F496256

General Info

Members Datasets Scaffolds Average Seq Length
2010 414 2010 101

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10242240|Ga0157380_102422402
Length 111
Sequence MSKAKQKQLPKDQLYGVILSPVITEKALVAKEETQDRRQLLTFRVDRRATKPEIKNAVESIFQVKVDQVRTANFLGKMARRGRTEGRKPSWKKAYVTLKAGEKPVDYGEAV

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
127 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
220 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
221 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
222 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
223 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
239 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
260 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
261 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
262 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
267 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
268 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
269 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
270 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
271 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
272 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
273 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
274 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
275 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
276 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
281 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
282 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
283 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
331 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
332 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
333 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
334 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
335 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
336 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
337 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
338 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
339 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
340 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
341 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
350 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
351 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
352 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
353 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
354 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
355 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
356 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
357 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
358 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
359 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
360 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
361 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
362 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
363 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
364 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
365 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
366 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
367 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
368 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
369 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
370 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
371 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
372 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
373 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
374 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
375 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
376 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
377 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
378 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
379 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
380 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
381 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
382 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
383 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
384 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
388 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
389 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
390 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
391 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
392 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
393 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
394 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
395 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
396 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
397 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
407 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
410 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.24
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_2181 2124908026 Bacteria 1377
2 MRS2a_Contig_26825 2124908027 Bacteria 781
3 SwRhRL2b_contig_946432 2162886007 Bacteria 3808
4 CNBas_1007066 3300000531 Bacteria 655
5 CNAas_1000871 3300000532 Bacteria 2841
6 CNXas_1019238 3300000545 Bacteria 503
7 JGI24034J14986_101814 3300001432 Bacteria 1174
8 JGI24748J21848_1000039 3300002074 Bacteria 67539
9 JGI24034J26672_10000042 3300002239 Bacteria 67592
10 JGI24034J26672_10000043 3300002239 Bacteria 67568
11 JGI24751J29686_10000073 3300002459 Bacteria 56805
12 JGI25406J46586_10024396 3300003203 Bacteria 2371
13 JGI25406J46586_10040565 3300003203 Bacteria 1649
14 JGI25406J46586_10040996 3300003203 Unclassified 1635
15 Ga0058860_10630337 3300004801 Bacteria 1022
16 Ga0058860_11428564 3300004801 Unclassified 1063
17 Ga0065714_10064424 3300005288 Bacteria 236118
18 Ga0065714_10281021 3300005288 Bacteria 723
19 Ga0065704_10001318 3300005289 Bacteria 10292
20 Ga0065704_10005913 3300005289 Bacteria 4087
21 Ga0065704_10075904 3300005289 Bacteria 5357
22 Ga0065704_10244026 3300005289 Unclassified 1003
23 Ga0065704_10245795 3300005289 Unclassified 1003
24 Ga0065704_10302691 3300005289 Unclassified 882
25 Ga0065704_10358042 3300005289 Bacteria 786
26 Ga0065704_10421108 3300005289 Bacteria 732
27 Ga0065704_10584762 3300005289 Unclassified 616
28 Ga0065704_10667972 3300005289 Bacteria 575
29 Ga0065704_10823681 3300005289 Unclassified 517
30 Ga0065712_10000117 3300005290 Bacteria 235194
31 Ga0065712_10007020 3300005290 Bacteria 3336
32 Ga0065712_10016951 3300005290 Bacteria 1797
33 Ga0065712_10078309 3300005290 Bacteria 3366
34 Ga0065712_10158219 3300005290 Bacteria 1320
35 Ga0065712_10306276 3300005290 Bacteria 838
36 Ga0065715_10025575 3300005293 Bacteria 1482
37 Ga0065715_10034609 3300005293 Bacteria 1521
38 Ga0065715_10090767 3300005293 Bacteria 6497
39 Ga0065715_10091345 3300005293 Bacteria 5862
40 Ga0065715_10108199 3300005293 Bacteria 2731
41 Ga0065715_10111198 3300005293 Bacteria 2581
42 Ga0065715_10112384 3300005293 Bacteria 2532
43 Ga0065715_10118066 3300005293 Bacteria 2296
44 Ga0065715_10122775 3300005293 Bacteria 2196
45 Ga0065715_10295341 3300005293 Unclassified 1044
46 Ga0065715_10414829 3300005293 Unclassified 865
47 Ga0065715_10651924 3300005293 Unclassified 678
48 Ga0065715_10857620 3300005293 Bacteria 589
49 Ga0065707_10001594 3300005295 Bacteria 7057
50 Ga0065707_10001595 3300005295 Bacteria 6041
51 Ga0065707_10031972 3300005295 Bacteria 1187
52 Ga0065707_10173596 3300005295 Bacteria 1467
53 Ga0065707_10321416 3300005295 Bacteria 966
54 Ga0065707_10379901 3300005295 Unclassified 878
55 Ga0065707_10382438 3300005295 Unclassified 875
56 Ga0065707_10623461 3300005295 Unclassified 677
57 Ga0065707_10757432 3300005295 Bacteria 616
58 Ga0065707_10852942 3300005295 Bacteria 575
59 Ga0070676_10034480 3300005328 Bacteria 2907
60 Ga0070676_10118720 3300005328 Bacteria 1657
61 Ga0070676_10244855 3300005328 Bacteria 1194
62 Ga0070676_10732115 3300005328 Unclassified 725
63 Ga0070676_11169174 3300005328 Unclassified 584
64 Ga0070683_101185355 3300005329 Unclassified 734
65 Ga0070690_100003298 3300005330 Bacteria 8811
66 Ga0070690_100020366 3300005330 Bacteria 4040
67 Ga0070690_100064287 3300005330 Bacteria 2369
68 Ga0070690_100114804 3300005330 Unclassified 1801
69 Ga0070690_100119738 3300005330 Bacteria 1766
70 Ga0070690_100183740 3300005330 Bacteria 1446
71 Ga0070690_100200783 3300005330 Bacteria 1387
72 Ga0070690_100222842 3300005330 Bacteria 1322
73 Ga0070690_100396319 3300005330 Bacteria 1013
74 Ga0070690_100580467 3300005330 Bacteria 849
75 Ga0070690_100592000 3300005330 Bacteria 841
76 Ga0070690_101681288 3300005330 Unclassified 516
77 Ga0070670_100002900 3300005331 Bacteria 14190
78 Ga0070670_100013601 3300005331 Bacteria 6974
79 Ga0070670_100023179 3300005331 Bacteria 5343
80 Ga0070670_100072963 3300005331 Bacteria 2948
81 Ga0070670_100098450 3300005331 Bacteria 2516
82 Ga0070670_100740310 3300005331 Bacteria 885
83 Ga0070670_101951180 3300005331 Unclassified 541
84 Ga0070670_101951427 3300005331 Unclassified 541
85 Ga0070670_101985441 3300005331 Unclassified 536
86 Ga0070677_10073894 3300005333 Bacteria 1441
87 Ga0070677_10124669 3300005333 Bacteria 1168
88 Ga0070677_10436169 3300005333 Bacteria 698
89 Ga0070677_10545235 3300005333 Unclassified 635
90 Ga0068869_100020479 3300005334 Bacteria 4535
91 Ga0068869_100036271 3300005334 Bacteria 3501
92 Ga0068869_100060217 3300005334 Bacteria 2782
93 Ga0068869_100069177 3300005334 Bacteria 2609
94 Ga0068869_100090982 3300005334 Unclassified 2295
95 Ga0068869_100138548 3300005334 Bacteria 1877
96 Ga0068869_100247416 3300005334 Bacteria 1423
97 Ga0068869_100300703 3300005334 Bacteria 1295
98 Ga0068869_100325121 3300005334 Bacteria 1248
99 Ga0068869_100371211 3300005334 Unclassified 1171
100 Ga0068869_100408816 3300005334 Bacteria 1118
101 Ga0068869_100423645 3300005334 Unclassified 1099
102 Ga0068869_100501134 3300005334 Bacteria 1014
103 Ga0068869_100643226 3300005334 Unclassified 899
104 Ga0068869_100649282 3300005334 Bacteria 895
105 Ga0068869_100928002 3300005334 Bacteria 755
106 Ga0068869_101171340 3300005334 Bacteria 675
107 Ga0068869_101666064 3300005334 Bacteria 569
108 Ga0070666_10023239 3300005335 Bacteria 4035
109 Ga0070666_10253138 3300005335 Bacteria 1247
110 Ga0070666_10831210 3300005335 Bacteria 681
111 Ga0070666_11080166 3300005335 Unclassified 596
112 Ga0070680_100004630 3300005336 Bacteria 10339
113 Ga0070680_100009331 3300005336 Bacteria 7536
114 Ga0070680_100100026 3300005336 Bacteria 2407
115 Ga0070680_100314092 3300005336 Bacteria 1330
116 Ga0070680_100932322 3300005336 Bacteria 749
117 Ga0070682_100000254 3300005337 Bacteria 38669
118 Ga0070682_100077085 3300005337 Bacteria 2147
119 Ga0070682_100295102 3300005337 Bacteria 1187
120 Ga0068868_100151558 3300005338 Bacteria 1909
121 Ga0068868_100192063 3300005338 Bacteria 1698
122 Ga0068868_100324200 3300005338 Bacteria 1313
123 Ga0068868_100339718 3300005338 Bacteria 1284
124 Ga0068868_100928093 3300005338 Unclassified 793
125 Ga0068868_101567871 3300005338 Unclassified 618
126 Ga0068868_101929721 3300005338 Unclassified 560
127 Ga0070660_100095647 3300005339 Bacteria 2348
128 Ga0070660_100917625 3300005339 Unclassified 739
129 Ga0070660_101004872 3300005339 Unclassified 705
130 Ga0070689_100047364 3300005340 Bacteria 3315
131 Ga0070689_100091891 3300005340 Bacteria 2393
132 Ga0070689_100100069 3300005340 Bacteria 2293
133 Ga0070689_100154283 3300005340 Bacteria 1853
134 Ga0070689_100202128 3300005340 Bacteria 1623
135 Ga0070689_100603714 3300005340 Bacteria 951
136 Ga0070689_100637802 3300005340 Unclassified 926
137 Ga0070689_100716192 3300005340 Unclassified 875
138 Ga0070689_101154374 3300005340 Unclassified 694
139 Ga0070689_101535762 3300005340 Unclassified 604
140 Ga0070689_101911853 3300005340 Unclassified 542
141 Ga0070689_102207920 3300005340 Unclassified 505
142 Ga0070691_10156292 3300005341 Bacteria 1172
143 Ga0070691_10687349 3300005341 Unclassified 613
144 Ga0070687_100001280 3300005343 Bacteria 8769
145 Ga0070687_100005475 3300005343 Bacteria 5142
146 Ga0070687_100051453 3300005343 Bacteria 2132
147 Ga0070687_100075897 3300005343 Bacteria 1819
148 Ga0070687_100102940 3300005343 Unclassified 1602
149 Ga0070687_100118644 3300005343 Bacteria 1509
150 Ga0070687_100376295 3300005343 Bacteria 924
151 Ga0070687_100472100 3300005343 Bacteria 839
152 Ga0070687_100509146 3300005343 Bacteria 812
153 Ga0070687_100621406 3300005343 Bacteria 745
154 Ga0070687_101417580 3300005343 Unclassified 520
155 Ga0070687_101422487 3300005343 Unclassified 519
156 Ga0070661_100026088 3300005344 Bacteria 4200
157 Ga0070661_100480548 3300005344 Bacteria 992
158 Ga0070692_10013187 3300005345 Bacteria 3847
159 Ga0070692_10043003 3300005345 Bacteria 2322
160 Ga0070692_10097898 3300005345 Unclassified 1604
161 Ga0070692_10099557 3300005345 Bacteria 1592
162 Ga0070692_10153086 3300005345 Unclassified 1315
163 Ga0070692_10356289 3300005345 Unclassified 911
164 Ga0070692_10405530 3300005345 Bacteria 862
165 Ga0070692_10602896 3300005345 Unclassified 727
166 Ga0070692_10791816 3300005345 Bacteria 647
167 Ga0070692_10854210 3300005345 Unclassified 626
168 Ga0070692_10990104 3300005345 Unclassified 587
169 Ga0070692_11015145 3300005345 Unclassified 581
170 Ga0070668_100181198 3300005347 Unclassified 1721
171 Ga0070668_101848989 3300005347 Unclassified 556
172 Ga0070669_100024991 3300005353 Bacteria 4288
173 Ga0070669_100044898 3300005353 Bacteria 3219
174 Ga0070669_100145067 3300005353 Bacteria 1833
175 Ga0070669_100243196 3300005353 Bacteria 1430
176 Ga0070669_100369603 3300005353 Bacteria 1168
177 Ga0070669_100393382 3300005353 Bacteria 1133
178 Ga0070669_100812964 3300005353 Unclassified 795
179 Ga0070669_101042255 3300005353 Unclassified 703
180 Ga0070669_101091608 3300005353 Bacteria 687
181 Ga0070669_101202936 3300005353 Bacteria 655
182 Ga0070675_100015185 3300005354 Bacteria 6081
183 Ga0070675_100178586 3300005354 Bacteria 1834
184 Ga0070675_100213945 3300005354 Bacteria 1676
185 Ga0070675_100469841 3300005354 Bacteria 1130
186 Ga0070675_100597089 3300005354 Bacteria 1001
187 Ga0070675_101910581 3300005354 Unclassified 547
188 Ga0070671_100043258 3300005355 Bacteria 3743
189 Ga0070671_100121702 3300005355 Bacteria 2196
190 Ga0070671_100159731 3300005355 Bacteria 1905
191 Ga0070671_100408563 3300005355 Bacteria 1162
192 Ga0070671_101810345 3300005355 Unclassified 543
193 Ga0070674_100062849 3300005356 Bacteria 2596
194 Ga0070674_100166482 3300005356 Bacteria 1677
195 Ga0070674_100279945 3300005356 Bacteria 1322
196 Ga0070674_100628823 3300005356 Unclassified 910
197 Ga0070673_100019365 3300005364 Bacteria 4884
198 Ga0070673_100036161 3300005364 Bacteria 3751
199 Ga0070673_100066612 3300005364 Bacteria 2877
200 Ga0070673_100121207 3300005364 Bacteria 2182
201 Ga0070673_100527392 3300005364 Bacteria 1071
202 Ga0070673_100680429 3300005364 Bacteria 944
203 Ga0070673_100814867 3300005364 Unclassified 862
204 Ga0070673_101494572 3300005364 Bacteria 637
205 Ga0070673_101592580 3300005364 Unclassified 617
206 Ga0070688_100025051 3300005365 Bacteria 3528
207 Ga0070688_100308085 3300005365 Bacteria 1147
208 Ga0070688_100567728 3300005365 Bacteria 865
209 Ga0070659_100006843 3300005366 Bacteria 8258
210 Ga0070659_100124171 3300005366 Bacteria 2093
211 Ga0070667_100016675 3300005367 Bacteria 6081
212 Ga0070667_100161024 3300005367 Bacteria 1976
213 Ga0070667_100471490 3300005367 Unclassified 1149
214 Ga0070703_10008541 3300005406 Bacteria 2880
215 Ga0070709_10254309 3300005434 Bacteria 1267
216 Ga0070709_10452157 3300005434 Bacteria 968
217 Ga0070709_10496300 3300005434 Bacteria 926
218 Ga0070714_100454041 3300005435 Bacteria 1218
219 Ga0070701_10020650 3300005438 Bacteria 3130
220 Ga0070701_10095568 3300005438 Bacteria 1636
221 Ga0070701_10117371 3300005438 Bacteria 1495
222 Ga0070701_10305432 3300005438 Unclassified 979
223 Ga0070701_10625076 3300005438 Unclassified 716
224 Ga0070701_11260548 3300005438 Bacteria 527
225 Ga0070705_100019989 3300005440 Bacteria 3534
226 Ga0070705_100081331 3300005440 Unclassified 1990
227 Ga0070705_100158410 3300005440 Bacteria 1511
228 Ga0070705_100250537 3300005440 Bacteria 1243
229 Ga0070705_100267130 3300005440 Bacteria 1210
230 Ga0070705_100306813 3300005440 Unclassified 1140
231 Ga0070705_100334044 3300005440 Unclassified 1099
232 Ga0070705_100349319 3300005440 Bacteria 1078
233 Ga0070705_100448173 3300005440 Bacteria 967
234 Ga0070705_100463399 3300005440 Bacteria 954
235 Ga0070705_100523076 3300005440 Bacteria 904
236 Ga0070705_100584198 3300005440 Bacteria 862
237 Ga0070705_100969906 3300005440 Unclassified 688
238 Ga0070705_101629188 3300005440 Unclassified 544
239 Ga0070705_101677144 3300005440 Bacteria 536
240 Ga0070705_101758372 3300005440 Unclassified 525
241 Ga0070700_100007443 3300005441 Bacteria 5912
242 Ga0070700_100007662 3300005441 Bacteria 5843
243 Ga0070700_100010740 3300005441 Bacteria 5059
244 Ga0070700_100032963 3300005441 Bacteria 3118
245 Ga0070700_100109728 3300005441 Bacteria 1832
246 Ga0070700_100167857 3300005441 Bacteria 1517
247 Ga0070700_100185187 3300005441 Bacteria 1452
248 Ga0070700_100186032 3300005441 Bacteria 1449
249 Ga0070700_100248044 3300005441 Bacteria 1276
250 Ga0070700_100249325 3300005441 Bacteria 1273
251 Ga0070700_100255918 3300005441 Bacteria 1258
252 Ga0070700_101161134 3300005441 Bacteria 643
253 Ga0070700_101569682 3300005441 Unclassified 561
254 Ga0070694_100001132 3300005444 Bacteria 15284
255 Ga0070694_100021310 3300005444 Bacteria 4139
256 Ga0070694_100025186 3300005444 Bacteria 3848
257 Ga0070694_100038084 3300005444 Bacteria 3193
258 Ga0070694_100040501 3300005444 Bacteria 3106
259 Ga0070694_100082686 3300005444 Bacteria 2236
260 Ga0070694_100082917 3300005444 Bacteria 2233
261 Ga0070694_100147552 3300005444 Bacteria 1715
262 Ga0070694_100234656 3300005444 Bacteria 1381
263 Ga0070694_100303807 3300005444 Bacteria 1223
264 Ga0070694_100409214 3300005444 Bacteria 1064
265 Ga0070694_100435400 3300005444 Bacteria 1033
266 Ga0070694_100452825 3300005444 Unclassified 1014
267 Ga0070694_100457609 3300005444 Bacteria 1009
268 Ga0070694_100679484 3300005444 Bacteria 836
269 Ga0070694_100813688 3300005444 Unclassified 767
270 Ga0070694_101321686 3300005444 Unclassified 607
271 Ga0070694_101457538 3300005444 Unclassified 579
272 Ga0070694_101619422 3300005444 Unclassified 550
273 Ga0070708_100000800 3300005445 Bacteria 23758
274 Ga0070708_100030539 3300005445 Bacteria 4658
275 Ga0070708_100094081 3300005445 Bacteria 2733
276 Ga0070708_100098732 3300005445 Bacteria 2670
277 Ga0070708_100139947 3300005445 Bacteria 2244
278 Ga0070708_100148199 3300005445 Bacteria 2181
279 Ga0070708_100150074 3300005445 Bacteria 2167
280 Ga0070708_100160507 3300005445 Bacteria 2095
281 Ga0070708_100232165 3300005445 Bacteria 1731
282 Ga0070708_101007153 3300005445 Unclassified 781
283 Ga0070708_101273461 3300005445 Bacteria 687
284 Ga0070708_101600920 3300005445 Unclassified 606
285 Ga0070708_101851823 3300005445 Bacteria 560
286 Ga0070663_100822117 3300005455 Bacteria 798
287 Ga0070678_100381356 3300005456 Bacteria 1220
288 Ga0070662_100126474 3300005457 Bacteria 1965
289 Ga0070662_100150164 3300005457 Bacteria 1813
290 Ga0070662_100204989 3300005457 Unclassified 1567
291 Ga0070662_100457869 3300005457 Bacteria 1060
292 Ga0070662_100802692 3300005457 Unclassified 800
293 Ga0070662_101253695 3300005457 Unclassified 638
294 Ga0070681_10001635 3300005458 Bacteria 19985
295 Ga0070681_10013006 3300005458 Bacteria 8265
296 Ga0070681_10026109 3300005458 Bacteria 5873
297 Ga0070681_10066843 3300005458 Bacteria 3563
298 Ga0070681_10389873 3300005458 Bacteria 1304
299 Ga0070681_10790614 3300005458 Bacteria 866
300 Ga0070681_11166369 3300005458 Unclassified 692
301 Ga0068867_100025248 3300005459 Bacteria 4263
302 Ga0068867_100159867 3300005459 Bacteria 1776
303 Ga0068867_100462074 3300005459 Unclassified 1084
304 Ga0068867_100516784 3300005459 Unclassified 1029
305 Ga0068867_100607492 3300005459 Bacteria 955
306 Ga0068867_100647288 3300005459 Bacteria 927
307 Ga0068867_100682909 3300005459 Bacteria 904
308 Ga0068867_100834508 3300005459 Bacteria 825
309 Ga0068867_101108539 3300005459 Unclassified 723
310 Ga0068867_101458477 3300005459 Bacteria 636
311 Ga0068867_102000683 3300005459 Unclassified 548
312 Ga0070685_10022558 3300005466 Bacteria 3433
313 Ga0070685_10193820 3300005466 Bacteria 1316
314 Ga0070685_10379263 3300005466 Bacteria 974
315 Ga0070706_100004882 3300005467 Bacteria 12828
316 Ga0070706_100005015 3300005467 Bacteria 12657
317 Ga0070706_100014378 3300005467 Bacteria 7315
318 Ga0070706_100037903 3300005467 Bacteria 4451
319 Ga0070706_100041097 3300005467 Bacteria 4269
320 Ga0070706_100087123 3300005467 Bacteria 2894
321 Ga0070706_100161309 3300005467 Bacteria 2094
322 Ga0070706_100341592 3300005467 Bacteria 1396
323 Ga0070706_100353370 3300005467 Bacteria 1370
324 Ga0070706_100461378 3300005467 Bacteria 1182
325 Ga0070706_100782388 3300005467 Bacteria 884
326 Ga0070706_101269808 3300005467 Unclassified 676
327 Ga0070707_100011296 3300005468 Bacteria 8326
328 Ga0070707_100011823 3300005468 Bacteria 8151
329 Ga0070707_100016203 3300005468 Bacteria 6995
330 Ga0070707_100022361 3300005468 Bacteria 5978
331 Ga0070707_100036363 3300005468 Bacteria 4699
332 Ga0070707_100042636 3300005468 Bacteria 4345
333 Ga0070707_100119489 3300005468 Bacteria 2558
334 Ga0070707_100145294 3300005468 Bacteria 2309
335 Ga0070707_100191556 3300005468 Bacteria 1994
336 Ga0070707_100199193 3300005468 Bacteria 1952
337 Ga0070707_100325095 3300005468 Bacteria 1494
338 Ga0070707_100957278 3300005468 Bacteria 821
339 Ga0070707_101109428 3300005468 Bacteria 757
340 Ga0070707_101296254 3300005468 Unclassified 695
341 Ga0070707_101580401 3300005468 Unclassified 623
342 Ga0070707_101969377 3300005468 Unclassified 552
343 Ga0070698_100000084 3300005471 Bacteria 73239
344 Ga0070698_100007334 3300005471 Bacteria 11938
345 Ga0070698_100022297 3300005471 Bacteria 6625
346 Ga0070698_100029543 3300005471 Bacteria 5691
347 Ga0070698_100033968 3300005471 Bacteria 5283
348 Ga0070698_100036446 3300005471 Bacteria 5081
349 Ga0070698_100067661 3300005471 Bacteria 3591
350 Ga0070698_100069158 3300005471 Bacteria 3546
351 Ga0070698_100074866 3300005471 Bacteria 3391
352 Ga0070698_100112639 3300005471 Bacteria 2685
353 Ga0070698_100627660 3300005471 Unclassified 1015
354 Ga0070698_100825049 3300005471 Unclassified 872
355 Ga0070698_100956516 3300005471 Unclassified 803
356 Ga0070698_101015813 3300005471 Bacteria 777
357 Ga0070698_101082568 3300005471 Bacteria 750
358 Ga0070698_101175906 3300005471 Unclassified 716
359 Ga0070698_101836735 3300005471 Unclassified 559
360 Ga0070699_100000199 3300005518 Bacteria 59210
361 Ga0070699_100018887 3300005518 Bacteria 5926
362 Ga0070699_100024447 3300005518 Bacteria 5206
363 Ga0070699_100030361 3300005518 Bacteria 4665
364 Ga0070699_100100985 3300005518 Bacteria 2528
365 Ga0070699_100223340 3300005518 Bacteria 1679
366 Ga0070699_100338004 3300005518 Unclassified 1355
367 Ga0070699_100466812 3300005518 Unclassified 1145
368 Ga0070699_100575740 3300005518 Bacteria 1026
369 Ga0070699_100700085 3300005518 Bacteria 926
370 Ga0070699_100797818 3300005518 Unclassified 864
371 Ga0070699_100949446 3300005518 Unclassified 788
372 Ga0070699_101032986 3300005518 Unclassified 754
373 Ga0070699_101144846 3300005518 Bacteria 714
374 Ga0070699_101338765 3300005518 Unclassified 657
375 Ga0070699_101779235 3300005518 Bacteria 564
376 Ga0070679_100000395 3300005530 Bacteria 37043
377 Ga0070679_100002779 3300005530 Bacteria 15910
378 Ga0070679_100524185 3300005530 Bacteria 1129
379 Ga0070679_100631962 3300005530 Bacteria 1014
380 Ga0070684_100256717 3300005535 Bacteria 1598
381 Ga0070684_100617619 3300005535 Unclassified 1008
382 Ga0070697_100000690 3300005536 Bacteria 25278
383 Ga0070697_100006353 3300005536 Bacteria 9146
384 Ga0070697_100033839 3300005536 Bacteria 4118
385 Ga0070697_100045159 3300005536 Bacteria 3570
386 Ga0070697_100071606 3300005536 Bacteria 2844
387 Ga0070697_100074747 3300005536 Bacteria 2784
388 Ga0070697_100168436 3300005536 Bacteria 1853
389 Ga0070697_100204103 3300005536 Bacteria 1680
390 Ga0070697_100231428 3300005536 Bacteria 1576
391 Ga0070697_100545210 3300005536 Bacteria 1017
392 Ga0070697_100680579 3300005536 Bacteria 907
393 Ga0070697_100886615 3300005536 Unclassified 791
394 Ga0070697_101036248 3300005536 Bacteria 730
395 Ga0070697_101060926 3300005536 Unclassified 721
396 Ga0070697_101060975 3300005536 Unclassified 721
397 Ga0070697_102029776 3300005536 Unclassified 515
398 Ga0068853_100017145 3300005539 Bacteria 5976
399 Ga0068853_100026578 3300005539 Bacteria 4861
400 Ga0068853_100184066 3300005539 Bacteria 1895
401 Ga0068853_100353415 3300005539 Bacteria 1367
402 Ga0068853_100923090 3300005539 Bacteria 839
403 Ga0068853_100991546 3300005539 Unclassified 808
404 Ga0068853_101760051 3300005539 Unclassified 601
405 Ga0068853_101935388 3300005539 Unclassified 572
406 Ga0068853_102392916 3300005539 Bacteria 512
407 Ga0070672_100167770 3300005543 Bacteria 1824
408 Ga0070672_100188509 3300005543 Bacteria 1721
409 Ga0070672_100435501 3300005543 Bacteria 1128
410 Ga0070672_100513181 3300005543 Unclassified 1038
411 Ga0070672_100832626 3300005543 Bacteria 813
412 Ga0070672_101168069 3300005543 Unclassified 685
413 Ga0070672_102007857 3300005543 Unclassified 521
414 Ga0070686_100015416 3300005544 Bacteria 4427
415 Ga0070686_100016099 3300005544 Bacteria 4344
416 Ga0070686_100093082 3300005544 Bacteria 2020
417 Ga0070686_100099757 3300005544 Bacteria 1959
418 Ga0070686_100141243 3300005544 Bacteria 1676
419 Ga0070686_100338717 3300005544 Bacteria 1126
420 Ga0070686_100457978 3300005544 Bacteria 982
421 Ga0070686_101429964 3300005544 Bacteria 581
422 Ga0070686_101622168 3300005544 Unclassified 548
423 Ga0070695_100029337 3300005545 Bacteria 3418
424 Ga0070695_100039206 3300005545 Bacteria 2993
425 Ga0070695_100049920 3300005545 Bacteria 2680
426 Ga0070695_100106428 3300005545 Bacteria 1896
427 Ga0070695_100106801 3300005545 Bacteria 1893
428 Ga0070695_100184353 3300005545 Bacteria 1481
429 Ga0070695_100204705 3300005545 Bacteria 1413
430 Ga0070695_100206044 3300005545 Bacteria 1408
431 Ga0070695_100447047 3300005545 Bacteria 989
432 Ga0070695_100493605 3300005545 Unclassified 946
433 Ga0070695_100594177 3300005545 Unclassified 868
434 Ga0070695_101004380 3300005545 Unclassified 679
435 Ga0070695_101055842 3300005545 Bacteria 663
436 Ga0070695_101169610 3300005545 Bacteria 632
437 Ga0070695_101178042 3300005545 Bacteria 629
438 Ga0070695_101886385 3300005545 Bacteria 502
439 Ga0070696_100006539 3300005546 Bacteria 7784
440 Ga0070696_100009227 3300005546 Bacteria 6602
441 Ga0070696_100106168 3300005546 Bacteria 2018
442 Ga0070696_100106813 3300005546 Bacteria 2013
443 Ga0070696_100116658 3300005546 Bacteria 1928
444 Ga0070696_100173710 3300005546 Bacteria 1594
445 Ga0070696_100232775 3300005546 Bacteria 1387
446 Ga0070696_100337080 3300005546 Bacteria 1165
447 Ga0070696_100371254 3300005546 Bacteria 1113
448 Ga0070696_100584087 3300005546 Bacteria 899
449 Ga0070696_100650456 3300005546 Bacteria 854
450 Ga0070696_100753910 3300005546 Bacteria 798
451 Ga0070696_101063507 3300005546 Bacteria 679
452 Ga0070696_101231737 3300005546 Bacteria 633
453 Ga0070696_101843260 3300005546 Unclassified 523
454 Ga0070693_100118069 3300005547 Bacteria 1641
455 Ga0070693_100131046 3300005547 Bacteria 1568
456 Ga0070693_100177605 3300005547 Bacteria 1368
457 Ga0070693_100256851 3300005547 Bacteria 1160
458 Ga0070693_100391846 3300005547 Unclassified 961
459 Ga0070693_100622967 3300005547 Bacteria 781
460 Ga0070693_101041329 3300005547 Unclassified 621
461 Ga0070693_101196169 3300005547 Unclassified 584
462 Ga0070665_100028770 3300005548 Bacteria 5595
463 Ga0070665_100266433 3300005548 Bacteria 1714
464 Ga0070665_100827191 3300005548 Unclassified 939
465 Ga0070704_100014713 3300005549 Bacteria 4892
466 Ga0070704_100070461 3300005549 Bacteria 2537
467 Ga0070704_100080500 3300005549 Bacteria 2396
468 Ga0070704_100095102 3300005549 Bacteria 2231
469 Ga0070704_100113589 3300005549 Bacteria 2065
470 Ga0070704_100150343 3300005549 Bacteria 1830
471 Ga0070704_100162690 3300005549 Bacteria 1766
472 Ga0070704_100195550 3300005549 Bacteria 1629
473 Ga0070704_100199543 3300005549 Bacteria 1614
474 Ga0070704_100259951 3300005549 Bacteria 1430
475 Ga0070704_100261702 3300005549 Bacteria 1425
