F496261

General Info

Members Datasets Scaffolds Average Seq Length
2014 515 4028 254

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100025942|Ga0070670_1000259425
Length 279
Sequence MFFGFLKCRRGPVPALELKRERVAGKIDPMHQFTVEPLVPLHIGQYDISLTNSAAWMLAALAVIGIFMWGGLKRQVVPGRWQMAVEGLTGFIDDLVQVNIGPEGKKFTPFVFSLFTFILVANLLGLLPLAVVPGWHPFTPTSHFSITGLLAIMSFSLVLIIGFWRHGFHFFSLFVPHGTPWYMLPLIIPIEIVSFLVRPFSLALRLFVAMMSGHILMEVFGSFIVNGFASGSPVGFGVGAVSFIFIVGVGALELLVCALQAYVFALLTSLYLNDAINLH

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
267 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
276 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
277 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
280 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
281 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
284 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
285 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
286 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
287 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
288 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
291 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
294 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
298 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
299 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
305 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
306 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
307 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
308 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
309 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
323 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
364 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
365 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
366 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
383 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
384 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
385 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
386 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
387 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
388 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
389 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
390 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
391 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
392 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
393 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
394 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
395 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
396 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
397 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
398 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
399 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
400 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
401 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
402 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
403 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
404 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
405 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
406 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
407 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
408 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
421 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
422 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
423 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
427 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
430 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
438 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
439 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
440 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
441 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
444 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
445 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
446 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
447 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
448 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
449 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
450 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
451 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
452 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
453 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
454 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
455 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
473 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
474 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
475 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
476 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
477 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
478 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
479 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
480 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
481 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
482 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
483 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
484 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
485 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
486 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
487 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
488 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
489 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
490 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
491 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
492 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
493 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
494 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
495 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
496 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
