495638_0082840
3315 Ga0495641_0013557
3316 Ga0495651_0046441
3317 Ga0495651_0220274
3318 Ga0495651_0307631
3319 Ga0495650_0000045
3320 Ga0495580_0000261
3321 Ga0495582_0002712
3322 Ga0495582_0294715
3323 Ga0495639_0011317
3324 Ga0495664_0030612
3325 Ga0495664_0116888
3326 Ga0495664_0213607
3327 Ga0495594_0001016
3328 Ga0495594_0073681
3329 Ga0495607_0192119
3330 Ga0495583_0000005
3331 Ga0495583_0048378
3332 Ga0495606_0004052
3333 Ga0495606_0117612
3334 Ga0495608_0037550
3335 Ga0495610_0000101
3336 Ga0495616_0000905
3337 Ga0495620_0088411
3338 Ga0495628_0053545
3339 Ga0495630_0196782
3340 Ga0495631_0002661
3341 Ga0495637_0007923
3342 Ga0495637_0053066
3343 Ga0495648_0000575
3344 Ga0495642_0001834
3345 Ga0495652_0058906
3346 Ga0495652_0129079
3347 Ga0495652_0167787
3348 Ga0495652_0172039
3349 Ga0495654_0000018
3350 Ga0495665_0005634
3351 Ga0495640_0122730
3352 Ga0495640_0165127
3353 Ga0495640_0187228
3354 Ga0495586_0148968
3355 Ga0495609_0035053
3356 Ga0495597_0012047
3357 Ga0495645_0001337
3358 Ga0495645_0102392
3359 Ga0495622_0003259
3360 Ga0495622_0024063
3361 Ga0495633_0000314
3362 Ga0495633_0086677
3363 Ga0495667_0006560
3364 Ga0495668_0000061
3365 Ga0495668_0005125
3366 Ga0495668_0007234
3367 Ga0495668_0016736
3368 Ga0495668_0044770
3369 Ga0495668_0063383
3370 Ga0495668_0096547
3371 Ga0495668_0188062
3372 Ga0495634_0009907
3373 Ga0495611_0116876
3374 Ga0495625_0004160
3375 Ga0495625_0005790
3376 Ga0495625_0006681
3377 Ga0495625_0009050
3378 Ga0495625_0024749
3379 Ga0495635_0027669
3380 Ga0495635_0065013
3381 Ga0495635_0118428
3382 Ga0495635_0189477
3383 Ga0495635_0249315
3384 Ga0495588_0013850
3385 Ga0495647_0007552
3386 Ga0495658_0004453
3387 Ga0495658_0030155
3388 Ga0495658_0103244
3389 Ga0495658_0116266
3390 Ga0495669_0000002
3391 Ga0495669_0000369
3392 Ga0495613_0000707
3393 Ga0495613_0003535
3394 Ga0495649_0000627
3395 Ga0495589_0130981
3396 Ga0495660_0004741
3397 Ga0495581_0000368
3398 Ga0495581_0021429
3399 Ga0495604_0137403
3400 Ga0495604_0202824
3401 Ga0495674_0126448
3402 Ga0495672_0001490
3403 Ga0495672_0007884
3404 Ga0495683_0059907
3405 Ga0495687_013678
3406 Ga0495673_0000119
3407 Ga0495673_0000264
3408 Ga0495681_0124370
3409 Ga0495684_0061528
3410 Ga0495684_0100602
3411 Ga0495684_0263219
3412 Ga0495686_0000096
3413 Ga0495686_0001221
3414 Ga0495686_0003784
3415 Ga0495686_0026999
3416 Ga0495686_0027289
3417 Ga0495686_0049096
3418 Ga0495686_0112000
3419 Ga0495593_0003713
3420 Ga0495593_0188398
3421 Ga0495602_0011229
3422 Ga0495602_0362417
3423 Ga0495614_0011074
3424 Ga0496100_0000888
3425 Ga0496100_0016389
3426 Ga0496100_0214973
3427 Ga0496101_0005049
3428 Ga0496101_0025576
3429 Ga0496101_0086661
3430 Ga0496101_0159197
3431 Ga0496102_0014500
3432 Ga0496102_0044401
3433 Ga0496102_0045269
3434 Ga0496102_0057144
3435 Ga0496102_0129891
3436 Ga0496102_0358026
3437 Ga0496103_0051190