476 Ga0070704_100383567 3300005549 Bacteria 1195
477 Ga0070704_100406322 3300005549 Bacteria 1163
478 Ga0070704_100425847 3300005549 Unclassified 1138
479 Ga0070704_100555276 3300005549 Bacteria 1004
480 Ga0070704_100580673 3300005549 Bacteria 983
481 Ga0070704_100606290 3300005549 Bacteria 963
482 Ga0070704_100734570 3300005549 Unclassified 878
483 Ga0070704_100934435 3300005549 Bacteria 782
484 Ga0070704_100988317 3300005549 Bacteria 761
485 Ga0070704_101027947 3300005549 Bacteria 746
486 Ga0070704_101496021 3300005549 Unclassified 621
487 Ga0070704_101836909 3300005549 Unclassified 561
488 Ga0068855_100529630 3300005563 Unclassified 1277
489 Ga0068855_100607065 3300005563 Bacteria 1179
490 Ga0068855_101673198 3300005563 Bacteria 649
491 Ga0070664_100093079 3300005564 Bacteria 2611
492 Ga0070664_100184980 3300005564 Bacteria 1854
493 Ga0070664_100284137 3300005564 Bacteria 1492
494 Ga0070664_100287459 3300005564 Bacteria 1484
495 Ga0070664_100382720 3300005564 Bacteria 1285
496 Ga0070664_100584601 3300005564 Unclassified 1035
497 Ga0070664_100855610 3300005564 Unclassified 852
498 Ga0070664_100879533 3300005564 Unclassified 839
499 Ga0070664_101807214 3300005564 Unclassified 580
500 Ga0068857_100005330 3300005577 Bacteria 10953
501 Ga0068857_100129039 3300005577 Bacteria 2279
502 Ga0068857_100187088 3300005577 Bacteria 1885
503 Ga0068857_100266390 3300005577 Bacteria 1574
504 Ga0068857_100300174 3300005577 Bacteria 1480
505 Ga0068857_100776962 3300005577 Bacteria 913
506 Ga0068857_100868577 3300005577 Unclassified 864
507 Ga0068857_101247240 3300005577 Unclassified 721
508 Ga0068857_101474381 3300005577 Unclassified 663
509 Ga0068857_101518796 3300005577 Unclassified 653
510 Ga0068857_102162131 3300005577 Unclassified 546
511 Ga0068857_102446133 3300005577 Unclassified 513
512 Ga0068854_100068497 3300005578 Bacteria 2588
513 Ga0068854_100126375 3300005578 Bacteria 1948
514 Ga0068854_100202778 3300005578 Bacteria 1560
515 Ga0068854_100308977 3300005578 Bacteria 1282
516 Ga0068854_100314424 3300005578 Bacteria 1271
517 Ga0068854_100375959 3300005578 Bacteria 1169
518 Ga0068854_100480009 3300005578 Bacteria 1043
519 Ga0068854_101200783 3300005578 Bacteria 680
520 Ga0068854_101379281 3300005578 Unclassified 637
521 Ga0068854_101471464 3300005578 Unclassified 617
522 Ga0068856_100021866 3300005614 Bacteria 6217
523 Ga0068856_100946753 3300005614 Bacteria 880
524 Ga0070702_100016163 3300005615 Bacteria 3824
525 Ga0070702_100086109 3300005615 Bacteria 1894
526 Ga0070702_100200828 3300005615 Bacteria 1320
527 Ga0070702_100323568 3300005615 Unclassified 1076
528 Ga0070702_100600193 3300005615 Unclassified 825
529 Ga0070702_101008714 3300005615 Bacteria 659
530 Ga0070702_101636429 3300005615 Bacteria 534
531 Ga0070702_101657207 3300005615 Unclassified 531
532 Ga0070702_101763485 3300005615 Unclassified 516
533 Ga0068852_100076037 3300005616 Bacteria 2964
534 Ga0068852_100588516 3300005616 Bacteria 1116
535 Ga0068852_100972951 3300005616 Unclassified 867
536 Ga0068852_101153232 3300005616 Bacteria 796
537 Ga0068852_101346873 3300005616 Unclassified 736
538 Ga0068852_101376516 3300005616 Unclassified 727
539 Ga0068852_101673499 3300005616 Unclassified 659
540 Ga0068859_100062276 3300005617 Bacteria 3760
541 Ga0068859_100062451 3300005617 Bacteria 3755
542 Ga0068859_100108338 3300005617 Bacteria 2839
543 Ga0068859_100135988 3300005617 Bacteria 2531
544 Ga0068859_100147283 3300005617 Bacteria 2430
545 Ga0068859_100166045 3300005617 Bacteria 2287
546 Ga0068859_100201229 3300005617 Bacteria 2076
547 Ga0068859_100281311 3300005617 Bacteria 1756
548 Ga0068859_100338139 3300005617 Bacteria 1599
549 Ga0068859_100403200 3300005617 Bacteria 1463
550 Ga0068859_100428773 3300005617 Bacteria 1419
551 Ga0068859_100504714 3300005617 Unclassified 1305
552 Ga0068859_100574549 3300005617 Unclassified 1221
553 Ga0068859_100715517 3300005617 Unclassified 1091
554 Ga0068859_100935161 3300005617 Bacteria 951
555 Ga0068859_100961946 3300005617 Bacteria 937
556 Ga0068859_100977687 3300005617 Unclassified 929
557 Ga0068859_101315718 3300005617 Unclassified 796
558 Ga0068859_101595310 3300005617 Bacteria 721
559 Ga0068859_101681669 3300005617 Unclassified 701
560 Ga0068859_101683119 3300005617 Unclassified 701
561 Ga0068859_101817866 3300005617 Unclassified 673
562 Ga0068859_102100977 3300005617 Unclassified 623
563 Ga0068859_102472765 3300005617 Unclassified 572
564 Ga0068859_102730219 3300005617 Unclassified 542
565 Ga0068864_100045153 3300005618 Bacteria 3779
566 Ga0068864_100123415 3300005618 Bacteria 2318
567 Ga0068864_100145091 3300005618 Bacteria 2145
568 Ga0068864_100201597 3300005618 Bacteria 1828
569 Ga0068864_100227811 3300005618 Bacteria 1722
570 Ga0068864_100262503 3300005618 Bacteria 1607
571 Ga0068864_100368150 3300005618 Bacteria 1359
572 Ga0068864_100450042 3300005618 Bacteria 1231
573 Ga0068864_100458950 3300005618 Bacteria 1219
574 Ga0068864_100654906 3300005618 Unclassified 1023
575 Ga0068864_100758028 3300005618 Unclassified 951
576 Ga0068864_100798184 3300005618 Bacteria 927
577 Ga0068864_100937716 3300005618 Bacteria 856
578 Ga0068864_101180645 3300005618 Bacteria 763
579 Ga0068864_101690914 3300005618 Unclassified 637
580 Ga0068864_101800990 3300005618 Unclassified 617
581 Ga0068864_101824525 3300005618 Unclassified 613
582 Ga0068864_102728101 3300005618 Unclassified 500
583 Ga0068866_10000684 3300005718 Bacteria 15437
584 Ga0068866_10057264 3300005718 Bacteria 2008
585 Ga0068866_10479900 3300005718 Unclassified 819
586 Ga0068866_11457357 3300005718 Unclassified 502
587 Ga0068861_100012289 3300005719 Bacteria 5972
588 Ga0068861_100023980 3300005719 Bacteria 4406
589 Ga0068861_100042290 3300005719 Bacteria 3414
590 Ga0068861_100308405 3300005719 Bacteria 1374
591 Ga0068861_100342796 3300005719 Bacteria 1308
592 Ga0068861_100350527 3300005719 Bacteria 1295
593 Ga0068861_100476995 3300005719 Bacteria 1123
594 Ga0068861_100513468 3300005719 Bacteria 1085
595 Ga0068861_100801240 3300005719 Unclassified 884
596 Ga0068861_100905690 3300005719 Bacteria 836
597 Ga0068861_100909435 3300005719 Bacteria 834
598 Ga0068861_101433214 3300005719 Unclassified 676
599 Ga0068861_101591211 3300005719 Unclassified 643
600 Ga0068861_102031372 3300005719 Bacteria 574
601 Ga0068851_10022997 3300005834 Bacteria 3043
602 Ga0068851_10432576 3300005834 Unclassified 779
603 Ga0068851_11087756 3300005834 Unclassified 507
604 Ga0068870_10012226 3300005840 Bacteria 4005
605 Ga0068870_10159976 3300005840 Bacteria 1334
606 Ga0068870_10472440 3300005840 Unclassified 830
607 Ga0068870_10716932 3300005840 Bacteria 692
608 Ga0068870_11021255 3300005840 Unclassified 591
609 Ga0068863_100026872 3300005841 Bacteria 5489
610 Ga0068863_100083000 3300005841 Bacteria 3036
611 Ga0068863_100320116 3300005841 Bacteria 1506
612 Ga0068863_100326198 3300005841 Bacteria 1492
613 Ga0068863_100357756 3300005841 Bacteria 1423
614 Ga0068863_100383026 3300005841 Bacteria 1373
615 Ga0068863_100535282 3300005841 Unclassified 1156
616 Ga0068863_100722764 3300005841 Bacteria 991
617 Ga0068863_100746215 3300005841 Bacteria 974
618 Ga0068863_100761277 3300005841 Bacteria 965
619 Ga0068863_100977751 3300005841 Bacteria 849
620 Ga0068863_101425753 3300005841 Bacteria 700
621 Ga0068863_101585153 3300005841 Bacteria 664
622 Ga0068863_101940714 3300005841 Unclassified 599
623 Ga0068858_100001829 3300005842 Bacteria 21656
624 Ga0068858_100023347 3300005842 Bacteria 5762
625 Ga0068858_100036674 3300005842 Bacteria 4546
626 Ga0068858_100047238 3300005842 Bacteria 3991
627 Ga0068858_100079267 3300005842 Bacteria 3052
628 Ga0068858_100141300 3300005842 Bacteria 2260
629 Ga0068858_100160778 3300005842 Bacteria 2115
630 Ga0068858_100487683 3300005842 Unclassified 1190
631 Ga0068858_100542570 3300005842 Unclassified 1125
632 Ga0068858_100619565 3300005842 Unclassified 1050
633 Ga0068858_100646196 3300005842 Bacteria 1028
634 Ga0068858_100675272 3300005842 Bacteria 1004
635 Ga0068858_100792243 3300005842 Unclassified 924
636 Ga0068858_101261334 3300005842 Unclassified 727
637 Ga0068858_101646526 3300005842 Unclassified 633
638 Ga0068858_102151029 3300005842 Unclassified 552
639 Ga0068858_102253181 3300005842 Unclassified 538
640 Ga0068858_102499757 3300005842 Unclassified 510
641 Ga0068860_100051201 3300005843 Bacteria 3929
642 Ga0068860_100106853 3300005843 Bacteria 2674
643 Ga0068860_100109863 3300005843 Bacteria 2635
644 Ga0068860_100148397 3300005843 Bacteria 2257
645 Ga0068860_100244712 3300005843 Bacteria 1745
646 Ga0068860_100258331 3300005843 Bacteria 1697
647 Ga0068860_100331116 3300005843 Bacteria 1496
648 Ga0068860_100425352 3300005843 Bacteria 1317
649 Ga0068860_100492019 3300005843 Bacteria 1224
650 Ga0068860_100515379 3300005843 Unclassified 1195
651 Ga0068860_100603635 3300005843 Bacteria 1103
652 Ga0068860_100850880 3300005843 Bacteria 927
653 Ga0068860_100945932 3300005843 Unclassified 879
654 Ga0068860_101524930 3300005843 Bacteria 690
655 Ga0068860_101903104 3300005843 Unclassified 616
656 Ga0068860_102003191 3300005843 Unclassified 600
657 Ga0068860_102422672 3300005843 Unclassified 545
658 Ga0068860_102643063 3300005843 Unclassified 521
659 Ga0068862_100058564 3300005844 Bacteria 3304
660 Ga0068862_100062012 3300005844 Bacteria 3215
661 Ga0068862_100124763 3300005844 Bacteria 2272
662 Ga0068862_100296367 3300005844 Bacteria 1487
663 Ga0068862_100869420 3300005844 Bacteria 884
664 Ga0068862_101111890 3300005844 Bacteria 786
665 Ga0068862_101117655 3300005844 Bacteria 784
666 Ga0068862_101221828 3300005844 Unclassified 751
667 Ga0068862_101363008 3300005844 Unclassified 712
668 Ga0068862_101524697 3300005844 Bacteria 674
669 Ga0068862_101650145 3300005844 Unclassified 649
670 Ga0068862_101663340 3300005844 Bacteria 646
671 Ga0068862_102468753 3300005844 Unclassified 531
672 Ga0081455_10429463 3300005937 Bacteria 909
673 Ga0081538_10003741 3300005981 Bacteria 14245
674 Ga0081539_10000317 3300005985 Bacteria 107746
675 Ga0081539_10000395 3300005985 Bacteria 93818
676 Ga0081539_10000660 3300005985 Bacteria 69312
677 Ga0081539_10005021 3300005985 Bacteria 13949
678 Ga0081539_10006228 3300005985 Bacteria 11565
679 Ga0081539_10059129 3300005985 Bacteria 2112
680 Ga0081539_10089483 3300005985 Bacteria 1594
681 Ga0081539_10090943 3300005985 Bacteria 1577
682 Ga0081539_10202377 3300005985 Bacteria 916
683 Ga0070715_10000038 3300006163 Bacteria 67091
684 Ga0070715_10267807 3300006163 Bacteria 900
685 Ga0070715_10696992 3300006163 Unclassified 606
686 Ga0070716_100000006 3300006173 Bacteria 268067
687 Ga0070716_100142480 3300006173 Unclassified 1530
688 Ga0070716_100373334 3300006173 Unclassified 1017
689 Ga0070716_100524580 3300006173 Bacteria 878
690 Ga0070716_100695730 3300006173 Unclassified 776
691 Ga0075366_10693484 3300006195 Bacteria 632
692 Ga0097621_100008417 3300006237 Bacteria 7428
693 Ga0097621_100012663 3300006237 Bacteria 6263
694 Ga0097621_100222114 3300006237 Bacteria 1646
695 Ga0097621_100981206 3300006237 Unclassified 790
696 Ga0068871_100049076 3300006358 Bacteria 3410
697 Ga0068871_100058549 3300006358 Bacteria 3137
698 Ga0068871_100060888 3300006358 Bacteria 3080
699 Ga0068871_100226864 3300006358 Bacteria 1620
700 Ga0068871_100351674 3300006358 Bacteria 1303
701 Ga0068871_100820083 3300006358 Bacteria 858
702 Ga0068871_100851665 3300006358 Unclassified 843
703 Ga0068871_100957430 3300006358 Unclassified 796
704 Ga0068871_101464783 3300006358 Unclassified 644
705 Ga0075428_100046173 3300006844 Bacteria 4785
706 Ga0075428_100378886 3300006844 Bacteria 1517
707 Ga0075428_100409149 3300006844 Bacteria 1454
708 Ga0075428_100604083 3300006844 Unclassified 1172
709 Ga0075428_100891609 3300006844 Bacteria 944
710 Ga0075428_101067530 3300006844 Unclassified 854
711 Ga0075428_101165970 3300006844 Unclassified 813
712 Ga0075428_102554776 3300006844 Unclassified 522
713 Ga0075430_100073963 3300006846 Bacteria 2857
714 Ga0075430_100197209 3300006846 Bacteria 1672
715 Ga0075430_100732752 3300006846 Unclassified 815
716 Ga0075431_100316891 3300006847 Bacteria 1573
717 Ga0075431_100416798 3300006847 Bacteria 1342
718 Ga0075431_100770310 3300006847 Bacteria 937
719 Ga0075431_101075014 3300006847 Unclassified 770
720 Ga0075431_101711549 3300006847 Unclassified 586
721 Ga0075433_10021535 3300006852 Bacteria 5406
722 Ga0075433_10084674 3300006852 Bacteria 2798
723 Ga0075433_10090942 3300006852 Bacteria 2697
724 Ga0075433_10284062 3300006852 Bacteria 1466
725 Ga0075433_10306888 3300006852 Bacteria 1405
726 Ga0075433_10316947 3300006852 Bacteria 1380
727 Ga0075433_10379007 3300006852 Unclassified 1249
728 Ga0075433_10423460 3300006852 Bacteria 1174
729 Ga0075433_10514936 3300006852 Bacteria 1053
730 Ga0075433_10593529 3300006852 Unclassified 972
731 Ga0075433_10672419 3300006852 Bacteria 907
732 Ga0075433_10724052 3300006852 Bacteria 871
733 Ga0075433_10745510 3300006852 Unclassified 857
734 Ga0075433_11053890 3300006852 Unclassified 708
735 Ga0075433_11140033 3300006852 Unclassified 677
736 Ga0075433_11911827 3300006852 Bacteria 509
737 Ga0075434_100061352 3300006871 Bacteria 3740
738 Ga0075434_100065544 3300006871 Bacteria 3617
739 Ga0075434_100181865 3300006871 Bacteria 2123
740 Ga0075434_100205752 3300006871 Bacteria 1988
741 Ga0075434_100207781 3300006871 Bacteria 1979
742 Ga0075434_100366973 3300006871 Bacteria 1461
743 Ga0075434_100413343 3300006871 Bacteria 1370
744 Ga0075434_100669002 3300006871 Bacteria 1056
745 Ga0075434_100865818 3300006871 Bacteria 919
746 Ga0075434_101093139 3300006871 Bacteria 811
747 Ga0075434_101750698 3300006871 Unclassified 629
748 Ga0075434_102260288 3300006871 Unclassified 547
749 Ga0075429_100030022 3300006880 Bacteria 4721
750 Ga0075429_100087817 3300006880 Bacteria 2710
751 Ga0075429_100646534 3300006880 Unclassified 927
752 Ga0075429_100797749 3300006880 Unclassified 827
753 Ga0075429_100986081 3300006880 Bacteria 737
754 Ga0075429_101380360 3300006880 Unclassified 614
755 Ga0068865_100007130 3300006881 Bacteria 6863
756 Ga0068865_100072236 3300006881 Unclassified 2451
757 Ga0068865_100314445 3300006881 Bacteria 1258
758 Ga0068865_100400731 3300006881 Unclassified 1124
759 Ga0068865_100762843 3300006881 Unclassified 832
760 Ga0068865_100770108 3300006881 Bacteria 828
761 Ga0068865_100784771 3300006881 Bacteria 821
762 Ga0068865_101211146 3300006881 Unclassified 669
763 Ga0075436_100007062 3300006914 Bacteria 7689
764 Ga0075436_100038627 3300006914 Bacteria 3294
765 Ga0075436_100765062 3300006914 Bacteria 718
766 Ga0075436_100880217 3300006914 Bacteria 669
767 Ga0075436_100893195 3300006914 Bacteria 664
768 Ga0097620_100062277 3300006931 Bacteria 3760
769 Ga0097620_100062449 3300006931 Bacteria 3755
770 Ga0097620_100108345 3300006931 Bacteria 2839
771 Ga0097620_100135993 3300006931 Bacteria 2531
772 Ga0097620_100147286 3300006931 Bacteria 2430
773 Ga0097620_100166045 3300006931 Bacteria 2287
774 Ga0097620_100201228 3300006931 Bacteria 2076
775 Ga0097620_100281320 3300006931 Bacteria 1756
776 Ga0097620_100338161 3300006931 Bacteria 1599
777 Ga0097620_100403211 3300006931 Bacteria 1463
778 Ga0097620_100428800 3300006931 Bacteria 1419
779 Ga0097620_100504694 3300006931 Unclassified 1305
780 Ga0097620_100574578 3300006931 Unclassified 1221
781 Ga0097620_100715552 3300006931 Unclassified 1091
782 Ga0097620_100935167 3300006931 Bacteria 951
783 Ga0097620_100962036 3300006931 Bacteria 937
784 Ga0097620_100977917 3300006931 Unclassified 929
785 Ga0097620_101315738 3300006931 Unclassified 796
786 Ga0097620_101595339 3300006931 Bacteria 721
787 Ga0097620_101681527 3300006931 Unclassified 701
788 Ga0097620_101683281 3300006931 Unclassified 701
789 Ga0097620_101818043 3300006931 Unclassified 673
790 Ga0097620_102100973 3300006931 Unclassified 623
791 Ga0097620_102472926 3300006931 Unclassified 572
792 Ga0097620_102730017 3300006931 Unclassified 542
793 Ga0075435_100005711 3300007076 Bacteria 8721
794 Ga0075435_100006806 3300007076 Bacteria 8112
795 Ga0075435_100429699 3300007076 Bacteria 1138
796 Ga0075435_100454567 3300007076 Bacteria 1105
797 Ga0075435_101700935 3300007076 Unclassified 554
798 Ga0099794_10006344 3300007265 Bacteria 4780
799 Ga0099794_10082760 3300007265 Bacteria 1585
800 Ga0099794_10744151 3300007265 Unclassified 523
801 Ga0099795_10058710 3300007788 Bacteria 1421
802 Ga0105251_10081760 3300009011 Bacteria 1492
803 Ga0105251_10160907 3300009011 Bacteria 1012
804 Ga0105251_10584864 3300009011 Unclassified 529
805 Ga0105250_10405631 3300009092 Bacteria 605
806 Ga0105240_10096141 3300009093 Bacteria 3611
807 Ga0105240_10272345 3300009093 Bacteria 1948
808 Ga0105240_10373847 3300009093 Bacteria 1611
809 Ga0105240_11620598 3300009093 Unclassified 677
810 Ga0111539_10000296 3300009094 Bacteria 60206
811 Ga0111539_10005702 3300009094 Bacteria 16116
812 Ga0111539_10052719 3300009094 Bacteria 4842
813 Ga0111539_10062111 3300009094 Bacteria 4424
814 Ga0111539_10212383 3300009094 Bacteria 2255
815 Ga0111539_10563858 3300009094 Bacteria 1326
816 Ga0111539_11007833 3300009094 Bacteria 968
817 Ga0111539_11275173 3300009094 Unclassified 853
818 Ga0111539_11535629 3300009094 Unclassified 772
819 Ga0111539_12432528 3300009094 Unclassified 607
820 Ga0105245_10135760 3300009098 Unclassified 2312
821 Ga0105245_10167793 3300009098 Bacteria 2088
822 Ga0105245_10321661 3300009098 Unclassified 1524
823 Ga0105245_10791912 3300009098 Bacteria 986
824 Ga0105245_10961854 3300009098 Bacteria 897
825 Ga0105245_11079749 3300009098 Bacteria 849
826 Ga0105245_11106429 3300009098 Bacteria 839
827 Ga0105245_12239735 3300009098 Bacteria 600
828 Ga0105247_10000052 3300009101 Bacteria 141465
829 Ga0105247_10243228 3300009101 Bacteria 1227
830 Ga0105247_10297923 3300009101 Unclassified 1118
831 Ga0105247_10346344 3300009101 Bacteria 1044
832 Ga0105247_10463239 3300009101 Bacteria 916
833 Ga0114129_10006921 3300009147 Bacteria 16129
834 Ga0114129_10010378 3300009147 Bacteria 13281
835 Ga0114129_10024293 3300009147 Bacteria 8586
836 Ga0114129_10051992 3300009147 Bacteria 5751
837 Ga0114129_10056168 3300009147 Bacteria 5515
838 Ga0114129_10157829 3300009147 Bacteria 3101
839 Ga0114129_10189298 3300009147 Unclassified 2795
840 Ga0114129_10201062 3300009147 Bacteria 2698
841 Ga0114129_10208551 3300009147 Bacteria 2643
842 Ga0114129_10300226 3300009147 Bacteria 2141
843 Ga0114129_10529431 3300009147 Bacteria 1535
844 Ga0114129_10695250 3300009147 Bacteria 1307
845 Ga0114129_10954612 3300009147 Bacteria 1083
846 Ga0114129_11002852 3300009147 Unclassified 1051
847 Ga0114129_11017944 3300009147 Bacteria 1042
848 Ga0114129_11048030 3300009147 Bacteria 1024
849 Ga0114129_11051562 3300009147 Unclassified 1022
850 Ga0114129_11128837 3300009147 Unclassified 980
851 Ga0114129_11400675 3300009147 Unclassified 863
852 Ga0114129_11685529 3300009147 Unclassified 774
853 Ga0114129_11733634 3300009147 Unclassified 761
854 Ga0114129_11986120 3300009147 Unclassified 704
855 Ga0114129_12490129 3300009147 Unclassified 619
856 Ga0114129_12815655 3300009147 Bacteria 578
857 Ga0114129_13207569 3300009147 Unclassified 532
858 Ga0105243_10000777 3300009148 Bacteria 30566
859 Ga0105243_10002279 3300009148 Bacteria 16094
860 Ga0105243_10017989 3300009148 Bacteria 5347
861 Ga0105243_10114247 3300009148 Bacteria 2265
862 Ga0105243_10152891 3300009148 Bacteria 1981
863 Ga0105243_10171293 3300009148 Bacteria 1880
864 Ga0105243_10175362 3300009148 Bacteria 1860
865 Ga0105243_10382306 3300009148 Bacteria 1302
866 Ga0105243_10413660 3300009148 Bacteria 1256
867 Ga0105243_10436392 3300009148 Bacteria 1225
868 Ga0105243_10516463 3300009148 Bacteria 1135
869 Ga0105243_10625893 3300009148 Bacteria 1040
870 Ga0105243_10940759 3300009148 Bacteria 862
871 Ga0105243_11268158 3300009148 Unclassified 753
872 Ga0105243_11889641 3300009148 Unclassified 630
873 Ga0105243_12133716 3300009148 Unclassified 596
874 Ga0105243_12165048 3300009148 Unclassified 592
875 Ga0105243_12200691 3300009148 Unclassified 588
876 Ga0105243_12386154 3300009148 Unclassified 567
877 Ga0105243_12741107 3300009148 Unclassified 533
878 Ga0105243_12830037 3300009148 Unclassified 526
879 Ga0105241_10057890 3300009174 Bacteria 2975
880 Ga0105241_10238004 3300009174 Bacteria 1538
881 Ga0105241_10346745 3300009174 Bacteria 1288
882 Ga0105241_10539231 3300009174 Unclassified 1046
883 Ga0105241_10556257 3300009174 Bacteria 1031
884 Ga0105241_10790393 3300009174 Bacteria 873
885 Ga0105241_11016467 3300009174 Bacteria 776
886 Ga0105241_11180208 3300009174 Bacteria 724
887 Ga0105241_11363231 3300009174 Bacteria 678
888 Ga0105241_11528978 3300009174 Unclassified 643
889 Ga0105241_11778277 3300009174 Unclassified 601
890 Ga0105241_12103060 3300009174 Unclassified 558
891 Ga0105241_12346680 3300009174 Unclassified 532
892 Ga0105241_12620463 3300009174 Unclassified 507
893 Ga0105242_10001940 3300009176 Bacteria 16279
894 Ga0105242_10003416 3300009176 Bacteria 12345
895 Ga0105242_10023865 3300009176 Bacteria 4825
896 Ga0105242_10193462 3300009176 Bacteria 1802
897 Ga0105242_10267964 3300009176 Bacteria 1546
898 Ga0105242_10324552 3300009176 Bacteria 1413
899 Ga0105242_10501358 3300009176 Bacteria 1155
900 Ga0105242_10563574 3300009176 Unclassified 1094
901 Ga0105242_10611128 3300009176 Unclassified 1054
902 Ga0105242_11116658 3300009176 Unclassified 803
903 Ga0105242_11803605 3300009176 Bacteria 650
904 Ga0105242_12486481 3300009176 Bacteria 566
905 Ga0105242_12856817 3300009176 Unclassified 533
906 Ga0105242_12890740 3300009176 Bacteria 531
907 Ga0105242_13320051 3300009176 Bacteria 500
908 Ga0105248_10063416 3300009177 Bacteria 4148
909 Ga0105248_10142812 3300009177 Bacteria 2701
910 Ga0105248_10189239 3300009177 Bacteria 2319
911 Ga0105248_10205686 3300009177 Bacteria 2218
912 Ga0105248_10259586 3300009177 Bacteria 1956
913 Ga0105248_10342663 3300009177 Bacteria 1682
914 Ga0105248_10428479 3300009177 Bacteria 1490
915 Ga0105248_10494319 3300009177 Bacteria 1379
916 Ga0105248_10752247 3300009177 Unclassified 1100
917 Ga0105248_10917125 3300009177 Bacteria 989
918 Ga0105248_11013184 3300009177 Bacteria 938
919 Ga0105248_11222115 3300009177 Bacteria 850
920 Ga0105248_11279471 3300009177 Bacteria 830
921 Ga0105248_11459581 3300009177 Unclassified 774
922 Ga0105248_12365989 3300009177 Unclassified 605
923 Ga0105248_12798188 3300009177 Unclassified 556
924 Ga0105237_10015988 3300009545 Bacteria 7802
925 Ga0105237_10117393 3300009545 Bacteria 2655
926 Ga0105237_10224210 3300009545 Bacteria 1880
927 Ga0105237_10413567 3300009545 Bacteria 1354
928 Ga0105237_10539185 3300009545 Bacteria 1173
929 Ga0105237_12090708 3300009545 Unclassified 575
930 Ga0105238_10034314 3300009551 Bacteria 5162
931 Ga0105238_10096786 3300009551 Bacteria 2937
932 Ga0105238_10683083 3300009551 Bacteria 1038
933 Ga0105238_12951574 3300009551 Unclassified 511
934 Ga0105249_10000118 3300009553 Bacteria 107887
935 Ga0105249_10005579 3300009553 Bacteria 10881
936 Ga0105249_10007338 3300009553 Bacteria 9611
937 Ga0105249_10066325 3300009553 Bacteria 3323
938 Ga0105249_10119423 3300009553 Bacteria 2504
939 Ga0105249_10299720 3300009553 Bacteria 1612
940 Ga0105249_10810991 3300009553 Unclassified 1000
941 Ga0105249_11164383 3300009553 Bacteria 842
942 Ga0105249_11324100 3300009553 Bacteria 792
943 Ga0105249_11734207 3300009553 Unclassified 697
944 Ga0105249_12809395 3300009553 Unclassified 558
945 Ga0105249_13551597 3300009553 Unclassified 502
946 Ga0099796_10179442 3300010159 Unclassified 849
947 Ga0099796_10322819 3300010159 Unclassified 659
948 Ga0105239_10074765 3300010375 Bacteria 3725
949 Ga0105239_10079201 3300010375 Bacteria 3616
950 Ga0105239_10346913 3300010375 Bacteria 1676
951 Ga0105239_10429857 3300010375 Bacteria 1497
952 Ga0105239_10557741 3300010375 Bacteria 1305
953 Ga0105239_10808154 3300010375 Unclassified 1074
954 Ga0105239_11160423 3300010375 Bacteria 890
955 Ga0105239_11879713 3300010375 Unclassified 694
956 Ga0105239_12340378 3300010375 Unclassified 622
957 Ga0105239_13467200 3300010375 Unclassified 513
958 Ga0105246_10171231 3300011119 Bacteria 1663
959 Ga0105246_10404402 3300011119 Bacteria 1135
960 Ga0105246_10481177 3300011119 Unclassified 1050
961 Ga0105246_11717863 3300011119 Unclassified 597
962 Ga0105246_11915561 3300011119 Unclassified 570
963 Ga0157346_1020038 3300012480 Bacteria 576
964 Ga0157315_1048965 3300012508 Unclassified 561
965 Ga0157373_10049467 3300013100 Bacteria 2996
966 Ga0157373_10062147 3300013100 Bacteria 2645
967 Ga0157373_10110780 3300013100 Bacteria 1930
968 Ga0157373_10272521 3300013100 Bacteria 1198
969 Ga0157373_10485861 3300013100 Bacteria 891
970 Ga0157373_10663822 3300013100 Bacteria 762
971 Ga0157373_10796465 3300013100 Unclassified 697
972 Ga0157373_11184393 3300013100 Unclassified 575
973 Ga0157371_10686847 3300013102 Unclassified 766
974 Ga0157371_10714477 3300013102 Bacteria 751
975 Ga0157371_10873586 3300013102 Unclassified 681
976 Ga0157370_11676311 3300013104 Bacteria 571
977 Ga0157369_11029923 3300013105 Bacteria 842
978 Ga0157374_10286428 3300013296 Bacteria 1627
979 Ga0157374_10449751 3300013296 Bacteria 1289
980 Ga0157374_10461365 3300013296 Bacteria 1272
981 Ga0157374_10539300 3300013296 Bacteria 1174
982 Ga0157374_11946103 3300013296 Unclassified 614
983 Ga0157378_10006521 3300013297 Bacteria 10202
984 Ga0157378_10008509 3300013297 Bacteria 8930
985 Ga0157378_10009044 3300013297 Bacteria 8668
986 Ga0157378_10009557 3300013297 Bacteria 8445
987 Ga0157378_10023296 3300013297 Bacteria 5449
988 Ga0157378_10088639 3300013297 Bacteria 2808
989 Ga0157378_10117153 3300013297 Bacteria 2450
990 Ga0157378_10134416 3300013297 Bacteria 2292
991 Ga0157378_10182389 3300013297 Bacteria 1975
992 Ga0157378_10244650 3300013297 Bacteria 1715
993 Ga0157378_10313696 3300013297 Bacteria 1522
994 Ga0157378_10335206 3300013297 Bacteria 1473
995 Ga0157378_10343492 3300013297 Unclassified 1456
996 Ga0157378_10348973 3300013297 Bacteria 1445
997 Ga0157378_10372610 3300013297 Unclassified 1400
998 Ga0157378_10561126 3300013297 Bacteria 1148
999 Ga0157378_10577010 3300013297 Unclassified 1133
1000 Ga0157378_10601955 3300013297 Bacteria 1110
1001 Ga0157378_10616037 3300013297 Bacteria 1098
1002 Ga0157378_10791456 3300013297 Bacteria 973
1003 Ga0157378_11248303 3300013297 Unclassified 783
1004 Ga0157378_11979366 3300013297 Unclassified 632
1005 Ga0157378_11985322 3300013297 Unclassified 631
1006 Ga0157378_12110352 3300013297 Bacteria 614
1007 Ga0157378_12464335 3300013297 Unclassified 572
1008 Ga0157378_12621650 3300013297 Bacteria 556
1009 Ga0157378_12928672 3300013297 Bacteria 529
1010 Ga0163162_10000059 3300013306 Bacteria 107864
1011 Ga0163162_10017503 3300013306 Bacteria 7011
1012 Ga0163162_10047675 3300013306 Bacteria 4294
1013 Ga0163162_10097605 3300013306 Bacteria 3027
1014 Ga0163162_10104208 3300013306 Bacteria 2931
1015 Ga0163162_10134662 3300013306 Bacteria 2581
1016 Ga0163162_10262547 3300013306 Bacteria 1858
1017 Ga0163162_10512522 3300013306 Bacteria 1329
1018 Ga0163162_10535545 3300013306 Bacteria 1300
1019 Ga0163162_10565830 3300013306 Bacteria 1264
1020 Ga0163162_10567515 3300013306 Bacteria 1262
1021 Ga0163162_10863799 3300013306 Bacteria 1019
1022 Ga0163162_11454992 3300013306 Bacteria 780
1023 Ga0163162_12119070 3300013306 Bacteria 645
1024 Ga0163162_12164865 3300013306 Bacteria 638
1025 Ga0163162_12817318 3300013306 Bacteria 560
1026 Ga0163162_13230623 3300013306 Unclassified 523
1027 Ga0157372_10028946 3300013307 Bacteria 6045
1028 Ga0157372_10471707 3300013307 Bacteria 1463
1029 Ga0157372_10700260 3300013307 Bacteria 1179
1030 Ga0157372_10945849 3300013307 Unclassified 999
1031 Ga0157372_11190883 3300013307 Unclassified 880
1032 Ga0157372_11474478 3300013307 Unclassified 784
1033 Ga0157372_11963358 3300013307 Unclassified 673
1034 Ga0157372_12158961 3300013307 Bacteria 640
1035 Ga0157372_12900828 3300013307 Unclassified 549
1036 Ga0157375_10060122 3300013308 Bacteria 3767
1037 Ga0157375_10090937 3300013308 Bacteria 3112
1038 Ga0157375_10141175 3300013308 Bacteria 2536
1039 Ga0157375_10227164 3300013308 Bacteria 2025
1040 Ga0157375_10287318 3300013308 Bacteria 1808
1041 Ga0157375_10553815 3300013308 Bacteria 1312
1042 Ga0157375_10791890 3300013308 Bacteria 1097
1043 Ga0157375_10813791 3300013308 Bacteria 1082
1044 Ga0157375_11131645 3300013308 Bacteria 917
1045 Ga0157375_11228589 3300013308 Unclassified 880
1046 Ga0157375_11437988 3300013308 Unclassified 813
1047 Ga0157375_11970053 3300013308 Unclassified 694
1048 Ga0157375_12470468 3300013308 Bacteria 620
1049 Ga0157375_13186531 3300013308 Unclassified 547
1050 Ga0157375_13635253 3300013308 Unclassified 513