497 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
498 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
499 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
500 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
501 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
502 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
503 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
504 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
505 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
506 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
507 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
508 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
509 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
510 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
511 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
512 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
513 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
514 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
515 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 1.59
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 4.77
Rhizosphere 84.16
Stem 0
Stem Tuber 0.05
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100025942 3300005331 Bacteria 5043
2 SwRhRL2b_contig_2373431 2162886007 Bacteria 2044
3 SwRhRL2b_contig_3240803 2162886007 Bacteria 7724
4 ARcpr5yngRDRAFT_c002310 3300000043 Bacteria 1991
5 ARcpr5yngRDRAFT_c002397 3300000043 Bacteria 1952
6 JGI24736J21556_1000024 3300001904 Bacteria 25524
7 JGI24736J21556_1000894 3300001904 Bacteria 5498
8 JGI24741J21665_1001581 3300001915 Bacteria 6416
9 JGI24741J21665_1005779 3300001915 Bacteria 2543
10 JGI24741J21665_1014952 3300001915 Bacteria 1288
11 JGI24752J21851_1000048 3300001976 Bacteria 14796
12 JGI24752J21851_1003668 3300001976 Bacteria 2022
13 JGI24740J21852_10013244 3300001979 Bacteria 3084
14 JGI24740J21852_10015928 3300001979 Bacteria 2730
15 JGI24740J21852_10017907 3300001979 Bacteria 2524
16 JGI24739J22299_10001507 3300001989 Bacteria 8786
17 JGI24739J22299_10002125 3300001989 Bacteria 7590
18 JGI24739J22299_10005863 3300001989 Bacteria 4649
19 JGI24739J22299_10013077 3300001989 Bacteria 3035
20 JGI24739J22299_10033675 3300001989 Bacteria 1751
21 JGI24737J22298_10000013 3300001990 Bacteria 50248
22 JGI24737J22298_10001009 3300001990 Bacteria 9974
23 JGI24737J22298_10001298 3300001990 Bacteria 8850
24 JGI24737J22298_10004537 3300001990 Bacteria 4833
25 JGI24737J22298_10004568 3300001990 Bacteria 4816
26 JGI24735J21928_10000956 3300002067 Bacteria 10324
27 JGI24735J21928_10004910 3300002067 Bacteria 4457
28 JGI24750J21931_1000042 3300002070 Bacteria 16868
29 JGI24748J21848_1000063 3300002074 Bacteria 40664
30 JGI24748J21848_1003743 3300002074 Bacteria 1739
31 JGI24738J21930_10000465 3300002075 Bacteria 11489
32 JGI24738J21930_10002029 3300002075 Bacteria 5429
33 JGI24738J21930_10002782 3300002075 Bacteria 4494
34 JGI24749J21850_1003782 3300002076 Bacteria 2111
35 JGI24749J21850_1011040 3300002076 Bacteria 1267
36 JGI24744J21845_10018508 3300002077 Bacteria 1380
37 JGI24034J26672_10000007 3300002239 Bacteria 224370
38 JGI24742J22300_10030958 3300002244 Bacteria 935
39 JGI24751J29686_10000403 3300002459 Bacteria 13939
40 JGI24751J29686_10012533 3300002459 Bacteria 1748
41 JGI25150J39212_1000452 3300002774 Bacteria 18164
42 JGI25153J46596_10000028 3300003215 Bacteria 209842
43 JGI25153J46596_10012957 3300003215 Bacteria 3558
44 Ga0055526_1000478 3300003771 Bacteria 31736
45 Ga0055537_1000941 3300003773 Bacteria 13502
46 Ga0055524_1000457 3300003775 Bacteria 33415
47 Ga0055536_1013568 3300003781 Bacteria 2925
48 Ga0055530_10006631 3300003791 Bacteria 5114
49 Ga0055540_1001525 3300003792 Bacteria 13634
50 Ga0055531_10020476 3300003794 Bacteria 2613
51 Ga0065165_1002415 3300005262 Bacteria 15934
52 Ga0065165_1003218 3300005262 Bacteria 11891
53 Ga0065165_1018400 3300005262 Bacteria 2529
54 Ga0065704_10000222 3300005289 Bacteria 73073
55 Ga0065704_10004971 3300005289 Bacteria 4516
56 Ga0065704_10007669 3300005289 Bacteria 6573
57 Ga0065704_10070636 3300005289 Bacteria 18670
58 Ga0065704_10080687 3300005289 Bacteria 3899
59 Ga0065704_10149602 3300005289 Bacteria 1441
60 Ga0065712_10082469 3300005290 Bacteria 2913
61 Ga0065712_10088469 3300005290 Bacteria 2518
62 Ga0065712_10093077 3300005290 Bacteria 2307
63 Ga0065712_10118555 3300005290 Bacteria 1704
64 Ga0065712_10160270 3300005290 Bacteria 1294
65 Ga0065712_10177062 3300005290 Bacteria 1212
66 Ga0065712_10193525 3300005290 Bacteria 1138
67 Ga0065712_10210627 3300005290 Bacteria 1074
68 Ga0065712_10223652 3300005290 Bacteria 1033
69 Ga0065715_10005958 3300005293 Bacteria 3199
70 Ga0065715_10006570 3300005293 Bacteria 3212
71 Ga0065715_10018753 3300005293 Bacteria 1774
72 Ga0065715_10243137 3300005293 Bacteria 1192
73 Ga0065715_10258268 3300005293 Bacteria 1146
74 Ga0065715_10282226 3300005293 Bacteria 1083
75 Ga0065715_10334563 3300005293 Bacteria 978
76 Ga0065707_10082480 3300005295 Bacteria 14624
77 Ga0065707_10089384 3300005295 Bacteria 4385
78 Ga0065707_10116477 3300005295 Bacteria 2236
79 Ga0065707_10186858 3300005295 Bacteria 1383
80 Ga0070658_10000033 3300005327 Bacteria 147380
81 Ga0070658_10000450 3300005327 Bacteria 35639
82 Ga0070658_10042460 3300005327 Bacteria 3673
83 Ga0070658_10071309 3300005327 Bacteria 2845
84 Ga0070658_10078982 3300005327 Bacteria 2701
85 Ga0070658_10234508 3300005327 Bacteria 1554
86 Ga0070658_10337144 3300005327 Bacteria 1289
87 Ga0070658_10356516 3300005327 Bacteria 1252
88 Ga0070658_10676806 3300005327 Bacteria 895
89 Ga0070676_10014750 3300005328 Bacteria 4299
90 Ga0070676_10014961 3300005328 Bacteria 4271
91 Ga0070676_10067228 3300005328 Bacteria 2143
92 Ga0070683_100059705 3300005329 Bacteria 3543
93 Ga0070683_100136330 3300005329 Bacteria 2324
94 Ga0070690_100000110 3300005330 Bacteria 42574
95 Ga0070690_100004829 3300005330 Bacteria 7521