3438 Ga0496104_0000175
3439 Ga0496104_0007205
3440 Ga0496104_0032624
3441 Ga0496104_0045404
3442 Ga0496104_0076235
3443 Ga0496104_0128702
3444 Ga0496104_0198346
3445 Ga0496104_0294277
3446 Ga0496105_0010602
3447 Ga0496105_0014060
3448 Ga0496105_0016830
3449 Ga0496105_0048042
3450 Ga0496105_0324425
3451 Ga0496106_0007110
3452 Ga0496106_0007877
3453 Ga0496106_0012041
3454 Ga0496106_0020304
3455 Ga0496106_0159017
3456 Ga0496107_0001574
3457 Ga0496107_0006517
3458 Ga0496107_0022536
3459 Ga0496107_0097844
3460 Ga0496107_0341440
3461 Ga0496107_0500874
3462 Ga0496108_0006491
3463 Ga0496108_0016024
3464 Ga0496108_0047229
3465 Ga0496108_0064110
3466 Ga0496108_0513180
3467 Ga0496109_0003143
3468 Ga0496109_0028937
3469 Ga0496109_0041855
3470 Ga0496109_0200967
3471 Ga0496109_0297055
3472 Ga0496110_0000549
3473 Ga0496110_0007751
3474 Ga0496110_0082000
3475 Ga0496110_0162415
3476 Ga0496110_0203572
3477 Ga0496111_0006678
3478 Ga0496111_0025793
3479 Ga0496111_0138676
3480 Ga0496111_0328516
3481 Ga0496111_0415729
3482 Ga0496112_0010229
3483 Ga0496112_0015256
3484 Ga0496112_0037705
3485 Ga0496112_0041350
3486 Ga0496112_0045837
3487 Ga0496112_0079257
3488 Ga0496112_0108721
3489 Ga0496112_0396084
3490 Ga0496113_0004354
3491 Ga0496113_0029421
3492 Ga0496113_0048824
3493 Ga0496113_0282940
3494 Ga0496114_0000794
3495 Ga0496114_0007626
3496 Ga0496114_0420852
3497 Ga0496115_0000050
3498 Ga0496115_0000862
3499 Ga0496115_0008977
3500 Ga0496115_0010603
3501 Ga0496115_0010863
3502 Ga0496115_0033370
3503 Ga0496115_0266317
3504 Ga0496115_0368245
3505 Ga0496118_0012536
3506 Ga0496119_0031855
3507 Ga0496121_0000397
3508 Ga0496121_0001859
3509 Ga0496121_0004198
3510 Ga0496121_0115248
3511 Ga0496121_0228241
3512 Ga0496122_0251081
3513 Ga0496123_0001218
3514 Ga0496124_0018292
3515 Ga0496126_0002022
3516 Ga0495678_001567
3517 Ga0495682_0001979
3518 Ga0495682_0009967
3519 Ga0501031_0020902
3520 Ga0501031_0050146
3521 Ga0501031_0063777
3522 Ga0501031_0103794
3523 Ga0501031_0161821
3524 Ga0501032_0000393
3525 Ga0501032_0001085
3526 Ga0501032_0009467
3527 Ga0501032_0099046
3528 Ga0501033_0003745
3529 Ga0501033_0021039
3530 Ga0501033_0069486
3531 Ga0501033_0100456
3532 Ga0501033_0116310
3533 Ga0501033_0213882
3534 Ga0501033_0350485
3535 Ga0501034_0000166
3536 Ga0501034_0000293
3537 Ga0501034_0002384
3538 Ga0501034_0009371
3539 Ga0501034_0022687
3540 Ga0501034_0024173
3541 Ga0501034_0036607
3542 Ga0501034_0036636
3543 Ga0501034_0042735
3544 Ga0501034_0061556
3545 Ga0501034_0065142
3546 Ga0501034_0077613
3547 Ga0501034_0188727
3548 Ga0501034_0350030
3549 Ga0501034_0373545
3550 Ga0501034_0524502
3551 Ga0501034_0599294
3552 Ga0501036_0000573
3553 Ga0501036_0019277
3554 Ga0501036_0056835
3555 Ga0501036_0059651
3556 Ga0501036_0089297
3557 Ga0501036_0092941
3558 Ga0501036_0166261
3559 Ga0501036_0223847
3560 Ga0501037_0001135