1051 Ga0163163_10028059 3300014325 Bacteria 5400
1052 Ga0163163_10034085 3300014325 Bacteria 4928
1053 Ga0163163_10084072 3300014325 Bacteria 3188
1054 Ga0163163_10087671 3300014325 Bacteria 3123
1055 Ga0163163_10107898 3300014325 Bacteria 2811
1056 Ga0163163_10115847 3300014325 Bacteria 2711
1057 Ga0163163_10133067 3300014325 Bacteria 2527
1058 Ga0163163_10396663 3300014325 Bacteria 1438
1059 Ga0163163_10453527 3300014325 Bacteria 1342
1060 Ga0163163_10489008 3300014325 Unclassified 1292
1061 Ga0163163_11059868 3300014325 Bacteria 874
1062 Ga0163163_11724562 3300014325 Unclassified 687
1063 Ga0163163_11739402 3300014325 Unclassified 684
1064 Ga0163163_12081908 3300014325 Bacteria 627
1065 Ga0163163_13276132 3300014325 Unclassified 505
1066 Ga0157380_10000784 3300014326 Bacteria 19929
1067 Ga0157380_10020962 3300014326 Bacteria 4896
1068 Ga0157380_10039316 3300014326 Bacteria 3678
1069 Ga0157380_10041565 3300014326 Bacteria 3588
1070 Ga0157380_10075491 3300014326 Bacteria 2740
1071 Ga0157380_10141550 3300014326 Unclassified 2067
1072 Ga0157380_10242240 3300014326 Bacteria 1627
1073 Ga0157380_10344628 3300014326 Bacteria 1391
1074 Ga0157380_10403825 3300014326 Bacteria 1297
1075 Ga0157380_10497201 3300014326 Bacteria 1184
1076 Ga0157380_10975247 3300014326 Bacteria 879
1077 Ga0157380_11301725 3300014326 Bacteria 774
1078 Ga0157380_11383809 3300014326 Unclassified 753
1079 Ga0157380_11678509 3300014326 Unclassified 692
1080 Ga0157380_13507643 3300014326 Bacteria 502
1081 Ga0157377_10006911 3300014745 Bacteria 5444
1082 Ga0157377_10349998 3300014745 Unclassified 991
1083 Ga0157377_10416899 3300014745 Unclassified 918
1084 Ga0157377_10460258 3300014745 Bacteria 880
1085 Ga0157377_10534045 3300014745 Unclassified 826
1086 Ga0157377_10814219 3300014745 Bacteria 690
1087 Ga0157377_11051377 3300014745 Unclassified 620
1088 Ga0157379_10098160 3300014968 Bacteria 2630
1089 Ga0157379_10231894 3300014968 Bacteria 1673
1090 Ga0157379_10284610 3300014968 Bacteria 1505
1091 Ga0157379_10320606 3300014968 Bacteria 1415
1092 Ga0157379_10612017 3300014968 Bacteria 1017
1093 Ga0157379_10844831 3300014968 Bacteria 866
1094 Ga0157379_10948027 3300014968 Unclassified 818
1095 Ga0157376_10008779 3300014969 Bacteria 7310
1096 Ga0157376_10132834 3300014969 Bacteria 2224
1097 Ga0157376_10300589 3300014969 Bacteria 1519
1098 Ga0157376_10305313 3300014969 Bacteria 1508
1099 Ga0157376_12071863 3300014969 Unclassified 607
1100 Ga0157376_12286583 3300014969 Unclassified 580
1101 Ga0182007_10060218 3300015262 Bacteria 1245
1102 Ga0182007_10301428 3300015262 Unclassified 589
1103 Ga0182005_1044333 3300015265 Bacteria 1209
1104 Ga0163161_10015560 3300017792 Bacteria 5304
1105 Ga0163161_10034538 3300017792 Bacteria 3618
1106 Ga0163161_10131529 3300017792 Bacteria 1888
1107 Ga0163161_10188036 3300017792 Unclassified 1586
1108 Ga0163161_10486302 3300017792 Bacteria 1003
1109 Ga0213874_10245778 3300021377 Bacteria 658
1110 Ga0213876_10001455 3300021384 Bacteria 14730
1111 Ga0213876_10019489 3300021384 Bacteria 3583
1112 Ga0213876_10259704 3300021384 Bacteria 923
1113 Ga0213875_10598444 3300021388 Unclassified 533
1114 Ga0207672_1000732 3300025223 Bacteria 3653
1115 Ga0207697_10096946 3300025315 Unclassified 1254
1116 Ga0207697_10463083 3300025315 Unclassified 561
1117 Ga0207656_10004238 3300025321 Bacteria 4994
1118 Ga0207713_1104157 3300025735 Bacteria 974
1119 Ga0207653_10010210 3300025885 Bacteria 2929
1120 Ga0207653_10021838 3300025885 Bacteria 2031
1121 Ga0207653_10030903 3300025885 Bacteria 1729
1122 Ga0207682_10019816 3300025893 Bacteria 2636
1123 Ga0207682_10112599 3300025893 Bacteria 1199
1124 Ga0207642_10040455 3300025899 Bacteria 2034
1125 Ga0207642_10090088 3300025899 Bacteria 1513
1126 Ga0207642_10187384 3300025899 Bacteria 1132
1127 Ga0207642_10555414 3300025899 Unclassified 710
1128 Ga0207710_10000004 3300025900 Bacteria 846540
1129 Ga0207710_10005253 3300025900 Bacteria 5595
1130 Ga0207710_10153107 3300025900 Bacteria 1119
1131 Ga0207710_10240487 3300025900 Bacteria 903
1132 Ga0207688_10370842 3300025901 Unclassified 884
1133 Ga0207688_10746078 3300025901 Unclassified 620
1134 Ga0207680_10228541 3300025903 Bacteria 1278
1135 Ga0207680_10682353 3300025903 Unclassified 736
1136 Ga0207647_10032321 3300025904 Bacteria 3364
1137 Ga0207647_10131474 3300025904 Bacteria 1471
1138 Ga0207647_10133636 3300025904 Bacteria 1457
1139 Ga0207647_10502783 3300025904 Bacteria 676
1140 Ga0207685_10000051 3300025905 Bacteria 39503
1141 Ga0207685_10074301 3300025905 Bacteria 1387
1142 Ga0207685_10727696 3300025905 Bacteria 542
1143 Ga0207699_10655954 3300025906 Bacteria 766
1144 Ga0207699_10765779 3300025906 Bacteria 709
1145 Ga0207645_10019493 3300025907 Bacteria 4446
1146 Ga0207645_10040599 3300025907 Bacteria 2980
1147 Ga0207645_10599845 3300025907 Unclassified 748
1148 Ga0207645_10604716 3300025907 Bacteria 744
1149 Ga0207645_10929687 3300025907 Bacteria 590
1150 Ga0207643_10001463 3300025908 Bacteria 13548
1151 Ga0207643_10120477 3300025908 Bacteria 1554
1152 Ga0207643_10155951 3300025908 Bacteria 1371
1153 Ga0207643_10228435 3300025908 Bacteria 1141
1154 Ga0207684_10001576 3300025910 Bacteria 24324
1155 Ga0207684_10009774 3300025910 Bacteria 8461
1156 Ga0207684_10011946 3300025910 Bacteria 7564
1157 Ga0207684_10028709 3300025910 Bacteria 4739
1158 Ga0207684_10032500 3300025910 Bacteria 4437
1159 Ga0207684_10103326 3300025910 Bacteria 2436
1160 Ga0207684_10264222 3300025910 Bacteria 1485
1161 Ga0207684_10292789 3300025910 Bacteria 1404
1162 Ga0207684_10346730 3300025910 Bacteria 1278
1163 Ga0207684_10424294 3300025910 Bacteria 1142
1164 Ga0207684_10475054 3300025910 Bacteria 1072
1165 Ga0207684_10914896 3300025910 Bacteria 737
1166 Ga0207684_10929290 3300025910 Bacteria 730
1167 Ga0207684_11398830 3300025910 Unclassified 573
1168 Ga0207654_10028896 3300025911 Bacteria 3027
1169 Ga0207654_10112142 3300025911 Bacteria 1699
1170 Ga0207654_10286388 3300025911 Bacteria 1116
1171 Ga0207654_10297976 3300025911 Bacteria 1096
1172 Ga0207654_10473052 3300025911 Unclassified 882
1173 Ga0207654_10510899 3300025911 Bacteria 850
1174 Ga0207654_10871758 3300025911 Unclassified 652
1175 Ga0207654_10902011 3300025911 Bacteria 641
1176 Ga0207654_11054608 3300025911 Unclassified 592
1177 Ga0207654_11066905 3300025911 Bacteria 588
1178 Ga0207707_10000097 3300025912 Bacteria 88081
1179 Ga0207707_10028834 3300025912 Bacteria 4851
1180 Ga0207707_10041693 3300025912 Bacteria 4008
1181 Ga0207707_10117269 3300025912 Bacteria 2327
1182 Ga0207707_10950893 3300025912 Bacteria 708
1183 Ga0207707_11080120 3300025912 Bacteria 655
1184 Ga0207695_10166217 3300025913 Bacteria 2134
1185 Ga0207695_10332221 3300025913 Bacteria 1408
1186 Ga0207695_11614781 3300025913 Unclassified 529
1187 Ga0207671_10019270 3300025914 Bacteria 5220
1188 Ga0207671_10036459 3300025914 Bacteria 3647
1189 Ga0207671_10553773 3300025914 Unclassified 917
1190 Ga0207671_10669843 3300025914 Bacteria 826
1191 Ga0207663_10495641 3300025916 Bacteria 948
1192 Ga0207663_11057297 3300025916 Bacteria 652
1193 Ga0207660_10008137 3300025917 Bacteria 6784
1194 Ga0207660_10030363 3300025917 Bacteria 3715
1195 Ga0207660_10251308 3300025917 Unclassified 1395
1196 Ga0207660_10346871 3300025917 Bacteria 1189
1197 Ga0207660_10528865 3300025917 Bacteria 958
1198 Ga0207660_10960997 3300025917 Bacteria 697
1199 Ga0207662_10001023 3300025918 Bacteria 13097
1200 Ga0207662_10001888 3300025918 Bacteria 10324
1201 Ga0207662_10057188 3300025918 Bacteria 2330
1202 Ga0207662_10078446 3300025918 Bacteria 2010
1203 Ga0207662_10094156 3300025918 Bacteria 1847
1204 Ga0207662_10107236 3300025918 Unclassified 1738
1205 Ga0207662_10158027 3300025918 Bacteria 1446
1206 Ga0207662_10180322 3300025918 Bacteria 1359
1207 Ga0207662_10413985 3300025918 Bacteria 916
1208 Ga0207662_10613485 3300025918 Bacteria 758
1209 Ga0207662_11313509 3300025918 Unclassified 514
1210 Ga0207657_10057692 3300025919 Bacteria 3345
1211 Ga0207657_10891732 3300025919 Bacteria 685
1212 Ga0207649_10040758 3300025920 Bacteria 2825
1213 Ga0207649_10402090 3300025920 Bacteria 1025
1214 Ga0207649_10627353 3300025920 Unclassified 829
1215 Ga0207649_10833981 3300025920 Unclassified 721
1216 Ga0207652_10000229 3300025921 Bacteria 58696
1217 Ga0207652_10009158 3300025921 Bacteria 7968
1218 Ga0207652_10125623 3300025921 Bacteria 2284
1219 Ga0207652_10473383 3300025921 Bacteria 1128
1220 Ga0207646_10002486 3300025922 Bacteria 21767
1221 Ga0207646_10023037 3300025922 Bacteria 5726
1222 Ga0207646_10044831 3300025922 Bacteria 3969
1223 Ga0207646_10101585 3300025922 Bacteria 2578
1224 Ga0207646_10132369 3300025922 Bacteria 2245
1225 Ga0207646_10138084 3300025922 Bacteria 2195
1226 Ga0207646_10382789 3300025922 Bacteria 1271
1227 Ga0207646_10840649 3300025922 Bacteria 816
1228 Ga0207646_11424911 3300025922 Bacteria 602
1229 Ga0207646_11636817 3300025922 Unclassified 554
1230 Ga0207681_10012129 3300025923 Bacteria 5312
1231 Ga0207681_10049116 3300025923 Bacteria 2850
1232 Ga0207681_10080448 3300025923 Bacteria 2298
1233 Ga0207681_10097490 3300025923 Bacteria 2113
1234 Ga0207681_10485491 3300025923 Unclassified 1010
1235 Ga0207681_10659263 3300025923 Unclassified 868
1236 Ga0207681_10961064 3300025923 Bacteria 716
1237 Ga0207694_10065782 3300025924 Bacteria 2827
1238 Ga0207694_10148212 3300025924 Bacteria 1890
1239 Ga0207694_11758427 3300025924 Unclassified 521
1240 Ga0207650_10000143 3300025925 Bacteria 87521
1241 Ga0207650_10001512 3300025925 Bacteria 16613
1242 Ga0207650_10299042 3300025925 Bacteria 1314
1243 Ga0207650_10437082 3300025925 Bacteria 1087
1244 Ga0207650_10627245 3300025925 Bacteria 905
1245 Ga0207650_10838155 3300025925 Unclassified 780
1246 Ga0207650_11560237 3300025925 Bacteria 561
1247 Ga0207650_11693567 3300025925 Unclassified 536
1248 Ga0207650_11769361 3300025925 Unclassified 523
1249 Ga0207659_10069720 3300025926 Bacteria 2562
1250 Ga0207659_10434449 3300025926 Bacteria 1103
1251 Ga0207659_10974991 3300025926 Unclassified 729
1252 Ga0207659_11062399 3300025926 Bacteria 697
1253 Ga0207659_11416982 3300025926 Unclassified 595
1254 Ga0207659_11422803 3300025926 Unclassified 594
1255 Ga0207687_10035123 3300025927 Bacteria 3409
1256 Ga0207687_10310075 3300025927 Bacteria 1274
1257 Ga0207687_10638570 3300025927 Bacteria 900
1258 Ga0207687_11186296 3300025927 Bacteria 656
1259 Ga0207664_10413394 3300025929 Bacteria 1201
1260 Ga0207644_10000414 3300025931 Bacteria 27902
1261 Ga0207644_10038017 3300025931 Bacteria 3388
1262 Ga0207644_10048465 3300025931 Bacteria 3038
1263 Ga0207644_10151989 3300025931 Bacteria 1792
1264 Ga0207644_11022874 3300025931 Unclassified 694
1265 Ga0207644_11419336 3300025931 Unclassified 583
1266 Ga0207644_11521299 3300025931 Unclassified 562
1267 Ga0207690_10087154 3300025932 Bacteria 2196
1268 Ga0207690_11103149 3300025932 Unclassified 661
1269 Ga0207690_11843290 3300025932 Bacteria 505
1270 Ga0207706_10141080 3300025933 Bacteria 2120
1271 Ga0207706_10168409 3300025933 Bacteria 1925
1272 Ga0207706_10334727 3300025933 Bacteria 1317
1273 Ga0207686_10000005 3300025934 Bacteria 260873
1274 Ga0207686_10001337 3300025934 Bacteria 14036
1275 Ga0207686_10004022 3300025934 Bacteria 7888
1276 Ga0207686_10036664 3300025934 Bacteria 2953
1277 Ga0207686_10046114 3300025934 Bacteria 2686
1278 Ga0207686_10212527 3300025934 Bacteria 1391
1279 Ga0207686_10224291 3300025934 Bacteria 1359
1280 Ga0207686_10228095 3300025934 Unclassified 1349
1281 Ga0207686_10402688 3300025934 Bacteria 1043
1282 Ga0207686_10479070 3300025934 Bacteria 962
1283 Ga0207686_10847112 3300025934 Unclassified 735
1284 Ga0207709_10000133 3300025935 Bacteria 108698
1285 Ga0207709_10009116 3300025935 Bacteria 5469
1286 Ga0207709_10009548 3300025935 Bacteria 5339
1287 Ga0207709_10082566 3300025935 Bacteria 2075
1288 Ga0207709_10086195 3300025935 Bacteria 2038
1289 Ga0207709_10233961 3300025935 Bacteria 1332
1290 Ga0207709_10235950 3300025935 Bacteria 1328
1291 Ga0207709_10304751 3300025935 Bacteria 1186
1292 Ga0207709_10596701 3300025935 Bacteria 874
1293 Ga0207709_10815540 3300025935 Bacteria 754
1294 Ga0207709_11443800 3300025935 Unclassified 570
1295 Ga0207709_11772409 3300025935 Unclassified 513
1296 Ga0207670_10000655 3300025936 Bacteria 18353
1297 Ga0207670_10065773 3300025936 Bacteria 2489
1298 Ga0207670_10071941 3300025936 Bacteria 2393
1299 Ga0207670_10250911 3300025936 Bacteria 1367
1300 Ga0207670_10503991 3300025936 Bacteria 983
1301 Ga0207670_10634173 3300025936 Bacteria 880
1302 Ga0207670_10676640 3300025936 Bacteria 853
1303 Ga0207670_10728938 3300025936 Bacteria 822
1304 Ga0207670_10832350 3300025936 Unclassified 770
1305 Ga0207670_10999727 3300025936 Unclassified 704
1306 Ga0207670_11945917 3300025936 Unclassified 500
1307 Ga0207669_10097537 3300025937 Unclassified 1933
1308 Ga0207669_10138007 3300025937 Bacteria 1688
1309 Ga0207669_10769692 3300025937 Unclassified 796
1310 Ga0207704_10045945 3300025938 Bacteria 2598
1311 Ga0207704_10117896 3300025938 Bacteria 1809
1312 Ga0207704_10245243 3300025938 Bacteria 1341
1313 Ga0207704_10260205 3300025938 Bacteria 1308
1314 Ga0207704_10461368 3300025938 Unclassified 1016
1315 Ga0207704_10518962 3300025938 Unclassified 963
1316 Ga0207704_10574218 3300025938 Unclassified 919
1317 Ga0207704_11164801 3300025938 Unclassified 656
1318 Ga0207704_11471115 3300025938 Unclassified 584
1319 Ga0207665_10000005 3300025939 Bacteria 194919
1320 Ga0207665_10064327 3300025939 Bacteria 2492
1321 Ga0207665_10239173 3300025939 Bacteria 1337
1322 Ga0207665_10734644 3300025939 Unclassified 777
1323 Ga0207665_11663330 3300025939 Unclassified 506
1324 Ga0207665_11674141 3300025939 Unclassified 504
1325 Ga0207691_10005231 3300025940 Bacteria 12520
1326 Ga0207691_10367087 3300025940 Bacteria 1230
1327 Ga0207691_10748001 3300025940 Unclassified 823
1328 Ga0207691_10867593 3300025940 Bacteria 756
1329 Ga0207711_10030109 3300025941 Bacteria 4578
1330 Ga0207711_10047901 3300025941 Bacteria 3656
1331 Ga0207711_10077453 3300025941 Bacteria 2898
1332 Ga0207711_10213085 3300025941 Unclassified 1765
1333 Ga0207711_10319224 3300025941 Bacteria 1435
1334 Ga0207711_10321516 3300025941 Bacteria 1430
1335 Ga0207711_10791620 3300025941 Bacteria 883
1336 Ga0207711_11551026 3300025941 Unclassified 606
1337 Ga0207711_12013969 3300025941 Unclassified 520
1338 Ga0207689_10004453 3300025942 Bacteria 12701
1339 Ga0207689_10034388 3300025942 Bacteria 4210
1340 Ga0207689_10038109 3300025942 Bacteria 3982
1341 Ga0207689_10045310 3300025942 Bacteria 3638
1342 Ga0207689_10056760 3300025942 Bacteria 3222
1343 Ga0207689_10089297 3300025942 Bacteria 2531
1344 Ga0207689_10114137 3300025942 Bacteria 2220
1345 Ga0207689_10165668 3300025942 Bacteria 1821
1346 Ga0207689_10168543 3300025942 Unclassified 1804
1347 Ga0207689_10169065 3300025942 Bacteria 1802
1348 Ga0207689_10267048 3300025942 Bacteria 1416
1349 Ga0207689_10304614 3300025942 Bacteria 1321
1350 Ga0207689_10357706 3300025942 Bacteria 1214
1351 Ga0207689_10532838 3300025942 Unclassified 985
1352 Ga0207689_10762423 3300025942 Unclassified 817
1353 Ga0207689_10934785 3300025942 Unclassified 732
1354 Ga0207689_11566187 3300025942 Unclassified 549
1355 Ga0207679_10020056 3300025945 Bacteria 4506
1356 Ga0207679_10070497 3300025945 Bacteria 2634
1357 Ga0207679_10099817 3300025945 Bacteria 2267
1358 Ga0207679_10299791 3300025945 Bacteria 1385
1359 Ga0207679_10358507 3300025945 Bacteria 1273
1360 Ga0207679_10364104 3300025945 Unclassified 1263
1361 Ga0207679_12006421 3300025945 Bacteria 527
1362 Ga0207667_10213925 3300025949 Bacteria 1975
1363 Ga0207667_10522271 3300025949 Bacteria 1203
1364 Ga0207651_10097491 3300025960 Bacteria 2171
1365 Ga0207651_10119712 3300025960 Bacteria 1994
1366 Ga0207651_10143242 3300025960 Bacteria 1849
1367 Ga0207651_10241653 3300025960 Bacteria 1472
1368 Ga0207651_10244025 3300025960 Bacteria 1466
1369 Ga0207651_10308934 3300025960 Bacteria 1318
1370 Ga0207651_10611332 3300025960 Bacteria 954
1371 Ga0207651_10883393 3300025960 Unclassified 795
1372 Ga0207651_10923646 3300025960 Bacteria 778
1373 Ga0207651_11656669 3300025960 Unclassified 576
1374 Ga0207712_10000709 3300025961 Bacteria 25746
1375 Ga0207712_10006712 3300025961 Bacteria 7257
1376 Ga0207712_10036610 3300025961 Bacteria 3344
1377 Ga0207712_10064684 3300025961 Bacteria 2609
1378 Ga0207712_10182336 3300025961 Bacteria 1650
1379 Ga0207712_10233580 3300025961 Bacteria 1478
1380 Ga0207712_10528507 3300025961 Bacteria 1012
1381 Ga0207668_10595235 3300025972 Unclassified 963
1382 Ga0207640_10075108 3300025981 Bacteria 2289
1383 Ga0207640_10189042 3300025981 Bacteria 1551
1384 Ga0207640_10331482 3300025981 Unclassified 1216
1385 Ga0207640_10333124 3300025981 Bacteria 1213
1386 Ga0207640_10497747 3300025981 Bacteria 1014
1387 Ga0207640_10649509 3300025981 Bacteria 899
1388 Ga0207640_10677691 3300025981 Bacteria 881
1389 Ga0207640_10886370 3300025981 Bacteria 778
1390 Ga0207640_10970501 3300025981 Bacteria 746
1391 Ga0207640_11212486 3300025981 Bacteria 671
1392 Ga0207640_11338489 3300025981 Unclassified 640
1393 Ga0207658_10172113 3300025986 Bacteria 1785
1394 Ga0207658_10479586 3300025986 Bacteria 1105
1395 Ga0207658_10616406 3300025986 Bacteria 976
1396 Ga0207677_10048300 3300026023 Bacteria 2865
1397 Ga0207677_10230178 3300026023 Unclassified 1492
1398 Ga0207677_10255277 3300026023 Unclassified 1426
1399 Ga0207677_10532806 3300026023 Bacteria 1021
1400 Ga0207677_10593868 3300026023 Unclassified 971
1401 Ga0207677_10665468 3300026023 Bacteria 920
1402 Ga0207677_11348132 3300026023 Unclassified 656
1403 Ga0207677_11468212 3300026023 Unclassified 629
1404 Ga0207677_11854491 3300026023 Unclassified 560
1405 Ga0207703_10001442 3300026035 Bacteria 21704
1406 Ga0207703_10024704 3300026035 Bacteria 4728
1407 Ga0207703_10098716 3300026035 Bacteria 2470
1408 Ga0207703_10108392 3300026035 Unclassified 2366
1409 Ga0207703_10223792 3300026035 Bacteria 1684
1410 Ga0207703_10263653 3300026035 Bacteria 1558
1411 Ga0207703_10364869 3300026035 Unclassified 1333
1412 Ga0207703_10447180 3300026035 Bacteria 1206
1413 Ga0207703_10475577 3300026035 Unclassified 1170
1414 Ga0207703_10493289 3300026035 Bacteria 1149
1415 Ga0207703_10784195 3300026035 Bacteria 909
1416 Ga0207703_11810199 3300026035 Unclassified 587
1417 Ga0207703_12165948 3300026035 Unclassified 532
1418 Ga0207703_12249400 3300026035 Unclassified 521
1419 Ga0207639_10148801 3300026041 Bacteria 1959
1420 Ga0207639_10151226 3300026041 Bacteria 1944
1421 Ga0207639_10920515 3300026041 Unclassified 817
1422 Ga0207639_11768390 3300026041 Unclassified 579
1423 Ga0207678_10425790 3300026067 Bacteria 1151
1424 Ga0207708_10000254 3300026075 Bacteria 42011
1425 Ga0207708_10003758 3300026075 Bacteria 11187
1426 Ga0207708_10020157 3300026075 Bacteria 5028
1427 Ga0207708_10020580 3300026075 Bacteria 4976
1428 Ga0207708_10050983 3300026075 Bacteria 3150
1429 Ga0207708_10067820 3300026075 Bacteria 2730
1430 Ga0207708_10086377 3300026075 Bacteria 2414
1431 Ga0207708_10164920 3300026075 Bacteria 1751
1432 Ga0207708_10358667 3300026075 Unclassified 1198
1433 Ga0207708_10717319 3300026075 Bacteria 856
1434 Ga0207708_10877237 3300026075 Unclassified 776
1435 Ga0207708_11307198 3300026075 Bacteria 635
1436 Ga0207708_11436981 3300026075 Unclassified 605
1437 Ga0207708_11627978 3300026075 Unclassified 567
1438 Ga0207702_10058499 3300026078 Bacteria 3280
1439 Ga0207702_11052081 3300026078 Bacteria 808
1440 Ga0207641_10045020 3300026088 Bacteria 3713
1441 Ga0207641_10254818 3300026088 Bacteria 1640
1442 Ga0207641_10260522 3300026088 Bacteria 1623
1443 Ga0207641_10393126 3300026088 Unclassified 1330
1444 Ga0207641_10611742 3300026088 Unclassified 1068
1445 Ga0207641_10665221 3300026088 Bacteria 1024
1446 Ga0207641_10699316 3300026088 Unclassified 998
1447 Ga0207641_11062361 3300026088 Unclassified 808
1448 Ga0207641_11485377 3300026088 Unclassified 679
1449 Ga0207641_11860630 3300026088 Bacteria 603
1450 Ga0207641_11923229 3300026088 Bacteria 593
1451 Ga0207641_12028279 3300026088 Bacteria 576
1452 Ga0207648_10008477 3300026089 Bacteria 9947
1453 Ga0207648_10130461 3300026089 Bacteria 2212
1454 Ga0207648_10140765 3300026089 Bacteria 2126
1455 Ga0207648_10145661 3300026089 Bacteria 2089
1456 Ga0207648_10229619 3300026089 Bacteria 1651
1457 Ga0207648_10396205 3300026089 Bacteria 1250
1458 Ga0207648_10554882 3300026089 Bacteria 1055
1459 Ga0207648_10571881 3300026089 Bacteria 1040
1460 Ga0207648_10756161 3300026089 Bacteria 903
1461 Ga0207648_10762778 3300026089 Bacteria 899
1462 Ga0207648_10770535 3300026089 Bacteria 894
1463 Ga0207648_10953983 3300026089 Bacteria 802
1464 Ga0207648_11127051 3300026089 Bacteria 736
1465 Ga0207648_12177502 3300026089 Unclassified 515
1466 Ga0207676_10008932 3300026095 Bacteria 7130
1467 Ga0207676_10025502 3300026095 Bacteria 4386
1468 Ga0207676_10078274 3300026095 Bacteria 2678
1469 Ga0207676_10080799 3300026095 Bacteria 2639
1470 Ga0207676_10104354 3300026095 Bacteria 2357
1471 Ga0207676_10148375 3300026095 Bacteria 2017
1472 Ga0207676_10188091 3300026095 Bacteria 1814
1473 Ga0207676_10194004 3300026095 Unclassified 1789
1474 Ga0207676_10240235 3300026095 Bacteria 1625
1475 Ga0207676_10344667 3300026095 Bacteria 1376
1476 Ga0207676_10354909 3300026095 Bacteria 1357
1477 Ga0207676_10658089 3300026095 Bacteria 1011
1478 Ga0207676_10911153 3300026095 Bacteria 863
1479 Ga0207676_11613906 3300026095 Bacteria 646
1480 Ga0207676_12368134 3300026095 Unclassified 528
1481 Ga0207674_10000129 3300026116 Bacteria 88458
1482 Ga0207674_10212381 3300026116 Bacteria 1884
1483 Ga0207674_10267177 3300026116 Bacteria 1658
1484 Ga0207674_10407307 3300026116 Bacteria 1314
1485 Ga0207674_10606429 3300026116 Bacteria 1057
1486 Ga0207674_10782055 3300026116 Bacteria 921
1487 Ga0207674_10931039 3300026116 Unclassified 837
1488 Ga0207674_10958773 3300026116 Bacteria 824
1489 Ga0207674_11022912 3300026116 Unclassified 795
1490 Ga0207674_11178345 3300026116 Bacteria 736
1491 Ga0207674_12037765 3300026116 Unclassified 538
1492 Ga0207674_12067235 3300026116 Bacteria 534
1493 Ga0207674_12147104 3300026116 Unclassified 522
1494 Ga0207675_100001227 3300026118 Bacteria 25579
1495 Ga0207675_100003424 3300026118 Bacteria 15494
1496 Ga0207675_100061965 3300026118 Bacteria 3492
1497 Ga0207675_100064333 3300026118 Bacteria 3428
1498 Ga0207675_100078112 3300026118 Bacteria 3101
1499 Ga0207675_100123212 3300026118 Bacteria 2454
1500 Ga0207675_100340084 3300026118 Bacteria 1469
1501 Ga0207675_100355804 3300026118 Bacteria 1436
1502 Ga0207675_100396060 3300026118 Bacteria 1360
1503 Ga0207675_100514622 3300026118 Bacteria 1192
1504 Ga0207675_100596114 3300026118 Bacteria 1107
1505 Ga0207675_100815172 3300026118 Unclassified 947
1506 Ga0207675_100866865 3300026118 Bacteria 918
1507 Ga0207675_100969103 3300026118 Unclassified 868
1508 Ga0207675_101109191 3300026118 Bacteria 811
1509 Ga0207675_101511187 3300026118 Bacteria 692
1510 Ga0207675_101579976 3300026118 Bacteria 676
1511 Ga0207675_101591346 3300026118 Unclassified 674
1512 Ga0207675_102688596 3300026118 Unclassified 506
1513 Ga0207683_11362906 3300026121 Unclassified 656
1514 Ga0207698_10465056 3300026142 Bacteria 1224
1515 Ga0207698_10685322 3300026142 Unclassified 1018
1516 Ga0207698_10809124 3300026142 Bacteria 940
1517 Ga0207698_11560130 3300026142 Bacteria 676
1518 Ga0207698_11760932 3300026142 Unclassified 635
1519 Ga0207698_11817109 3300026142 Bacteria 624
1520 Ga0209969_1060987 3300027360 Bacteria 596
1521 Ga0209588_1010605 3300027671 Bacteria 2774
1522 Ga0207428_10013155 3300027907 Bacteria 7244
1523 Ga0207428_10022575 3300027907 Bacteria 5307
1524 Ga0207428_10125269 3300027907 Bacteria 1968
1525 Ga0207428_10170089 3300027907 Bacteria 1651
1526 Ga0207428_11101063 3300027907 Unclassified 555
1527 Ga0268266_10623828 3300028379 Bacteria 1036
1528 Ga0268266_11495061 3300028379 Bacteria 651
1529 Ga0268265_10048879 3300028380 Bacteria 3178
1530 Ga0268265_10063139 3300028380 Bacteria 2848
1531 Ga0268265_10441934 3300028380 Bacteria 1212
1532 Ga0268265_10497170 3300028380 Unclassified 1148
1533 Ga0268265_10529340 3300028380 Bacteria 1115
1534 Ga0268265_10571716 3300028380 Bacteria 1076
1535 Ga0268265_10705164 3300028380 Bacteria 975
1536 Ga0268265_11269795 3300028380 Bacteria 736
1537 Ga0268265_11796821 3300028380 Bacteria 619
1538 Ga0268265_12028036 3300028380 Unclassified 582
1539 Ga0268264_10085035 3300028381 Bacteria 2714
1540 Ga0268264_10114653 3300028381 Bacteria 2366
1541 Ga0268264_10132055 3300028381 Bacteria 2215
1542 Ga0268264_10145685 3300028381 Bacteria 2117
1543 Ga0268264_10233483 3300028381 Bacteria 1700
1544 Ga0268264_10264221 3300028381 Bacteria 1605
1545 Ga0268264_10311895 3300028381 Bacteria 1484
1546 Ga0268264_10343439 3300028381 Bacteria 1419
1547 Ga0268264_10368371 3300028381 Unclassified 1372
1548 Ga0268264_10429509 3300028381 Bacteria 1276
1549 Ga0268264_10483917 3300028381 Bacteria 1204
1550 Ga0268264_10649449 3300028381 Bacteria 1044
1551 Ga0268264_11170416 3300028381 Bacteria 778
1552 Ga0268264_11721797 3300028381 Bacteria 637
1553 Ga0316176_1114701 3300030732 Unclassified 614
1554 Ga0316176_1131905 3300030732 Unclassified 507
1555 Ga0316178_1152305 3300030735 Bacteria 946
1556 Ga0316183_1163653 3300030742 Bacteria 659
1557 Ga0316181_1050874 3300030744 Unclassified 740
1558 Ga0316182_1065118 3300030745 Unclassified 623
1559 Ga0316182_1397664 3300030745 Bacteria 668
1560 Ga0307513_10119701 3300031456 Bacteria 2604
1561 Ga0307513_10208833 3300031456 Bacteria 1786
1562 Ga0307408_100010460 3300031548 Bacteria 6119
1563 Ga0307408_100070551 3300031548 Bacteria 2580
1564 Ga0307408_100118436 3300031548 Bacteria 2047
1565 Ga0307408_100161410 3300031548 Bacteria 1781
1566 Ga0307408_100173980 3300031548 Bacteria 1721
1567 Ga0307408_100265803 3300031548 Unclassified 1422
1568 Ga0307408_100480150 3300031548 Unclassified 1084
1569 Ga0307408_101647287 3300031548 Bacteria 610
1570 Ga0307405_10004715 3300031731 Bacteria 6488
1571 Ga0307405_10058990 3300031731 Bacteria 2417
1572 Ga0307405_10704732 3300031731 Unclassified 836
1573 Ga0307405_10745462 3300031731 Bacteria 815
1574 Ga0307405_10840303 3300031731 Bacteria 772
1575 Ga0307405_10919921 3300031731 Bacteria 741
1576 Ga0307405_11195875 3300031731 Bacteria 657
1577 Ga0307405_11612208 3300031731 Bacteria 573
1578 Ga0307413_10105113 3300031824 Bacteria 1876
1579 Ga0307413_10209615 3300031824 Bacteria 1414
1580 Ga0307413_10296984 3300031824 Bacteria 1223
1581 Ga0307413_10341523 3300031824 Unclassified 1152
1582 Ga0307413_10503619 3300031824 Bacteria 973
1583 Ga0307413_10812522 3300031824 Unclassified 787
1584 Ga0307413_12122216 3300031824 Unclassified 508
1585 Ga0307410_10037085 3300031852 Bacteria 3181
1586 Ga0307410_10568346 3300031852 Bacteria 942
1587 Ga0307410_11059552 3300031852 Bacteria 701
1588 Ga0307410_12139629 3300031852 Unclassified 501
1589 Ga0326468_10073643 3300031889 Unclassified 574
1590 Ga0307406_10039674 3300031901 Bacteria 2923
1591 Ga0307406_10055051 3300031901 Bacteria 2541
1592 Ga0307406_10125719 3300031901 Bacteria 1791
1593 Ga0307406_10167005 3300031901 Bacteria 1589
1594 Ga0307406_10458069 3300031901 Bacteria 1025
1595 Ga0307406_11720902 3300031901 Unclassified 556
1596 Ga0307407_10075022 3300031903 Bacteria 2026
1597 Ga0307407_10076830 3300031903 Bacteria 2006
1598 Ga0307407_10206026 3300031903 Bacteria 1321
1599 Ga0307407_10303323 3300031903 Bacteria 1114
1600 Ga0307407_10303370 3300031903 Bacteria 1114
1601 Ga0307407_10552024 3300031903 Bacteria 852
1602 Ga0307407_11181458 3300031903 Unclassified 597
1603 Ga0307412_10014128 3300031911 Bacteria 4702
1604 Ga0307412_10025492 3300031911 Bacteria 3664
1605 Ga0307412_10210137 3300031911 Bacteria 1484
1606 Ga0307412_10539172 3300031911 Bacteria 978
1607 Ga0307412_10892845 3300031911 Unclassified 778
1608 Ga0307412_11953830 3300031911 Bacteria 542
1609 Ga0307409_100013591 3300031995 Bacteria 5250
1610 Ga0307409_100185700 3300031995 Bacteria 1845
1611 Ga0307409_101064662 3300031995 Unclassified 829
1612 Ga0307409_102105723 3300031995 Unclassified 594
1613 Ga0307409_102384652 3300031995 Bacteria 558
1614 Ga0307416_100041308 3300032002 Bacteria 3591
1615 Ga0307416_100058365 3300032002 Bacteria 3128
1616 Ga0307416_100180502 3300032002 Bacteria 1978
1617 Ga0307416_100182692 3300032002 Bacteria 1967
1618 Ga0307416_100413122 3300032002 Bacteria 1391
1619 Ga0307416_100450980 3300032002 Bacteria 1339
1620 Ga0307416_100499535 3300032002 Bacteria 1280
1621 Ga0307416_100582696 3300032002 Bacteria 1196
1622 Ga0307416_100902381 3300032002 Bacteria 984
1623 Ga0307416_101605244 3300032002 Bacteria 756