96 Ga0070690_100020417 3300005330 Bacteria 4036
97 Ga0070690_100053095 3300005330 Bacteria 2592
98 Ga0070690_100163954 3300005330 Bacteria 1525
99 Ga0070690_100184473 3300005330 Bacteria 1443
100 Ga0070670_100000125 3300005331 Bacteria 71778
101 Ga0070670_100000333 3300005331 Bacteria 39598
102 Ga0070670_100001778 3300005331 Bacteria 17553
103 Ga0070670_100002586 3300005331 Bacteria 14960
104 Ga0070670_100012077 3300005331 Bacteria 7389
105 Ga0070670_100013439 3300005331 Bacteria 7011
106 Ga0070670_100015489 3300005331 Bacteria 6548
107 Ga0070670_100029264 3300005331 Bacteria 4740
108 Ga0070670_100029441 3300005331 Bacteria 4728
109 Ga0070670_100051457 3300005331 Bacteria 3537
110 Ga0070670_100052537 3300005331 Bacteria 3499
111 Ga0070670_100078442 3300005331 Bacteria 2837
112 Ga0070670_100086470 3300005331 Bacteria 2694
113 Ga0070670_100159477 3300005331 Bacteria 1955
114 Ga0070670_100203684 3300005331 Bacteria 1719
115 Ga0070670_100229536 3300005331 Bacteria 1615
116 Ga0070670_100236887 3300005331 Bacteria 1589
117 Ga0070670_100496537 3300005331 Bacteria 1085
118 Ga0070677_10001545 3300005333 Bacteria 7284
119 Ga0070677_10001946 3300005333 Bacteria 6550
120 Ga0070677_10011715 3300005333 Bacteria 3029
121 Ga0070677_10047149 3300005333 Bacteria 1726
122 Ga0070677_10098879 3300005333 Bacteria 1283
123 Ga0068869_100000237 3300005334 Bacteria 29089
124 Ga0068869_100189511 3300005334 Bacteria 1616
125 Ga0068869_100262403 3300005334 Bacteria 1383
126 Ga0070666_10000417 3300005335 Bacteria 26409
127 Ga0070666_10000676 3300005335 Bacteria 20635
128 Ga0070666_10003972 3300005335 Bacteria 8971
129 Ga0070666_10006036 3300005335 Bacteria 7444
130 Ga0070666_10006758 3300005335 Bacteria 7065
131 Ga0070666_10014173 3300005335 Bacteria 5073
132 Ga0070666_10052740 3300005335 Bacteria 2741
133 Ga0070666_10054102 3300005335 Bacteria 2708
134 Ga0070666_10067242 3300005335 Bacteria 2433
135 Ga0070666_10083831 3300005335 Bacteria 2181
136 Ga0070666_10087865 3300005335 Bacteria 2131
137 Ga0070666_10108440 3300005335 Bacteria 1919
138 Ga0070666_10127509 3300005335 Bacteria 1767
139 Ga0070682_100083698 3300005337 Bacteria 2071
140 Ga0068868_100000122 3300005338 Bacteria 49376
141 Ga0068868_100001091 3300005338 Bacteria 18581
142 Ga0068868_100005075 3300005338 Bacteria 9246
143 Ga0068868_100006917 3300005338 Bacteria 8059
144 Ga0068868_100258934 3300005338 Bacteria 1466
145 Ga0068868_100278324 3300005338 Bacteria 1415
146 Ga0070660_100000521 3300005339 Bacteria 25661
147 Ga0070660_100001018 3300005339 Bacteria 18836
148 Ga0070660_100001039 3300005339 Bacteria 18659
149 Ga0070660_100012193 3300005339 Bacteria 6137
150 Ga0070660_100022443 3300005339 Bacteria 4667
151 Ga0070660_100031061 3300005339 Bacteria 4010
152 Ga0070660_100057483 3300005339 Bacteria 3013
153 Ga0070660_100076306 3300005339 Bacteria 2625
154 Ga0070660_100161037 3300005339 Bacteria 1808
155 Ga0070660_100223256 3300005339 Bacteria 1532
156 Ga0070660_100467001 3300005339 Bacteria 1048
157 Ga0070689_100006341 3300005340 Bacteria 8171
158 Ga0070689_100088407 3300005340 Bacteria 2439
159 Ga0070687_100132272 3300005343 Bacteria 1442
160 Ga0070661_100000189 3300005344 Bacteria 51018
161 Ga0070661_100011834 3300005344 Bacteria 6087
162 Ga0070661_100015278 3300005344 Bacteria 5419
163 Ga0070661_100033583 3300005344 Bacteria 3717
164 Ga0070661_100039406 3300005344 Bacteria 3442
165 Ga0070661_100048565 3300005344 Bacteria 3106
166 Ga0070661_100055642 3300005344 Bacteria 2897
167 Ga0070661_100059752 3300005344 Bacteria 2796
168 Ga0070661_100073323 3300005344 Bacteria 2520
169 Ga0070661_100106867 3300005344 Bacteria 2087
170 Ga0070661_100126139 3300005344 Bacteria 1920
171 Ga0070692_10100948 3300005345 Bacteria 1581
172 Ga0070692_10183445 3300005345 Bacteria 1214
173 Ga0070668_100000240 3300005347 Bacteria 36015
174 Ga0070668_100004440 3300005347 Bacteria 10413
175 Ga0070668_100008123 3300005347 Bacteria 7794
176 Ga0070668_100011693 3300005347 Bacteria 6535
177 Ga0070668_100061502 3300005347 Bacteria 2909
178 Ga0070668_100063714 3300005347 Bacteria 2858
179 Ga0070668_100075481 3300005347 Bacteria 2632
180 Ga0070668_100197650 3300005347 Bacteria 1650
181 Ga0070668_100289955 3300005347 Bacteria 1369
182 Ga0070668_100393140 3300005347 Bacteria 1182
183 Ga0070669_100000018 3300005353 Bacteria 195789
184 Ga0070669_100000319 3300005353 Bacteria 37553
185 Ga0070669_100000332 3300005353 Bacteria 36750
186 Ga0070669_100000421 3300005353 Bacteria 32386
187 Ga0070669_100007923 3300005353 Bacteria 7591
188 Ga0070669_100011907 3300005353 Bacteria 6173
189 Ga0070669_100036616 3300005353 Bacteria 3556
190 Ga0070669_100089598 3300005353 Bacteria 2305
191 Ga0070669_100373508 3300005353 Bacteria 1162
192 Ga0070675_100001409 3300005354 Bacteria 17655
193 Ga0070675_100002655 3300005354 Bacteria 13442
194 Ga0070675_100003126 3300005354 Bacteria 12521
195 Ga0070675_100021791 3300005354 Bacteria 5119
196 Ga0070675_100026876 3300005354 Bacteria 4621
197 Ga0070675_100091721 3300005354 Bacteria 2546
198 Ga0070675_100133004 3300005354 Bacteria 2121
199 Ga0070675_100145506 3300005354 Bacteria 2029
200 Ga0070675_100152366 3300005354 Bacteria 1983
201 Ga0070675_100163368 3300005354 Bacteria 1916
202 Ga0070675_100201155 3300005354 Bacteria 1729
203 Ga0070671_100000011 3300005355 Bacteria 202057
204 Ga0070671_100000356 3300005355 Bacteria 31426
205 Ga0070671_100000499 3300005355 Bacteria 27413
206 Ga0070671_100000884 3300005355 Bacteria 21921
207 Ga0070671_100001310 3300005355 Bacteria 18679
208 Ga0070671_100002896 3300005355 Bacteria 13357
209 Ga0070671_100002925 3300005355 Bacteria 13280
210 Ga0070671_100004838 3300005355 Bacteria 10706
211 Ga0070671_100005998 3300005355 Bacteria 9684
212 Ga0070671_100008440 3300005355 Bacteria 8258
213 Ga0070671_100009391 3300005355 Bacteria 7854
214 Ga0070671_100014649 3300005355 Bacteria 6338
215 Ga0070671_100019425 3300005355 Bacteria 5529
216 Ga0070671_100028054 3300005355 Bacteria 4635