3561 Ga0501037_0019417
3562 Ga0501037_0042986
3563 Ga0501037_0133980
3564 Ga0501037_0287301
3565 Ga0501038_0020349
3566 Ga0501038_0033540
3567 Ga0501038_0074234
3568 Ga0501038_0285909
3569 Ga0501039_0000452
3570 Ga0501039_0034178
3571 Ga0501039_0079424
3572 Ga0501039_0090104
3573 Ga0501039_0178252
3574 Ga0501039_0359488
3575 Ga0501040_0000753
3576 Ga0501040_0004689
3577 Ga0501040_0025592
3578 Ga0501040_0042041
3579 Ga0501040_0132240
3580 Ga0501040_0296136
3581 Ga0501041_0015930
3582 Ga0501041_0019141
3583 Ga0501041_0164405
3584 Ga0501042_0014718
3585 Ga0501042_0085769
3586 Ga0501042_0117858
3587 Ga0501042_0218263
3588 Ga0501042_0258461
3589 Ga0501043_0009819
3590 Ga0501043_0014748
3591 Ga0501043_0033540
3592 Ga0501043_0060434
3593 Ga0501043_0077234
3594 Ga0501043_0078731
3595 Ga0501043_0115030
3596 Ga0501043_0116875
3597 Ga0501043_0257498
3598 Ga0501043_0339544
3599 Ga0501046_0000224
3600 Ga0501046_0001372
3601 Ga0501046_0003178
3602 Ga0501046_0014585
3603 Ga0501046_0034673
3604 Ga0501046_0040933
3605 Ga0501046_0073657
3606 Ga0501046_0203757
3607 Ga0501047_0000283
3608 Ga0501047_0000643
3609 Ga0501047_0002385
3610 Ga0501047_0012475
3611 Ga0501047_0017227
3612 Ga0501047_0026443
3613 Ga0501047_0026914
3614 Ga0501047_0029202
3615 Ga0501047_0041630
3616 Ga0501047_0068585
3617 Ga0501047_0073181
3618 Ga0501047_0372289
3619 Ga0501048_0000649
3620 Ga0501048_0017618
3621 Ga0501048_0126057
3622 Ga0501048_0139986
3623 Ga0501048_0143658
3624 Ga0501067_0000034
3625 Ga0501067_0001137
3626 Ga0501067_0001833
3627 Ga0501067_0007840
3628 Ga0501067_0010141
3629 Ga0501068_0027576
3630 Ga0501068_0078899
3631 Ga0501068_0174240
3632 Ga0501068_0180178
3633 Ga0501069_0005268
3634 Ga0501069_0017674
3635 Ga0501069_0020008
3636 Ga0501069_0031051
3637 Ga0501070_0006852
3638 Ga0501070_0013555
3639 Ga0501070_0042188
3640 Ga0501070_0052496
3641 Ga0501070_0185107
3642 Ga0501071_0022728
3643 Ga0501071_0086866
3644 Ga0501071_0111696
3645 Ga0501071_0142669
3646 Ga0501071_0220018
3647 Ga0501071_0289678
3648 Ga0501072_0017631
3649 Ga0501072_0026088
3650 Ga0501072_0032705
3651 Ga0501072_0041455
3652 Ga0501072_0041762
3653 Ga0501072_0069545
3654 Ga0501072_0088646
3655 Ga0501072_0109945
3656 Ga0501072_0114876
3657 Ga0501072_0173038
3658 Ga0501072_0262635
3659 Ga0501072_0377622
3660 Ga0501073_0000013
3661 Ga0501073_0001616
3662 Ga0501073_0013717
3663 Ga0501073_0022747
3664 Ga0501073_0066687
3665 Ga0501073_0146604
3666 Ga0501073_0149174
3667 Ga0501073_0244677
3668 Ga0501073_0282778
3669 Ga0501074_0022336
3670 Ga0501074_0069593
3671 Ga0501074_0141173
3672 Ga0501074_0219711
3673 Ga0501074_0264619
3674 Ga0501074_0312973
3675 Ga0501075_0001958
3676 Ga0501075_0007759
3677 Ga0501075_0035010
3678 Ga0501075_0037459
3679 Ga0501075_0071646
3680 Ga0501075_0077203
3681 Ga0501075_0180931
3682 Ga0501076_0002771
3683 Ga0501076_0076938
3684 Ga0501076_0078153