1624 Ga0307416_101643416 3300032002 Unclassified 747
1625 Ga0307416_101745347 3300032002 Unclassified 727
1626 Ga0307416_103734251 3300032002 Bacteria 510
1627 Ga0307414_10010849 3300032004 Bacteria 5314
1628 Ga0307414_10150651 3300032004 Bacteria 1835
1629 Ga0307414_10439812 3300032004 Bacteria 1141
1630 Ga0307414_10524540 3300032004 Bacteria 1052
1631 Ga0307414_11293599 3300032004 Bacteria 676
1632 Ga0307411_10036169 3300032005 Bacteria 3091
1633 Ga0307411_10082705 3300032005 Bacteria 2215
1634 Ga0307411_10590393 3300032005 Bacteria 953
1635 Ga0307411_10848772 3300032005 Bacteria 808
1636 Ga0307411_10910066 3300032005 Bacteria 782
1637 Ga0307411_11080738 3300032005 Unclassified 722
1638 Ga0307411_11435383 3300032005 Unclassified 632
1639 Ga0307415_100063142 3300032126 Bacteria 2572
1640 Ga0307415_100342718 3300032126 Bacteria 1255
1641 Ga0307415_100874978 3300032126 Bacteria 826
1642 Ga0307415_100955598 3300032126 Unclassified 793
1643 Ga0307415_101040426 3300032126 Unclassified 763
1644 Ga0307415_101174478 3300032126 Bacteria 722
1645 Ga0373959_0041060 3300034820 Unclassified 971
1646 Ga0373928_0192268 3300035084 Bacteria 585
1647 Ga0373928_0235037 3300035084 Unclassified 541
1648 Ga0373929_0179079 3300035085 Unclassified 584
1649 Ga0373940_0036332 3300035088 Unclassified 1338
1650 Ga0373940_0336057 3300035088 Unclassified 527
1651 Ga0373951_0005973 3300035091 Bacteria 2806
1652 Ga0373951_0105827 3300035091 Bacteria 752
1653 Ga0373951_0193381 3300035091 Unclassified 590
1654 Ga0373923_0101084 3300035111 Bacteria 1272
1655 Ga0373932_0203473 3300035112 Unclassified 705
1656 Ga0373939_0327025 3300035114 Bacteria 618
1657 Ga0373943_0668244 3300035170 Bacteria 614
1658 Ga0373942_0006518 3300035207 Bacteria 2697
1659 Ga0373961_0092505 3300035241 Unclassified 968
1660 Ga0373961_0095711 3300035241 Bacteria 955
1661 Ga0373931_0117570 3300035691 Bacteria 1516
1662 Ga0373935_0277352 3300035692 Bacteria 1180
1663 Ga0373933_0327525 3300035724 Unclassified 994
1664 Ga0373937_0154007 3300036401 Bacteria 2154
1665 Ga0373937_0219024 3300036401 Bacteria 1792
1666 Ga0395899_0657409 3300037312 Bacteria 662
1667 Ga0395900_0105517 3300037418 Bacteria 2895
1668 Ga0395900_0166303 3300037418 Bacteria 2247
1669 Ga0395900_0263628 3300037418 Bacteria 1720
1670 Ga0395900_0342999 3300037418 Bacteria 1469
1671 Ga0395900_0672217 3300037418 Bacteria 971
1672 Ga0395898_0171193 3300037466 Bacteria 2076
1673 Ga0395898_0328589 3300037466 Unclassified 1458
1674 Ga0395898_0522198 3300037466 Bacteria 1129
1675 Ga0395898_0841307 3300037466 Unclassified 857
1676 Ga0395905_0004072 3300037471 Bacteria 15323
1677 Ga0395905_0030119 3300037471 Bacteria 5115
1678 Ga0436364_0478435 3300037853 Unclassified 1609
1679 Ga0436364_0653795 3300037853 Bacteria 721
1680 Ga0436364_1207613 3300037853 Bacteria 1263
1681 Ga0395901_0050149 3300038443 Bacteria 4338
1682 Ga0395901_0097048 3300038443 Bacteria 3089
1683 Ga0395901_0236501 3300038443 Bacteria 1906
1684 Ga0242419_006000 3300038698 Bacteria 874
1685 Ga0242419_007703 3300038698 Unclassified 797
1686 Ga0242422_00182 3300038699 Bacteria 3476
1687 Ga0242420_001977 3300038996 Bacteria 2855
1688 Ga0242420_003462 3300038996 Bacteria 2330
1689 Ga0242420_003719 3300038996 Bacteria 2267
1690 Ga0400483_143808 3300039062 Bacteria 1012
1691 Ga0436365_0275079 3300039437 Bacteria 1910
1692 Ga0436365_0691918 3300039437 Bacteria 3633
1693 Ga0436365_0780917 3300039437 Bacteria 1776
1694 Ga0436365_1107781 3300039437 Unclassified 1178
1695 Ga0436365_1319766 3300039437 Bacteria 503
1696 Ga0436365_1501396 3300039437 Bacteria 3521
1697 Ga0436360_1268721 3300039438 Bacteria 693
1698 Ga0436363_1472621 3300039450 Bacteria 1064
1699 Ga0439439_0178726 3300041406 Unclassified 611
1700 Ga0439453_0038699 3300041408 Bacteria 929
1701 Ga0451791_1698514 3300041451 Unclassified 651
1702 Ga0451793_1437177 3300041452 Unclassified 550
1703 Ga0451837_0510004 3300041494 Bacteria 839
1704 Ga0439442_055147 3300042002 Bacteria 840
1705 Ga0439455_0008775 3300042012 Bacteria 2175
1706 Ga0439457_021544 3300042014 Bacteria 1430
1707 Ga0439462_0009642 3300042015 Unclassified 2441
1708 Ga0439462_0017954 3300042015 Bacteria 1835
1709 Ga0450892_026993 3300042130 Unclassified 589
1710 Ga0450905_098339 3300042142 Unclassified 523
1711 Ga0439446_0160554 3300042156 Bacteria 743
1712 Ga0439458_0006664 3300042157 Bacteria 2574
1713 Ga0439434_0013536 3300042435 Bacteria 2422
1714 Ga0439434_0186706 3300042435 Bacteria 696
1715 Ga0439435_0057583 3300042436 Bacteria 1126
1716 Ga0439435_0064345 3300042436 Bacteria 1075
1717 Ga0439435_0318282 3300042436 Unclassified 535
1718 Ga0439444_0018713 3300042437 Bacteria 1202
1719 Ga0439459_0097705 3300042438 Bacteria 715
1720 Ga0439464_0024004 3300042439 Bacteria 1685
1721 Ga0451577_0056944 3300042876 Bacteria 3486
1722 Ga0451577_1023371 3300042876 Bacteria 741
1723 Ga0451577_1445202 3300042876 Bacteria 609
1724 Ga0453683_0473100 3300044673 Bacteria 812
1725 Ga0453684_0903081 3300044712 Unclassified 946
1726 Ga0451576_0669840 3300045051 Bacteria 1090
1727 Ga0451576_0967777 3300045051 Bacteria 892
1728 Ga0451576_1590693 3300045051 Unclassified 678
1729 Ga0451576_1751010 3300045051 Archaea 643
1730 Ga0451576_2379893 3300045051 Unclassified 542
1731 Ga0466967_2139940 3300045976 Unclassified 556
1732 Ga0495590_0030456 3300046457 Bacteria 1891
1733 Ga0495580_0190632 3300046472 Bacteria 1414
1734 Ga0495582_0121519 3300046473 Bacteria 1472
1735 Ga0495662_0087257 3300046476 Bacteria 1520
1736 Ga0495610_0116247 3300046512 Bacteria 1178
1737 Ga0495618_0097309 3300046514 Bacteria 1883
1738 Ga0495620_0352839 3300046515 Unclassified 558
1739 Ga0495630_0087083 3300046517 Bacteria 2359
1740 Ga0495632_0041632 3300046519 Bacteria 2307
1741 Ga0495663_0031461 3300046525 Bacteria 1576
1742 Ga0495666_0454746 3300046526 Unclassified 573
1743 Ga0495642_0199975 3300046528 Bacteria 871
1744 Ga0495586_0158761 3300046535 Bacteria 1275
1745 Ga0495621_0002629 3300046539 Bacteria 4855
1746 Ga0495621_0003735 3300046539 Bacteria 4218
1747 Ga0495656_0450851 3300046615 Unclassified 678
1748 Ga0495668_0353220 3300046616 Bacteria 807
1749 Ga0495625_0123105 3300046660 Bacteria 1763
1750 Ga0495635_0118662 3300046663 Bacteria 1805
1751 Ga0495669_0577942 3300046684 Unclassified 547
1752 Ga0495613_0139238 3300046689 Bacteria 1735
1753 Ga0495670_0332567 3300046691 Unclassified 816
1754 Ga0495600_0040284 3300046809 Bacteria 3042
1755 Ga0495581_0384816 3300047315 Bacteria 819
1756 Ga0495636_0019939 3300047318 Bacteria 2699
1757 Ga0495672_0433635 3300047320 Unclassified 595
1758 Ga0495685_217509 3300047447 Bacteria 610
1759 Ga0495684_0183101 3300047471 Bacteria 1552
1760 Ga0495614_0274843 3300048089 Bacteria 775
1761 Ga0495615_0019471 3300048090 Bacteria 1508
1762 Ga0496100_0653641 3300048903 Bacteria 819
1763 Ga0496100_0971590 3300048903 Unclassified 668
1764 Ga0496102_0017811 3300048905 Bacteria 6228
1765 Ga0496102_0273991 3300048905 Bacteria 1591
1766 Ga0496102_1019260 3300048905 Unclassified 748
1767 Ga0496102_1057621 3300048905 Unclassified 732
1768 Ga0496103_0099657 3300048906 Bacteria 1838
1769 Ga0496104_0051718 3300048907 Bacteria 3878
1770 Ga0496104_0070007 3300048907 Bacteria 3335
1771 Ga0496104_0648438 3300048907 Bacteria 965
1772 Ga0496104_1256574 3300048907 Unclassified 644
1773 Ga0496106_0004259 3300048909 Bacteria 10652
1774 Ga0496106_0055057 3300048909 Bacteria 3006
1775 Ga0496106_1316341 3300048909 Bacteria 560
1776 Ga0496106_1451716 3300048909 Bacteria 529
1777 Ga0496107_0074027 3300048910 Bacteria 2478
1778 Ga0496107_0169893 3300048910 Unclassified 1618
1779 Ga0496107_0777631 3300048910 Bacteria 702
1780 Ga0496108_0105590 3300048911 Bacteria 2405
1781 Ga0496108_0593906 3300048911 Bacteria 965
1782 Ga0496108_1426533 3300048911 Bacteria 578
1783 Ga0496109_0044357 3300048912 Bacteria 4034
1784 Ga0496109_0399282 3300048912 Bacteria 1299
1785 Ga0496109_1000695 3300048912 Unclassified 774
1786 Ga0496110_0914850 3300048913 Bacteria 783
1787 Ga0496110_1018490 3300048913 Bacteria 736
1788 Ga0496110_1576779 3300048913 Bacteria 567
1789 Ga0496110_1595155 3300048913 Unclassified 563
1790 Ga0496111_0231442 3300048914 Bacteria 1373
1791 Ga0496112_0079543 3300048915 Bacteria 3243
1792 Ga0496112_0224066 3300048915 Bacteria 1836
1793 Ga0496112_0251224 3300048915 Bacteria 1719
1794 Ga0496112_0443088 3300048915 Bacteria 1237
1795 Ga0496112_0557274 3300048915 Unclassified 1080
1796 Ga0496112_0669639 3300048915 Bacteria 967
1797 Ga0496112_0720129 3300048915 Bacteria 925
1798 Ga0496112_0802136 3300048915 Bacteria 866
1799 Ga0496112_0861885 3300048915 Unclassified 829
1800 Ga0496113_0220248 3300048916 Bacteria 1512
1801 Ga0496113_0296936 3300048916 Bacteria 1293
1802 Ga0496113_0816380 3300048916 Unclassified 740
1803 Ga0496113_1224519 3300048916 Unclassified 586
1804 Ga0496113_1272561 3300048916 Bacteria 573
1805 Ga0501290_028321 3300049513 Unclassified 793
1806 Ga0501291_032148 3300049514 Bacteria 889
1807 Ga0501291_092465 3300049514 Unclassified 619
1808 Ga0501292_037297 3300049515 Bacteria 831
1809 Ga0501292_053336 3300049515 Bacteria 721
1810 Ga0501293_046113 3300049516 Bacteria 508
1811 Ga0501294_015591 3300049517 Bacteria 785
1812 Ga0501295_015159 3300049518 Unclassified 1314
1813 Ga0501296_003427 3300049519 Bacteria 1692
1814 Ga0501296_005536 3300049519 Bacteria 1412
1815 Ga0501297_054343 3300049520 Unclassified 597
1816 Ga0501298_000513 3300049521 Bacteria 5244
1817 Ga0501298_003745 3300049521 Bacteria 2370
1818 Ga0501298_018322 3300049521 Bacteria 1286
1819 Ga0501298_048276 3300049521 Bacteria 877
1820 Ga0501299_002737 3300049522 Bacteria 2473
1821 Ga0501299_038367 3300049522 Bacteria 952
1822 Ga0501303_049884 3300049526 Unclassified 547
1823 Ga0501311_103897 3300049527 Unclassified 505
1824 Ga0501038_0003393 3300049574 Bacteria 14851
1825 Ga0501041_0899393 3300049577 Bacteria 569
1826 Ga0501042_0480554 3300049578 Unclassified 902
1827 Ga0501048_0037126 3300049582 Bacteria 3499
1828 Ga0501069_0268000 3300049585 Bacteria 998
1829 Ga0501071_1294824 3300049587 Unclassified 563
1830 Ga0501076_0195538 3300049592 Bacteria 1651
1831 Ga0501198_030863 3300049649 Bacteria 894
1832 Ga0501198_038518 3300049649 Unclassified 821
1833 Ga0501198_065835 3300049649 Bacteria 674
1834 Ga0501201_038152 3300049651 Unclassified 569
1835 Ga0501202_013898 3300049652 Bacteria 1536
1836 Ga0501202_044798 3300049652 Bacteria 965
1837 Ga0501207_003424 3300049654 Bacteria 2112
1838 Ga0501207_024851 3300049654 Bacteria 980
1839 Ga0501209_066306 3300049656 Bacteria 1018
1840 Ga0501214_011496 3300049659 Bacteria 992
1841 Ga0501216_004975 3300049660 Bacteria 1989
1842 Ga0501216_007638 3300049660 Bacteria 1687
1843 Ga0501216_007976 3300049660 Bacteria 1658
1844 Ga0501216_103034 3300049660 Unclassified 632
1845 Ga0501217_010351 3300049661 Bacteria 2041
1846 Ga0501217_019837 3300049661 Bacteria 1573
1847 Ga0501217_020774 3300049661 Unclassified 1545
1848 Ga0501217_055864 3300049661 Unclassified 1043
1849 Ga0501223_045714 3300049663 Bacteria 849
1850 Ga0501224_002725 3300049664 Bacteria 2430
1851 Ga0501224_083257 3300049664 Unclassified 512
1852 Ga0501227_005457 3300049665 Bacteria 2722
1853 Ga0501227_029169 3300049665 Bacteria 1314
1854 Ga0501228_028517 3300049666 Bacteria 672
1855 Ga0501230_046471 3300049667 Unclassified 853
1856 Ga0501230_084784 3300049667 Bacteria 667
1857 Ga0501233_022442 3300049668 Bacteria 1363
1858 Ga0501233_179657 3300049668 Bacteria 605
1859 Ga0501235_020409 3300049669 Bacteria 1471
1860 Ga0501235_020985 3300049669 Unclassified 1451
1861 Ga0501235_047421 3300049669 Bacteria 991
1862 Ga0501235_196420 3300049669 Unclassified 544
1863 Ga0501238_070746 3300049671 Bacteria 542
1864 Ga0501239_010730 3300049672 Bacteria 1014
1865 Ga0501239_021468 3300049672 Bacteria 795
1866 Ga0501239_022097 3300049672 Unclassified 787
1867 Ga0501242_051215 3300049674 Unclassified 607
1868 Ga0501243_028665 3300049675 Unclassified 943
1869 Ga0501246_002536 3300049676 Bacteria 1443
1870 Ga0501246_030861 3300049676 Unclassified 602
1871 Ga0501247_019321 3300049677 Bacteria 876
1872 Ga0501247_029507 3300049677 Bacteria 744
1873 Ga0501249_026377 3300049679 Bacteria 1284
1874 Ga0501249_046654 3300049679 Bacteria 990
1875 Ga0501249_058433 3300049679 Bacteria 891
1876 Ga0501250_004199 3300049680 Bacteria 1421
1877 Ga0501251_056136 3300049681 Bacteria 637
1878 Ga0501253_019615 3300049683 Bacteria 1169
1879 Ga0501253_055503 3300049683 Bacteria 841
1880 Ga0501256_005713 3300049685 Bacteria 1103
1881 Ga0501256_031939 3300049685 Bacteria 596
1882 Ga0501257_010713 3300049686 Bacteria 2085
1883 Ga0501257_059821 3300049686 Bacteria 962
1884 Ga0501257_065647 3300049686 Bacteria 921
1885 Ga0501257_076330 3300049686 Bacteria 860
1886 Ga0501258_016021 3300049687 Bacteria 844
1887 Ga0501259_012435 3300049688 Bacteria 1420
1888 Ga0501259_042617 3300049688 Unclassified 897
1889 Ga0501260_007676 3300049689 Unclassified 1054
1890 Ga0501260_038663 3300049689 Unclassified 573
1891 Ga0501261_043933 3300049690 Bacteria 713
1892 Ga0501219_031273 3300049703 Unclassified 502
1893 Ga0501221_032772 3300049704 Bacteria 1093
1894 Ga0501221_062204 3300049704 Bacteria 865
1895 Ga0501221_220505 3300049704 Bacteria 534
1896 Ga0501225_0037426 3300049705 Bacteria 1337
1897 Ga0501225_0182605 3300049705 Bacteria 656
1898 Ga0501225_0283106 3300049705 Bacteria 556
1899 Ga0501229_064567 3300049706 Bacteria 564
1900 Ga0501245_018065 3300049708 Bacteria 1082
1901 Ga0501245_074194 3300049708 Bacteria 646
1902 Ga0501079_0385915 3300049741 Bacteria 1098
1903 Ga0501081_0305140 3300049743 Bacteria 1168
1904 Ga0501267_064469 3300049764 Bacteria 501
1905 Ga0501269_026236 3300049766 Bacteria 736
1906 Ga0501270_007418 3300049767 Bacteria 1356
1907 Ga0501270_012143 3300049767 Bacteria 1170
1908 Ga0501271_017840 3300049768 Bacteria 807
1909 Ga0501272_007658 3300049769 Bacteria 1174
1910 Ga0501273_002047 3300049770 Unclassified 2015
1911 Ga0501273_005281 3300049770 Bacteria 1453
1912 Ga0501275_036930 3300049772 Bacteria 670
1913 Ga0501282_008354 3300049778 Bacteria 1109
1914 Ga0501283_002459 3300049779 Bacteria 2407
1915 Ga0501283_029855 3300049779 Bacteria 910
1916 Ga0501283_045201 3300049779 Bacteria 770
1917 Ga0501212_026237 3300049851 Bacteria 923
1918 Ga0501226_009264 3300049853 Bacteria 1097
1919 Ga0501226_015842 3300049853 Bacteria 830
1920 nmdc:mga05p37_120804_c1 3300050507 Bacteria 3218
1921 nmdc:mga05p37_1338754_c1 3300050507 Bacteria 726
1922 nmdc:mga05p37_149953_c1 3300050507 Bacteria 2853
1923 nmdc:mga05p37_171876_c1 3300050507 Unclassified 2642
1924 nmdc:mga05p37_186728_c1 3300050507 Bacteria 2520
1925 nmdc:mga05p37_1873149_c1 3300050507 Unclassified 574
1926 nmdc:mga05p37_2117195_c1 3300050507 Unclassified 526
1927 nmdc:mga05p37_2156524_c1 3300050507 Unclassified 519
1928 nmdc:mga05p37_297927_c1 3300050507 Bacteria 1917
1929 nmdc:mga05p37_354785_c1 3300050507 Bacteria 1726
1930 nmdc:mga05p37_368239_c1 3300050507 Bacteria 1687
1931 nmdc:mga05p37_368600_c1 3300050507 Bacteria 1686
1932 nmdc:mga05p37_44946_c1 3300050507 Bacteria 5433
1933 nmdc:mga05p37_525004_c1 3300050507 Bacteria 1353
1934 nmdc:mga05p37_726895_c1 3300050507 Bacteria 1098
1935 nmdc:mga05p37_75055_c1 3300050507 Bacteria 4162
1936 nmdc:mga05p37_795005_c1 3300050507 Bacteria 1036
1937 nmdc:mga05p37_84881_c1 3300050507 Bacteria 3901
1938 nmdc:mga05p37_919318_c1 3300050507 Bacteria 941
1939 nmdc:mga09592_1019693_c1 3300050508 Unclassified 691
1940 nmdc:mga09592_109716_c1 3300050508 Bacteria 2367
1941 nmdc:mga09592_149740_c1 3300050508 Bacteria 2013
1942 nmdc:mga09592_1631598_c1 3300050508 Unclassified 521
1943 nmdc:mga09592_404510_c1 3300050508 Bacteria 1180
1944 nmdc:mga09592_456619_c1 3300050508 Bacteria 1102
1945 nmdc:mga0qj67_158498_c1 3300050509 Bacteria 1837
1946 nmdc:mga0qj67_60903_c1 3300050509 Bacteria 2996
1947 nmdc:mga0qj67_74171_c1 3300050509 Bacteria 2719
1948 nmdc:mga06r32_1039059_c1 3300050510 Unclassified 770
1949 nmdc:mga06r32_1941765_c1 3300050510 Bacteria 523
1950 nmdc:mga06r32_310374_c1 3300050510 Unclassified 1563
1951 nmdc:mga06r32_426168_c1 3300050510 Bacteria 1308
1952 nmdc:mga06r32_781317_c1 3300050510 Bacteria 916
1953 nmdc:mga08y16_123832_c1 3300050511 Bacteria 2690
1954 nmdc:mga08y16_1615414_c1 3300050511 Unclassified 606
1955 nmdc:mga08y16_23449_c1 3300050511 Bacteria 6520
1956 nmdc:mga08y16_416416_c1 3300050511 Unclassified 1374
1957 nmdc:mga08y16_5130_c1 3300050511 Bacteria 13690
1958 nmdc:mga08y16_941060_c1 3300050511 Bacteria 848
1959 nmdc:mga0n895_1019373_c1 3300050512 Unclassified 808
1960 nmdc:mga0n895_104188_c1 3300050512 Bacteria 2849
1961 nmdc:mga0n895_1355487_c1 3300050512 Unclassified 681
1962 nmdc:mga0n895_1533145_c1 3300050512 Unclassified 632
1963 nmdc:mga0n895_1584000_c1 3300050512 Bacteria 620
1964 nmdc:mga0n895_1632146_c1 3300050512 Unclassified 608
1965 nmdc:mga0n895_169469_c1 3300050512 Bacteria 2215
1966 nmdc:mga0n895_1919830_c1 3300050512 Unclassified 551
1967 nmdc:mga0n895_31204_c1 3300050512 Bacteria 5099
1968 nmdc:mga0n895_330977_c1 3300050512 Bacteria 1543
1969 nmdc:mga0n895_368601_c1 3300050512 Bacteria 1454
1970 nmdc:mga0n895_46880_c1 3300050512 Bacteria 4224
1971 nmdc:mga0n895_470902_c1 3300050512 Bacteria 1267
1972 nmdc:mga0n895_560721_c1 3300050512 Unclassified 1147
1973 nmdc:mga0n895_761884_c1 3300050512 Bacteria 960
1974 nmdc:mga0n895_784698_c1 3300050512 Unclassified 944
1975 nmdc:mga0n895_900314_c1 3300050512 Bacteria 870
1976 nmdc:mga0n895_90323_c1 3300050512 Bacteria 3065
1977 nmdc:mga0rr50_116_c1 3300050513 Bacteria 44002
1978 nmdc:mga0rr50_142776_c1 3300050513 Bacteria 1928
1979 nmdc:mga0rr50_192186_c1 3300050513 Bacteria 1673
1980 nmdc:mga0rr50_223268_c1 3300050513 Bacteria 1556
1981 nmdc:mga0rr50_429847_c1 3300050513 Bacteria 1118
1982 nmdc:mga0rr50_479607_c1 3300050513 Bacteria 1056
1983 nmdc:mga08x19_12913_c1 3300050514 Bacteria 5040
1984 nmdc:mga08x19_187197_c1 3300050514 Bacteria 1415
1985 nmdc:mga08x19_40_c1 3300050514 Bacteria 154170
1986 nmdc:mga0a205_115731_c1 3300050515 Bacteria 2580
1987 nmdc:mga0a205_159324_c1 3300050515 Bacteria 2154
1988 nmdc:mga0a205_322086_c1 3300050515 Bacteria 1417
1989 nmdc:mga0a205_35529_c1 3300050515 Bacteria 4785
1990 nmdc:mga0a205_358707_c1 3300050515 Unclassified 1324
1991 nmdc:mga0a205_392929_c1 3300050515 Bacteria 1251
1992 nmdc:mga0a205_420431_c1 3300050515 Bacteria 1199
1993 nmdc:mga0a205_46253_c1 3300050515 Bacteria 4197
1994 nmdc:mga0a205_466487_c1 3300050515 Unclassified 1122
1995 nmdc:mga0a205_476656_c1 3300050515 Unclassified 1106
1996 nmdc:mga0a205_536590_c1 3300050515 Bacteria 1026
1997 nmdc:mga0a205_657443_c1 3300050515 Bacteria 899
1998 nmdc:mga0a205_932129_c1 3300050515 Unclassified 715
1999 nmdc:mga0a205_97677_c1 3300050515 Bacteria 2836
2000 Ga0500577_0010694 3300053142 Bacteria 2712
2001 Ga0500616_0000478 3300053153 Bacteria 51881
2002 Ga0500619_215499 3300053154 Bacteria 641
2003 Ga0587084_106954 3300059477 Unclassified 574
2004 Ga0587076_118614 3300059645 Bacteria 610
2005 Ga0587114_101161 3300059655 Unclassified 562
2006 Ga0501082_0450148 3300060353 Bacteria 1125
2007 Ga0501082_1566160 3300060353 Bacteria 575
2008 Ga0530510_0324057 3300061734 Bacteria 1155
2009 Ga0530510_0346744 3300061734 Bacteria 1115
2010 Ga0530510_0814937 3300061734 Bacteria 712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100604083 Ga0075428_1006040832 90
2 3300049649 Ga0501198_065835 Ga0501198_065835_15_287 90
3 3300005435 Ga0070714_100454041 Ga0070714_1004540412 93
4 3300005563 Ga0068855_101673198 Ga0068855_1016731982 93
5 3300005981 Ga0081538_10003741 Ga0081538_100037415 93
6 3300009174 Ga0105241_10556257 Ga0105241_105562572 93
7 3300013104 Ga0157370_11676311 Ga0157370_116763112 93
8 3300013105 Ga0157369_11029923 Ga0157369_110299231 93
9 3300013307 Ga0157372_12158961 Ga0157372_121589611 93
10 3300025911 Ga0207654_10510899 Ga0207654_105108992 93
11 3300025929 Ga0207664_10413394 Ga0207664_104133942 93
12 3300025949 Ga0207667_10213925 Ga0207667_102139254 93
13 3300039062 Ga0400483_143808 Ga0400483_143808_153_455 93
14 3300031731 Ga0307405_10058990 Ga0307405_100589902 94
15 3300031824 Ga0307413_10209615 Ga0307413_102096152 94
16 3300031903 Ga0307407_10303323 Ga0307407_103033232 94
17 3300031911 Ga0307412_10210137 Ga0307412_102101372 94
18 3300032002 Ga0307416_100499535 Ga0307416_1004995352 94
19 3300032002 Ga0307416_101605244 Ga0307416_1016052442 94
20 3300032004 Ga0307414_10439812 Ga0307414_104398122 94
21 3300032005 Ga0307411_10082705 Ga0307411_100827054 94
22 3300032126 Ga0307415_101174478 Ga0307415_1011744782 94
23 3300039438 Ga0436360_1268721 Ga0436360_1268721_51_383 94
24 3300005546 Ga0070696_101843260 Ga0070696_1018432601 95
25 3300044673 Ga0453683_0473100 Ga0453683_0473100_250_537 95
26 3300004801 Ga0058860_10630337 Ga0058860_106303372 96
27 3300005445 Ga0070708_100232165 Ga0070708_1002321652 96
28 3300005467 Ga0070706_100341592 Ga0070706_1003415923 96
29 3300005471 Ga0070698_100074866 Ga0070698_1000748662 96
30 3300005985 Ga0081539_10000317 Ga0081539_1000031797 96
31 3300006844 Ga0075428_102554776 Ga0075428_1025547762 96
32 3300006880 Ga0075429_100986081 Ga0075429_1009860812 96
33 3300009147 Ga0114129_10529431 Ga0114129_105294312 96
34 3300014325 Ga0163163_11724562 Ga0163163_117245622 96
35 3300025910 Ga0207684_10264222 Ga0207684_102642223 96
36 3300050507 nmdc:mga05p37_368600_c1 nmdc:mga05p37_368600_c1_954_1247 96
37 3300041406 Ga0439439_0178726 Ga0439439_0178726_264_560 98
38 3300042130 Ga0450892_026993 Ga0450892_026993_176_472 98
39 3300049687 Ga0501258_016021 Ga0501258_016021_199_495 98
40 3300009147 Ga0114129_11017944 Ga0114129_110179442 99
41 3300005471 Ga0070698_101082568 Ga0070698_1010825682 100
42 3300005545 Ga0070695_101169610 Ga0070695_1011696102 100
43 3300031731 Ga0307405_11195875 Ga0307405_111958751 100
44 3300031901 Ga0307406_10039674 Ga0307406_100396742 100
45 3300046457 Ga0495590_0030456 Ga0495590_0030456_503_832 100
46 3300049587 Ga0501071_1294824 Ga0501071_1294824_208_537 100
47 2124908026 MRS1a_Contig_2181 MRS1a_00015230 101
48 2124908027 MRS2a_Contig_26825 MRS2a_00679320 101
49 2162886007 SwRhRL2b_contig_946432 SwRhRL2b_0619.00000750 101
50 3300000531 CNBas_1007066 CNBas_10070662 101
51 3300000532 CNAas_1000871 CNAas_10008715 101
52 3300000545 CNXas_1019238 CNXas_10192381 101
53 3300001432 JGI24034J14986_101814 JGI24034J14986_1018142 101
54 3300002074 JGI24748J21848_1000039 JGI24748J21848_100003976 101
55 3300002239 JGI24034J26672_10000042 JGI24034J26672_1000004276 101
56 3300002239 JGI24034J26672_10000043 JGI24034J26672_1000004376 101
57 3300002459 JGI24751J29686_10000073 JGI24751J29686_100000735 101
58 3300003203 JGI25406J46586_10024396 JGI25406J46586_100243964 101
59 3300003203 JGI25406J46586_10040565 JGI25406J46586_100405652 101
60 3300003203 JGI25406J46586_10040996 JGI25406J46586_100409963 101
61 3300004801 Ga0058860_11428564 Ga0058860_114285642 101
62 3300005288 Ga0065714_10064424 Ga0065714_10064424221 101
63 3300005288 Ga0065714_10281021 Ga0065714_102810211 101
64 3300005289 Ga0065704_10001318 Ga0065704_100013185 101
65 3300005289 Ga0065704_10005913 Ga0065704_100059135 101
66 3300005289 Ga0065704_10075904 Ga0065704_100759046 101
67 3300005289 Ga0065704_10244026 Ga0065704_102440261 101
68 3300005289 Ga0065704_10245795 Ga0065704_102457952 101
69 3300005289 Ga0065704_10302691 Ga0065704_103026912 101
70 3300005289 Ga0065704_10358042 Ga0065704_103580422 101
71 3300005289 Ga0065704_10421108 Ga0065704_104211081 101
72 3300005289 Ga0065704_10584762 Ga0065704_105847621 101
73 3300005289 Ga0065704_10667972 Ga0065704_106679721 101
74 3300005289 Ga0065704_10823681 Ga0065704_108236811 101
75 3300005290 Ga0065712_10000117 Ga0065712_10000117221 101
76 3300005290 Ga0065712_10007020 Ga0065712_100070203 101
77 3300005290 Ga0065712_10016951 Ga0065712_100169512 101
78 3300005290 Ga0065712_10078309 Ga0065712_100783092 101
79 3300005290 Ga0065712_10158219 Ga0065712_101582192 101
80 3300005290 Ga0065712_10306276 Ga0065712_103062762 101
81 3300005293 Ga0065715_10025575 Ga0065715_100255753 101
82 3300005293 Ga0065715_10034609 Ga0065715_100346092 101
83 3300005293 Ga0065715_10090767 Ga0065715_1009076710 101
84 3300005293 Ga0065715_10091345 Ga0065715_100913454 101
85 3300005293 Ga0065715_10108199 Ga0065715_101081993 101
86 3300005293 Ga0065715_10111198 Ga0065715_101111982 101
87 3300005293 Ga0065715_10112384 Ga0065715_101123843 101
88 3300005293 Ga0065715_10118066 Ga0065715_101180662 101
89 3300005293 Ga0065715_10122775 Ga0065715_101227754 101
90 3300005293 Ga0065715_10295341 Ga0065715_102953412 101
91 3300005293 Ga0065715_10414829 Ga0065715_104148292 101
92 3300005293 Ga0065715_10651924 Ga0065715_106519241 101
93 3300005293 Ga0065715_10857620 Ga0065715_108576202 101
94 3300005295 Ga0065707_10001594 Ga0065707_100015942 101
95 3300005295 Ga0065707_10001595 Ga0065707_100015955 101
96 3300005295 Ga0065707_10031972 Ga0065707_100319722 101
97 3300005295 Ga0065707_10173596 Ga0065707_101735963 101
98 3300005295 Ga0065707_10321416 Ga0065707_103214162 101
99 3300005295 Ga0065707_10379901 Ga0065707_103799011 101
100 3300005295 Ga0065707_10382438 Ga0065707_103824381 101
101 3300005295 Ga0065707_10623461 Ga0065707_106234611 101
102 3300005295 Ga0065707_10757432 Ga0065707_107574322 101
103 3300005295 Ga0065707_10852942 Ga0065707_108529421 101
104 3300005328 Ga0070676_10034480 Ga0070676_100344802 101
105 3300005328 Ga0070676_10118720 Ga0070676_101187202 101
106 3300005328 Ga0070676_10244855 Ga0070676_102448553 101
107 3300005328 Ga0070676_10732115 Ga0070676_107321152 101
108 3300005328 Ga0070676_11169174 Ga0070676_111691741 101
109 3300005329 Ga0070683_101185355 Ga0070683_1011853552 101
110 3300005330 Ga0070690_100003298 Ga0070690_1000032983 101
111 3300005330 Ga0070690_100020366 Ga0070690_1000203663 101
112 3300005330 Ga0070690_100064287 Ga0070690_1000642872 101
113 3300005330 Ga0070690_100114804 Ga0070690_1001148042 101
114 3300005330 Ga0070690_100119738 Ga0070690_1001197383 101
115 3300005330 Ga0070690_100183740 Ga0070690_1001837403 101
116 3300005330 Ga0070690_100200783 Ga0070690_1002007832 101
117 3300005330 Ga0070690_100222842 Ga0070690_1002228422 101
118 3300005330 Ga0070690_100396319 Ga0070690_1003963192 101
119 3300005330 Ga0070690_100580467 Ga0070690_1005804671 101
120 3300005330 Ga0070690_100592000 Ga0070690_1005920002 101
121 3300005330 Ga0070690_101681288 Ga0070690_1016812881 101
122 3300005331 Ga0070670_100002900 Ga0070670_10000290021 101
123 3300005331 Ga0070670_100013601 Ga0070670_1000136019 101
124 3300005331 Ga0070670_100023179 Ga0070670_1000231792 101
125 3300005331 Ga0070670_100072963 Ga0070670_1000729635 101
126 3300005331 Ga0070670_100098450 Ga0070670_1000984505 101
127 3300005331 Ga0070670_100740310 Ga0070670_1007403102 101
128 3300005331 Ga0070670_101951180 Ga0070670_1019511802 101
129 3300005331 Ga0070670_101951427 Ga0070670_1019514271 101
130 3300005331 Ga0070670_101985441 Ga0070670_1019854411 101
131 3300005333 Ga0070677_10073894 Ga0070677_100738942 101
132 3300005333 Ga0070677_10124669 Ga0070677_101246692 101
133 3300005333 Ga0070677_10436169 Ga0070677_104361692 101
134 3300005333 Ga0070677_10545235 Ga0070677_105452352 101
135 3300005334 Ga0068869_100020479 Ga0068869_1000204795 101
136 3300005334 Ga0068869_100036271 Ga0068869_1000362715 101
137 3300005334 Ga0068869_100060217 Ga0068869_1000602172 101
138 3300005334 Ga0068869_100069177 Ga0068869_1000691774 101
139 3300005334 Ga0068869_100090982 Ga0068869_1000909824 101
140 3300005334 Ga0068869_100138548 Ga0068869_1001385482 101
141 3300005334 Ga0068869_100247416 Ga0068869_1002474162 101
142 3300005334 Ga0068869_100300703 Ga0068869_1003007032 101
143 3300005334 Ga0068869_100325121 Ga0068869_1003251212 101
144 3300005334 Ga0068869_100371211 Ga0068869_1003712112 101
145 3300005334 Ga0068869_100408816 Ga0068869_1004088162 101
146 3300005334 Ga0068869_100423645 Ga0068869_1004236452 101
147 3300005334 Ga0068869_100501134 Ga0068869_1005011342 101
148 3300005334 Ga0068869_100643226 Ga0068869_1006432262 101
149 3300005334 Ga0068869_100649282 Ga0068869_1006492821 101
150 3300005334 Ga0068869_100928002 Ga0068869_1009280021 101
151 3300005334 Ga0068869_101171340 Ga0068869_1011713401 101
152 3300005334 Ga0068869_101666064 Ga0068869_1016660642 101
153 3300005335 Ga0070666_10023239 Ga0070666_100232395 101
154 3300005335 Ga0070666_10253138 Ga0070666_102531382 101
155 3300005335 Ga0070666_10831210 Ga0070666_108312102 101
156 3300005335 Ga0070666_11080166 Ga0070666_110801661 101
157 3300005336 Ga0070680_100004630 Ga0070680_1000046304 101
158 3300005336 Ga0070680_100009331 Ga0070680_10000933112 101