217 Ga0070671_100030482 3300005355 Bacteria 4450
218 Ga0070671_100044108 3300005355 Bacteria 3705
219 Ga0070671_100047259 3300005355 Bacteria 3579
220 Ga0070671_100052754 3300005355 Bacteria 3381
221 Ga0070671_100061374 3300005355 Bacteria 3131
222 Ga0070671_100074596 3300005355 Bacteria 2834
223 Ga0070671_100075715 3300005355 Bacteria 2812
224 Ga0070671_100078812 3300005355 Bacteria 2753
225 Ga0070671_100081221 3300005355 Bacteria 2710
226 Ga0070671_100088570 3300005355 Bacteria 2591
227 Ga0070671_100132006 3300005355 Bacteria 2104
228 Ga0070671_100160893 3300005355 Bacteria 1898
229 Ga0070671_100183576 3300005355 Bacteria 1772
230 Ga0070671_100215263 3300005355 Bacteria 1630
231 Ga0070671_100348675 3300005355 Bacteria 1263
232 Ga0070671_100612328 3300005355 Bacteria 941
233 Ga0070674_100014686 3300005356 Bacteria 4871
234 Ga0070674_100019587 3300005356 Bacteria 4302
235 Ga0070674_100022907 3300005356 Bacteria 4033
236 Ga0070674_100024081 3300005356 Bacteria 3949
237 Ga0070673_100000113 3300005364 Bacteria 37191
238 Ga0070673_100000300 3300005364 Bacteria 25842
239 Ga0070673_100010659 3300005364 Bacteria 6232
240 Ga0070673_100010748 3300005364 Bacteria 6211
241 Ga0070673_100017136 3300005364 Bacteria 5142
242 Ga0070673_100022961 3300005364 Bacteria 4551
243 Ga0070673_100031959 3300005364 Bacteria 3956
244 Ga0070673_100049806 3300005364 Bacteria 3272
245 Ga0070673_100053601 3300005364 Bacteria 3169
246 Ga0070673_100097735 3300005364 Bacteria 2412
247 Ga0070673_100121797 3300005364 Bacteria 2177
248 Ga0070673_100254267 3300005364 Bacteria 1532
249 Ga0070673_100308737 3300005364 Bacteria 1395
250 Ga0070673_100371098 3300005364 Bacteria 1274
251 Ga0070673_100542636 3300005364 Bacteria 1056
252 Ga0070673_100561120 3300005364 Bacteria 1038
253 Ga0070688_100003977 3300005365 Bacteria 7664
254 Ga0070659_100000032 3300005366 Bacteria 120241
255 Ga0070659_100003411 3300005366 Bacteria 11326
256 Ga0070659_100009984 3300005366 Bacteria 6984
257 Ga0070659_100015331 3300005366 Bacteria 5740
258 Ga0070659_100016094 3300005366 Bacteria 5612
259 Ga0070659_100029044 3300005366 Bacteria 4273
260 Ga0070659_100037070 3300005366 Bacteria 3801
261 Ga0070659_100050930 3300005366 Bacteria 3255
262 Ga0070659_100057371 3300005366 Bacteria 3071
263 Ga0070659_100080529 3300005366 Bacteria 2600
264 Ga0070659_100085498 3300005366 Bacteria 2523
265 Ga0070659_100089581 3300005366 Bacteria 2464
266 Ga0070659_100098113 3300005366 Bacteria 2356
267 Ga0070659_100315935 3300005366 Bacteria 1305
268 Ga0070667_100000067 3300005367 Bacteria 133023
269 Ga0070667_100000089 3300005367 Bacteria 113661
270 Ga0070667_100000261 3300005367 Bacteria 60134
271 Ga0070667_100001008 3300005367 Bacteria 25807
272 Ga0070667_100001137 3300005367 Bacteria 24208
273 Ga0070667_100001520 3300005367 Bacteria 20770
274 Ga0070667_100003895 3300005367 Bacteria 12670
275 Ga0070667_100007223 3300005367 Bacteria 9231
276 Ga0070667_100010244 3300005367 Bacteria 7745
277 Ga0070667_100012492 3300005367 Bacteria 7024
278 Ga0070667_100015024 3300005367 Bacteria 6397
279 Ga0070667_100020274 3300005367 Bacteria 5519
280 Ga0070667_100023912 3300005367 Bacteria 5074
281 Ga0070667_100035579 3300005367 Bacteria 4173
282 Ga0070667_100045987 3300005367 Bacteria 3671
283 Ga0070667_100138763 3300005367 Bacteria 2127
284 Ga0070667_100159829 3300005367 Bacteria 1984
285 Ga0070667_100168236 3300005367 Bacteria 1934
286 Ga0070667_100173332 3300005367 Bacteria 1905
287 Ga0070667_100179058 3300005367 Bacteria 1874
288 Ga0070667_100421899 3300005367 Bacteria 1216
289 Ga0070713_100059809 3300005436 Bacteria 3184
290 Ga0070710_10301363 3300005437 Bacteria 1046
291 Ga0070701_10015542 3300005438 Bacteria 3518
292 Ga0070711_100038436 3300005439 Bacteria 3219
293 Ga0070700_100145153 3300005441 Bacteria 1617
294 Ga0070663_100003135 3300005455 Bacteria 9473
295 Ga0070663_100008334 3300005455 Bacteria 6368
296 Ga0070663_100023406 3300005455 Bacteria 4140
297 Ga0070663_100025649 3300005455 Bacteria 3982
298 Ga0070663_100027770 3300005455 Bacteria 3846
299 Ga0070663_100031033 3300005455 Bacteria 3669
300 Ga0070663_100074842 3300005455 Bacteria 2473
301 Ga0070663_100240729 3300005455 Bacteria 1428
302 Ga0070663_100244673 3300005455 Bacteria 1417
303 Ga0070663_100457887 3300005455 Bacteria 1053
304 Ga0070678_100008369 3300005456 Bacteria 6196
305 Ga0070678_100016001 3300005456 Bacteria 4782
306 Ga0070678_100016815 3300005456 Bacteria 4689
307 Ga0070678_100054824 3300005456 Bacteria 2907
308 Ga0070678_100106622 3300005456 Bacteria 2184
309 Ga0070678_100107671 3300005456 Bacteria 2174
310 Ga0070678_100319178 3300005456 Bacteria 1326
311 Ga0070678_100515892 3300005456 Bacteria 1057
312 Ga0070662_100001355 3300005457 Bacteria 15049
313 Ga0070662_100006282 3300005457 Bacteria 7655
314 Ga0070662_100012806 3300005457 Bacteria 5569
315 Ga0070662_100014394 3300005457 Bacteria 5284
316 Ga0070662_100018571 3300005457 Bacteria 4705
317 Ga0070662_100018704 3300005457 Bacteria 4691
318 Ga0070662_100028342 3300005457 Bacteria 3896
319 Ga0070662_100037861 3300005457 Bacteria 3422
320 Ga0070662_100049488 3300005457 Bacteria 3030
321 Ga0070662_100068924 3300005457 Bacteria 2602
322 Ga0070662_100070505 3300005457 Bacteria 2575
323 Ga0070662_100071576 3300005457 Bacteria 2557
324 Ga0070662_100075743 3300005457 Bacteria 2492
325 Ga0070662_100079880 3300005457 Bacteria 2433
326 Ga0070662_100082084 3300005457 Bacteria 2403
327 Ga0070662_100090727 3300005457 Bacteria 2294
328 Ga0070662_100192360 3300005457 Bacteria 1614
329 Ga0070662_100294000 3300005457 Bacteria 1317
330 Ga0070662_100301571 3300005457 Bacteria 1302
331 Ga0070681_10391235 3300005458 Bacteria 1301
332 Ga0068867_100001291 3300005459 Bacteria 17281
333 Ga0068867_100003727 3300005459 Bacteria 10724
334 Ga0068867_100011300 3300005459 Bacteria 6298
335 Ga0068867_100015079 3300005459 Bacteria 5480
336 Ga0068867_100027370 3300005459 Bacteria 4096
337 Ga0068867_100323198 3300005459 Bacteria 1279
338 Ga0070685_10001239 3300005466 Bacteria 13558