3685 Ga0501076_0103508
3686 Ga0501076_0113893
3687 Ga0501076_0343798
3688 Ga0501076_0391467
3689 Ga0501077_0000032
3690 Ga0501077_0003508
3691 Ga0501077_0048318
3692 Ga0501077_0051285
3693 Ga0501077_0057879
3694 Ga0501077_0069657
3695 Ga0501077_0072007
3696 Ga0501077_0149333
3697 Ga0501077_0201904
3698 Ga0501077_0309142
3699 Ga0501079_0001097
3700 Ga0501079_0012147
3701 Ga0501079_0075110
3702 Ga0501079_0076925
3703 Ga0501079_0077944
3704 Ga0501079_0101057
3705 Ga0501079_0140582
3706 Ga0501079_0356933
3707 Ga0501080_0000315
3708 Ga0501080_0002921
3709 Ga0501080_0004237
3710 Ga0501080_0006226
3711 Ga0501080_0024099
3712 Ga0501080_0025399
3713 Ga0501080_0070328
3714 Ga0501080_0083070
3715 Ga0501080_0122642
3716 Ga0501080_0126788
3717 Ga0501080_0182576
3718 Ga0501080_0248969
3719 Ga0501080_0250153
3720 Ga0501080_0447353
3721 Ga0501080_0511549
3722 Ga0501081_0000197
3723 Ga0501081_0004838
3724 Ga0501081_0006179
3725 Ga0501081_0014493
3726 Ga0501081_0048475
3727 Ga0501081_0068946
3728 Ga0501081_0156971
3729 Ga0501081_0256298
3730 Ga0501083_0006676
3731 Ga0501083_0010086
3732 Ga0501083_0022332
3733 Ga0501083_0083400
3734 Ga0501083_0083409
3735 Ga0501083_0101529
3736 Ga0501083_0266516
3737 Ga0501083_0398461
3738 Ga0501035_0000084
3739 Ga0501035_0004157
3740 Ga0501035_0017251
3741 Ga0501035_0019450
3742 Ga0501035_0034636
3743 Ga0501035_0063808
3744 Ga0501035_0089729
3745 Ga0501035_0093460
3746 Ga0501035_0143575
3747 Ga0501035_0167887
3748 Ga0501035_0179237
3749 Ga0501035_0180239
3750 Ga0501044_0000073
3751 Ga0501044_0002338
3752 Ga0501044_0006073
3753 Ga0501044_0013504
3754 Ga0501044_0015609
3755 Ga0501044_0016919
3756 Ga0501044_0024961
3757 Ga0501044_0031208
3758 Ga0501044_0047398
3759 Ga0501044_0068731
3760 Ga0501044_0092258
3761 Ga0501044_0170850
3762 Ga0501044_0211874
3763 Ga0501044_0306815
3764 Ga0501044_0332239
3765 Ga0501045_0008028
3766 Ga0501045_0024337
3767 Ga0501045_0090001
3768 Ga0501045_0104102
3769 Ga0501045_0105664
3770 Ga0501045_0157645
3771 Ga0501045_0186813
3772 Ga0501045_0196881
3773 Ga0501045_0244115
3774 nmdc:mga03683_134274_c1
3775 nmdc:mga03683_67370_c1
3776 nmdc:mga00v17_263953_c1
3777 nmdc:mga00v17_509_c1
3778 nmdc:mga00v17_54865_c1
3779 nmdc:mga0yw44_63019_c1
3780 nmdc:mga0yw44_8358_c1
3781 nmdc:mga0k408_142329_c1
3782 nmdc:mga0k408_42496_c1
3783 nmdc:mga0k408_77846_c1
3784 nmdc:mga06z11_2382_c1
3785 nmdc:mga06z11_7594_c1
3786 nmdc:mga04h51_230_c1
3787 nmdc:mga04h51_2815_c1
3788 nmdc:mga04h51_30937_c1
3789 nmdc:mga07m45_159056_c1
3790 nmdc:mga05p37_14898_c1
3791 nmdc:mga05p37_424127_c1
3792 nmdc:mga05p37_475407_c1
3793 nmdc:mga05p37_59194_c1
3794 nmdc:mga09592_19535_c1
3795 nmdc:mga09592_565933_c1
3796 nmdc:mga0qj67_21702_c1
3797 nmdc:mga06r32_14451_c1
3798 nmdc:mga06r32_25520_c1
3799 nmdc:mga06r32_67460_c1
3800 nmdc:mga06r32_70210_c1
3801 nmdc:mga08y16_175_c1