159 3300005336 Ga0070680_100100026 Ga0070680_1001000263 101
160 3300005336 Ga0070680_100314092 Ga0070680_1003140922 101
161 3300005336 Ga0070680_100932322 Ga0070680_1009323221 101
162 3300005337 Ga0070682_100000254 Ga0070682_10000025448 101
163 3300005337 Ga0070682_100077085 Ga0070682_1000770852 101
164 3300005337 Ga0070682_100295102 Ga0070682_1002951022 101
165 3300005338 Ga0068868_100151558 Ga0068868_1001515583 101
166 3300005338 Ga0068868_100192063 Ga0068868_1001920632 101
167 3300005338 Ga0068868_100324200 Ga0068868_1003242002 101
168 3300005338 Ga0068868_100339718 Ga0068868_1003397182 101
169 3300005338 Ga0068868_100928093 Ga0068868_1009280932 101
170 3300005338 Ga0068868_101567871 Ga0068868_1015678711 101
171 3300005338 Ga0068868_101929721 Ga0068868_1019297211 101
172 3300005339 Ga0070660_100095647 Ga0070660_1000956474 101
173 3300005339 Ga0070660_100917625 Ga0070660_1009176251 101
174 3300005339 Ga0070660_101004872 Ga0070660_1010048721 101
175 3300005340 Ga0070689_100047364 Ga0070689_1000473642 101
176 3300005340 Ga0070689_100091891 Ga0070689_1000918915 101
177 3300005340 Ga0070689_100100069 Ga0070689_1001000694 101
178 3300005340 Ga0070689_100154283 Ga0070689_1001542833 101
179 3300005340 Ga0070689_100202128 Ga0070689_1002021282 101
180 3300005340 Ga0070689_100603714 Ga0070689_1006037142 101
181 3300005340 Ga0070689_100637802 Ga0070689_1006378022 101
182 3300005340 Ga0070689_100716192 Ga0070689_1007161922 101
183 3300005340 Ga0070689_101154374 Ga0070689_1011543742 101
184 3300005340 Ga0070689_101535762 Ga0070689_1015357622 101
185 3300005340 Ga0070689_101911853 Ga0070689_1019118531 101
186 3300005340 Ga0070689_102207920 Ga0070689_1022079201 101
187 3300005341 Ga0070691_10156292 Ga0070691_101562922 101
188 3300005341 Ga0070691_10687349 Ga0070691_106873492 101
189 3300005343 Ga0070687_100001280 Ga0070687_1000012805 101
190 3300005343 Ga0070687_100005475 Ga0070687_1000054754 101
191 3300005343 Ga0070687_100051453 Ga0070687_1000514531 101
192 3300005343 Ga0070687_100075897 Ga0070687_1000758972 101
193 3300005343 Ga0070687_100102940 Ga0070687_1001029401 101
194 3300005343 Ga0070687_100118644 Ga0070687_1001186442 101
195 3300005343 Ga0070687_100376295 Ga0070687_1003762952 101
196 3300005343 Ga0070687_100472100 Ga0070687_1004721002 101
197 3300005343 Ga0070687_100509146 Ga0070687_1005091462 101
198 3300005343 Ga0070687_100621406 Ga0070687_1006214062 101
199 3300005343 Ga0070687_101417580 Ga0070687_1014175802 101
200 3300005343 Ga0070687_101422487 Ga0070687_1014224871 101
201 3300005344 Ga0070661_100026088 Ga0070661_1000260883 101
202 3300005344 Ga0070661_100480548 Ga0070661_1004805482 101
203 3300005345 Ga0070692_10013187 Ga0070692_100131874 101
204 3300005345 Ga0070692_10043003 Ga0070692_100430032 101
205 3300005345 Ga0070692_10097898 Ga0070692_100978982 101
206 3300005345 Ga0070692_10099557 Ga0070692_100995572 101
207 3300005345 Ga0070692_10153086 Ga0070692_101530861 101
208 3300005345 Ga0070692_10356289 Ga0070692_103562892 101
209 3300005345 Ga0070692_10405530 Ga0070692_104055301 101
210 3300005345 Ga0070692_10602896 Ga0070692_106028962 101
211 3300005345 Ga0070692_10791816 Ga0070692_107918162 101
212 3300005345 Ga0070692_10854210 Ga0070692_108542102 101
213 3300005345 Ga0070692_10990104 Ga0070692_109901042 101
214 3300005345 Ga0070692_11015145 Ga0070692_110151452 101
215 3300005347 Ga0070668_100181198 Ga0070668_1001811982 101
216 3300005347 Ga0070668_101848989 Ga0070668_1018489892 101
217 3300005353 Ga0070669_100024991 Ga0070669_1000249913 101
218 3300005353 Ga0070669_100044898 Ga0070669_1000448983 101
219 3300005353 Ga0070669_100145067 Ga0070669_1001450673 101
220 3300005353 Ga0070669_100243196 Ga0070669_1002431962 101
221 3300005353 Ga0070669_100369603 Ga0070669_1003696032 101
222 3300005353 Ga0070669_100393382 Ga0070669_1003933822 101
223 3300005353 Ga0070669_100812964 Ga0070669_1008129642 101
224 3300005353 Ga0070669_101042255 Ga0070669_1010422551 101
225 3300005353 Ga0070669_101091608 Ga0070669_1010916081 101
226 3300005353 Ga0070669_101202936 Ga0070669_1012029361 101
227 3300005354 Ga0070675_100015185 Ga0070675_1000151851 101
228 3300005354 Ga0070675_100178586 Ga0070675_1001785863 101
229 3300005354 Ga0070675_100213945 Ga0070675_1002139452 101
230 3300005354 Ga0070675_100469841 Ga0070675_1004698412 101
231 3300005354 Ga0070675_100597089 Ga0070675_1005970892 101
232 3300005354 Ga0070675_101910581 Ga0070675_1019105812 101
233 3300005355 Ga0070671_100043258 Ga0070671_1000432584 101
234 3300005355 Ga0070671_100121702 Ga0070671_1001217023 101
235 3300005355 Ga0070671_100159731 Ga0070671_1001597311 101
236 3300005355 Ga0070671_100408563 Ga0070671_1004085632 101
237 3300005355 Ga0070671_101810345 Ga0070671_1018103451 101
238 3300005356 Ga0070674_100062849 Ga0070674_1000628494 101
239 3300005356 Ga0070674_100166482 Ga0070674_1001664823 101
240 3300005356 Ga0070674_100279945 Ga0070674_1002799452 101
241 3300005356 Ga0070674_100628823 Ga0070674_1006288232 101
242 3300005364 Ga0070673_100019365 Ga0070673_1000193655 101
243 3300005364 Ga0070673_100036161 Ga0070673_1000361612 101
244 3300005364 Ga0070673_100066612 Ga0070673_1000666123 101
245 3300005364 Ga0070673_100121207 Ga0070673_1001212072 101
246 3300005364 Ga0070673_100527392 Ga0070673_1005273922 101
247 3300005364 Ga0070673_100680429 Ga0070673_1006804292 101
248 3300005364 Ga0070673_100814867 Ga0070673_1008148672 101
249 3300005364 Ga0070673_101494572 Ga0070673_1014945722 101
250 3300005364 Ga0070673_101592580 Ga0070673_1015925801 101
251 3300005365 Ga0070688_100025051 Ga0070688_1000250513 101
252 3300005365 Ga0070688_100308085 Ga0070688_1003080852 101
253 3300005365 Ga0070688_100567728 Ga0070688_1005677281 101
254 3300005366 Ga0070659_100006843 Ga0070659_10000684312 101
255 3300005366 Ga0070659_100124171 Ga0070659_1001241714 101
256 3300005367 Ga0070667_100016675 Ga0070667_10001667511 101
257 3300005367 Ga0070667_100161024 Ga0070667_1001610243 101
258 3300005367 Ga0070667_100471490 Ga0070667_1004714902 101
259 3300005406 Ga0070703_10008541 Ga0070703_100085412 101
260 3300005434 Ga0070709_10254309 Ga0070709_102543092 101
261 3300005434 Ga0070709_10452157 Ga0070709_104521572 101
262 3300005434 Ga0070709_10496300 Ga0070709_104963002 101
263 3300005438 Ga0070701_10020650 Ga0070701_100206505 101
264 3300005438 Ga0070701_10095568 Ga0070701_100955682 101
265 3300005438 Ga0070701_10117371 Ga0070701_101173712 101
266 3300005438 Ga0070701_10305432 Ga0070701_103054322 101
267 3300005438 Ga0070701_10625076 Ga0070701_106250761 101
268 3300005438 Ga0070701_11260548 Ga0070701_112605482 101
269 3300005440 Ga0070705_100019989 Ga0070705_1000199895 101
270 3300005440 Ga0070705_100081331 Ga0070705_1000813313 101
271 3300005440 Ga0070705_100158410 Ga0070705_1001584102 101
272 3300005440 Ga0070705_100250537 Ga0070705_1002505372 101
273 3300005440 Ga0070705_100267130 Ga0070705_1002671302 101
274 3300005440 Ga0070705_100306813 Ga0070705_1003068132 101
275 3300005440 Ga0070705_100334044 Ga0070705_1003340441 101
276 3300005440 Ga0070705_100349319 Ga0070705_1003493192 101
277 3300005440 Ga0070705_100448173 Ga0070705_1004481732 101
278 3300005440 Ga0070705_100463399 Ga0070705_1004633992 101
279 3300005440 Ga0070705_100523076 Ga0070705_1005230762 101
280 3300005440 Ga0070705_100584198 Ga0070705_1005841982 101
281 3300005440 Ga0070705_100969906 Ga0070705_1009699061 101
282 3300005440 Ga0070705_101629188 Ga0070705_1016291882 101
283 3300005440 Ga0070705_101677144 Ga0070705_1016771441 101
284 3300005440 Ga0070705_101758372 Ga0070705_1017583721 101
285 3300005441 Ga0070700_100007443 Ga0070700_1000074433 101
286 3300005441 Ga0070700_100007662 Ga0070700_1000076622 101
287 3300005441 Ga0070700_100010740 Ga0070700_1000107402 101
288 3300005441 Ga0070700_100032963 Ga0070700_1000329634 101
289 3300005441 Ga0070700_100109728 Ga0070700_1001097282 101
290 3300005441 Ga0070700_100167857 Ga0070700_1001678572 101
291 3300005441 Ga0070700_100185187 Ga0070700_1001851872 101
292 3300005441 Ga0070700_100186032 Ga0070700_1001860322 101
293 3300005441 Ga0070700_100248044 Ga0070700_1002480442 101
294 3300005441 Ga0070700_100249325 Ga0070700_1002493252 101
295 3300005441 Ga0070700_100255918 Ga0070700_1002559182 101
296 3300005441 Ga0070700_101161134 Ga0070700_1011611341 101
297 3300005441 Ga0070700_101569682 Ga0070700_1015696821 101
298 3300005444 Ga0070694_100001132 Ga0070694_1000011325 101
299 3300005444 Ga0070694_100021310 Ga0070694_1000213102 101
300 3300005444 Ga0070694_100025186 Ga0070694_1000251864 101
301 3300005444 Ga0070694_100038084 Ga0070694_1000380843 101
302 3300005444 Ga0070694_100040501 Ga0070694_1000405014 101
303 3300005444 Ga0070694_100082686 Ga0070694_1000826863 101
304 3300005444 Ga0070694_100082917 Ga0070694_1000829174 101
305 3300005444 Ga0070694_100147552 Ga0070694_1001475521 101
306 3300005444 Ga0070694_100234656 Ga0070694_1002346562 101
307 3300005444 Ga0070694_100303807 Ga0070694_1003038072 101
308 3300005444 Ga0070694_100409214 Ga0070694_1004092142 101
309 3300005444 Ga0070694_100435400 Ga0070694_1004354002 101
310 3300005444 Ga0070694_100452825 Ga0070694_1004528252 101
311 3300005444 Ga0070694_100457609 Ga0070694_1004576092 101
312 3300005444 Ga0070694_100679484 Ga0070694_1006794842 101
313 3300005444 Ga0070694_100813688 Ga0070694_1008136881 101
314 3300005444 Ga0070694_101321686 Ga0070694_1013216862 101
315 3300005444 Ga0070694_101457538 Ga0070694_1014575382 101
316 3300005444 Ga0070694_101619422 Ga0070694_1016194221 101
317 3300005445 Ga0070708_100000800 Ga0070708_10000080035 101
318 3300005445 Ga0070708_100030539 Ga0070708_1000305395 101
319 3300005445 Ga0070708_100094081 Ga0070708_1000940811 101
320 3300005445 Ga0070708_100098732 Ga0070708_1000987322 101
321 3300005445 Ga0070708_100139947 Ga0070708_1001399472 101
322 3300005445 Ga0070708_100148199 Ga0070708_1001481992 101
323 3300005445 Ga0070708_100150074 Ga0070708_1001500744 101
324 3300005445 Ga0070708_100160507 Ga0070708_1001605072 101
325 3300005445 Ga0070708_101007153 Ga0070708_1010071532 101
326 3300005445 Ga0070708_101273461 Ga0070708_1012734612 101
327 3300005445 Ga0070708_101600920 Ga0070708_1016009202 101
328 3300005445 Ga0070708_101851823 Ga0070708_1018518231 101
329 3300005455 Ga0070663_100822117 Ga0070663_1008221172 101
330 3300005456 Ga0070678_100381356 Ga0070678_1003813562 101
331 3300005457 Ga0070662_100126474 Ga0070662_1001264742 101
332 3300005457 Ga0070662_100150164 Ga0070662_1001501642 101
333 3300005457 Ga0070662_100204989 Ga0070662_1002049893 101
334 3300005457 Ga0070662_100457869 Ga0070662_1004578692 101
335 3300005457 Ga0070662_100802692 Ga0070662_1008026921 101
336 3300005457 Ga0070662_101253695 Ga0070662_1012536952 101
337 3300005458 Ga0070681_10001635 Ga0070681_1000163533 101
338 3300005458 Ga0070681_10013006 Ga0070681_1001300614 101
339 3300005458 Ga0070681_10026109 Ga0070681_100261097 101
340 3300005458 Ga0070681_10066843 Ga0070681_100668435 101
341 3300005458 Ga0070681_10389873 Ga0070681_103898732 101
342 3300005458 Ga0070681_10790614 Ga0070681_107906142 101
343 3300005458 Ga0070681_11166369 Ga0070681_111663691 101
344 3300005459 Ga0068867_100025248 Ga0068867_1000252485 101
345 3300005459 Ga0068867_100159867 Ga0068867_1001598674 101
346 3300005459 Ga0068867_100462074 Ga0068867_1004620742 101
347 3300005459 Ga0068867_100516784 Ga0068867_1005167841 101
348 3300005459 Ga0068867_100607492 Ga0068867_1006074921 101
349 3300005459 Ga0068867_100647288 Ga0068867_1006472882 101
350 3300005459 Ga0068867_100682909 Ga0068867_1006829092 101
351 3300005459 Ga0068867_100834508 Ga0068867_1008345081 101
352 3300005459 Ga0068867_101108539 Ga0068867_1011085392 101
353 3300005459 Ga0068867_101458477 Ga0068867_1014584771 101
354 3300005459 Ga0068867_102000683 Ga0068867_1020006832 101
355 3300005466 Ga0070685_10022558 Ga0070685_100225584 101
356 3300005466 Ga0070685_10193820 Ga0070685_101938203 101
357 3300005466 Ga0070685_10379263 Ga0070685_103792631 101
358 3300005467 Ga0070706_100004882 Ga0070706_1000048825 101
359 3300005467 Ga0070706_100005015 Ga0070706_1000050155 101
360 3300005467 Ga0070706_100014378 Ga0070706_1000143784 101
361 3300005467 Ga0070706_100037903 Ga0070706_1000379032 101
362 3300005467 Ga0070706_100041097 Ga0070706_1000410974 101
363 3300005467 Ga0070706_100087123 Ga0070706_1000871233 101
364 3300005467 Ga0070706_100161309 Ga0070706_1001613092 101
365 3300005467 Ga0070706_100353370 Ga0070706_1003533702 101
366 3300005467 Ga0070706_100461378 Ga0070706_1004613782 101
367 3300005467 Ga0070706_100782388 Ga0070706_1007823881 101
368 3300005467 Ga0070706_101269808 Ga0070706_1012698081 101
369 3300005468 Ga0070707_100011296 Ga0070707_10001129613 101
370 3300005468 Ga0070707_100011823 Ga0070707_1000118235 101
371 3300005468 Ga0070707_100016203 Ga0070707_1000162032 101
372 3300005468 Ga0070707_100022361 Ga0070707_1000223615 101
373 3300005468 Ga0070707_100036363 Ga0070707_1000363636 101
374 3300005468 Ga0070707_100042636 Ga0070707_1000426365 101
375 3300005468 Ga0070707_100119489 Ga0070707_1001194892 101
376 3300005468 Ga0070707_100145294 Ga0070707_1001452942 101
377 3300005468 Ga0070707_100191556 Ga0070707_1001915561 101
378 3300005468 Ga0070707_100199193 Ga0070707_1001991933 101
379 3300005468 Ga0070707_100325095 Ga0070707_1003250952 101
380 3300005468 Ga0070707_100957278 Ga0070707_1009572781 101
381 3300005468 Ga0070707_101109428 Ga0070707_1011094282 101
382 3300005468 Ga0070707_101296254 Ga0070707_1012962542 101
383 3300005468 Ga0070707_101580401 Ga0070707_1015804011 101
384 3300005468 Ga0070707_101969377 Ga0070707_1019693771 101
385 3300005471 Ga0070698_100000084 Ga0070698_10000008479 101
386 3300005471 Ga0070698_100007334 Ga0070698_1000073343 101
387 3300005471 Ga0070698_100022297 Ga0070698_1000222972 101
388 3300005471 Ga0070698_100029543 Ga0070698_1000295436 101
389 3300005471 Ga0070698_100033968 Ga0070698_1000339684 101
390 3300005471 Ga0070698_100036446 Ga0070698_1000364466 101
391 3300005471 Ga0070698_100067661 Ga0070698_1000676612 101
392 3300005471 Ga0070698_100069158 Ga0070698_1000691584 101
393 3300005471 Ga0070698_100112639 Ga0070698_1001126392 101
394 3300005471 Ga0070698_100627660 Ga0070698_1006276602 101
395 3300005471 Ga0070698_100825049 Ga0070698_1008250491 101
396 3300005471 Ga0070698_100956516 Ga0070698_1009565162 101
397 3300005471 Ga0070698_101015813 Ga0070698_1010158131 101
398 3300005471 Ga0070698_101175906 Ga0070698_1011759062 101
399 3300005471 Ga0070698_101836735 Ga0070698_1018367351 101
400 3300005518 Ga0070699_100000199 Ga0070699_10000019955 101
401 3300005518 Ga0070699_100018887 Ga0070699_1000188879 101
402 3300005518 Ga0070699_100024447 Ga0070699_1000244476 101
403 3300005518 Ga0070699_100030361 Ga0070699_1000303612 101
404 3300005518 Ga0070699_100100985 Ga0070699_1001009853 101
405 3300005518 Ga0070699_100223340 Ga0070699_1002233402 101
406 3300005518 Ga0070699_100338004 Ga0070699_1003380043 101
407 3300005518 Ga0070699_100466812 Ga0070699_1004668122 101
408 3300005518 Ga0070699_100575740 Ga0070699_1005757402 101
409 3300005518 Ga0070699_100700085 Ga0070699_1007000852 101
410 3300005518 Ga0070699_100797818 Ga0070699_1007978181 101
411 3300005518 Ga0070699_100949446 Ga0070699_1009494461 101
412 3300005518 Ga0070699_101032986 Ga0070699_1010329862 101
413 3300005518 Ga0070699_101144846 Ga0070699_1011448462 101
414 3300005518 Ga0070699_101338765 Ga0070699_1013387652 101
415 3300005518 Ga0070699_101779235 Ga0070699_1017792352 101
416 3300005530 Ga0070679_100000395 Ga0070679_10000039548 101
417 3300005530 Ga0070679_100002779 Ga0070679_1000027799 101
418 3300005530 Ga0070679_100524185 Ga0070679_1005241852 101
419 3300005530 Ga0070679_100631962 Ga0070679_1006319622 101
420 3300005535 Ga0070684_100256717 Ga0070684_1002567173 101
421 3300005535 Ga0070684_100617619 Ga0070684_1006176192 101
422 3300005536 Ga0070697_100000690 Ga0070697_1000006904 101
423 3300005536 Ga0070697_100006353 Ga0070697_1000063535 101
424 3300005536 Ga0070697_100033839 Ga0070697_1000338395 101
425 3300005536 Ga0070697_100045159 Ga0070697_1000451593 101
426 3300005536 Ga0070697_100071606 Ga0070697_1000716065 101
427 3300005536 Ga0070697_100074747 Ga0070697_1000747474 101
428 3300005536 Ga0070697_100168436 Ga0070697_1001684362 101
429 3300005536 Ga0070697_100204103 Ga0070697_1002041032 101
430 3300005536 Ga0070697_100231428 Ga0070697_1002314281 101
431 3300005536 Ga0070697_100545210 Ga0070697_1005452101 101
432 3300005536 Ga0070697_100680579 Ga0070697_1006805792 101
433 3300005536 Ga0070697_100886615 Ga0070697_1008866151 101
434 3300005536 Ga0070697_101036248 Ga0070697_1010362482 101
435 3300005536 Ga0070697_101060926 Ga0070697_1010609261 101
436 3300005536 Ga0070697_101060975 Ga0070697_1010609751 101
437 3300005536 Ga0070697_102029776 Ga0070697_1020297761 101
438 3300005539 Ga0068853_100017145 Ga0068853_1000171453 101
439 3300005539 Ga0068853_100026578 Ga0068853_1000265785 101
440 3300005539 Ga0068853_100184066 Ga0068853_1001840662 101
441 3300005539 Ga0068853_100353415 Ga0068853_1003534153 101
442 3300005539 Ga0068853_100923090 Ga0068853_1009230902 101
443 3300005539 Ga0068853_100991546 Ga0068853_1009915462 101
444 3300005539 Ga0068853_101760051 Ga0068853_1017600511 101
445 3300005539 Ga0068853_101935388 Ga0068853_1019353881 101
446 3300005539 Ga0068853_102392916 Ga0068853_1023929161 101
447 3300005543 Ga0070672_100167770 Ga0070672_1001677702 101
448 3300005543 Ga0070672_100188509 Ga0070672_1001885092 101
449 3300005543 Ga0070672_100435501 Ga0070672_1004355012 101
450 3300005543 Ga0070672_100513181 Ga0070672_1005131812 101
451 3300005543 Ga0070672_100832626 Ga0070672_1008326262 101
452 3300005543 Ga0070672_101168069 Ga0070672_1011680692 101
453 3300005543 Ga0070672_102007857 Ga0070672_1020078572 101
454 3300005544 Ga0070686_100015416 Ga0070686_1000154164 101
455 3300005544 Ga0070686_100016099 Ga0070686_1000160995 101
456 3300005544 Ga0070686_100093082 Ga0070686_1000930822 101
457 3300005544 Ga0070686_100099757 Ga0070686_1000997573 101
458 3300005544 Ga0070686_100141243 Ga0070686_1001412432 101
459 3300005544 Ga0070686_100338717 Ga0070686_1003387172 101
460 3300005544 Ga0070686_100457978 Ga0070686_1004579782 101
461 3300005544 Ga0070686_101429964 Ga0070686_1014299641 101
462 3300005544 Ga0070686_101622168 Ga0070686_1016221682 101
463 3300005545 Ga0070695_100029337 Ga0070695_1000293375 101
464 3300005545 Ga0070695_100039206 Ga0070695_1000392065 101
465 3300005545 Ga0070695_100049920 Ga0070695_1000499205 101
466 3300005545 Ga0070695_100106428 Ga0070695_1001064282 101
467 3300005545 Ga0070695_100106801 Ga0070695_1001068012 101
468 3300005545 Ga0070695_100184353 Ga0070695_1001843532 101
469 3300005545 Ga0070695_100204705 Ga0070695_1002047052 101
470 3300005545 Ga0070695_100206044 Ga0070695_1002060442 101
471 3300005545 Ga0070695_100447047 Ga0070695_1004470472 101
472 3300005545 Ga0070695_100493605 Ga0070695_1004936052 101
473 3300005545 Ga0070695_100594177 Ga0070695_1005941772 101
474 3300005545 Ga0070695_101004380 Ga0070695_1010043802 101
475 3300005545 Ga0070695_101055842 Ga0070695_1010558421 101
476 3300005545 Ga0070695_101178042 Ga0070695_1011780422 101
477 3300005545 Ga0070695_101886385 Ga0070695_1018863852 101
478 3300005546 Ga0070696_100006539 Ga0070696_10000653910 101
479 3300005546 Ga0070696_100009227 Ga0070696_10000922710 101
480 3300005546 Ga0070696_100106168 Ga0070696_1001061684 101
481 3300005546 Ga0070696_100106813 Ga0070696_1001068132 101
482 3300005546 Ga0070696_100116658 Ga0070696_1001166582 101
483 3300005546 Ga0070696_100173710 Ga0070696_1001737102 101
484 3300005546 Ga0070696_100232775 Ga0070696_1002327752 101
485 3300005546 Ga0070696_100337080 Ga0070696_1003370802 101
486 3300005546 Ga0070696_100371254 Ga0070696_1003712542 101
487 3300005546 Ga0070696_100584087 Ga0070696_1005840872 101
488 3300005546 Ga0070696_100650456 Ga0070696_1006504562 101
489 3300005546 Ga0070696_100753910 Ga0070696_1007539102 101
490 3300005546 Ga0070696_101063507 Ga0070696_1010635071 101
491 3300005546 Ga0070696_101231737 Ga0070696_1012317371 101
492 3300005547 Ga0070693_100118069 Ga0070693_1001180693 101
493 3300005547 Ga0070693_100131046 Ga0070693_1001310461 101
494 3300005547 Ga0070693_100177605 Ga0070693_1001776052 101
495 3300005547 Ga0070693_100256851 Ga0070693_1002568511 101
496 3300005547 Ga0070693_100391846 Ga0070693_1003918462 101
497 3300005547 Ga0070693_100622967 Ga0070693_1006229672 101
498 3300005547 Ga0070693_101041329 Ga0070693_1010413291 101
499 3300005547 Ga0070693_101196169 Ga0070693_1011961692 101
500 3300005548 Ga0070665_100028770 Ga0070665_1000287703 101
501 3300005548 Ga0070665_100266433 Ga0070665_1002664332 101
502 3300005548 Ga0070665_100827191 Ga0070665_1008271911 101
503 3300005549 Ga0070704_100014713 Ga0070704_1000147132 101
504 3300005549 Ga0070704_100070461 Ga0070704_1000704615 101
505 3300005549 Ga0070704_100080500 Ga0070704_1000805003 101
506 3300005549 Ga0070704_100095102 Ga0070704_1000951024 101
507 3300005549 Ga0070704_100113589 Ga0070704_1001135892 101
508 3300005549 Ga0070704_100150343 Ga0070704_1001503432 101
509 3300005549 Ga0070704_100162690 Ga0070704_1001626902 101
510 3300005549 Ga0070704_100195550 Ga0070704_1001955502 101
511 3300005549 Ga0070704_100199543 Ga0070704_1001995432 101
512 3300005549 Ga0070704_100259951 Ga0070704_1002599511 101
513 3300005549 Ga0070704_100261702 Ga0070704_1002617021 101
514 3300005549 Ga0070704_100383567 Ga0070704_1003835672 101
515 3300005549 Ga0070704_100406322 Ga0070704_1004063222 101
516 3300005549 Ga0070704_100425847 Ga0070704_1004258472 101
517 3300005549 Ga0070704_100555276 Ga0070704_1005552762 101
518 3300005549 Ga0070704_100580673 Ga0070704_1005806732 101
519 3300005549 Ga0070704_100606290 Ga0070704_1006062902 101
520 3300005549 Ga0070704_100734570 Ga0070704_1007345702 101
521 3300005549 Ga0070704_100934435 Ga0070704_1009344352 101
522 3300005549 Ga0070704_100988317 Ga0070704_1009883172 101
523 3300005549 Ga0070704_101027947 Ga0070704_1010279472 101
524 3300005549 Ga0070704_101496021 Ga0070704_1014960211 101
525 3300005549 Ga0070704_101836909 Ga0070704_1018369092 101
526 3300005563 Ga0068855_100529630 Ga0068855_1005296303 101
527 3300005563 Ga0068855_100607065 Ga0068855_1006070652 101
528 3300005564 Ga0070664_100093079 Ga0070664_1000930792 101
529 3300005564 Ga0070664_100184980 Ga0070664_1001849803 101
530 3300005564 Ga0070664_100284137 Ga0070664_1002841371 101
531 3300005564 Ga0070664_100287459 Ga0070664_1002874592 101
532 3300005564 Ga0070664_100382720 Ga0070664_1003827201 101
533 3300005564 Ga0070664_100584601 Ga0070664_1005846012 101
534 3300005564 Ga0070664_100855610 Ga0070664_1008556102 101
535 3300005564 Ga0070664_100879533 Ga0070664_1008795332 101
536 3300005564 Ga0070664_101807214 Ga0070664_1018072142 101
537 3300005577 Ga0068857_100005330 Ga0068857_1000053305 101
538 3300005577 Ga0068857_100129039 Ga0068857_1001290393 101
539 3300005577 Ga0068857_100187088 Ga0068857_1001870882 101
540 3300005577 Ga0068857_100266390 Ga0068857_1002663902 101
541 3300005577 Ga0068857_100300174 Ga0068857_1003001742 101
542 3300005577 Ga0068857_100776962 Ga0068857_1007769622 101
543 3300005577 Ga0068857_100868577 Ga0068857_1008685772 101
544 3300005577 Ga0068857_101247240 Ga0068857_1012472402 101
545 3300005577 Ga0068857_101474381 Ga0068857_1014743812 101
546 3300005577 Ga0068857_101518796 Ga0068857_1015187961 101
547 3300005577 Ga0068857_102162131 Ga0068857_1021621311 101
548 3300005577 Ga0068857_102446133 Ga0068857_1024461331 101
549 3300005578 Ga0068854_100068497 Ga0068854_1000684974 101
550 3300005578 Ga0068854_100126375 Ga0068854_1001263754 101
551 3300005578 Ga0068854_100202778 Ga0068854_1002027782 101
552 3300005578 Ga0068854_100308977 Ga0068854_1003089771 101
553 3300005578 Ga0068854_100314424 Ga0068854_1003144241 101
554 3300005578 Ga0068854_100375959 Ga0068854_1003759592 101
555 3300005578 Ga0068854_100480009 Ga0068854_1004800092 101
556 3300005578 Ga0068854_101200783 Ga0068854_1012007832 101
557 3300005578 Ga0068854_101379281 Ga0068854_1013792812 101
558 3300005578 Ga0068854_101471464 Ga0068854_1014714641 101
559 3300005614 Ga0068856_100021866 Ga0068856_10002186610 101
560 3300005614 Ga0068856_100946753 Ga0068856_1009467532 101
561 3300005615 Ga0070702_100016163 Ga0070702_1000161632 101
562 3300005615 Ga0070702_100086109 Ga0070702_1000861092 101
563 3300005615 Ga0070702_100200828 Ga0070702_1002008282 101
564 3300005615 Ga0070702_100323568 Ga0070702_1003235682 101
565 3300005615 Ga0070702_100600193 Ga0070702_1006001932 101
566 3300005615 Ga0070702_101008714 Ga0070702_1010087141 101
567 3300005615 Ga0070702_101636429 Ga0070702_1016364292 101
568 3300005615 Ga0070702_101657207 Ga0070702_1016572072 101
569 3300005615 Ga0070702_101763485 Ga0070702_1017634851 101
570 3300005616 Ga0068852_100076037 Ga0068852_1000760374 101
571 3300005616 Ga0068852_100588516 Ga0068852_1005885162 101
572 3300005616 Ga0068852_100972951 Ga0068852_1009729512 101
573 3300005616 Ga0068852_101153232 Ga0068852_1011532321 101
574 3300005616 Ga0068852_101346873 Ga0068852_1013468732 101
575 3300005616 Ga0068852_101376516 Ga0068852_1013765162 101
576 3300005616 Ga0068852_101673499 Ga0068852_1016734991 101
577 3300005617 Ga0068859_100062276 Ga0068859_1000622765 101
578 3300005617 Ga0068859_100062451 Ga0068859_1000624516 101
579 3300005617 Ga0068859_100108338 Ga0068859_1001083382 101
580 3300005617 Ga0068859_100135988 Ga0068859_1001359883 101
581 3300005617 Ga0068859_100147283 Ga0068859_1001472833 101
582 3300005617 Ga0068859_100166045 Ga0068859_1001660453 101
583 3300005617 Ga0068859_100201229 Ga0068859_1002012292 101
584 3300005617 Ga0068859_100281311 Ga0068859_1002813112 101
585 3300005617 Ga0068859_100338139 Ga0068859_1003381393 101
586 3300005617 Ga0068859_100403200 Ga0068859_1004032002 101
587 3300005617 Ga0068859_100428773 Ga0068859_1004287732 101
588 3300005617 Ga0068859_100504714 Ga0068859_1005047142 101
589 3300005617 Ga0068859_100574549 Ga0068859_1005745491 101
590 3300005617 Ga0068859_100715517 Ga0068859_1007155172 101
591 3300005617 Ga0068859_100935161 Ga0068859_1009351612 101
592 3300005617 Ga0068859_100961946 Ga0068859_1009619462 101
593 3300005617 Ga0068859_100977687 Ga0068859_1009776872 101
594 3300005617 Ga0068859_101315718 Ga0068859_1013157182 101
595 3300005617 Ga0068859_101595310 Ga0068859_1015953102 101
596 3300005617 Ga0068859_101681669 Ga0068859_1016816691 101
597 3300005617 Ga0068859_101683119 Ga0068859_1016831192 101
598 3300005617 Ga0068859_101817866 Ga0068859_1018178662 101
599 3300005617 Ga0068859_102100977 Ga0068859_1021009772 101
600 3300005617 Ga0068859_102472765 Ga0068859_1024727651 101
601 3300005617 Ga0068859_102730219 Ga0068859_1027302191 101
602 3300005618 Ga0068864_100045153 Ga0068864_1000451534 101
603 3300005618 Ga0068864_100123415 Ga0068864_1001234152 101
604 3300005618 Ga0068864_100145091 Ga0068864_1001450913 101
605 3300005618 Ga0068864_100201597 Ga0068864_1002015972 101
606 3300005618 Ga0068864_100227811 Ga0068864_1002278112 101
607 3300005618 Ga0068864_100262503 Ga0068864_1002625032 101
608 3300005618 Ga0068864_100368150 Ga0068864_1003681502 101
609 3300005618 Ga0068864_100450042 Ga0068864_1004500422 101
610 3300005618 Ga0068864_100458950 Ga0068864_1004589502 101
611 3300005618 Ga0068864_100654906 Ga0068864_1006549062 101
612 3300005618 Ga0068864_100758028 Ga0068864_1007580282 101
613 3300005618 Ga0068864_100798184 Ga0068864_1007981842 101
614 3300005618 Ga0068864_100937716 Ga0068864_1009377161 101
615 3300005618 Ga0068864_101180645 Ga0068864_1011806452 101
616 3300005618 Ga0068864_101690914 Ga0068864_1016909142 101
617 3300005618 Ga0068864_101800990 Ga0068864_1018009902 101
618 3300005618 Ga0068864_101824525 Ga0068864_1018245252 101
619 3300005618 Ga0068864_102728101 Ga0068864_1027281012 101
620 3300005718 Ga0068866_10000684 Ga0068866_1000068414 101
621 3300005718 Ga0068866_10057264 Ga0068866_100572643 101
622 3300005718 Ga0068866_10479900 Ga0068866_104799002 101
623 3300005718 Ga0068866_11457357 Ga0068866_114573571 101
624 3300005719 Ga0068861_100012289 Ga0068861_1000122895 101
625 3300005719 Ga0068861_100023980 Ga0068861_1000239804 101
626 3300005719 Ga0068861_100042290 Ga0068861_1000422903 101
627 3300005719 Ga0068861_100308405 Ga0068861_1003084052 101
628 3300005719 Ga0068861_100342796 Ga0068861_1003427962 101
629 3300005719 Ga0068861_100350527 Ga0068861_1003505272 101
630 3300005719 Ga0068861_100476995 Ga0068861_1004769952 101
631 3300005719 Ga0068861_100513468 Ga0068861_1005134681 101
632 3300005719 Ga0068861_100801240 Ga0068861_1008012402 101
633 3300005719 Ga0068861_100905690 Ga0068861_1009056902 101