339 Ga0070685_10042572 3300005466 Bacteria 2592
340 Ga0070685_10350626 3300005466 Bacteria 1009
341 Ga0070679_100000019 3300005530 Bacteria 127108
342 Ga0070679_100179814 3300005530 Bacteria 2088
343 Ga0070684_100106919 3300005535 Bacteria 2506
344 Ga0070684_100513986 3300005535 Bacteria 1110
345 Ga0068853_100003210 3300005539 Bacteria 12493
346 Ga0068853_100004246 3300005539 Bacteria 11067
347 Ga0068853_100015290 3300005539 Bacteria 6307
348 Ga0068853_100016799 3300005539 Bacteria 6029
349 Ga0068853_100065729 3300005539 Bacteria 3147
350 Ga0068853_100570741 3300005539 Bacteria 1073
351 Ga0070672_100000668 3300005543 Bacteria 20156
352 Ga0070672_100003275 3300005543 Bacteria 10484
353 Ga0070672_100022559 3300005543 Bacteria 4626
354 Ga0070672_100029021 3300005543 Bacteria 4143
355 Ga0070672_100038782 3300005543 Bacteria 3643
356 Ga0070672_100071810 3300005543 Bacteria 2754
357 Ga0070672_100174384 3300005543 Bacteria 1789
358 Ga0070672_100236100 3300005543 Bacteria 1537
359 Ga0070672_100342632 3300005543 Bacteria 1273
360 Ga0070686_100000045 3300005544 Bacteria 101988
361 Ga0070686_100000526 3300005544 Bacteria 22933
362 Ga0070686_100014525 3300005544 Bacteria 4543
363 Ga0070686_100050543 3300005544 Bacteria 2643
364 Ga0070696_100004394 3300005546 Bacteria 9405
365 Ga0070693_100017586 3300005547 Bacteria 3720
366 Ga0070693_100066901 3300005547 Bacteria 2104
367 Ga0070665_100000042 3300005548 Bacteria 292582
368 Ga0070665_100000089 3300005548 Bacteria 177659
369 Ga0070665_100000195 3300005548 Bacteria 106493
370 Ga0070665_100000319 3300005548 Bacteria 74295
371 Ga0070665_100000785 3300005548 Bacteria 41798
372 Ga0070665_100006145 3300005548 Bacteria 12279
373 Ga0070665_100017694 3300005548 Bacteria 7156
374 Ga0070665_100043566 3300005548 Bacteria 4510
375 Ga0070665_100045299 3300005548 Bacteria 4418
376 Ga0070665_100065445 3300005548 Bacteria 3646
377 Ga0070665_100086216 3300005548 Bacteria 3146
378 Ga0070665_100185646 3300005548 Bacteria 2080
379 Ga0070665_100445100 3300005548 Bacteria 1305
380 Ga0070665_100447304 3300005548 Bacteria 1301
381 Ga0068855_100250516 3300005563 Bacteria 1975
382 Ga0068855_100576541 3300005563 Bacteria 1216
383 Ga0068855_100581624 3300005563 Bacteria 1209
384 Ga0070664_100002420 3300005564 Bacteria 15002
385 Ga0070664_100003416 3300005564 Bacteria 12825
386 Ga0070664_100003923 3300005564 Bacteria 12001
387 Ga0070664_100004556 3300005564 Bacteria 11120
388 Ga0070664_100005620 3300005564 Bacteria 10089
389 Ga0070664_100009795 3300005564 Bacteria 7764
390 Ga0070664_100033345 3300005564 Bacteria 4313
391 Ga0070664_100042865 3300005564 Bacteria 3818
392 Ga0070664_100089834 3300005564 Bacteria 2658
393 Ga0070664_100153901 3300005564 Bacteria 2031
394 Ga0070664_100167731 3300005564 Bacteria 1946
395 Ga0070664_100178032 3300005564 Bacteria 1889
396 Ga0070664_100197637 3300005564 Bacteria 1793
397 Ga0070664_100247559 3300005564 Bacteria 1601
398 Ga0068857_100000246 3300005577 Bacteria 36409
399 Ga0068857_100022941 3300005577 Bacteria 5490
400 Ga0068857_100038715 3300005577 Bacteria 4222
401 Ga0068857_100039894 3300005577 Bacteria 4161
402 Ga0068857_100055371 3300005577 Bacteria 3520
403 Ga0068857_100063783 3300005577 Bacteria 3275
404 Ga0068857_100167621 3300005577 Bacteria 1995
405 Ga0068857_100197369 3300005577 Bacteria 1834
406 Ga0068857_100367189 3300005577 Bacteria 1335
407 Ga0068857_100369914 3300005577 Bacteria 1330
408 Ga0068857_100413912 3300005577 Bacteria 1256
409 Ga0068854_100000337 3300005578 Bacteria 30470
410 Ga0068854_100002354 3300005578 Bacteria 11653
411 Ga0068854_100004453 3300005578 Bacteria 8835
412 Ga0068854_100016873 3300005578 Bacteria 4876
413 Ga0068854_100020055 3300005578 Bacteria 4514
414 Ga0068854_100027186 3300005578 Bacteria 3940
415 Ga0068854_100062081 3300005578 Bacteria 2708
416 Ga0068854_100087993 3300005578 Bacteria 2305
417 Ga0068854_100434772 3300005578 Bacteria 1093
418 Ga0068854_100726430 3300005578 Bacteria 859
419 Ga0068856_100010754 3300005614 Bacteria 8889
420 Ga0068856_100048193 3300005614 Bacteria 4197
421 Ga0068856_100261898 3300005614 Bacteria 1744
422 Ga0068852_100002096 3300005616 Bacteria 13636
423 Ga0068852_100024440 3300005616 Bacteria 4883
424 Ga0068852_100046560 3300005616 Bacteria 3697
425 Ga0068852_100058884 3300005616 Bacteria 3329
426 Ga0068852_100067394 3300005616 Bacteria 3129
427 Ga0068852_100121525 3300005616 Bacteria 2392
428 Ga0068852_100167825 3300005616 Bacteria 2055
429 Ga0068852_100173499 3300005616 Bacteria 2023
430 Ga0068852_100192935 3300005616 Bacteria 1923
431 Ga0068852_100299961 3300005616 Bacteria 1555
432 Ga0068852_100378888 3300005616 Bacteria 1387
433 Ga0068859_100000689 3300005617 Bacteria 33880
434 Ga0068859_100001164 3300005617 Bacteria 26886
435 Ga0068859_100016217 3300005617 Bacteria 7483
436 Ga0068859_100037559 3300005617 Bacteria 4861
437 Ga0068859_100064861 3300005617 Bacteria 3685
438 Ga0068859_100101995 3300005617 Bacteria 2927
439 Ga0068859_100217336 3300005617 Bacteria 1999
440 Ga0068859_100257482 3300005617 Bacteria 1836
441 Ga0068859_100475868 3300005617 Bacteria 1344
442 Ga0068864_100000098 3300005618 Bacteria 85661
443 Ga0068864_100000713 3300005618 Bacteria 27896
444 Ga0068864_100000764 3300005618 Bacteria 27049
445 Ga0068864_100001740 3300005618 Bacteria 17896
446 Ga0068864_100003303 3300005618 Bacteria 13323
447 Ga0068864_100003505 3300005618 Bacteria 12970
448 Ga0068864_100005845 3300005618 Bacteria 10087
449 Ga0068864_100009867 3300005618 Bacteria 7876
450 Ga0068864_100010212 3300005618 Bacteria 7754
451 Ga0068864_100025846 3300005618 Bacteria 4947
452 Ga0068864_100026270 3300005618 Bacteria 4910
453 Ga0068864_100033224 3300005618 Bacteria 4386
454 Ga0068864_100033807 3300005618 Bacteria 4347
455 Ga0068864_100172246 3300005618 Bacteria 1974
456 Ga0068864_100452560 3300005618 Bacteria 1228
457 Ga0068864_100538256 3300005618 Bacteria 1128
458 Ga0068866_10025209 3300005718 Bacteria 2793