3802 nmdc:mga08y16_198871_c1
3803 nmdc:mga08y16_211052_c1
3804 nmdc:mga08y16_247928_c1
3805 nmdc:mga08y16_368635_c1
3806 nmdc:mga08y16_83478_c1
3807 nmdc:mga0n895_159904_c1
3808 nmdc:mga0n895_182774_c1
3809 nmdc:mga0n895_295439_c1
3810 nmdc:mga0n895_6848_c1
3811 nmdc:mga0n895_97053_c1
3812 nmdc:mga0rr50_13712_c2
3813 nmdc:mga0rr50_17190_c1
3814 nmdc:mga0rr50_251206_c1
3815 nmdc:mga08x19_165366_c1
3816 nmdc:mga08x19_3036_c1
3817 nmdc:mga08x19_35621_c1
3818 nmdc:mga0a205_169862_c1
3819 nmdc:mga0a205_227977_c1
3820 nmdc:mga0a205_3040_c1
3821 nmdc:mga0sz30_5290_c1
3822 Ga0495601_0002642
3823 Ga0495601_0004037
3824 Ga0495612_0012290
3825 Ga0495612_0029221
3826 Ga0500635_0000216
3827 Ga0500635_0002546
3828 Ga0495595_0007562
3829 Ga0495595_0026766
3830 Ga0495595_0107670
3831 Ga0495619_0014082
3832 Ga0495619_0018044
3833 Ga0495619_0077400
3834 Ga0495619_0180851
3835 Ga0500578_0000070
3836 Ga0500643_000017
3837 Ga0500643_000374
3838 Ga0500643_007339
3839 Ga0500643_041485
3840 Ga0500644_0000087
3841 Ga0500644_0002225
3842 Ga0500644_0006658
3843 Ga0500647_0012142
3844 Ga0500651_0011452
3845 Ga0500651_0038466
3846 Ga0500641_0001055
3847 Ga0500641_0066799
3848 Ga0500641_0083496
3849 Ga0500555_008402
3850 Ga0500556_0000379
3851 Ga0500556_0001645
3852 Ga0500556_0006342
3853 Ga0500562_005578
3854 Ga0500562_010000
3855 Ga0500562_010799
3856 Ga0500569_000301
3857 Ga0500572_000259
3858 Ga0500594_0000146
3859 Ga0500595_000630
3860 Ga0500595_003016
3861 Ga0500595_003866
3862 Ga0500595_006380
3863 Ga0500595_011880
3864 Ga0500595_033925
3865 Ga0500608_000048
3866 Ga0500608_008519
3867 Ga0500618_000336
3868 Ga0500652_091300
3869 Ga0500655_033196
3870 Ga0500559_0000039
3871 Ga0500559_0000070
3872 Ga0500559_0006751
3873 Ga0500564_000023
3874 Ga0500573_0000026
3875 Ga0500590_008718
3876 Ga0500616_0002568
3877 Ga0500616_0004681
3878 Ga0500616_0016403
3879 Ga0500616_0017981
3880 Ga0500616_0048493
3881 Ga0500616_0055550
3882 Ga0500622_0002894
3883 Ga0500622_0010072
3884 Ga0500622_0015184
3885 Ga0500622_0019007
3886 Ga0500638_015003
3887 Ga0500636_0039430
3888 Ga0500636_0056950
3889 Ga0500637_0053907
3890 Ga0500637_0059374
3891 Ga0500645_000674
3892 Ga0500645_001836
3893 Ga0500645_001866
3894 Ga0500645_039783
3895 Ga0500609_000122
3896 Ga0500552_003643
3897 Ga0501084_0004473
3898 Ga0501084_0005188
3899 Ga0501084_0007894
3900 Ga0501084_0008308
3901 Ga0501084_0008886
3902 Ga0501084_0011060
3903 Ga0501084_0011078
3904 Ga0501084_0011118
3905 Ga0501084_0018253
3906 Ga0501084_0049411
3907 Ga0501082_0000168
3908 Ga0501082_0006709
3909 Ga0501082_0019419
3910 Ga0501082_0034493
3911 Ga0501082_0037495
3912 Ga0501082_0052842
3913 Ga0501082_0109853
3914 Ga0501082_0126507
3915 Ga0501082_0139236
3916 Ga0501082_0236104
3917 Ga0501082_0248180
3918 Ga0501082_0267505
3919 Ga0501082_0293947
3920 Ga0466962_0000450
3921 Ga0530510_0007936