634 3300005719 Ga0068861_100909435 Ga0068861_1009094352 101
635 3300005719 Ga0068861_101433214 Ga0068861_1014332142 101
636 3300005719 Ga0068861_101591211 Ga0068861_1015912112 101
637 3300005719 Ga0068861_102031372 Ga0068861_1020313722 101
638 3300005834 Ga0068851_10022997 Ga0068851_100229974 101
639 3300005834 Ga0068851_10432576 Ga0068851_104325762 101
640 3300005834 Ga0068851_11087756 Ga0068851_110877562 101
641 3300005840 Ga0068870_10012226 Ga0068870_100122262 101
642 3300005840 Ga0068870_10159976 Ga0068870_101599762 101
643 3300005840 Ga0068870_10472440 Ga0068870_104724402 101
644 3300005840 Ga0068870_10716932 Ga0068870_107169322 101
645 3300005840 Ga0068870_11021255 Ga0068870_110212551 101
646 3300005841 Ga0068863_100026872 Ga0068863_10002687211 101
647 3300005841 Ga0068863_100083000 Ga0068863_1000830005 101
648 3300005841 Ga0068863_100320116 Ga0068863_1003201162 101
649 3300005841 Ga0068863_100326198 Ga0068863_1003261982 101
650 3300005841 Ga0068863_100357756 Ga0068863_1003577562 101
651 3300005841 Ga0068863_100383026 Ga0068863_1003830262 101
652 3300005841 Ga0068863_100535282 Ga0068863_1005352822 101
653 3300005841 Ga0068863_100722764 Ga0068863_1007227642 101
654 3300005841 Ga0068863_100746215 Ga0068863_1007462152 101
655 3300005841 Ga0068863_100761277 Ga0068863_1007612772 101
656 3300005841 Ga0068863_100977751 Ga0068863_1009777512 101
657 3300005841 Ga0068863_101425753 Ga0068863_1014257532 101
658 3300005841 Ga0068863_101585153 Ga0068863_1015851532 101
659 3300005841 Ga0068863_101940714 Ga0068863_1019407141 101
660 3300005842 Ga0068858_100001829 Ga0068858_1000018295 101
661 3300005842 Ga0068858_100023347 Ga0068858_1000233475 101
662 3300005842 Ga0068858_100036674 Ga0068858_1000366743 101
663 3300005842 Ga0068858_100047238 Ga0068858_1000472384 101
664 3300005842 Ga0068858_100079267 Ga0068858_1000792674 101
665 3300005842 Ga0068858_100141300 Ga0068858_1001413001 101
666 3300005842 Ga0068858_100160778 Ga0068858_1001607784 101
667 3300005842 Ga0068858_100487683 Ga0068858_1004876831 101
668 3300005842 Ga0068858_100542570 Ga0068858_1005425702 101
669 3300005842 Ga0068858_100619565 Ga0068858_1006195652 101
670 3300005842 Ga0068858_100646196 Ga0068858_1006461962 101
671 3300005842 Ga0068858_100675272 Ga0068858_1006752721 101
672 3300005842 Ga0068858_100792243 Ga0068858_1007922432 101
673 3300005842 Ga0068858_101261334 Ga0068858_1012613342 101
674 3300005842 Ga0068858_101646526 Ga0068858_1016465262 101
675 3300005842 Ga0068858_102151029 Ga0068858_1021510291 101
676 3300005842 Ga0068858_102253181 Ga0068858_1022531811 101
677 3300005842 Ga0068858_102499757 Ga0068858_1024997571 101
678 3300005843 Ga0068860_100051201 Ga0068860_1000512012 101
679 3300005843 Ga0068860_100106853 Ga0068860_1001068532 101
680 3300005843 Ga0068860_100109863 Ga0068860_1001098632 101
681 3300005843 Ga0068860_100148397 Ga0068860_1001483972 101
682 3300005843 Ga0068860_100244712 Ga0068860_1002447122 101
683 3300005843 Ga0068860_100258331 Ga0068860_1002583311 101
684 3300005843 Ga0068860_100331116 Ga0068860_1003311162 101
685 3300005843 Ga0068860_100425352 Ga0068860_1004253522 101
686 3300005843 Ga0068860_100492019 Ga0068860_1004920192 101
687 3300005843 Ga0068860_100515379 Ga0068860_1005153793 101
688 3300005843 Ga0068860_100603635 Ga0068860_1006036353 101
689 3300005843 Ga0068860_100850880 Ga0068860_1008508802 101
690 3300005843 Ga0068860_100945932 Ga0068860_1009459322 101
691 3300005843 Ga0068860_101524930 Ga0068860_1015249302 101
692 3300005843 Ga0068860_101903104 Ga0068860_1019031042 101
693 3300005843 Ga0068860_102003191 Ga0068860_1020031912 101
694 3300005843 Ga0068860_102422672 Ga0068860_1024226721 101
695 3300005843 Ga0068860_102643063 Ga0068860_1026430632 101
696 3300005844 Ga0068862_100058564 Ga0068862_1000585642 101
697 3300005844 Ga0068862_100062012 Ga0068862_1000620125 101
698 3300005844 Ga0068862_100124763 Ga0068862_1001247633 101
699 3300005844 Ga0068862_100296367 Ga0068862_1002963672 101
700 3300005844 Ga0068862_100869420 Ga0068862_1008694202 101
701 3300005844 Ga0068862_101111890 Ga0068862_1011118902 101
702 3300005844 Ga0068862_101117655 Ga0068862_1011176552 101
703 3300005844 Ga0068862_101221828 Ga0068862_1012218281 101
704 3300005844 Ga0068862_101363008 Ga0068862_1013630082 101
705 3300005844 Ga0068862_101524697 Ga0068862_1015246972 101
706 3300005844 Ga0068862_101650145 Ga0068862_1016501452 101
707 3300005844 Ga0068862_101663340 Ga0068862_1016633401 101
708 3300005844 Ga0068862_102468753 Ga0068862_1024687531 101
709 3300005937 Ga0081455_10429463 Ga0081455_104294631 101
710 3300005985 Ga0081539_10000395 Ga0081539_1000039548 101
711 3300005985 Ga0081539_10000660 Ga0081539_100006605 101
712 3300005985 Ga0081539_10005021 Ga0081539_100050215 101
713 3300005985 Ga0081539_10006228 Ga0081539_1000622818 101
714 3300005985 Ga0081539_10059129 Ga0081539_100591294 101
715 3300005985 Ga0081539_10089483 Ga0081539_100894832 101
716 3300005985 Ga0081539_10090943 Ga0081539_100909432 101
717 3300005985 Ga0081539_10202377 Ga0081539_102023771 101
718 3300006163 Ga0070715_10000038 Ga0070715_1000003874 101
719 3300006163 Ga0070715_10267807 Ga0070715_102678071 101
720 3300006163 Ga0070715_10696992 Ga0070715_106969921 101
721 3300006173 Ga0070716_100000006 Ga0070716_100000006250 101
722 3300006173 Ga0070716_100142480 Ga0070716_1001424802 101
723 3300006173 Ga0070716_100373334 Ga0070716_1003733342 101
724 3300006173 Ga0070716_100524580 Ga0070716_1005245801 101
725 3300006173 Ga0070716_100695730 Ga0070716_1006957301 101
726 3300006195 Ga0075366_10693484 Ga0075366_106934841 101
727 3300006237 Ga0097621_100008417 Ga0097621_10000841715 101
728 3300006237 Ga0097621_100012663 Ga0097621_1000126635 101
729 3300006237 Ga0097621_100222114 Ga0097621_1002221142 101
730 3300006237 Ga0097621_100981206 Ga0097621_1009812062 101
731 3300006358 Ga0068871_100049076 Ga0068871_1000490764 101
732 3300006358 Ga0068871_100058549 Ga0068871_1000585492 101
733 3300006358 Ga0068871_100060888 Ga0068871_1000608882 101
734 3300006358 Ga0068871_100226864 Ga0068871_1002268643 101
735 3300006358 Ga0068871_100351674 Ga0068871_1003516742 101
736 3300006358 Ga0068871_100820083 Ga0068871_1008200832 101
737 3300006358 Ga0068871_100851665 Ga0068871_1008516652 101
738 3300006358 Ga0068871_100957430 Ga0068871_1009574301 101
739 3300006358 Ga0068871_101464783 Ga0068871_1014647832 101
740 3300006844 Ga0075428_100046173 Ga0075428_1000461736 101
741 3300006844 Ga0075428_100378886 Ga0075428_1003788862 101
742 3300006844 Ga0075428_100409149 Ga0075428_1004091492 101
743 3300006844 Ga0075428_100891609 Ga0075428_1008916092 101
744 3300006844 Ga0075428_101067530 Ga0075428_1010675302 101
745 3300006844 Ga0075428_101165970 Ga0075428_1011659702 101
746 3300006846 Ga0075430_100073963 Ga0075430_1000739632 101
747 3300006846 Ga0075430_100197209 Ga0075430_1001972092 101
748 3300006846 Ga0075430_100732752 Ga0075430_1007327522 101
749 3300006847 Ga0075431_100316891 Ga0075431_1003168912 101
750 3300006847 Ga0075431_100416798 Ga0075431_1004167982 101
751 3300006847 Ga0075431_100770310 Ga0075431_1007703102 101
752 3300006847 Ga0075431_101075014 Ga0075431_1010750142 101
753 3300006847 Ga0075431_101711549 Ga0075431_1017115491 101
754 3300006852 Ga0075433_10021535 Ga0075433_100215355 101
755 3300006852 Ga0075433_10084674 Ga0075433_100846742 101
756 3300006852 Ga0075433_10090942 Ga0075433_100909422 101
757 3300006852 Ga0075433_10284062 Ga0075433_102840622 101
758 3300006852 Ga0075433_10306888 Ga0075433_103068882 101
759 3300006852 Ga0075433_10316947 Ga0075433_103169472 101
760 3300006852 Ga0075433_10379007 Ga0075433_103790072 101
761 3300006852 Ga0075433_10423460 Ga0075433_104234602 101
762 3300006852 Ga0075433_10514936 Ga0075433_105149362 101
763 3300006852 Ga0075433_10593529 Ga0075433_105935291 101
764 3300006852 Ga0075433_10672419 Ga0075433_106724191 101
765 3300006852 Ga0075433_10724052 Ga0075433_107240522 101
766 3300006852 Ga0075433_10745510 Ga0075433_107455102 101
767 3300006852 Ga0075433_11053890 Ga0075433_110538902 101
768 3300006852 Ga0075433_11140033 Ga0075433_111400331 101
769 3300006852 Ga0075433_11911827 Ga0075433_119118272 101
770 3300006871 Ga0075434_100061352 Ga0075434_1000613526 101
771 3300006871 Ga0075434_100065544 Ga0075434_1000655444 101
772 3300006871 Ga0075434_100181865 Ga0075434_1001818652 101
773 3300006871 Ga0075434_100205752 Ga0075434_1002057523 101
774 3300006871 Ga0075434_100207781 Ga0075434_1002077812 101
775 3300006871 Ga0075434_100366973 Ga0075434_1003669732 101
776 3300006871 Ga0075434_100413343 Ga0075434_1004133432 101
777 3300006871 Ga0075434_100669002 Ga0075434_1006690022 101
778 3300006871 Ga0075434_100865818 Ga0075434_1008658181 101
779 3300006871 Ga0075434_101093139 Ga0075434_1010931392 101
780 3300006871 Ga0075434_101750698 Ga0075434_1017506981 101
781 3300006871 Ga0075434_102260288 Ga0075434_1022602881 101
782 3300006880 Ga0075429_100030022 Ga0075429_1000300227 101
783 3300006880 Ga0075429_100087817 Ga0075429_1000878175 101
784 3300006880 Ga0075429_100646534 Ga0075429_1006465342 101
785 3300006880 Ga0075429_100797749 Ga0075429_1007977492 101
786 3300006880 Ga0075429_101380360 Ga0075429_1013803602 101
787 3300006881 Ga0068865_100007130 Ga0068865_1000071304 101
788 3300006881 Ga0068865_100072236 Ga0068865_1000722362 101
789 3300006881 Ga0068865_100314445 Ga0068865_1003144452 101
790 3300006881 Ga0068865_100400731 Ga0068865_1004007312 101
791 3300006881 Ga0068865_100762843 Ga0068865_1007628432 101
792 3300006881 Ga0068865_100770108 Ga0068865_1007701082 101
793 3300006881 Ga0068865_100784771 Ga0068865_1007847712 101
794 3300006881 Ga0068865_101211146 Ga0068865_1012111462 101
795 3300006914 Ga0075436_100007062 Ga0075436_10000706216 101
796 3300006914 Ga0075436_100038627 Ga0075436_1000386272 101
797 3300006914 Ga0075436_100765062 Ga0075436_1007650622 101
798 3300006914 Ga0075436_100880217 Ga0075436_1008802172 101
799 3300006914 Ga0075436_100893195 Ga0075436_1008931952 101
800 3300006931 Ga0097620_100062277 Ga0097620_1000622774 101
801 3300006931 Ga0097620_100062449 Ga0097620_1000624496 101
802 3300006931 Ga0097620_100108345 Ga0097620_1001083452 101
803 3300006931 Ga0097620_100135993 Ga0097620_1001359933 101
804 3300006931 Ga0097620_100147286 Ga0097620_1001472862 101
805 3300006931 Ga0097620_100166045 Ga0097620_1001660452 101
806 3300006931 Ga0097620_100201228 Ga0097620_1002012282 101
807 3300006931 Ga0097620_100281320 Ga0097620_1002813202 101
808 3300006931 Ga0097620_100338161 Ga0097620_1003381612 101
809 3300006931 Ga0097620_100403211 Ga0097620_1004032112 101
810 3300006931 Ga0097620_100428800 Ga0097620_1004288002 101
811 3300006931 Ga0097620_100504694 Ga0097620_1005046942 101
812 3300006931 Ga0097620_100574578 Ga0097620_1005745781 101
813 3300006931 Ga0097620_100715552 Ga0097620_1007155522 101
814 3300006931 Ga0097620_100935167 Ga0097620_1009351672 101
815 3300006931 Ga0097620_100962036 Ga0097620_1009620362 101
816 3300006931 Ga0097620_100977917 Ga0097620_1009779172 101
817 3300006931 Ga0097620_101315738 Ga0097620_1013157382 101
818 3300006931 Ga0097620_101595339 Ga0097620_1015953391 101
819 3300006931 Ga0097620_101681527 Ga0097620_1016815271 101
820 3300006931 Ga0097620_101683281 Ga0097620_1016832812 101
821 3300006931 Ga0097620_101818043 Ga0097620_1018180432 101
822 3300006931 Ga0097620_102100973 Ga0097620_1021009732 101
823 3300006931 Ga0097620_102472926 Ga0097620_1024729261 101
824 3300006931 Ga0097620_102730017 Ga0097620_1027300171 101
825 3300007076 Ga0075435_100005711 Ga0075435_1000057115 101
826 3300007076 Ga0075435_100006806 Ga0075435_1000068065 101
827 3300007076 Ga0075435_100429699 Ga0075435_1004296992 101
828 3300007076 Ga0075435_100454567 Ga0075435_1004545672 101
829 3300007076 Ga0075435_101700935 Ga0075435_1017009351 101
830 3300007265 Ga0099794_10006344 Ga0099794_100063445 101
831 3300007265 Ga0099794_10082760 Ga0099794_100827602 101
832 3300007265 Ga0099794_10744151 Ga0099794_107441512 101
833 3300007788 Ga0099795_10058710 Ga0099795_100587103 101
834 3300009011 Ga0105251_10081760 Ga0105251_100817602 101
835 3300009011 Ga0105251_10160907 Ga0105251_101609072 101
836 3300009011 Ga0105251_10584864 Ga0105251_105848641 101
837 3300009092 Ga0105250_10405631 Ga0105250_104056312 101
838 3300009093 Ga0105240_10096141 Ga0105240_100961413 101
839 3300009093 Ga0105240_10272345 Ga0105240_102723454 101
840 3300009093 Ga0105240_10373847 Ga0105240_103738473 101
841 3300009093 Ga0105240_11620598 Ga0105240_116205982 101
842 3300009094 Ga0111539_10000296 Ga0111539_1000029639 101
843 3300009094 Ga0111539_10005702 Ga0111539_100057025 101
844 3300009094 Ga0111539_10052719 Ga0111539_100527198 101
845 3300009094 Ga0111539_10062111 Ga0111539_100621115 101
846 3300009094 Ga0111539_10212383 Ga0111539_102123832 101
847 3300009094 Ga0111539_10563858 Ga0111539_105638582 101
848 3300009094 Ga0111539_11007833 Ga0111539_110078331 101
849 3300009094 Ga0111539_11275173 Ga0111539_112751732 101
850 3300009094 Ga0111539_11535629 Ga0111539_115356292 101
851 3300009094 Ga0111539_12432528 Ga0111539_124325281 101
852 3300009098 Ga0105245_10135760 Ga0105245_101357604 101
853 3300009098 Ga0105245_10167793 Ga0105245_101677933 101
854 3300009098 Ga0105245_10321661 Ga0105245_103216613 101
855 3300009098 Ga0105245_10791912 Ga0105245_107919122 101
856 3300009098 Ga0105245_10961854 Ga0105245_109618543 101
857 3300009098 Ga0105245_11079749 Ga0105245_110797492 101
858 3300009098 Ga0105245_11106429 Ga0105245_111064292 101
859 3300009098 Ga0105245_12239735 Ga0105245_122397351 101
860 3300009101 Ga0105247_10000052 Ga0105247_10000052144 101
861 3300009101 Ga0105247_10243228 Ga0105247_102432282 101
862 3300009101 Ga0105247_10297923 Ga0105247_102979232 101
863 3300009101 Ga0105247_10346344 Ga0105247_103463442 101
864 3300009101 Ga0105247_10463239 Ga0105247_104632392 101
865 3300009147 Ga0114129_10006921 Ga0114129_100069215 101
866 3300009147 Ga0114129_10010378 Ga0114129_1001037821 101
867 3300009147 Ga0114129_10024293 Ga0114129_100242932 101
868 3300009147 Ga0114129_10051992 Ga0114129_100519926 101
869 3300009147 Ga0114129_10056168 Ga0114129_100561685 101
870 3300009147 Ga0114129_10157829 Ga0114129_101578295 101
871 3300009147 Ga0114129_10189298 Ga0114129_101892982 101
872 3300009147 Ga0114129_10201062 Ga0114129_102010622 101
873 3300009147 Ga0114129_10208551 Ga0114129_102085514 101
874 3300009147 Ga0114129_10300226 Ga0114129_103002262 101
875 3300009147 Ga0114129_10695250 Ga0114129_106952502 101
876 3300009147 Ga0114129_10954612 Ga0114129_109546122 101
877 3300009147 Ga0114129_11002852 Ga0114129_110028522 101
878 3300009147 Ga0114129_11048030 Ga0114129_110480302 101
879 3300009147 Ga0114129_11051562 Ga0114129_110515623 101
880 3300009147 Ga0114129_11128837 Ga0114129_111288372 101
881 3300009147 Ga0114129_11400675 Ga0114129_114006752 101
882 3300009147 Ga0114129_11685529 Ga0114129_116855291 101
883 3300009147 Ga0114129_11733634 Ga0114129_117336342 101
884 3300009147 Ga0114129_11986120 Ga0114129_119861202 101
885 3300009147 Ga0114129_12490129 Ga0114129_124901292 101
886 3300009147 Ga0114129_12815655 Ga0114129_128156552 101
887 3300009147 Ga0114129_13207569 Ga0114129_132075691 101
888 3300009148 Ga0105243_10000777 Ga0105243_1000077743 101
889 3300009148 Ga0105243_10002279 Ga0105243_100022794 101
890 3300009148 Ga0105243_10017989 Ga0105243_100179896 101
891 3300009148 Ga0105243_10114247 Ga0105243_101142472 101
892 3300009148 Ga0105243_10152891 Ga0105243_101528912 101
893 3300009148 Ga0105243_10171293 Ga0105243_101712932 101
894 3300009148 Ga0105243_10175362 Ga0105243_101753623 101
895 3300009148 Ga0105243_10382306 Ga0105243_103823062 101
896 3300009148 Ga0105243_10413660 Ga0105243_104136603 101
897 3300009148 Ga0105243_10436392 Ga0105243_104363922 101
898 3300009148 Ga0105243_10516463 Ga0105243_105164632 101
899 3300009148 Ga0105243_10625893 Ga0105243_106258932 101
900 3300009148 Ga0105243_10940759 Ga0105243_109407592 101
901 3300009148 Ga0105243_11268158 Ga0105243_112681581 101
902 3300009148 Ga0105243_11889641 Ga0105243_118896411 101
903 3300009148 Ga0105243_12133716 Ga0105243_121337161 101
904 3300009148 Ga0105243_12165048 Ga0105243_121650482 101
905 3300009148 Ga0105243_12200691 Ga0105243_122006912 101
906 3300009148 Ga0105243_12386154 Ga0105243_123861541 101
907 3300009148 Ga0105243_12741107 Ga0105243_127411072 101
908 3300009148 Ga0105243_12830037 Ga0105243_128300372 101
909 3300009174 Ga0105241_10057890 Ga0105241_100578905 101
910 3300009174 Ga0105241_10238004 Ga0105241_102380041 101
911 3300009174 Ga0105241_10346745 Ga0105241_103467452 101
912 3300009174 Ga0105241_10539231 Ga0105241_105392312 101
913 3300009174 Ga0105241_10790393 Ga0105241_107903932 101
914 3300009174 Ga0105241_11016467 Ga0105241_110164672 101
915 3300009174 Ga0105241_11180208 Ga0105241_111802081 101
916 3300009174 Ga0105241_11363231 Ga0105241_113632311 101
917 3300009174 Ga0105241_11528978 Ga0105241_115289781 101
918 3300009174 Ga0105241_11778277 Ga0105241_117782772 101
919 3300009174 Ga0105241_12103060 Ga0105241_121030601 101
920 3300009174 Ga0105241_12346680 Ga0105241_123466801 101
921 3300009174 Ga0105241_12620463 Ga0105241_126204632 101
922 3300009176 Ga0105242_10001940 Ga0105242_1000194026 101
923 3300009176 Ga0105242_10003416 Ga0105242_1000341618 101
924 3300009176 Ga0105242_10023865 Ga0105242_100238654 101
925 3300009176 Ga0105242_10193462 Ga0105242_101934622 101
926 3300009176 Ga0105242_10267964 Ga0105242_102679642 101
927 3300009176 Ga0105242_10324552 Ga0105242_103245522 101
928 3300009176 Ga0105242_10501358 Ga0105242_105013581 101
929 3300009176 Ga0105242_10563574 Ga0105242_105635742 101
930 3300009176 Ga0105242_10611128 Ga0105242_106111282 101
931 3300009176 Ga0105242_11116658 Ga0105242_111166582 101
932 3300009176 Ga0105242_11803605 Ga0105242_118036052 101
933 3300009176 Ga0105242_12486481 Ga0105242_124864811 101
934 3300009176 Ga0105242_12856817 Ga0105242_128568172 101
935 3300009176 Ga0105242_12890740 Ga0105242_128907402 101
936 3300009176 Ga0105242_13320051 Ga0105242_133200511 101
937 3300009177 Ga0105248_10063416 Ga0105248_100634165 101
938 3300009177 Ga0105248_10142812 Ga0105248_101428124 101
939 3300009177 Ga0105248_10189239 Ga0105248_101892393 101
940 3300009177 Ga0105248_10205686 Ga0105248_102056862 101
941 3300009177 Ga0105248_10259586 Ga0105248_102595862 101
942 3300009177 Ga0105248_10342663 Ga0105248_103426631 101
943 3300009177 Ga0105248_10428479 Ga0105248_104284793 101
944 3300009177 Ga0105248_10494319 Ga0105248_104943191 101
945 3300009177 Ga0105248_10752247 Ga0105248_107522472 101
946 3300009177 Ga0105248_10917125 Ga0105248_109171251 101
947 3300009177 Ga0105248_11013184 Ga0105248_110131842 101
948 3300009177 Ga0105248_11222115 Ga0105248_112221152 101
949 3300009177 Ga0105248_11279471 Ga0105248_112794711 101
950 3300009177 Ga0105248_11459581 Ga0105248_114595812 101
951 3300009177 Ga0105248_12365989 Ga0105248_123659891 101
952 3300009177 Ga0105248_12798188 Ga0105248_127981881 101
953 3300009545 Ga0105237_10015988 Ga0105237_1001598812 101
954 3300009545 Ga0105237_10117393 Ga0105237_101173932 101
955 3300009545 Ga0105237_10224210 Ga0105237_102242102 101
956 3300009545 Ga0105237_10413567 Ga0105237_104135672 101
957 3300009545 Ga0105237_10539185 Ga0105237_105391852 101
958 3300009545 Ga0105237_12090708 Ga0105237_120907082 101
959 3300009551 Ga0105238_10034314 Ga0105238_1003431411 101
960 3300009551 Ga0105238_10096786 Ga0105238_100967863 101
961 3300009551 Ga0105238_10683083 Ga0105238_106830831 101
962 3300009551 Ga0105238_12951574 Ga0105238_129515741 101
963 3300009553 Ga0105249_10000118 Ga0105249_100001185 101
964 3300009553 Ga0105249_10005579 Ga0105249_100055793 101
965 3300009553 Ga0105249_10007338 Ga0105249_1000733814 101
966 3300009553 Ga0105249_10066325 Ga0105249_100663252 101
967 3300009553 Ga0105249_10119423 Ga0105249_101194234 101
968 3300009553 Ga0105249_10299720 Ga0105249_102997201 101
969 3300009553 Ga0105249_10810991 Ga0105249_108109912 101
970 3300009553 Ga0105249_11164383 Ga0105249_111643831 101
971 3300009553 Ga0105249_11324100 Ga0105249_113241002 101
972 3300009553 Ga0105249_11734207 Ga0105249_117342072 101
973 3300009553 Ga0105249_12809395 Ga0105249_128093952 101
974 3300009553 Ga0105249_13551597 Ga0105249_135515971 101
975 3300010159 Ga0099796_10179442 Ga0099796_101794421 101
976 3300010159 Ga0099796_10322819 Ga0099796_103228191 101
977 3300010375 Ga0105239_10074765 Ga0105239_100747655 101
978 3300010375 Ga0105239_10079201 Ga0105239_100792013 101
979 3300010375 Ga0105239_10346913 Ga0105239_103469133 101
980 3300010375 Ga0105239_10429857 Ga0105239_104298572 101
981 3300010375 Ga0105239_10557741 Ga0105239_105577412 101
982 3300010375 Ga0105239_10808154 Ga0105239_108081541 101
983 3300010375 Ga0105239_11160423 Ga0105239_111604232 101
984 3300010375 Ga0105239_11879713 Ga0105239_118797132 101
985 3300010375 Ga0105239_12340378 Ga0105239_123403782 101
986 3300010375 Ga0105239_13467200 Ga0105239_134672001 101
987 3300011119 Ga0105246_10171231 Ga0105246_101712312 101
988 3300011119 Ga0105246_10404402 Ga0105246_104044022 101
989 3300011119 Ga0105246_10481177 Ga0105246_104811772 101
990 3300011119 Ga0105246_11717863 Ga0105246_117178631 101
991 3300011119 Ga0105246_11915561 Ga0105246_119155611 101
992 3300012480 Ga0157346_1020038 Ga0157346_10200381 101
993 3300012508 Ga0157315_1048965 Ga0157315_10489651 101
994 3300013100 Ga0157373_10049467 Ga0157373_100494672 101
995 3300013100 Ga0157373_10062147 Ga0157373_100621472 101
996 3300013100 Ga0157373_10110780 Ga0157373_101107803 101
997 3300013100 Ga0157373_10272521 Ga0157373_102725212 101
998 3300013100 Ga0157373_10485861 Ga0157373_104858612 101
999 3300013100 Ga0157373_10663822 Ga0157373_106638222 101
1000 3300013100 Ga0157373_10796465 Ga0157373_107964652 101
1001 3300013100 Ga0157373_11184393 Ga0157373_111843932 101
1002 3300013102 Ga0157371_10686847 Ga0157371_106868472 101
1003 3300013102 Ga0157371_10714477 Ga0157371_107144772 101
1004 3300013102 Ga0157371_10873586 Ga0157371_108735862 101
1005 3300013296 Ga0157374_10286428 Ga0157374_102864282 101
1006 3300013296 Ga0157374_10449751 Ga0157374_104497512 101
1007 3300013296 Ga0157374_10461365 Ga0157374_104613652 101
1008 3300013296 Ga0157374_10539300 Ga0157374_105393002 101
1009 3300013296 Ga0157374_11946103 Ga0157374_119461032 101
1010 3300013297 Ga0157378_10006521 Ga0157378_100065214 101
1011 3300013297 Ga0157378_10008509 Ga0157378_100085095 101
1012 3300013297 Ga0157378_10009044 Ga0157378_1000904412 101
1013 3300013297 Ga0157378_10009557 Ga0157378_1000955712 101
1014 3300013297 Ga0157378_10023296 Ga0157378_100232965 101
1015 3300013297 Ga0157378_10088639 Ga0157378_100886392 101
1016 3300013297 Ga0157378_10117153 Ga0157378_101171532 101
1017 3300013297 Ga0157378_10134416 Ga0157378_101344164 101
1018 3300013297 Ga0157378_10182389 Ga0157378_101823891 101
1019 3300013297 Ga0157378_10244650 Ga0157378_102446503 101
1020 3300013297 Ga0157378_10313696 Ga0157378_103136962 101
1021 3300013297 Ga0157378_10335206 Ga0157378_103352063 101
1022 3300013297 Ga0157378_10343492 Ga0157378_103434923 101
1023 3300013297 Ga0157378_10348973 Ga0157378_103489732 101
1024 3300013297 Ga0157378_10372610 Ga0157378_103726101 101
1025 3300013297 Ga0157378_10561126 Ga0157378_105611262 101
1026 3300013297 Ga0157378_10577010 Ga0157378_105770102 101
1027 3300013297 Ga0157378_10601955 Ga0157378_106019552 101
1028 3300013297 Ga0157378_10616037 Ga0157378_106160372 101
1029 3300013297 Ga0157378_10791456 Ga0157378_107914562 101
1030 3300013297 Ga0157378_11248303 Ga0157378_112483032 101
1031 3300013297 Ga0157378_11979366 Ga0157378_119793662 101
1032 3300013297 Ga0157378_11985322 Ga0157378_119853222 101
1033 3300013297 Ga0157378_12110352 Ga0157378_121103522 101
1034 3300013297 Ga0157378_12464335 Ga0157378_124643351 101
1035 3300013297 Ga0157378_12621650 Ga0157378_126216502 101
1036 3300013297 Ga0157378_12928672 Ga0157378_129286721 101
1037 3300013306 Ga0163162_10000059 Ga0163162_10000059105 101
1038 3300013306 Ga0163162_10017503 Ga0163162_1001750310 101
1039 3300013306 Ga0163162_10047675 Ga0163162_100476752 101
1040 3300013306 Ga0163162_10097605 Ga0163162_100976055 101
1041 3300013306 Ga0163162_10104208 Ga0163162_101042082 101
1042 3300013306 Ga0163162_10134662 Ga0163162_101346622 101
1043 3300013306 Ga0163162_10262547 Ga0163162_102625473 101
1044 3300013306 Ga0163162_10512522 Ga0163162_105125222 101
1045 3300013306 Ga0163162_10535545 Ga0163162_105355451 101
1046 3300013306 Ga0163162_10565830 Ga0163162_105658302 101
1047 3300013306 Ga0163162_10567515 Ga0163162_105675152 101
1048 3300013306 Ga0163162_10863799 Ga0163162_108637992 101
1049 3300013306 Ga0163162_11454992 Ga0163162_114549922 101
1050 3300013306 Ga0163162_12119070 Ga0163162_121190701 101
1051 3300013306 Ga0163162_12164865 Ga0163162_121648651 101
1052 3300013306 Ga0163162_12817318 Ga0163162_128173181 101
1053 3300013306 Ga0163162_13230623 Ga0163162_132306231 101
1054 3300013307 Ga0157372_10028946 Ga0157372_100289469 101
1055 3300013307 Ga0157372_10471707 Ga0157372_104717072 101
1056 3300013307 Ga0157372_10700260 Ga0157372_107002602 101
1057 3300013307 Ga0157372_10945849 Ga0157372_109458492 101
1058 3300013307 Ga0157372_11190883 Ga0157372_111908831 101
1059 3300013307 Ga0157372_11474478 Ga0157372_114744781 101
1060 3300013307 Ga0157372_11963358 Ga0157372_119633582 101
1061 3300013307 Ga0157372_12900828 Ga0157372_129008281 101
1062 3300013308 Ga0157375_10060122 Ga0157375_100601224 101
1063 3300013308 Ga0157375_10090937 Ga0157375_100909374 101
1064 3300013308 Ga0157375_10141175 Ga0157375_101411755 101
1065 3300013308 Ga0157375_10227164 Ga0157375_102271644 101
1066 3300013308 Ga0157375_10287318 Ga0157375_102873182 101
1067 3300013308 Ga0157375_10553815 Ga0157375_105538152 101
1068 3300013308 Ga0157375_10791890 Ga0157375_107918901 101
1069 3300013308 Ga0157375_10813791 Ga0157375_108137912 101
1070 3300013308 Ga0157375_11131645 Ga0157375_111316452 101
1071 3300013308 Ga0157375_11228589 Ga0157375_112285892 101
1072 3300013308 Ga0157375_11437988 Ga0157375_114379882 101
1073 3300013308 Ga0157375_11970053 Ga0157375_119700532 101
1074 3300013308 Ga0157375_12470468 Ga0157375_124704682 101
1075 3300013308 Ga0157375_13186531 Ga0157375_131865312 101
1076 3300013308 Ga0157375_13635253 Ga0157375_136352532 101
1077 3300014325 Ga0163163_10028059 Ga0163163_100280592 101
1078 3300014325 Ga0163163_10034085 Ga0163163_100340854 101
1079 3300014325 Ga0163163_10084072 Ga0163163_100840723 101
1080 3300014325 Ga0163163_10087671 Ga0163163_100876714 101
1081 3300014325 Ga0163163_10107898 Ga0163163_101078984 101
1082 3300014325 Ga0163163_10115847 Ga0163163_101158472 101
1083 3300014325 Ga0163163_10133067 Ga0163163_101330672 101
1084 3300014325 Ga0163163_10396663 Ga0163163_103966632 101
1085 3300014325 Ga0163163_10453527 Ga0163163_104535272 101
1086 3300014325 Ga0163163_10489008 Ga0163163_104890083 101
1087 3300014325 Ga0163163_11059868 Ga0163163_110598682 101
1088 3300014325 Ga0163163_11739402 Ga0163163_117394022 101
1089 3300014325 Ga0163163_12081908 Ga0163163_120819081 101
1090 3300014325 Ga0163163_13276132 Ga0163163_132761322 101
1091 3300014326 Ga0157380_10000784 Ga0157380_1000078411 101
1092 3300014326 Ga0157380_10020962 Ga0157380_100209625 101
1093 3300014326 Ga0157380_10039316 Ga0157380_100393162 101
1094 3300014326 Ga0157380_10041565 Ga0157380_100415653 101
1095 3300014326 Ga0157380_10075491 Ga0157380_100754912 101
1096 3300014326 Ga0157380_10141550 Ga0157380_101415502 101
1097 3300014326 Ga0157380_10242240 Ga0157380_102422402 101
1098 3300014326 Ga0157380_10344628 Ga0157380_103446282 101
1099 3300014326 Ga0157380_10403825 Ga0157380_104038252 101
1100 3300014326 Ga0157380_10497201 Ga0157380_104972012 101
1101 3300014326 Ga0157380_10975247 Ga0157380_109752472 101
1102 3300014326 Ga0157380_11301725 Ga0157380_113017252 101
1103 3300014326 Ga0157380_11383809 Ga0157380_113838092 101
1104 3300014326 Ga0157380_11678509 Ga0157380_116785091 101
1105 3300014326 Ga0157380_13507643 Ga0157380_135076432 101
1106 3300014745 Ga0157377_10006911 Ga0157377_100069116 101
1107 3300014745 Ga0157377_10349998 Ga0157377_103499982 101
1108 3300014745 Ga0157377_10416899 Ga0157377_104168991 101
1109 3300014745 Ga0157377_10460258 Ga0157377_104602582 101
1110 3300014745 Ga0157377_10534045 Ga0157377_105340452 101
1111 3300014745 Ga0157377_10814219 Ga0157377_108142191 101
1112 3300014745 Ga0157377_11051377 Ga0157377_110513771 101
1113 3300014968 Ga0157379_10098160 Ga0157379_100981603 101
1114 3300014968 Ga0157379_10231894 Ga0157379_102318942 101
1115 3300014968 Ga0157379_10284610 Ga0157379_102846102 101
1116 3300014968 Ga0157379_10320606 Ga0157379_103206061 101