459 Ga0068861_100000965 3300005719 Bacteria 17524
460 Ga0068861_100002114 3300005719 Bacteria 12859
461 Ga0068861_100005488 3300005719 Bacteria 8594
462 Ga0068861_100024325 3300005719 Bacteria 4379
463 Ga0068861_100227883 3300005719 Bacteria 1579
464 Ga0068851_10004263 3300005834 Bacteria 6439
465 Ga0068851_10008936 3300005834 Bacteria 4647
466 Ga0068851_10025204 3300005834 Bacteria 2916
467 Ga0068851_10160235 3300005834 Bacteria 1235
468 Ga0068870_10115804 3300005840 Bacteria 1537
469 Ga0068870_10151832 3300005840 Bacteria 1365
470 Ga0068863_100000001 3300005841 Bacteria 581116
471 Ga0068863_100000038 3300005841 Bacteria 161477
472 Ga0068863_100000063 3300005841 Bacteria 118269
473 Ga0068863_100000127 3300005841 Bacteria 80572
474 Ga0068863_100000280 3300005841 Bacteria 52729
475 Ga0068863_100002103 3300005841 Bacteria 19737
476 Ga0068863_100002105 3300005841 Bacteria 19733
477 Ga0068863_100003894 3300005841 Bacteria 14746
478 Ga0068863_100006391 3300005841 Bacteria 11555
479 Ga0068863_100016297 3300005841 Bacteria 7132
480 Ga0068863_100024705 3300005841 Bacteria 5730
481 Ga0068863_100027733 3300005841 Bacteria 5404
482 Ga0068863_100032298 3300005841 Bacteria 4990
483 Ga0068863_100032822 3300005841 Bacteria 4947
484 Ga0068863_100070455 3300005841 Bacteria 3306
485 Ga0068863_100097598 3300005841 Bacteria 2790
486 Ga0068863_100157129 3300005841 Bacteria 2177
487 Ga0068858_100001032 3300005842 Bacteria 28756
488 Ga0068858_100001398 3300005842 Bacteria 24841
489 Ga0068858_100001407 3300005842 Bacteria 24703
490 Ga0068858_100024878 3300005842 Bacteria 5574
491 Ga0068858_100026940 3300005842 Bacteria 5339
492 Ga0068858_100029006 3300005842 Bacteria 5138
493 Ga0068858_100043741 3300005842 Bacteria 4153
494 Ga0068858_100076726 3300005842 Bacteria 3104
495 Ga0068858_100081039 3300005842 Bacteria 3016
496 Ga0068858_100100293 3300005842 Bacteria 2700
497 Ga0068858_100100369 3300005842 Bacteria 2699
498 Ga0068858_100112533 3300005842 Bacteria 2542
499 Ga0068858_100136890 3300005842 Bacteria 2298
500 Ga0068858_100283853 3300005842 Bacteria 1577
501 Ga0068860_100000008 3300005843 Bacteria 427367
502 Ga0068860_100000148 3300005843 Bacteria 113661
503 Ga0068860_100000182 3300005843 Bacteria 100888
504 Ga0068860_100004003 3300005843 Bacteria 15124
505 Ga0068860_100009788 3300005843 Bacteria 9515
506 Ga0068860_100013876 3300005843 Bacteria 7900
507 Ga0068860_100039467 3300005843 Bacteria 4516
508 Ga0068860_100057702 3300005843 Bacteria 3690
509 Ga0068860_100061998 3300005843 Bacteria 3553
510 Ga0068860_100066553 3300005843 Bacteria 3423
511 Ga0068860_100255839 3300005843 Bacteria 1706
512 Ga0068860_100386012 3300005843 Bacteria 1383
513 Ga0068860_100497677 3300005843 Bacteria 1216
514 Ga0068862_100000133 3300005844 Bacteria 86113
515 Ga0068862_100000308 3300005844 Bacteria 53687
516 Ga0068862_100000543 3300005844 Bacteria 39504
517 Ga0068862_100001324 3300005844 Bacteria 23010
518 Ga0068862_100001693 3300005844 Bacteria 19978
519 Ga0068862_100010712 3300005844 Bacteria 7570
520 Ga0068862_100033955 3300005844 Bacteria 4315
521 Ga0068862_100036543 3300005844 Bacteria 4163
522 Ga0068862_100082265 3300005844 Bacteria 2794
523 Ga0068862_100093340 3300005844 Bacteria 2624
524 Ga0068862_100172255 3300005844 Bacteria 1938
525 Ga0068862_100230793 3300005844 Bacteria 1679
526 Ga0068862_100557699 3300005844 Bacteria 1095
527 Ga0081455_10000187 3300005937 Bacteria 78623
528 Ga0081455_10140246 3300005937 Bacteria 1878
529 Ga0081538_10144448 3300005981 Bacteria 1090
530 Ga0081540_1072233 3300005983 Bacteria 1590
531 Ga0081539_10012087 3300005985 Bacteria 6708
532 Ga0075365_10010968 3300006038 Bacteria 5308
533 Ga0075368_10002950 3300006042 Bacteria 5620
534 Ga0075363_100023909 3300006048 Bacteria 3102
535 Ga0075364_10039882 3300006051 Bacteria 3045
536 Ga0075364_10048589 3300006051 Bacteria 2765
537 Ga0075432_10001783 3300006058 Bacteria 7090
538 Ga0070712_100008962 3300006175 Bacteria 6303
539 Ga0075362_10000006 3300006177 Bacteria 123313
540 Ga0075362_10011696 3300006177 Bacteria 3463
541 Ga0075367_10000008 3300006178 Bacteria 43881
542 Ga0075367_10000771 3300006178 Bacteria 12548
543 Ga0075369_10018821 3300006186 Bacteria 2815
544 Ga0075366_10000394 3300006195 Bacteria 20296
545 Ga0075366_10097161 3300006195 Bacteria 1766
546 Ga0075366_10130738 3300006195 Bacteria 1515
547 Ga0075366_10152353 3300006195 Bacteria 1400
548 Ga0075366_10299303 3300006195 Bacteria 984
549 Ga0097621_100134928 3300006237 Bacteria 2104
550 Ga0097621_100159472 3300006237 Bacteria 1938
551 Ga0075370_10000005 3300006353 Bacteria 112202
552 Ga0075370_10018602 3300006353 Bacteria 3771
553 Ga0075370_10023684 3300006353 Bacteria 3384
554 Ga0075370_10041302 3300006353 Bacteria 2604
555 Ga0075370_10071400 3300006353 Bacteria 1986
556 Ga0075370_10294902 3300006353 Bacteria 964
557 Ga0068871_100044840 3300006358 Bacteria 3557
558 Ga0068871_100086210 3300006358 Bacteria 2609
559 Ga0068871_100117985 3300006358 Bacteria 2238
560 Ga0068871_100206546 3300006358 Bacteria 1697
561 Ga0068871_100355010 3300006358 Bacteria 1297
562 Ga0075430_100040948 3300006846 Bacteria 3920
563 Ga0075434_100212640 3300006871 Bacteria 1954
564 Ga0068865_100000374 3300006881 Bacteria 24788
565 Ga0068865_100001644 3300006881 Bacteria 13101
566 Ga0097620_100000689 3300006931 Bacteria 33880
567 Ga0097620_100001164 3300006931 Bacteria 26886
568 Ga0097620_100005488 3300006931 Bacteria 12913
569 Ga0097620_100016219 3300006931 Bacteria 7483
570 Ga0097620_100037559 3300006931 Bacteria 4861
571 Ga0097620_100064861 3300006931 Bacteria 3685
572 Ga0097620_100101993 3300006931 Bacteria 2927
573 Ga0097620_100217347 3300006931 Bacteria 1999
574 Ga0097620_100257479 3300006931 Bacteria 1836
575 Ga0097620_100475860 3300006931 Bacteria 1344
576 Ga0075435_100383554 3300007076 Bacteria 1207
577 Ga0105251_10003236 3300009011 Bacteria 11991
578 Ga0105251_10006607 3300009011 Bacteria 7348
579 Ga0105251_10021929 3300009011 Bacteria 3325
580 Ga0105251_10120967 3300009011 Bacteria 1189