3922 Ga0530510_0012177
3923 Ga0530510_0056191
3924 Ga0530510_0059805
3925 Ga0530510_0061070
3926 Ga0530510_0153927
3927 Ga0530510_0246838
3928 Ga0530510_0319349
3929 Ga0530510_0332454
3930 Ga0530510_0339818
3931 2511122101
3932 2512035755
3933 2523108112
3934 2524609465
3935 2545673161
3936 2585146612
3937 2585152378
3938 2585199028
3939 2587917752
3940 2596373405
3941 2599105835
3942 2643750097
3943 2643782483
3944 2643882351
3945 2643924262
3946 2643928692
3947 2643998845
3948 2644087127
3949 2644226728
3950 2644233802
3951 2644342081
3952 2644353564
3953 2644368368
3954 2644510747
3955 2644548659
3956 2644549376
3957 2671695435
3958 2715501371
3959 2738743187
3960 2739352804
3961 2739792463
3962 2757570352
3963 2774873043
3964 2792462957
3965 2819537309
3966 2819646629
3967 2840880697
3968 2842700468
3969 2843746505
3970 2846955617
3971 2848862395
3972 2849561782
3973 2849574155
3974 2851157833
3975 2854683035
3976 2855021455
3977 2857507009
3978 2882461349
3979 2884961658
3980 2889307847
3981 2889793135
3982 2889917633
3983 2897804453
3984 2898332520
3985 2898797796
3986 2899262033
3987 2899277373
3988 2902336623
3989 2902406894
3990 2917554441
3991 2919679334
3992 2928127069
3993 2928531402
3994 2928974321
3995 2937845332
3996 2939673994
3997 2977243244
3998 2989771371
3999 3000019371
4000 3000406591
4001 3003666057
4002 641642235
4003 643598241
4004 8054007928
4005 8054561364
4006 8057134478

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

231

326

1

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

49

228

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 1.002 26 55
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 1.002 26 55
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 0.9991 28 55
6lke-assembly1.cif.gz_A in meso full-length rat kmo in complex with an inhibitor identified via dna-encoded chemical library screening 0.998 26 55
7c4a-assembly1.cif.gz_B nica2 with cofactor fad 0.9907 27 55
ID Description Score Start End Superfamily
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.003 28 54 3.50.50.60
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9991 28 55 3.50.50.60
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9975 27 54 3.50.50.60
3ka7A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9953 28 55 3.50.50.60
af_Q54US8_49_419_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9949 28 54 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A519PEM2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9997 213 313 GO:0006631
GO:0008691
AF-A0A656TFL7-F1-model_v4 deleted 0.998 217 304
AF-A0A061S868-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9932 208 306 GO:0006631
GO:0016616
AF-A0A3B9B4L3-F1-model_v4 deleted 0.9915 213 306
AF-A0A519PEM2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9899 213 313 GO:0006631
GO:0008691

Map