1117 3300014968 Ga0157379_10612017 Ga0157379_106120171 101
1118 3300014968 Ga0157379_10844831 Ga0157379_108448311 101
1119 3300014968 Ga0157379_10948027 Ga0157379_109480272 101
1120 3300014969 Ga0157376_10008779 Ga0157376_100087795 101
1121 3300014969 Ga0157376_10132834 Ga0157376_101328342 101
1122 3300014969 Ga0157376_10300589 Ga0157376_103005891 101
1123 3300014969 Ga0157376_10305313 Ga0157376_103053133 101
1124 3300014969 Ga0157376_12071863 Ga0157376_120718631 101
1125 3300014969 Ga0157376_12286583 Ga0157376_122865832 101
1126 3300015262 Ga0182007_10060218 Ga0182007_100602182 101
1127 3300015262 Ga0182007_10301428 Ga0182007_103014281 101
1128 3300015265 Ga0182005_1044333 Ga0182005_10443332 101
1129 3300017792 Ga0163161_10015560 Ga0163161_100155605 101
1130 3300017792 Ga0163161_10034538 Ga0163161_100345385 101
1131 3300017792 Ga0163161_10131529 Ga0163161_101315293 101
1132 3300017792 Ga0163161_10188036 Ga0163161_101880362 101
1133 3300017792 Ga0163161_10486302 Ga0163161_104863022 101
1134 3300021377 Ga0213874_10245778 Ga0213874_102457781 101
1135 3300021384 Ga0213876_10001455 Ga0213876_1000145522 101
1136 3300021384 Ga0213876_10019489 Ga0213876_100194893 101
1137 3300021384 Ga0213876_10259704 Ga0213876_102597041 101
1138 3300021388 Ga0213875_10598444 Ga0213875_105984442 101
1139 3300025223 Ga0207672_1000732 Ga0207672_10007325 101
1140 3300025315 Ga0207697_10096946 Ga0207697_100969462 101
1141 3300025315 Ga0207697_10463083 Ga0207697_104630832 101
1142 3300025321 Ga0207656_10004238 Ga0207656_100042385 101
1143 3300025735 Ga0207713_1104157 Ga0207713_11041572 101
1144 3300025885 Ga0207653_10010210 Ga0207653_100102105 101
1145 3300025885 Ga0207653_10021838 Ga0207653_100218381 101
1146 3300025885 Ga0207653_10030903 Ga0207653_100309031 101
1147 3300025893 Ga0207682_10019816 Ga0207682_100198161 101
1148 3300025893 Ga0207682_10112599 Ga0207682_101125992 101
1149 3300025899 Ga0207642_10040455 Ga0207642_100404553 101
1150 3300025899 Ga0207642_10090088 Ga0207642_100900882 101
1151 3300025899 Ga0207642_10187384 Ga0207642_101873841 101
1152 3300025899 Ga0207642_10555414 Ga0207642_105554141 101
1153 3300025900 Ga0207710_10000004 Ga0207710_10000004362 101
1154 3300025900 Ga0207710_10005253 Ga0207710_100052533 101
1155 3300025900 Ga0207710_10153107 Ga0207710_101531072 101
1156 3300025900 Ga0207710_10240487 Ga0207710_102404872 101
1157 3300025901 Ga0207688_10370842 Ga0207688_103708422 101
1158 3300025901 Ga0207688_10746078 Ga0207688_107460782 101
1159 3300025903 Ga0207680_10228541 Ga0207680_102285412 101
1160 3300025903 Ga0207680_10682353 Ga0207680_106823532 101
1161 3300025904 Ga0207647_10032321 Ga0207647_100323214 101
1162 3300025904 Ga0207647_10131474 Ga0207647_101314742 101
1163 3300025904 Ga0207647_10133636 Ga0207647_101336362 101
1164 3300025904 Ga0207647_10502783 Ga0207647_105027832 101
1165 3300025905 Ga0207685_10000051 Ga0207685_1000005150 101
1166 3300025905 Ga0207685_10074301 Ga0207685_100743012 101
1167 3300025905 Ga0207685_10727696 Ga0207685_107276962 101
1168 3300025906 Ga0207699_10655954 Ga0207699_106559542 101
1169 3300025906 Ga0207699_10765779 Ga0207699_107657791 101
1170 3300025907 Ga0207645_10019493 Ga0207645_100194932 101
1171 3300025907 Ga0207645_10040599 Ga0207645_100405995 101
1172 3300025907 Ga0207645_10599845 Ga0207645_105998451 101
1173 3300025907 Ga0207645_10604716 Ga0207645_106047162 101
1174 3300025907 Ga0207645_10929687 Ga0207645_109296872 101
1175 3300025908 Ga0207643_10001463 Ga0207643_100014635 101
1176 3300025908 Ga0207643_10120477 Ga0207643_101204772 101
1177 3300025908 Ga0207643_10155951 Ga0207643_101559512 101
1178 3300025908 Ga0207643_10228435 Ga0207643_102284352 101
1179 3300025910 Ga0207684_10001576 Ga0207684_1000157637 101
1180 3300025910 Ga0207684_10009774 Ga0207684_100097744 101
1181 3300025910 Ga0207684_10011946 Ga0207684_1001194612 101
1182 3300025910 Ga0207684_10028709 Ga0207684_100287095 101
1183 3300025910 Ga0207684_10032500 Ga0207684_100325005 101
1184 3300025910 Ga0207684_10103326 Ga0207684_101033262 101
1185 3300025910 Ga0207684_10292789 Ga0207684_102927891 101
1186 3300025910 Ga0207684_10346730 Ga0207684_103467301 101
1187 3300025910 Ga0207684_10424294 Ga0207684_104242942 101
1188 3300025910 Ga0207684_10475054 Ga0207684_104750542 101
1189 3300025910 Ga0207684_10914896 Ga0207684_109148962 101
1190 3300025910 Ga0207684_10929290 Ga0207684_109292902 101
1191 3300025910 Ga0207684_11398830 Ga0207684_113988302 101
1192 3300025911 Ga0207654_10028896 Ga0207654_100288964 101
1193 3300025911 Ga0207654_10112142 Ga0207654_101121422 101
1194 3300025911 Ga0207654_10286388 Ga0207654_102863882 101
1195 3300025911 Ga0207654_10297976 Ga0207654_102979762 101
1196 3300025911 Ga0207654_10473052 Ga0207654_104730522 101
1197 3300025911 Ga0207654_10871758 Ga0207654_108717581 101
1198 3300025911 Ga0207654_10902011 Ga0207654_109020111 101
1199 3300025911 Ga0207654_11054608 Ga0207654_110546081 101
1200 3300025911 Ga0207654_11066905 Ga0207654_110669051 101
1201 3300025912 Ga0207707_10000097 Ga0207707_1000009792 101
1202 3300025912 Ga0207707_10028834 Ga0207707_100288347 101
1203 3300025912 Ga0207707_10041693 Ga0207707_100416934 101
1204 3300025912 Ga0207707_10117269 Ga0207707_101172693 101
1205 3300025912 Ga0207707_10950893 Ga0207707_109508932 101
1206 3300025912 Ga0207707_11080120 Ga0207707_110801202 101
1207 3300025913 Ga0207695_10166217 Ga0207695_101662172 101
1208 3300025913 Ga0207695_10332221 Ga0207695_103322212 101
1209 3300025913 Ga0207695_11614781 Ga0207695_116147812 101
1210 3300025914 Ga0207671_10019270 Ga0207671_100192705 101
1211 3300025914 Ga0207671_10036459 Ga0207671_100364592 101
1212 3300025914 Ga0207671_10553773 Ga0207671_105537732 101
1213 3300025914 Ga0207671_10669843 Ga0207671_106698431 101
1214 3300025916 Ga0207663_10495641 Ga0207663_104956411 101
1215 3300025916 Ga0207663_11057297 Ga0207663_110572972 101
1216 3300025917 Ga0207660_10008137 Ga0207660_1000813712 101
1217 3300025917 Ga0207660_10030363 Ga0207660_100303633 101
1218 3300025917 Ga0207660_10251308 Ga0207660_102513081 101
1219 3300025917 Ga0207660_10346871 Ga0207660_103468712 101
1220 3300025917 Ga0207660_10528865 Ga0207660_105288652 101
1221 3300025917 Ga0207660_10960997 Ga0207660_109609972 101
1222 3300025918 Ga0207662_10001023 Ga0207662_1000102313 101
1223 3300025918 Ga0207662_10001888 Ga0207662_100018885 101
1224 3300025918 Ga0207662_10057188 Ga0207662_100571884 101
1225 3300025918 Ga0207662_10078446 Ga0207662_100784462 101
1226 3300025918 Ga0207662_10094156 Ga0207662_100941562 101
1227 3300025918 Ga0207662_10107236 Ga0207662_101072363 101
1228 3300025918 Ga0207662_10158027 Ga0207662_101580272 101
1229 3300025918 Ga0207662_10180322 Ga0207662_101803222 101
1230 3300025918 Ga0207662_10413985 Ga0207662_104139851 101
1231 3300025918 Ga0207662_10613485 Ga0207662_106134852 101
1232 3300025918 Ga0207662_11313509 Ga0207662_113135092 101
1233 3300025919 Ga0207657_10057692 Ga0207657_100576922 101
1234 3300025919 Ga0207657_10891732 Ga0207657_108917322 101
1235 3300025920 Ga0207649_10040758 Ga0207649_100407583 101
1236 3300025920 Ga0207649_10402090 Ga0207649_104020902 101
1237 3300025920 Ga0207649_10627353 Ga0207649_106273532 101
1238 3300025920 Ga0207649_10833981 Ga0207649_108339812 101
1239 3300025921 Ga0207652_10000229 Ga0207652_1000022962 101
1240 3300025921 Ga0207652_10009158 Ga0207652_1000915811 101
1241 3300025921 Ga0207652_10125623 Ga0207652_101256234 101
1242 3300025921 Ga0207652_10473383 Ga0207652_104733832 101
1243 3300025922 Ga0207646_10002486 Ga0207646_1000248632 101
1244 3300025922 Ga0207646_10023037 Ga0207646_1002303711 101
1245 3300025922 Ga0207646_10044831 Ga0207646_100448315 101
1246 3300025922 Ga0207646_10101585 Ga0207646_101015852 101
1247 3300025922 Ga0207646_10132369 Ga0207646_101323694 101
1248 3300025922 Ga0207646_10138084 Ga0207646_101380842 101
1249 3300025922 Ga0207646_10382789 Ga0207646_103827892 101
1250 3300025922 Ga0207646_10840649 Ga0207646_108406492 101
1251 3300025922 Ga0207646_11424911 Ga0207646_114249112 101
1252 3300025922 Ga0207646_11636817 Ga0207646_116368172 101
1253 3300025923 Ga0207681_10012129 Ga0207681_100121296 101
1254 3300025923 Ga0207681_10049116 Ga0207681_100491165 101
1255 3300025923 Ga0207681_10080448 Ga0207681_100804482 101
1256 3300025923 Ga0207681_10097490 Ga0207681_100974902 101
1257 3300025923 Ga0207681_10485491 Ga0207681_104854912 101
1258 3300025923 Ga0207681_10659263 Ga0207681_106592632 101
1259 3300025923 Ga0207681_10961064 Ga0207681_109610642 101
1260 3300025924 Ga0207694_10065782 Ga0207694_100657822 101
1261 3300025924 Ga0207694_10148212 Ga0207694_101482123 101
1262 3300025924 Ga0207694_11758427 Ga0207694_117584272 101
1263 3300025925 Ga0207650_10000143 Ga0207650_1000014394 101
1264 3300025925 Ga0207650_10001512 Ga0207650_1000151225 101
1265 3300025925 Ga0207650_10299042 Ga0207650_102990422 101
1266 3300025925 Ga0207650_10437082 Ga0207650_104370822 101
1267 3300025925 Ga0207650_10627245 Ga0207650_106272452 101
1268 3300025925 Ga0207650_10838155 Ga0207650_108381552 101
1269 3300025925 Ga0207650_11560237 Ga0207650_115602371 101
1270 3300025925 Ga0207650_11693567 Ga0207650_116935671 101
1271 3300025925 Ga0207650_11769361 Ga0207650_117693611 101
1272 3300025926 Ga0207659_10069720 Ga0207659_100697203 101
1273 3300025926 Ga0207659_10434449 Ga0207659_104344492 101
1274 3300025926 Ga0207659_10974991 Ga0207659_109749912 101
1275 3300025926 Ga0207659_11062399 Ga0207659_110623992 101
1276 3300025926 Ga0207659_11416982 Ga0207659_114169822 101
1277 3300025926 Ga0207659_11422803 Ga0207659_114228031 101
1278 3300025927 Ga0207687_10035123 Ga0207687_100351233 101
1279 3300025927 Ga0207687_10310075 Ga0207687_103100753 101
1280 3300025927 Ga0207687_10638570 Ga0207687_106385702 101
1281 3300025927 Ga0207687_11186296 Ga0207687_111862962 101
1282 3300025931 Ga0207644_10000414 Ga0207644_100004145 101
1283 3300025931 Ga0207644_10038017 Ga0207644_100380175 101
1284 3300025931 Ga0207644_10048465 Ga0207644_100484652 101
1285 3300025931 Ga0207644_10151989 Ga0207644_101519892 101
1286 3300025931 Ga0207644_11022874 Ga0207644_110228742 101
1287 3300025931 Ga0207644_11419336 Ga0207644_114193362 101
1288 3300025931 Ga0207644_11521299 Ga0207644_115212992 101
1289 3300025932 Ga0207690_10087154 Ga0207690_100871541 101
1290 3300025932 Ga0207690_11103149 Ga0207690_111031492 101
1291 3300025932 Ga0207690_11843290 Ga0207690_118432901 101
1292 3300025933 Ga0207706_10141080 Ga0207706_101410804 101
1293 3300025933 Ga0207706_10168409 Ga0207706_101684092 101
1294 3300025933 Ga0207706_10334727 Ga0207706_103347271 101
1295 3300025934 Ga0207686_10000005 Ga0207686_100000055 101
1296 3300025934 Ga0207686_10001337 Ga0207686_100013373 101
1297 3300025934 Ga0207686_10004022 Ga0207686_100040222 101
1298 3300025934 Ga0207686_10036664 Ga0207686_100366645 101
1299 3300025934 Ga0207686_10046114 Ga0207686_100461142 101
1300 3300025934 Ga0207686_10212527 Ga0207686_102125273 101
1301 3300025934 Ga0207686_10224291 Ga0207686_102242911 101
1302 3300025934 Ga0207686_10228095 Ga0207686_102280952 101
1303 3300025934 Ga0207686_10402688 Ga0207686_104026881 101
1304 3300025934 Ga0207686_10479070 Ga0207686_104790702 101
1305 3300025934 Ga0207686_10847112 Ga0207686_108471122 101
1306 3300025935 Ga0207709_10000133 Ga0207709_100001335 101
1307 3300025935 Ga0207709_10009116 Ga0207709_100091165 101
1308 3300025935 Ga0207709_10009548 Ga0207709_100095485 101
1309 3300025935 Ga0207709_10082566 Ga0207709_100825662 101
1310 3300025935 Ga0207709_10086195 Ga0207709_100861951 101
1311 3300025935 Ga0207709_10233961 Ga0207709_102339612 101
1312 3300025935 Ga0207709_10235950 Ga0207709_102359501 101
1313 3300025935 Ga0207709_10304751 Ga0207709_103047512 101
1314 3300025935 Ga0207709_10596701 Ga0207709_105967012 101
1315 3300025935 Ga0207709_10815540 Ga0207709_108155402 101
1316 3300025935 Ga0207709_11443800 Ga0207709_114438001 101
1317 3300025935 Ga0207709_11772409 Ga0207709_117724092 101
1318 3300025936 Ga0207670_10000655 Ga0207670_1000065519 101
1319 3300025936 Ga0207670_10065773 Ga0207670_100657733 101
1320 3300025936 Ga0207670_10071941 Ga0207670_100719413 101
1321 3300025936 Ga0207670_10250911 Ga0207670_102509112 101
1322 3300025936 Ga0207670_10503991 Ga0207670_105039912 101
1323 3300025936 Ga0207670_10634173 Ga0207670_106341732 101
1324 3300025936 Ga0207670_10676640 Ga0207670_106766402 101
1325 3300025936 Ga0207670_10728938 Ga0207670_107289382 101
1326 3300025936 Ga0207670_10832350 Ga0207670_108323501 101
1327 3300025936 Ga0207670_10999727 Ga0207670_109997272 101
1328 3300025936 Ga0207670_11945917 Ga0207670_119459172 101
1329 3300025937 Ga0207669_10097537 Ga0207669_100975373 101
1330 3300025937 Ga0207669_10138007 Ga0207669_101380073 101
1331 3300025937 Ga0207669_10769692 Ga0207669_107696922 101
1332 3300025938 Ga0207704_10045945 Ga0207704_100459454 101
1333 3300025938 Ga0207704_10117896 Ga0207704_101178962 101
1334 3300025938 Ga0207704_10245243 Ga0207704_102452431 101
1335 3300025938 Ga0207704_10260205 Ga0207704_102602052 101
1336 3300025938 Ga0207704_10461368 Ga0207704_104613682 101
1337 3300025938 Ga0207704_10518962 Ga0207704_105189621 101
1338 3300025938 Ga0207704_10574218 Ga0207704_105742182 101
1339 3300025938 Ga0207704_11164801 Ga0207704_111648012 101
1340 3300025938 Ga0207704_11471115 Ga0207704_114711152 101
1341 3300025939 Ga0207665_10000005 Ga0207665_10000005175 101
1342 3300025939 Ga0207665_10064327 Ga0207665_100643275 101
1343 3300025939 Ga0207665_10239173 Ga0207665_102391732 101
1344 3300025939 Ga0207665_10734644 Ga0207665_107346441 101
1345 3300025939 Ga0207665_11663330 Ga0207665_116633302 101
1346 3300025939 Ga0207665_11674141 Ga0207665_116741411 101
1347 3300025940 Ga0207691_10005231 Ga0207691_100052315 101
1348 3300025940 Ga0207691_10367087 Ga0207691_103670872 101
1349 3300025940 Ga0207691_10748001 Ga0207691_107480012 101
1350 3300025940 Ga0207691_10867593 Ga0207691_108675932 101
1351 3300025941 Ga0207711_10030109 Ga0207711_100301092 101
1352 3300025941 Ga0207711_10047901 Ga0207711_100479014 101
1353 3300025941 Ga0207711_10077453 Ga0207711_100774533 101
1354 3300025941 Ga0207711_10213085 Ga0207711_102130854 101
1355 3300025941 Ga0207711_10319224 Ga0207711_103192242 101
1356 3300025941 Ga0207711_10321516 Ga0207711_103215162 101
1357 3300025941 Ga0207711_10791620 Ga0207711_107916202 101
1358 3300025941 Ga0207711_11551026 Ga0207711_115510261 101
1359 3300025941 Ga0207711_12013969 Ga0207711_120139692 101
1360 3300025942 Ga0207689_10004453 Ga0207689_100044535 101
1361 3300025942 Ga0207689_10034388 Ga0207689_100343886 101
1362 3300025942 Ga0207689_10038109 Ga0207689_100381095 101
1363 3300025942 Ga0207689_10045310 Ga0207689_100453105 101
1364 3300025942 Ga0207689_10056760 Ga0207689_100567605 101
1365 3300025942 Ga0207689_10089297 Ga0207689_100892974 101
1366 3300025942 Ga0207689_10114137 Ga0207689_101141373 101
1367 3300025942 Ga0207689_10165668 Ga0207689_101656682 101
1368 3300025942 Ga0207689_10168543 Ga0207689_101685433 101
1369 3300025942 Ga0207689_10169065 Ga0207689_101690653 101
1370 3300025942 Ga0207689_10267048 Ga0207689_102670482 101
1371 3300025942 Ga0207689_10304614 Ga0207689_103046142 101
1372 3300025942 Ga0207689_10357706 Ga0207689_103577062 101
1373 3300025942 Ga0207689_10532838 Ga0207689_105328382 101
1374 3300025942 Ga0207689_10762423 Ga0207689_107624232 101
1375 3300025942 Ga0207689_10934785 Ga0207689_109347852 101
1376 3300025942 Ga0207689_11566187 Ga0207689_115661872 101
1377 3300025945 Ga0207679_10020056 Ga0207679_100200561 101
1378 3300025945 Ga0207679_10070497 Ga0207679_100704972 101
1379 3300025945 Ga0207679_10099817 Ga0207679_100998174 101
1380 3300025945 Ga0207679_10299791 Ga0207679_102997912 101
1381 3300025945 Ga0207679_10358507 Ga0207679_103585072 101
1382 3300025945 Ga0207679_10364104 Ga0207679_103641042 101
1383 3300025945 Ga0207679_12006421 Ga0207679_120064211 101
1384 3300025949 Ga0207667_10522271 Ga0207667_105222712 101
1385 3300025960 Ga0207651_10097491 Ga0207651_100974913 101
1386 3300025960 Ga0207651_10119712 Ga0207651_101197121 101
1387 3300025960 Ga0207651_10143242 Ga0207651_101432423 101
1388 3300025960 Ga0207651_10241653 Ga0207651_102416532 101
1389 3300025960 Ga0207651_10244025 Ga0207651_102440252 101
1390 3300025960 Ga0207651_10308934 Ga0207651_103089342 101
1391 3300025960 Ga0207651_10611332 Ga0207651_106113321 101
1392 3300025960 Ga0207651_10883393 Ga0207651_108833932 101
1393 3300025960 Ga0207651_10923646 Ga0207651_109236462 101
1394 3300025960 Ga0207651_11656669 Ga0207651_116566692 101
1395 3300025961 Ga0207712_10000709 Ga0207712_100007092 101
1396 3300025961 Ga0207712_10006712 Ga0207712_1000671214 101
1397 3300025961 Ga0207712_10036610 Ga0207712_100366105 101
1398 3300025961 Ga0207712_10064684 Ga0207712_100646843 101
1399 3300025961 Ga0207712_10182336 Ga0207712_101823362 101
1400 3300025961 Ga0207712_10233580 Ga0207712_102335802 101
1401 3300025961 Ga0207712_10528507 Ga0207712_105285072 101
1402 3300025972 Ga0207668_10595235 Ga0207668_105952352 101
1403 3300025981 Ga0207640_10075108 Ga0207640_100751083 101
1404 3300025981 Ga0207640_10189042 Ga0207640_101890422 101
1405 3300025981 Ga0207640_10331482 Ga0207640_103314822 101
1406 3300025981 Ga0207640_10333124 Ga0207640_103331242 101
1407 3300025981 Ga0207640_10497747 Ga0207640_104977472 101
1408 3300025981 Ga0207640_10649509 Ga0207640_106495091 101
1409 3300025981 Ga0207640_10677691 Ga0207640_106776912 101
1410 3300025981 Ga0207640_10886370 Ga0207640_108863702 101
1411 3300025981 Ga0207640_10970501 Ga0207640_109705011 101
1412 3300025981 Ga0207640_11212486 Ga0207640_112124862 101
1413 3300025981 Ga0207640_11338489 Ga0207640_113384892 101
1414 3300025986 Ga0207658_10172113 Ga0207658_101721133 101
1415 3300025986 Ga0207658_10479586 Ga0207658_104795862 101
1416 3300025986 Ga0207658_10616406 Ga0207658_106164061 101
1417 3300026023 Ga0207677_10048300 Ga0207677_100483003 101
1418 3300026023 Ga0207677_10230178 Ga0207677_102301782 101
1419 3300026023 Ga0207677_10255277 Ga0207677_102552772 101
1420 3300026023 Ga0207677_10532806 Ga0207677_105328061 101
1421 3300026023 Ga0207677_10593868 Ga0207677_105938681 101
1422 3300026023 Ga0207677_10665468 Ga0207677_106654682 101
1423 3300026023 Ga0207677_11348132 Ga0207677_113481322 101
1424 3300026023 Ga0207677_11468212 Ga0207677_114682121 101
1425 3300026023 Ga0207677_11854491 Ga0207677_118544911 101
1426 3300026035 Ga0207703_10001442 Ga0207703_100014425 101
1427 3300026035 Ga0207703_10024704 Ga0207703_100247045 101
1428 3300026035 Ga0207703_10098716 Ga0207703_100987162 101
1429 3300026035 Ga0207703_10108392 Ga0207703_101083923 101
1430 3300026035 Ga0207703_10223792 Ga0207703_102237922 101
1431 3300026035 Ga0207703_10263653 Ga0207703_102636532 101
1432 3300026035 Ga0207703_10364869 Ga0207703_103648693 101
1433 3300026035 Ga0207703_10447180 Ga0207703_104471801 101
1434 3300026035 Ga0207703_10475577 Ga0207703_104755772 101
1435 3300026035 Ga0207703_10493289 Ga0207703_104932892 101
1436 3300026035 Ga0207703_10784195 Ga0207703_107841952 101
1437 3300026035 Ga0207703_11810199 Ga0207703_118101991 101
1438 3300026035 Ga0207703_12165948 Ga0207703_121659481 101
1439 3300026035 Ga0207703_12249400 Ga0207703_122494001 101
1440 3300026041 Ga0207639_10148801 Ga0207639_101488011 101
1441 3300026041 Ga0207639_10151226 Ga0207639_101512262 101
1442 3300026041 Ga0207639_10920515 Ga0207639_109205152 101
1443 3300026041 Ga0207639_11768390 Ga0207639_117683901 101
1444 3300026067 Ga0207678_10425790 Ga0207678_104257902 101
1445 3300026075 Ga0207708_10000254 Ga0207708_1000025454 101
1446 3300026075 Ga0207708_10003758 Ga0207708_1000375819 101
1447 3300026075 Ga0207708_10020157 Ga0207708_100201573 101
1448 3300026075 Ga0207708_10020580 Ga0207708_100205803 101
1449 3300026075 Ga0207708_10050983 Ga0207708_100509835 101
1450 3300026075 Ga0207708_10067820 Ga0207708_100678205 101
1451 3300026075 Ga0207708_10086377 Ga0207708_100863775 101
1452 3300026075 Ga0207708_10164920 Ga0207708_101649202 101
1453 3300026075 Ga0207708_10358667 Ga0207708_103586672 101
1454 3300026075 Ga0207708_10717319 Ga0207708_107173192 101
1455 3300026075 Ga0207708_10877237 Ga0207708_108772372 101
1456 3300026075 Ga0207708_11307198 Ga0207708_113071981 101
1457 3300026075 Ga0207708_11436981 Ga0207708_114369812 101
1458 3300026075 Ga0207708_11627978 Ga0207708_116279782 101
1459 3300026078 Ga0207702_10058499 Ga0207702_100584994 101
1460 3300026078 Ga0207702_11052081 Ga0207702_110520812 101
1461 3300026088 Ga0207641_10045020 Ga0207641_100450205 101
1462 3300026088 Ga0207641_10254818 Ga0207641_102548182 101
1463 3300026088 Ga0207641_10260522 Ga0207641_102605221 101
1464 3300026088 Ga0207641_10393126 Ga0207641_103931262 101
1465 3300026088 Ga0207641_10611742 Ga0207641_106117422 101
1466 3300026088 Ga0207641_10665221 Ga0207641_106652212 101
1467 3300026088 Ga0207641_10699316 Ga0207641_106993162 101
1468 3300026088 Ga0207641_11062361 Ga0207641_110623612 101
1469 3300026088 Ga0207641_11485377 Ga0207641_114853772 101
1470 3300026088 Ga0207641_11860630 Ga0207641_118606302 101
1471 3300026088 Ga0207641_11923229 Ga0207641_119232292 101
1472 3300026088 Ga0207641_12028279 Ga0207641_120282791 101
1473 3300026089 Ga0207648_10008477 Ga0207648_1000847716 101
1474 3300026089 Ga0207648_10130461 Ga0207648_101304611 101
1475 3300026089 Ga0207648_10140765 Ga0207648_101407654 101
1476 3300026089 Ga0207648_10145661 Ga0207648_101456614 101
1477 3300026089 Ga0207648_10229619 Ga0207648_102296192 101
1478 3300026089 Ga0207648_10396205 Ga0207648_103962051 101
1479 3300026089 Ga0207648_10554882 Ga0207648_105548822 101
1480 3300026089 Ga0207648_10571881 Ga0207648_105718811 101
1481 3300026089 Ga0207648_10756161 Ga0207648_107561612 101
1482 3300026089 Ga0207648_10762778 Ga0207648_107627781 101
1483 3300026089 Ga0207648_10770535 Ga0207648_107705351 101
1484 3300026089 Ga0207648_10953983 Ga0207648_109539832 101
1485 3300026089 Ga0207648_11127051 Ga0207648_111270512 101
1486 3300026089 Ga0207648_12177502 Ga0207648_121775022 101
1487 3300026095 Ga0207676_10008932 Ga0207676_100089322 101
1488 3300026095 Ga0207676_10025502 Ga0207676_100255022 101
1489 3300026095 Ga0207676_10078274 Ga0207676_100782743 101
1490 3300026095 Ga0207676_10080799 Ga0207676_100807992 101
1491 3300026095 Ga0207676_10104354 Ga0207676_101043541 101
1492 3300026095 Ga0207676_10148375 Ga0207676_101483754 101
1493 3300026095 Ga0207676_10188091 Ga0207676_101880912 101
1494 3300026095 Ga0207676_10194004 Ga0207676_101940042 101
1495 3300026095 Ga0207676_10240235 Ga0207676_102402352 101
1496 3300026095 Ga0207676_10344667 Ga0207676_103446672 101
1497 3300026095 Ga0207676_10354909 Ga0207676_103549092 101
1498 3300026095 Ga0207676_10658089 Ga0207676_106580892 101
1499 3300026095 Ga0207676_10911153 Ga0207676_109111532 101
1500 3300026095 Ga0207676_11613906 Ga0207676_116139061 101
1501 3300026095 Ga0207676_12368134 Ga0207676_123681341 101
1502 3300026116 Ga0207674_10000129 Ga0207674_1000012990 101
1503 3300026116 Ga0207674_10212381 Ga0207674_102123812 101
1504 3300026116 Ga0207674_10267177 Ga0207674_102671772 101
1505 3300026116 Ga0207674_10407307 Ga0207674_104073072 101
1506 3300026116 Ga0207674_10606429 Ga0207674_106064292 101
1507 3300026116 Ga0207674_10782055 Ga0207674_107820552 101
1508 3300026116 Ga0207674_10931039 Ga0207674_109310392 101
1509 3300026116 Ga0207674_10958773 Ga0207674_109587732 101
1510 3300026116 Ga0207674_11022912 Ga0207674_110229122 101
1511 3300026116 Ga0207674_11178345 Ga0207674_111783451 101
1512 3300026116 Ga0207674_12037765 Ga0207674_120377651 101
1513 3300026116 Ga0207674_12067235 Ga0207674_120672352 101
1514 3300026116 Ga0207674_12147104 Ga0207674_121471042 101
1515 3300026118 Ga0207675_100001227 Ga0207675_10000122738 101
1516 3300026118 Ga0207675_100003424 Ga0207675_1000034245 101
1517 3300026118 Ga0207675_100061965 Ga0207675_1000619655 101
1518 3300026118 Ga0207675_100064333 Ga0207675_1000643335 101
1519 3300026118 Ga0207675_100078112 Ga0207675_1000781124 101
1520 3300026118 Ga0207675_100123212 Ga0207675_1001232122 101
1521 3300026118 Ga0207675_100340084 Ga0207675_1003400841 101
1522 3300026118 Ga0207675_100355804 Ga0207675_1003558042 101
1523 3300026118 Ga0207675_100396060 Ga0207675_1003960602 101
1524 3300026118 Ga0207675_100514622 Ga0207675_1005146222 101
1525 3300026118 Ga0207675_100596114 Ga0207675_1005961141 101
1526 3300026118 Ga0207675_100815172 Ga0207675_1008151721 101
1527 3300026118 Ga0207675_100866865 Ga0207675_1008668652 101
1528 3300026118 Ga0207675_100969103 Ga0207675_1009691031 101
1529 3300026118 Ga0207675_101109191 Ga0207675_1011091912 101
1530 3300026118 Ga0207675_101511187 Ga0207675_1015111871 101
1531 3300026118 Ga0207675_101579976 Ga0207675_1015799761 101
1532 3300026118 Ga0207675_101591346 Ga0207675_1015913461 101
1533 3300026118 Ga0207675_102688596 Ga0207675_1026885961 101
1534 3300026121 Ga0207683_11362906 Ga0207683_113629061 101
1535 3300026142 Ga0207698_10465056 Ga0207698_104650562 101
1536 3300026142 Ga0207698_10685322 Ga0207698_106853222 101
1537 3300026142 Ga0207698_10809124 Ga0207698_108091242 101
1538 3300026142 Ga0207698_11560130 Ga0207698_115601301 101
1539 3300026142 Ga0207698_11760932 Ga0207698_117609321 101
1540 3300026142 Ga0207698_11817109 Ga0207698_118171092 101
1541 3300027360 Ga0209969_1060987 Ga0209969_10609872 101
1542 3300027671 Ga0209588_1010605 Ga0209588_10106052 101
1543 3300027907 Ga0207428_10013155 Ga0207428_100131555 101
1544 3300027907 Ga0207428_10022575 Ga0207428_100225754 101
1545 3300027907 Ga0207428_10125269 Ga0207428_101252693 101
1546 3300027907 Ga0207428_10170089 Ga0207428_101700892 101
1547 3300027907 Ga0207428_11101063 Ga0207428_111010632 101
1548 3300028379 Ga0268266_10623828 Ga0268266_106238282 101
1549 3300028379 Ga0268266_11495061 Ga0268266_114950612 101
1550 3300028380 Ga0268265_10048879 Ga0268265_100488794 101
1551 3300028380 Ga0268265_10063139 Ga0268265_100631394 101
1552 3300028380 Ga0268265_10441934 Ga0268265_104419341 101
1553 3300028380 Ga0268265_10497170 Ga0268265_104971702 101
1554 3300028380 Ga0268265_10529340 Ga0268265_105293402 101
1555 3300028380 Ga0268265_10571716 Ga0268265_105717162 101
1556 3300028380 Ga0268265_10705164 Ga0268265_107051642 101
1557 3300028380 Ga0268265_11269795 Ga0268265_112697952 101
1558 3300028380 Ga0268265_11796821 Ga0268265_117968211 101
1559 3300028380 Ga0268265_12028036 Ga0268265_120280362 101
1560 3300028381 Ga0268264_10085035 Ga0268264_100850352 101
1561 3300028381 Ga0268264_10114653 Ga0268264_101146531 101
1562 3300028381 Ga0268264_10132055 Ga0268264_101320554 101
1563 3300028381 Ga0268264_10145685 Ga0268264_101456853 101
1564 3300028381 Ga0268264_10233483 Ga0268264_102334832 101
1565 3300028381 Ga0268264_10264221 Ga0268264_102642212 101
1566 3300028381 Ga0268264_10311895 Ga0268264_103118952 101
1567 3300028381 Ga0268264_10343439 Ga0268264_103434393 101
1568 3300028381 Ga0268264_10368371 Ga0268264_103683712 101
1569 3300028381 Ga0268264_10429509 Ga0268264_104295092 101
1570 3300028381 Ga0268264_10483917 Ga0268264_104839172 101
1571 3300028381 Ga0268264_10649449 Ga0268264_106494492 101
1572 3300028381 Ga0268264_11170416 Ga0268264_111704162 101
1573 3300028381 Ga0268264_11721797 Ga0268264_117217971 101
1574 3300030732 Ga0316176_1114701 Ga0316176_11147012 101
1575 3300030732 Ga0316176_1131905 Ga0316176_11319051 101
1576 3300030735 Ga0316178_1152305 Ga0316178_11523051 101
1577 3300030742 Ga0316183_1163653 Ga0316183_11636531 101
1578 3300030744 Ga0316181_1050874 Ga0316181_10508741 101
1579 3300030745 Ga0316182_1065118 Ga0316182_10651182 101
1580 3300030745 Ga0316182_1397664 Ga0316182_13976641 101
1581 3300031456 Ga0307513_10119701 Ga0307513_101197015 101
1582 3300031456 Ga0307513_10208833 Ga0307513_102088333 101
1583 3300031548 Ga0307408_100010460 Ga0307408_1000104606 101
1584 3300031548 Ga0307408_100070551 Ga0307408_1000705515 101
1585 3300031548 Ga0307408_100118436 Ga0307408_1001184362 101
1586 3300031548 Ga0307408_100161410 Ga0307408_1001614102 101
1587 3300031548 Ga0307408_100173980 Ga0307408_1001739802 101
1588 3300031548 Ga0307408_100265803 Ga0307408_1002658031 101
1589 3300031548 Ga0307408_100480150 Ga0307408_1004801502 101
1590 3300031548 Ga0307408_101647287 Ga0307408_1016472872 101
1591 3300031731 Ga0307405_10004715 Ga0307405_100047155 101
1592 3300031731 Ga0307405_10704732 Ga0307405_107047321 101
1593 3300031731 Ga0307405_10745462 Ga0307405_107454622 101
1594 3300031731 Ga0307405_10840303 Ga0307405_108403032 101
1595 3300031731 Ga0307405_10919921 Ga0307405_109199211 101
1596 3300031731 Ga0307405_11612208 Ga0307405_116122081 101
1597 3300031824 Ga0307413_10105113 Ga0307413_101051132 101
1598 3300031824 Ga0307413_10296984 Ga0307413_102969842 101