581 Ga0105250_10009124 3300009092 Bacteria 4188
582 Ga0105250_10111883 3300009092 Bacteria 1118
583 Ga0105240_10029132 3300009093 Bacteria 7199
584 Ga0111539_10033582 3300009094 Bacteria 6229
585 Ga0111539_10391531 3300009094 Bacteria 1618
586 Ga0111539_10516094 3300009094 Bacteria 1392
587 Ga0105245_10000275 3300009098 Bacteria 48749
588 Ga0105245_10016442 3300009098 Bacteria 6453
589 Ga0105245_10083269 3300009098 Bacteria 2928
590 Ga0105245_10109571 3300009098 Bacteria 2566
591 Ga0105245_10347077 3300009098 Bacteria 1469
592 Ga0105247_10001942 3300009101 Bacteria 14375
593 Ga0105247_10011194 3300009101 Bacteria 5409
594 Ga0105247_10071249 3300009101 Bacteria 2173
595 Ga0105247_10079231 3300009101 Bacteria 2067
596 Ga0105247_10393315 3300009101 Bacteria 986
597 Ga0105243_10014560 3300009148 Bacteria 5951
598 Ga0105243_10186412 3300009148 Bacteria 1809
599 Ga0105241_10016657 3300009174 Bacteria 5393
600 Ga0105241_10698525 3300009174 Bacteria 926
601 Ga0105242_10235765 3300009176 Bacteria 1642
602 Ga0105248_10001002 3300009177 Bacteria 31241
603 Ga0105248_10001403 3300009177 Bacteria 26914
604 Ga0105248_10001965 3300009177 Bacteria 22859
605 Ga0105248_10003027 3300009177 Bacteria 18646
606 Ga0105248_10005405 3300009177 Bacteria 14042
607 Ga0105248_10005700 3300009177 Bacteria 13683
608 Ga0105248_10006421 3300009177 Bacteria 12900
609 Ga0105248_10008541 3300009177 Bacteria 11243
610 Ga0105248_10009274 3300009177 Bacteria 10833
611 Ga0105248_10012003 3300009177 Bacteria 9554
612 Ga0105248_10013496 3300009177 Bacteria 8995
613 Ga0105248_10013676 3300009177 Bacteria 8933
614 Ga0105248_10022196 3300009177 Bacteria 7037
615 Ga0105248_10034272 3300009177 Bacteria 5676
616 Ga0105248_10042302 3300009177 Bacteria 5109
617 Ga0105248_10047594 3300009177 Bacteria 4809
618 Ga0105248_10057189 3300009177 Bacteria 4377
619 Ga0105248_10058159 3300009177 Bacteria 4341
620 Ga0105248_10098913 3300009177 Bacteria 3287
621 Ga0105248_10120281 3300009177 Bacteria 2963
622 Ga0105248_10144286 3300009177 Bacteria 2686
623 Ga0105248_10156923 3300009177 Bacteria 2568
624 Ga0105248_10160618 3300009177 Bacteria 2535
625 Ga0105248_10166711 3300009177 Bacteria 2483
626 Ga0105248_10211019 3300009177 Bacteria 2188
627 Ga0105248_10322256 3300009177 Bacteria 1741
628 Ga0105248_10419741 3300009177 Bacteria 1507
629 Ga0105248_10993465 3300009177 Bacteria 948
630 Ga0105237_10148496 3300009545 Bacteria 2340
631 Ga0105237_10412435 3300009545 Bacteria 1356
632 Ga0105238_10043518 3300009551 Bacteria 4543
633 Ga0105238_10152221 3300009551 Bacteria 2288
634 Ga0105238_10201835 3300009551 Bacteria 1964
635 Ga0105238_10325014 3300009551 Bacteria 1524
636 Ga0105238_10344119 3300009551 Bacteria 1480
637 Ga0105238_10345599 3300009551 Bacteria 1476
638 Ga0105249_10000012 3300009553 Bacteria 292640
639 Ga0105249_10000015 3300009553 Bacteria 282138
640 Ga0105249_10000116 3300009553 Bacteria 108394
641 Ga0105249_10001380 3300009553 Bacteria 21246
642 Ga0105249_10006062 3300009553 Bacteria 10476
643 Ga0105249_10048489 3300009553 Bacteria 3872
644 Ga0105249_10101523 3300009553 Bacteria 2706
645 Ga0105249_10127151 3300009553 Bacteria 2428
646 Ga0105148_100034 3300009978 Bacteria 19962
647 Ga0105239_10893646 3300010375 Bacteria 1019
648 Ga0105246_10073371 3300011119 Bacteria 2416
649 Ga0105246_10148737 3300011119 Bacteria 1770
650 Ga0157373_10028185 3300013100 Bacteria 4052
651 Ga0157373_10031420 3300013100 Bacteria 3823
652 Ga0157373_10077816 3300013100 Bacteria 2340
653 Ga0157373_10095623 3300013100 Bacteria 2091
654 Ga0157373_10100257 3300013100 Bacteria 2038
655 Ga0157373_10119728 3300013100 Bacteria 1850
656 Ga0157373_10187991 3300013100 Bacteria 1455
657 Ga0157373_10262063 3300013100 Bacteria 1223
658 Ga0157371_10000637 3300013102 Bacteria 41589
659 Ga0157371_10080987 3300013102 Bacteria 2299
660 Ga0157371_10498472 3300013102 Bacteria 899
661 Ga0157370_10055122 3300013104 Bacteria 3789
662 Ga0157370_10197093 3300013104 Bacteria 1869
663 Ga0157369_10005661 3300013105 Bacteria 14515
664 Ga0157369_10037584 3300013105 Bacteria 5301
665 Ga0157374_10203983 3300013296 Bacteria 1937
666 Ga0157374_10276447 3300013296 Bacteria 1657
667 Ga0157378_10011608 3300013297 Bacteria 7713
668 Ga0157378_10023980 3300013297 Bacteria 5367
669 Ga0157378_10025514 3300013297 Bacteria 5203
670 Ga0157378_10050299 3300013297 Bacteria 3709
671 Ga0157378_10063086 3300013297 Bacteria 3310
672 Ga0157378_10097008 3300013297 Bacteria 2686
673 Ga0157378_10181343 3300013297 Bacteria 1981
674 Ga0163162_10006001 3300013306 Bacteria 11755
675 Ga0163162_10019524 3300013306 Bacteria 6651
676 Ga0163162_10030175 3300013306 Bacteria 5372
677 Ga0163162_10074201 3300013306 Bacteria 3460
678 Ga0163162_10118832 3300013306 Bacteria 2746
679 Ga0163162_10145916 3300013306 Bacteria 2483
680 Ga0163162_10167088 3300013306 Bacteria 2324
681 Ga0163162_10260008 3300013306 Bacteria 1868
682 Ga0163162_10344263 3300013306 Bacteria 1623
683 Ga0163162_10351276 3300013306 Bacteria 1607
684 Ga0163162_10559005 3300013306 Bacteria 1272
685 Ga0157372_10012231 3300013307 Bacteria 9139
686 Ga0157372_10018134 3300013307 Bacteria 7567
687 Ga0157372_10100537 3300013307 Bacteria 3300
688 Ga0157372_10130571 3300013307 Bacteria 2890
689 Ga0157372_10233796 3300013307 Bacteria 2131
690 Ga0157372_10592026 3300013307 Bacteria 1293
691 Ga0157372_10990163 3300013307 Bacteria 974
692 Ga0157372_11227584 3300013307 Bacteria 866
693 Ga0157375_10012598 3300013308 Bacteria 7505
694 Ga0157375_10021073 3300013308 Bacteria 5969
695 Ga0157375_10033612 3300013308 Bacteria 4875
696 Ga0157375_10060400 3300013308 Bacteria 3759
697 Ga0157375_10161062 3300013308 Bacteria 2385
698 Ga0157375_10236474 3300013308 Bacteria 1986
699 Ga0157375_10500687 3300013308 Bacteria 1379
700 Ga0157375_10840585 3300013308 Bacteria 1065
701 Ga0163163_10000991 3300014325 Bacteria 24023
702 Ga0163163_10013315 3300014325 Bacteria 7526
703 Ga0163163_10048754 3300014325 Bacteria 4166
704 Ga0163163_10073655 3300014325 Bacteria 3406