1599 3300031824 Ga0307413_10341523 Ga0307413_103415232 101
1600 3300031824 Ga0307413_10503619 Ga0307413_105036192 101
1601 3300031824 Ga0307413_10812522 Ga0307413_108125222 101
1602 3300031824 Ga0307413_12122216 Ga0307413_121222161 101
1603 3300031852 Ga0307410_10037085 Ga0307410_100370854 101
1604 3300031852 Ga0307410_10568346 Ga0307410_105683461 101
1605 3300031852 Ga0307410_11059552 Ga0307410_110595522 101
1606 3300031852 Ga0307410_12139629 Ga0307410_121396291 101
1607 3300031889 Ga0326468_10073643 Ga0326468_100736431 101
1608 3300031901 Ga0307406_10055051 Ga0307406_100550513 101
1609 3300031901 Ga0307406_10125719 Ga0307406_101257193 101
1610 3300031901 Ga0307406_10167005 Ga0307406_101670052 101
1611 3300031901 Ga0307406_10458069 Ga0307406_104580692 101
1612 3300031901 Ga0307406_11720902 Ga0307406_117209021 101
1613 3300031903 Ga0307407_10075022 Ga0307407_100750224 101
1614 3300031903 Ga0307407_10076830 Ga0307407_100768302 101
1615 3300031903 Ga0307407_10206026 Ga0307407_102060262 101
1616 3300031903 Ga0307407_10303370 Ga0307407_103033702 101
1617 3300031903 Ga0307407_10552024 Ga0307407_105520242 101
1618 3300031903 Ga0307407_11181458 Ga0307407_111814581 101
1619 3300031911 Ga0307412_10014128 Ga0307412_100141285 101
1620 3300031911 Ga0307412_10025492 Ga0307412_100254925 101
1621 3300031911 Ga0307412_10539172 Ga0307412_105391722 101
1622 3300031911 Ga0307412_10892845 Ga0307412_108928452 101
1623 3300031911 Ga0307412_11953830 Ga0307412_119538302 101
1624 3300031995 Ga0307409_100013591 Ga0307409_1000135913 101
1625 3300031995 Ga0307409_100185700 Ga0307409_1001857002 101
1626 3300031995 Ga0307409_101064662 Ga0307409_1010646622 101
1627 3300031995 Ga0307409_102105723 Ga0307409_1021057232 101
1628 3300031995 Ga0307409_102384652 Ga0307409_1023846522 101
1629 3300032002 Ga0307416_100041308 Ga0307416_1000413082 101
1630 3300032002 Ga0307416_100058365 Ga0307416_1000583654 101
1631 3300032002 Ga0307416_100180502 Ga0307416_1001805022 101
1632 3300032002 Ga0307416_100182692 Ga0307416_1001826924 101
1633 3300032002 Ga0307416_100413122 Ga0307416_1004131222 101
1634 3300032002 Ga0307416_100450980 Ga0307416_1004509802 101
1635 3300032002 Ga0307416_100582696 Ga0307416_1005826962 101
1636 3300032002 Ga0307416_100902381 Ga0307416_1009023811 101
1637 3300032002 Ga0307416_101643416 Ga0307416_1016434162 101
1638 3300032002 Ga0307416_101745347 Ga0307416_1017453472 101
1639 3300032002 Ga0307416_103734251 Ga0307416_1037342511 101
1640 3300032004 Ga0307414_10010849 Ga0307414_100108495 101
1641 3300032004 Ga0307414_10150651 Ga0307414_101506512 101
1642 3300032004 Ga0307414_10524540 Ga0307414_105245402 101
1643 3300032004 Ga0307414_11293599 Ga0307414_112935991 101
1644 3300032005 Ga0307411_10036169 Ga0307411_100361695 101
1645 3300032005 Ga0307411_10590393 Ga0307411_105903932 101
1646 3300032005 Ga0307411_10848772 Ga0307411_108487722 101
1647 3300032005 Ga0307411_10910066 Ga0307411_109100662 101
1648 3300032005 Ga0307411_11080738 Ga0307411_110807381 101
1649 3300032005 Ga0307411_11435383 Ga0307411_114353831 101
1650 3300032126 Ga0307415_100063142 Ga0307415_1000631423 101
1651 3300032126 Ga0307415_100342718 Ga0307415_1003427181 101
1652 3300032126 Ga0307415_100874978 Ga0307415_1008749782 101
1653 3300032126 Ga0307415_100955598 Ga0307415_1009555982 101
1654 3300032126 Ga0307415_101040426 Ga0307415_1010404262 101
1655 3300034820 Ga0373959_0041060 Ga0373959_0041060_506_811 101
1656 3300035084 Ga0373928_0192268 Ga0373928_0192268_30_335 101
1657 3300035084 Ga0373928_0235037 Ga0373928_0235037_212_517 101
1658 3300035085 Ga0373929_0179079 Ga0373929_0179079_170_475 101
1659 3300035088 Ga0373940_0036332 Ga0373940_0036332_866_1171 101
1660 3300035088 Ga0373940_0336057 Ga0373940_0336057_47_352 101
1661 3300035091 Ga0373951_0005973 Ga0373951_0005973_1835_2140 101
1662 3300035091 Ga0373951_0105827 Ga0373951_0105827_211_519 101
1663 3300035091 Ga0373951_0193381 Ga0373951_0193381_115_420 101
1664 3300035111 Ga0373923_0101084 Ga0373923_0101084_949_1254 101
1665 3300035112 Ga0373932_0203473 Ga0373932_0203473_113_421 101
1666 3300035114 Ga0373939_0327025 Ga0373939_0327025_216_527 101
1667 3300035170 Ga0373943_0668244 Ga0373943_0668244_228_545 101
1668 3300035207 Ga0373942_0006518 Ga0373942_0006518_1903_2208 101
1669 3300035241 Ga0373961_0092505 Ga0373961_0092505_529_834 101
1670 3300035241 Ga0373961_0095711 Ga0373961_0095711_420_725 101
1671 3300035691 Ga0373931_0117570 Ga0373931_0117570_412_717 101
1672 3300035692 Ga0373935_0277352 Ga0373935_0277352_513_818 101
1673 3300035724 Ga0373933_0327525 Ga0373933_0327525_623_928 101
1674 3300036401 Ga0373937_0154007 Ga0373937_0154007_1273_1578 101
1675 3300036401 Ga0373937_0219024 Ga0373937_0219024_580_885 101
1676 3300037312 Ga0395899_0657409 Ga0395899_0657409_134_439 101
1677 3300037418 Ga0395900_0105517 Ga0395900_0105517_764_1069 101
1678 3300037418 Ga0395900_0166303 Ga0395900_0166303_331_636 101
1679 3300037418 Ga0395900_0263628 Ga0395900_0263628_429_734 101
1680 3300037418 Ga0395900_0342999 Ga0395900_0342999_136_441 101
1681 3300037418 Ga0395900_0672217 Ga0395900_0672217_129_440 101
1682 3300037466 Ga0395898_0171193 Ga0395898_0171193_963_1268 101
1683 3300037466 Ga0395898_0328589 Ga0395898_0328589_58_363 101
1684 3300037466 Ga0395898_0522198 Ga0395898_0522198_518_823 101
1685 3300037466 Ga0395898_0841307 Ga0395898_0841307_402_707 101
1686 3300037471 Ga0395905_0004072 Ga0395905_0004072_6598_6903 101
1687 3300037471 Ga0395905_0030119 Ga0395905_0030119_4693_4998 101
1688 3300037853 Ga0436364_0478435 Ga0436364_0478435_654_959 101
1689 3300037853 Ga0436364_0653795 Ga0436364_0653795_207_512 101
1690 3300037853 Ga0436364_1207613 Ga0436364_1207613_461_766 101
1691 3300038443 Ga0395901_0050149 Ga0395901_0050149_2750_3055 101
1692 3300038443 Ga0395901_0097048 Ga0395901_0097048_2171_2476 101
1693 3300038443 Ga0395901_0236501 Ga0395901_0236501_942_1247 101
1694 3300038698 Ga0242419_006000 Ga0242419_006000_260_565 101
1695 3300038698 Ga0242419_007703 Ga0242419_007703_91_396 101
1696 3300038699 Ga0242422_00182 Ga0242422_00182_2636_2941 101
1697 3300038996 Ga0242420_001977 Ga0242420_001977_1282_1593 101
1698 3300038996 Ga0242420_003462 Ga0242420_003462_1448_1753 101
1699 3300038996 Ga0242420_003719 Ga0242420_003719_142_447 101
1700 3300039437 Ga0436365_0275079 Ga0436365_0275079_295_600 101
1701 3300039437 Ga0436365_0691918 Ga0436365_0691918_1194_1499 101
1702 3300039437 Ga0436365_0780917 Ga0436365_0780917_815_1120 101
1703 3300039437 Ga0436365_1107781 Ga0436365_1107781_659_964 101
1704 3300039437 Ga0436365_1319766 Ga0436365_1319766_75_380 101
1705 3300039437 Ga0436365_1501396 Ga0436365_1501396_1150_1455 101
1706 3300039450 Ga0436363_1472621 Ga0436363_1472621_429_734 101
1707 3300041408 Ga0439453_0038699 Ga0439453_0038699_610_915 101
1708 3300041451 Ga0451791_1698514 Ga0451791_1698514_95_412 101
1709 3300041452 Ga0451793_1437177 Ga0451793_1437177_165_494 101
1710 3300041494 Ga0451837_0510004 Ga0451837_0510004_434_763 101
1711 3300042002 Ga0439442_055147 Ga0439442_055147_477_782 101
1712 3300042012 Ga0439455_0008775 Ga0439455_0008775_1363_1668 101
1713 3300042014 Ga0439457_021544 Ga0439457_021544_862_1167 101
1714 3300042015 Ga0439462_0009642 Ga0439462_0009642_1741_2046 101
1715 3300042015 Ga0439462_0017954 Ga0439462_0017954_1040_1345 101
1716 3300042142 Ga0450905_098339 Ga0450905_098339_207_512 101
1717 3300042156 Ga0439446_0160554 Ga0439446_0160554_102_407 101
1718 3300042157 Ga0439458_0006664 Ga0439458_0006664_622_927 101
1719 3300042435 Ga0439434_0013536 Ga0439434_0013536_144_449 101
1720 3300042435 Ga0439434_0186706 Ga0439434_0186706_317_622 101
1721 3300042436 Ga0439435_0057583 Ga0439435_0057583_542_847 101
1722 3300042436 Ga0439435_0064345 Ga0439435_0064345_123_428 101
1723 3300042436 Ga0439435_0318282 Ga0439435_0318282_105_410 101
1724 3300042437 Ga0439444_0018713 Ga0439444_0018713_556_861 101
1725 3300042438 Ga0439459_0097705 Ga0439459_0097705_92_397 101
1726 3300042439 Ga0439464_0024004 Ga0439464_0024004_788_1093 101
1727 3300042876 Ga0451577_0056944 Ga0451577_0056944_360_665 101
1728 3300042876 Ga0451577_1023371 Ga0451577_1023371_344_649 101
1729 3300042876 Ga0451577_1445202 Ga0451577_1445202_232_537 101
1730 3300044712 Ga0453684_0903081 Ga0453684_0903081_393_698 101
1731 3300045051 Ga0451576_0669840 Ga0451576_0669840_33_338 101
1732 3300045051 Ga0451576_0967777 Ga0451576_0967777_183_488 101
1733 3300045051 Ga0451576_1590693 Ga0451576_1590693_147_452 101
1734 3300045051 Ga0451576_1751010 Ga0451576_1751010_246_551 101
1735 3300045051 Ga0451576_2379893 Ga0451576_2379893_47_352 101
1736 3300045976 Ga0466967_2139940 Ga0466967_2139940_13_318 101
1737 3300046472 Ga0495580_0190632 Ga0495580_0190632_96_401 101
1738 3300046473 Ga0495582_0121519 Ga0495582_0121519_137_442 101
1739 3300046476 Ga0495662_0087257 Ga0495662_0087257_1054_1359 101
1740 3300046512 Ga0495610_0116247 Ga0495610_0116247_518_823 101
1741 3300046514 Ga0495618_0097309 Ga0495618_0097309_267_572 101
1742 3300046515 Ga0495620_0352839 Ga0495620_0352839_124_429 101
1743 3300046517 Ga0495630_0087083 Ga0495630_0087083_1252_1557 101
1744 3300046519 Ga0495632_0041632 Ga0495632_0041632_52_357 101
1745 3300046525 Ga0495663_0031461 Ga0495663_0031461_92_397 101
1746 3300046526 Ga0495666_0454746 Ga0495666_0454746_69_374 101
1747 3300046528 Ga0495642_0199975 Ga0495642_0199975_514_819 101
1748 3300046535 Ga0495586_0158761 Ga0495586_0158761_332_637 101
1749 3300046539 Ga0495621_0002629 Ga0495621_0002629_2972_3277 101
1750 3300046539 Ga0495621_0003735 Ga0495621_0003735_167_472 101
1751 3300046615 Ga0495656_0450851 Ga0495656_0450851_293_598 101
1752 3300046616 Ga0495668_0353220 Ga0495668_0353220_453_758 101
1753 3300046660 Ga0495625_0123105 Ga0495625_0123105_1008_1313 101
1754 3300046663 Ga0495635_0118662 Ga0495635_0118662_1323_1628 101
1755 3300046684 Ga0495669_0577942 Ga0495669_0577942_225_530 101
1756 3300046689 Ga0495613_0139238 Ga0495613_0139238_91_396 101
1757 3300046691 Ga0495670_0332567 Ga0495670_0332567_302_607 101
1758 3300046809 Ga0495600_0040284 Ga0495600_0040284_2078_2383 101
1759 3300047315 Ga0495581_0384816 Ga0495581_0384816_220_525 101
1760 3300047318 Ga0495636_0019939 Ga0495636_0019939_1030_1335 101
1761 3300047320 Ga0495672_0433635 Ga0495672_0433635_256_561 101
1762 3300047447 Ga0495685_217509 Ga0495685_217509_84_389 101
1763 3300047471 Ga0495684_0183101 Ga0495684_0183101_1169_1474 101
1764 3300048089 Ga0495614_0274843 Ga0495614_0274843_263_568 101
1765 3300048090 Ga0495615_0019471 Ga0495615_0019471_857_1162 101
1766 3300048903 Ga0496100_0653641 Ga0496100_0653641_108_413 101
1767 3300048903 Ga0496100_0971590 Ga0496100_0971590_320_625 101
1768 3300048905 Ga0496102_0017811 Ga0496102_0017811_211_522 101
1769 3300048905 Ga0496102_0273991 Ga0496102_0273991_505_810 101
1770 3300048905 Ga0496102_1019260 Ga0496102_1019260_200_505 101
1771 3300048905 Ga0496102_1057621 Ga0496102_1057621_178_483 101
1772 3300048906 Ga0496103_0099657 Ga0496103_0099657_360_671 101
1773 3300048907 Ga0496104_0051718 Ga0496104_0051718_2008_2319 101
1774 3300048907 Ga0496104_0070007 Ga0496104_0070007_2787_3092 101
1775 3300048907 Ga0496104_0648438 Ga0496104_0648438_45_350 101
1776 3300048907 Ga0496104_1256574 Ga0496104_1256574_49_354 101
1777 3300048909 Ga0496106_0004259 Ga0496106_0004259_7627_7932 101
1778 3300048909 Ga0496106_0055057 Ga0496106_0055057_1323_1634 101
1779 3300048909 Ga0496106_1316341 Ga0496106_1316341_210_515 101
1780 3300048909 Ga0496106_1451716 Ga0496106_1451716_199_504 101
1781 3300048910 Ga0496107_0074027 Ga0496107_0074027_1640_1945 101
1782 3300048910 Ga0496107_0169893 Ga0496107_0169893_130_435 101
1783 3300048910 Ga0496107_0777631 Ga0496107_0777631_71_376 101
1784 3300048911 Ga0496108_0105590 Ga0496108_0105590_1876_2181 101
1785 3300048911 Ga0496108_0593906 Ga0496108_0593906_26_331 101
1786 3300048911 Ga0496108_1426533 Ga0496108_1426533_244_555 101
1787 3300048912 Ga0496109_0044357 Ga0496109_0044357_2562_2873 101
1788 3300048912 Ga0496109_0399282 Ga0496109_0399282_179_484 101
1789 3300048912 Ga0496109_1000695 Ga0496109_1000695_89_394 101
1790 3300048913 Ga0496110_0914850 Ga0496110_0914850_267_572 101
1791 3300048913 Ga0496110_1018490 Ga0496110_1018490_297_602 101
1792 3300048913 Ga0496110_1576779 Ga0496110_1576779_167_472 101
1793 3300048913 Ga0496110_1595155 Ga0496110_1595155_247_552 101
1794 3300048914 Ga0496111_0231442 Ga0496111_0231442_20_325 101
1795 3300048915 Ga0496112_0079543 Ga0496112_0079543_2698_3003 101
1796 3300048915 Ga0496112_0224066 Ga0496112_0224066_222_527 101
1797 3300048915 Ga0496112_0251224 Ga0496112_0251224_528_833 101
1798 3300048915 Ga0496112_0443088 Ga0496112_0443088_626_931 101
1799 3300048915 Ga0496112_0557274 Ga0496112_0557274_389_694 101
1800 3300048915 Ga0496112_0669639 Ga0496112_0669639_423_728 101
1801 3300048915 Ga0496112_0720129 Ga0496112_0720129_592_897 101
1802 3300048915 Ga0496112_0802136 Ga0496112_0802136_136_441 101
1803 3300048915 Ga0496112_0861885 Ga0496112_0861885_481_786 101
1804 3300048916 Ga0496113_0220248 Ga0496113_0220248_538_843 101
1805 3300048916 Ga0496113_0296936 Ga0496113_0296936_639_950 101
1806 3300048916 Ga0496113_0816380 Ga0496113_0816380_129_434 101
1807 3300048916 Ga0496113_1224519 Ga0496113_1224519_256_561 101
1808 3300048916 Ga0496113_1272561 Ga0496113_1272561_124_429 101
1809 3300049513 Ga0501290_028321 Ga0501290_028321_152_457 101
1810 3300049514 Ga0501291_032148 Ga0501291_032148_142_447 101
1811 3300049514 Ga0501291_092465 Ga0501291_092465_220_525 101
1812 3300049515 Ga0501292_037297 Ga0501292_037297_58_363 101
1813 3300049515 Ga0501292_053336 Ga0501292_053336_42_347 101
1814 3300049516 Ga0501293_046113 Ga0501293_046113_14_319 101
1815 3300049517 Ga0501294_015591 Ga0501294_015591_258_563 101
1816 3300049518 Ga0501295_015159 Ga0501295_015159_765_1070 101
1817 3300049519 Ga0501296_003427 Ga0501296_003427_1192_1497 101
1818 3300049519 Ga0501296_005536 Ga0501296_005536_263_568 101
1819 3300049520 Ga0501297_054343 Ga0501297_054343_160_465 101
1820 3300049521 Ga0501298_000513 Ga0501298_000513_1838_2143 101
1821 3300049521 Ga0501298_003745 Ga0501298_003745_1310_1615 101
1822 3300049521 Ga0501298_018322 Ga0501298_018322_532_837 101
1823 3300049521 Ga0501298_048276 Ga0501298_048276_193_498 101
1824 3300049522 Ga0501299_002737 Ga0501299_002737_1388_1693 101
1825 3300049522 Ga0501299_038367 Ga0501299_038367_389_694 101
1826 3300049526 Ga0501303_049884 Ga0501303_049884_159_464 101
1827 3300049527 Ga0501311_103897 Ga0501311_103897_44_349 101
1828 3300049574 Ga0501038_0003393 Ga0501038_0003393_6902_7207 101
1829 3300049577 Ga0501041_0899393 Ga0501041_0899393_163_468 101
1830 3300049578 Ga0501042_0480554 Ga0501042_0480554_483_788 101
1831 3300049582 Ga0501048_0037126 Ga0501048_0037126_1005_1310 101
1832 3300049585 Ga0501069_0268000 Ga0501069_0268000_654_959 101
1833 3300049592 Ga0501076_0195538 Ga0501076_0195538_70_375 101
1834 3300049649 Ga0501198_030863 Ga0501198_030863_463_768 101
1835 3300049649 Ga0501198_038518 Ga0501198_038518_423_728 101
1836 3300049651 Ga0501201_038152 Ga0501201_038152_245_550 101
1837 3300049652 Ga0501202_013898 Ga0501202_013898_1193_1498 101
1838 3300049652 Ga0501202_044798 Ga0501202_044798_272_577 101
1839 3300049654 Ga0501207_003424 Ga0501207_003424_1375_1680 101
1840 3300049654 Ga0501207_024851 Ga0501207_024851_73_378 101
1841 3300049656 Ga0501209_066306 Ga0501209_066306_639_944 101
1842 3300049659 Ga0501214_011496 Ga0501214_011496_561_866 101
1843 3300049660 Ga0501216_004975 Ga0501216_004975_1497_1802 101
1844 3300049660 Ga0501216_007638 Ga0501216_007638_1041_1346 101
1845 3300049660 Ga0501216_007976 Ga0501216_007976_423_728 101
1846 3300049660 Ga0501216_103034 Ga0501216_103034_211_516 101
1847 3300049661 Ga0501217_010351 Ga0501217_010351_496_801 101
1848 3300049661 Ga0501217_019837 Ga0501217_019837_771_1076 101
1849 3300049661 Ga0501217_020774 Ga0501217_020774_960_1265 101
1850 3300049661 Ga0501217_055864 Ga0501217_055864_409_714 101
1851 3300049663 Ga0501223_045714 Ga0501223_045714_274_579 101
1852 3300049664 Ga0501224_002725 Ga0501224_002725_1352_1657 101
1853 3300049664 Ga0501224_083257 Ga0501224_083257_179_484 101
1854 3300049665 Ga0501227_005457 Ga0501227_005457_494_799 101
1855 3300049665 Ga0501227_029169 Ga0501227_029169_58_363 101
1856 3300049666 Ga0501228_028517 Ga0501228_028517_305_610 101
1857 3300049667 Ga0501230_046471 Ga0501230_046471_421_726 101
1858 3300049667 Ga0501230_084784 Ga0501230_084784_156_461 101
1859 3300049668 Ga0501233_022442 Ga0501233_022442_960_1265 101
1860 3300049668 Ga0501233_179657 Ga0501233_179657_192_497 101
1861 3300049669 Ga0501235_020409 Ga0501235_020409_330_635 101
1862 3300049669 Ga0501235_020985 Ga0501235_020985_1043_1348 101
1863 3300049669 Ga0501235_047421 Ga0501235_047421_567_872 101
1864 3300049669 Ga0501235_196420 Ga0501235_196420_52_357 101
1865 3300049671 Ga0501238_070746 Ga0501238_070746_85_390 101
1866 3300049672 Ga0501239_010730 Ga0501239_010730_264_569 101
1867 3300049672 Ga0501239_021468 Ga0501239_021468_453_758 101
1868 3300049672 Ga0501239_022097 Ga0501239_022097_282_587 101
1869 3300049674 Ga0501242_051215 Ga0501242_051215_86_391 101
1870 3300049675 Ga0501243_028665 Ga0501243_028665_618_923 101
1871 3300049676 Ga0501246_002536 Ga0501246_002536_705_1010 101
1872 3300049676 Ga0501246_030861 Ga0501246_030861_68_373 101
1873 3300049677 Ga0501247_019321 Ga0501247_019321_405_710 101
1874 3300049677 Ga0501247_029507 Ga0501247_029507_276_581 101
1875 3300049679 Ga0501249_026377 Ga0501249_026377_902_1207 101
1876 3300049679 Ga0501249_046654 Ga0501249_046654_408_713 101
1877 3300049679 Ga0501249_058433 Ga0501249_058433_214_519 101
1878 3300049680 Ga0501250_004199 Ga0501250_004199_397_702 101
1879 3300049681 Ga0501251_056136 Ga0501251_056136_79_384 101
1880 3300049683 Ga0501253_019615 Ga0501253_019615_421_726 101
1881 3300049683 Ga0501253_055503 Ga0501253_055503_423_728 101
1882 3300049685 Ga0501256_005713 Ga0501256_005713_741_1046 101
1883 3300049685 Ga0501256_031939 Ga0501256_031939_252_557 101
1884 3300049686 Ga0501257_010713 Ga0501257_010713_453_758 101
1885 3300049686 Ga0501257_059821 Ga0501257_059821_638_943 101
1886 3300049686 Ga0501257_065647 Ga0501257_065647_559_864 101
1887 3300049686 Ga0501257_076330 Ga0501257_076330_377_682 101
1888 3300049688 Ga0501259_012435 Ga0501259_012435_1015_1320 101
1889 3300049688 Ga0501259_042617 Ga0501259_042617_568_873 101
1890 3300049689 Ga0501260_007676 Ga0501260_007676_300_605 101
1891 3300049689 Ga0501260_038663 Ga0501260_038663_170_475 101
1892 3300049690 Ga0501261_043933 Ga0501261_043933_144_449 101
1893 3300049703 Ga0501219_031273 Ga0501219_031273_135_440 101
1894 3300049704 Ga0501221_032772 Ga0501221_032772_504_809 101
1895 3300049704 Ga0501221_062204 Ga0501221_062204_449_754 101
1896 3300049704 Ga0501221_220505 Ga0501221_220505_133_438 101
1897 3300049705 Ga0501225_0037426 Ga0501225_0037426_589_894 101
1898 3300049705 Ga0501225_0182605 Ga0501225_0182605_17_322 101
1899 3300049705 Ga0501225_0283106 Ga0501225_0283106_20_325 101
1900 3300049706 Ga0501229_064567 Ga0501229_064567_63_368 101
1901 3300049708 Ga0501245_018065 Ga0501245_018065_101_406 101
1902 3300049708 Ga0501245_074194 Ga0501245_074194_131_436 101
1903 3300049741 Ga0501079_0385915 Ga0501079_0385915_160_465 101
1904 3300049743 Ga0501081_0305140 Ga0501081_0305140_70_375 101
1905 3300049764 Ga0501267_064469 Ga0501267_064469_91_396 101
1906 3300049766 Ga0501269_026236 Ga0501269_026236_86_391 101
1907 3300049767 Ga0501270_007418 Ga0501270_007418_885_1190 101
1908 3300049767 Ga0501270_012143 Ga0501270_012143_675_980 101
1909 3300049768 Ga0501271_017840 Ga0501271_017840_128_433 101
1910 3300049769 Ga0501272_007658 Ga0501272_007658_386_691 101
1911 3300049770 Ga0501273_002047 Ga0501273_002047_217_522 101
1912 3300049770 Ga0501273_005281 Ga0501273_005281_421_726 101
1913 3300049772 Ga0501275_036930 Ga0501275_036930_50_355 101
1914 3300049778 Ga0501282_008354 Ga0501282_008354_591_896 101
1915 3300049779 Ga0501283_002459 Ga0501283_002459_1906_2211 101
1916 3300049779 Ga0501283_029855 Ga0501283_029855_420_725 101
1917 3300049779 Ga0501283_045201 Ga0501283_045201_421_726 101
1918 3300049851 Ga0501212_026237 Ga0501212_026237_269_574 101
1919 3300049853 Ga0501226_009264 Ga0501226_009264_264_569 101
1920 3300049853 Ga0501226_015842 Ga0501226_015842_268_573 101
1921 3300050507 nmdc:mga05p37_120804_c1 nmdc:mga05p37_120804_c1_1107_1412 101
1922 3300050507 nmdc:mga05p37_1338754_c1 nmdc:mga05p37_1338754_c1_82_387 101
1923 3300050507 nmdc:mga05p37_149953_c1 nmdc:mga05p37_149953_c1_2164_2469 101
1924 3300050507 nmdc:mga05p37_171876_c1 nmdc:mga05p37_171876_c1_1097_1402 101
1925 3300050507 nmdc:mga05p37_186728_c1 nmdc:mga05p37_186728_c1_525_830 101
1926 3300050507 nmdc:mga05p37_1873149_c1 nmdc:mga05p37_1873149_c1_229_534 101
1927 3300050507 nmdc:mga05p37_2117195_c1 nmdc:mga05p37_2117195_c1_179_484 101
1928 3300050507 nmdc:mga05p37_2156524_c1 nmdc:mga05p37_2156524_c1_157_462 101
1929 3300050507 nmdc:mga05p37_297927_c1 nmdc:mga05p37_297927_c1_1408_1713 101
1930 3300050507 nmdc:mga05p37_354785_c1 nmdc:mga05p37_354785_c1_274_579 101
1931 3300050507 nmdc:mga05p37_368239_c1 nmdc:mga05p37_368239_c1_683_988 101
1932 3300050507 nmdc:mga05p37_44946_c1 nmdc:mga05p37_44946_c1_3964_4269 101
1933 3300050507 nmdc:mga05p37_525004_c1 nmdc:mga05p37_525004_c1_673_978 101
1934 3300050507 nmdc:mga05p37_726895_c1 nmdc:mga05p37_726895_c1_458_763 101
1935 3300050507 nmdc:mga05p37_75055_c1 nmdc:mga05p37_75055_c1_186_491 101
1936 3300050507 nmdc:mga05p37_795005_c1 nmdc:mga05p37_795005_c1_210_515 101
1937 3300050507 nmdc:mga05p37_84881_c1 nmdc:mga05p37_84881_c1_2100_2405 101
1938 3300050507 nmdc:mga05p37_919318_c1 nmdc:mga05p37_919318_c1_376_681 101
1939 3300050508 nmdc:mga09592_1019693_c1 nmdc:mga09592_1019693_c1_20_325 101
1940 3300050508 nmdc:mga09592_109716_c1 nmdc:mga09592_109716_c1_927_1232 101
1941 3300050508 nmdc:mga09592_149740_c1 nmdc:mga09592_149740_c1_236_541 101
1942 3300050508 nmdc:mga09592_1631598_c1 nmdc:mga09592_1631598_c1_175_480 101
1943 3300050508 nmdc:mga09592_404510_c1 nmdc:mga09592_404510_c1_68_373 101
1944 3300050508 nmdc:mga09592_456619_c1 nmdc:mga09592_456619_c1_129_434 101
1945 3300050509 nmdc:mga0qj67_158498_c1 nmdc:mga0qj67_158498_c1_957_1262 101
1946 3300050509 nmdc:mga0qj67_60903_c1 nmdc:mga0qj67_60903_c1_1037_1342 101
1947 3300050509 nmdc:mga0qj67_74171_c1 nmdc:mga0qj67_74171_c1_941_1246 101
1948 3300050510 nmdc:mga06r32_1039059_c1 nmdc:mga06r32_1039059_c1_205_510 101
1949 3300050510 nmdc:mga06r32_1941765_c1 nmdc:mga06r32_1941765_c1_184_489 101
1950 3300050510 nmdc:mga06r32_310374_c1 nmdc:mga06r32_310374_c1_180_485 101
1951 3300050510 nmdc:mga06r32_426168_c1 nmdc:mga06r32_426168_c1_523_828 101
1952 3300050510 nmdc:mga06r32_781317_c1 nmdc:mga06r32_781317_c1_346_651 101
1953 3300050511 nmdc:mga08y16_123832_c1 nmdc:mga08y16_123832_c1_1972_2277 101
1954 3300050511 nmdc:mga08y16_1615414_c1 nmdc:mga08y16_1615414_c1_239_544 101
1955 3300050511 nmdc:mga08y16_23449_c1 nmdc:mga08y16_23449_c1_6064_6372 101
1956 3300050511 nmdc:mga08y16_416416_c1 nmdc:mga08y16_416416_c1_783_1088 101
1957 3300050511 nmdc:mga08y16_5130_c1 nmdc:mga08y16_5130_c1_10968_11273 101
1958 3300050511 nmdc:mga08y16_941060_c1 nmdc:mga08y16_941060_c1_379_684 101
1959 3300050512 nmdc:mga0n895_1019373_c1 nmdc:mga0n895_1019373_c1_484_789 101
1960 3300050512 nmdc:mga0n895_104188_c1 nmdc:mga0n895_104188_c1_1491_1796 101
1961 3300050512 nmdc:mga0n895_1355487_c1 nmdc:mga0n895_1355487_c1_336_641 101
1962 3300050512 nmdc:mga0n895_1533145_c1 nmdc:mga0n895_1533145_c1_14_319 101
1963 3300050512 nmdc:mga0n895_1584000_c1 nmdc:mga0n895_1584000_c1_23_334 101
1964 3300050512 nmdc:mga0n895_1632146_c1 nmdc:mga0n895_1632146_c1_219_524 101
1965 3300050512 nmdc:mga0n895_169469_c1 nmdc:mga0n895_169469_c1_1342_1650 101
1966 3300050512 nmdc:mga0n895_1919830_c1 nmdc:mga0n895_1919830_c1_180_485 101
1967 3300050512 nmdc:mga0n895_31204_c1 nmdc:mga0n895_31204_c1_100_405 101
1968 3300050512 nmdc:mga0n895_330977_c1 nmdc:mga0n895_330977_c1_1216_1521 101
1969 3300050512 nmdc:mga0n895_368601_c1 nmdc:mga0n895_368601_c1_250_555 101
1970 3300050512 nmdc:mga0n895_46880_c1 nmdc:mga0n895_46880_c1_1549_1854 101
1971 3300050512 nmdc:mga0n895_470902_c1 nmdc:mga0n895_470902_c1_327_632 101
1972 3300050512 nmdc:mga0n895_560721_c1 nmdc:mga0n895_560721_c1_523_828 101
1973 3300050512 nmdc:mga0n895_761884_c1 nmdc:mga0n895_761884_c1_447_752 101
1974 3300050512 nmdc:mga0n895_784698_c1 nmdc:mga0n895_784698_c1_321_626 101
1975 3300050512 nmdc:mga0n895_900314_c1 nmdc:mga0n895_900314_c1_33_338 101
1976 3300050512 nmdc:mga0n895_90323_c1 nmdc:mga0n895_90323_c1_1841_2146 101
1977 3300050513 nmdc:mga0rr50_116_c1 nmdc:mga0rr50_116_c1_2787_3092 101
1978 3300050513 nmdc:mga0rr50_142776_c1 nmdc:mga0rr50_142776_c1_956_1261 101
1979 3300050513 nmdc:mga0rr50_192186_c1 nmdc:mga0rr50_192186_c1_81_386 101
1980 3300050513 nmdc:mga0rr50_223268_c1 nmdc:mga0rr50_223268_c1_794_1099 101
1981 3300050513 nmdc:mga0rr50_429847_c1 nmdc:mga0rr50_429847_c1_202_513 101
1982 3300050513 nmdc:mga0rr50_479607_c1 nmdc:mga0rr50_479607_c1_102_413 101
1983 3300050514 nmdc:mga08x19_12913_c1 nmdc:mga08x19_12913_c1_4406_4711 101
1984 3300050514 nmdc:mga08x19_187197_c1 nmdc:mga08x19_187197_c1_614_919 101
1985 3300050514 nmdc:mga08x19_40_c1 nmdc:mga08x19_40_c1_152225_152530 101
1986 3300050515 nmdc:mga0a205_115731_c1 nmdc:mga0a205_115731_c1_585_890 101
1987 3300050515 nmdc:mga0a205_159324_c1 nmdc:mga0a205_159324_c1_554_859 101
1988 3300050515 nmdc:mga0a205_322086_c1 nmdc:mga0a205_322086_c1_929_1234 101
1989 3300050515 nmdc:mga0a205_35529_c1 nmdc:mga0a205_35529_c1_4309_4614 101
1990 3300050515 nmdc:mga0a205_358707_c1 nmdc:mga0a205_358707_c1_802_1107 101
1991 3300050515 nmdc:mga0a205_392929_c1 nmdc:mga0a205_392929_c1_544_849 101
1992 3300050515 nmdc:mga0a205_420431_c1 nmdc:mga0a205_420431_c1_585_890 101
1993 3300050515 nmdc:mga0a205_46253_c1 nmdc:mga0a205_46253_c1_3450_3755 101
1994 3300050515 nmdc:mga0a205_466487_c1 nmdc:mga0a205_466487_c1_23_328 101
1995 3300050515 nmdc:mga0a205_476656_c1 nmdc:mga0a205_476656_c1_649_954 101
1996 3300050515 nmdc:mga0a205_536590_c1 nmdc:mga0a205_536590_c1_220_525 101
1997 3300050515 nmdc:mga0a205_657443_c1 nmdc:mga0a205_657443_c1_547_852 101
1998 3300050515 nmdc:mga0a205_932129_c1 nmdc:mga0a205_932129_c1_68_373 101
1999 3300050515 nmdc:mga0a205_97677_c1 nmdc:mga0a205_97677_c1_214_525 101
2000 3300053142 Ga0500577_0010694 Ga0500577_0010694_2009_2320 101
2001 3300053153 Ga0500616_0000478 Ga0500616_0000478_49497_49805 101
2002 3300053154 Ga0500619_215499 Ga0500619_215499_312_620 101
2003 3300059477 Ga0587084_106954 Ga0587084_106954_148_453 101
2004 3300059645 Ga0587076_118614 Ga0587076_118614_108_413 101
2005 3300059655 Ga0587114_101161 Ga0587114_101161_193_498 101
2006 3300060353 Ga0501082_0450148 Ga0501082_0450148_453_758 101
2007 3300060353 Ga0501082_1566160 Ga0501082_1566160_60_365 101
2008 3300061734 Ga0530510_0324057 Ga0530510_0324057_712_1017 101
2009 3300061734 Ga0530510_0346744 Ga0530510_0346744_601_906 101
2010 3300061734 Ga0530510_0814937 Ga0530510_0814937_254_559 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

16

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9313 3 92
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9273 4 96
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.924 4 89
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9198 4 92
6tnn-assembly1.cif.gz_m mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna 0.9187 1 96
ID Description Score Start End Superfamily
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8814 6 95 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8767 4 96 3.30.70.330
4a1aR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8718 1 92 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8711 2 92 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.863 6 95 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A7V9P8Z4-F1-model_v4 Large ribosomal subunit protein uL23m (50S ribosomal protein L23) 0.963 29 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2V5VG40-F1-model_v4 50S ribosomal protein L23 0.9597 1 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q03PV9-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9588 2 96 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3C0KRD0-F1-model_v4 50S ribosomal protein L23 0.9584 2 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F3XY97-F1-model_v4 Large ribosomal subunit protein uL23 0.9581 1 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.99 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map