705 Ga0163163_10244188 3300014325 Bacteria 1846
706 Ga0157380_10000151 3300014326 Bacteria 39765
707 Ga0157380_10002954 3300014326 Bacteria 11567
708 Ga0157380_10010723 3300014326 Bacteria 6604
709 Ga0157380_10021843 3300014326 Bacteria 4806
710 Ga0157380_10032670 3300014326 Bacteria 4005
711 Ga0157380_10046302 3300014326 Bacteria 3415
712 Ga0157380_10171626 3300014326 Bacteria 1896
713 Ga0157377_10112943 3300014745 Bacteria 1635
714 Ga0157377_10155302 3300014745 Bacteria 1418
715 Ga0157379_10001787 3300014968 Bacteria 17755
716 Ga0157379_10003144 3300014968 Bacteria 13972
717 Ga0157379_10032029 3300014968 Bacteria 4685
718 Ga0157379_10075276 3300014968 Bacteria 3022
719 Ga0157379_10177479 3300014968 Bacteria 1924
720 Ga0157379_10185964 3300014968 Bacteria 1877
721 Ga0157379_10242412 3300014968 Bacteria 1635
722 Ga0157376_10011982 3300014969 Bacteria 6413
723 Ga0163161_10000202 3300017792 Bacteria 54518
724 Ga0163161_10008736 3300017792 Bacteria 7003
725 Ga0163161_10092128 3300017792 Bacteria 2244
726 Ga0163161_10185132 3300017792 Bacteria 1598
727 Ga0163161_10391341 3300017792 Bacteria 1113
728 Ga0213873_10000007 3300021358 Bacteria 309961
729 Ga0213876_10000005 3300021384 Bacteria 727326
730 Ga0213876_10000310 3300021384 Bacteria 42816
731 Ga0213875_10000460 3300021388 Bacteria 35213
732 Ga0209436_115525 3300025208 Bacteria 1174
733 Ga0207672_1001078 3300025223 Bacteria 2493
734 Ga0209147_100573 3300025229 Bacteria 20613
735 Ga0207425_1000005 3300025245 Bacteria 900502
736 Ga0209129_1000825 3300025258 Bacteria 19506
737 Ga0209565_1000007 3300025263 Bacteria 784361
738 Ga0209565_1013651 3300025263 Bacteria 1894
739 Ga0209673_1003508 3300025273 Bacteria 9195
740 Ga0207673_1004992 3300025290 Bacteria 1605
741 Ga0207673_1009775 3300025290 Bacteria 1228
742 Ga0209675_1012946 3300025291 Bacteria 2647
743 Ga0209676_1007137 3300025292 Bacteria 5335
744 Ga0209676_1030091 3300025292 Bacteria 1666
745 Ga0209025_1000296 3300025294 Bacteria 111440
746 Ga0209564_1002668 3300025295 Bacteria 13552
747 Ga0209564_1029926 3300025295 Bacteria 1700
748 Ga0209758_1000002 3300025297 Bacteria 1400310
749 Ga0209758_1007072 3300025297 Bacteria 7779
750 Ga0209050_1000005 3300025298 Bacteria 1557793
751 Ga0209050_1000119 3300025298 Bacteria 200661
752 Ga0209050_1000196 3300025298 Bacteria 135678
753 Ga0209256_1000009 3300025299 Bacteria 922071
754 Ga0209051_1000153 3300025303 Bacteria 131166
755 Ga0209257_1018969 3300025304 Bacteria 2613
756 Ga0207697_10000112 3300025315 Bacteria 37791
757 Ga0207697_10000184 3300025315 Bacteria 32509
758 Ga0207697_10003055 3300025315 Bacteria 8393
759 Ga0207697_10012939 3300025315 Bacteria 3487
760 Ga0207697_10016926 3300025315 Bacteria 2999
761 Ga0207697_10052980 3300025315 Bacteria 1680
762 Ga0207656_10006655 3300025321 Bacteria 4172
763 Ga0207656_10010153 3300025321 Bacteria 3516
764 Ga0207656_10012184 3300025321 Bacteria 3265
765 Ga0207656_10015878 3300025321 Bacteria 2922
766 Ga0207656_10017245 3300025321 Bacteria 2825
767 Ga0207696_1002415 3300025711 Bacteria 9173
768 Ga0207696_1037019 3300025711 Bacteria 1446
769 Ga0207713_1002886 3300025735 Bacteria 12047
770 Ga0207713_1003622 3300025735 Bacteria 10406
771 Ga0207713_1006188 3300025735 Bacteria 7341
772 Ga0207713_1087456 3300025735 Bacteria 1104
773 Ga0207682_10002710 3300025893 Bacteria 7872
774 Ga0207682_10002860 3300025893 Bacteria 7622
775 Ga0207682_10002893 3300025893 Bacteria 7565
776 Ga0207682_10014144 3300025893 Bacteria 3110
777 Ga0207682_10015047 3300025893 Bacteria 3012
778 Ga0207682_10015327 3300025893 Bacteria 2983
779 Ga0207642_10015476 3300025899 Bacteria 2843
780 Ga0207710_10001597 3300025900 Bacteria 11102
781 Ga0207710_10009552 3300025900 Bacteria 4078
782 Ga0207710_10047974 3300025900 Bacteria 1910
783 Ga0207688_10008979 3300025901 Bacteria 5441
784 Ga0207688_10029435 3300025901 Bacteria 3023
785 Ga0207688_10093816 3300025901 Bacteria 1726
786 Ga0207688_10114629 3300025901 Bacteria 1568
787 Ga0207688_10177804 3300025901 Bacteria 1268
788 Ga0207680_10000012 3300025903 Bacteria 293810
789 Ga0207680_10000271 3300025903 Bacteria 24747
790 Ga0207680_10000692 3300025903 Bacteria 15887
791 Ga0207680_10001034 3300025903 Bacteria 13130
792 Ga0207680_10008180 3300025903 Bacteria 5125
793 Ga0207680_10011756 3300025903 Bacteria 4434
794 Ga0207680_10017042 3300025903 Bacteria 3829
795 Ga0207680_10044831 3300025903 Bacteria 2604
796 Ga0207680_10052973 3300025903 Bacteria 2434
797 Ga0207680_10072919 3300025903 Bacteria 2133
798 Ga0207680_10161883 3300025903 Bacteria 1501
799 Ga0207680_10378752 3300025903 Bacteria 997
800 Ga0207647_10000101 3300025904 Bacteria 66258
801 Ga0207647_10001349 3300025904 Bacteria 18852
802 Ga0207647_10001622 3300025904 Bacteria 17295
803 Ga0207647_10002227 3300025904 Bacteria 14775
804 Ga0207647_10002787 3300025904 Bacteria 13184
805 Ga0207647_10021433 3300025904 Bacteria 4313
806 Ga0207647_10052249 3300025904 Bacteria 2523
807 Ga0207645_10006401 3300025907 Bacteria 8455
808 Ga0207645_10043390 3300025907 Bacteria 2878
809 Ga0207645_10064820 3300025907 Bacteria 2334
810 Ga0207645_10071597 3300025907 Bacteria 2219
811 Ga0207645_10185867 3300025907 Bacteria 1364
812 Ga0207643_10110725 3300025908 Bacteria 1618
813 Ga0207643_10153402 3300025908 Bacteria 1382
814 Ga0207643_10156445 3300025908 Bacteria 1369
815 Ga0207643_10163656 3300025908 Bacteria 1340
816 Ga0207705_10000002 3300025909 Bacteria 2046852
817 Ga0207705_10000004 3300025909 Bacteria 705756
818 Ga0207705_10001792 3300025909 Bacteria 16928
819 Ga0207705_10043949 3300025909 Bacteria 3210
820 Ga0207705_10047919 3300025909 Bacteria 3073
821 Ga0207705_10107495 3300025909 Bacteria 2058
822 Ga0207705_10191879 3300025909 Bacteria 1545
823 Ga0207705_10211405 3300025909 Bacteria 1471
824 Ga0207705_10345878 3300025909 Bacteria 1145
825 Ga0207705_10470606 3300025909 Bacteria 975
826 Ga0207654_10000293 3300025911 Bacteria 30167
827 Ga0207654_10006254 3300025911 Bacteria 5987
828 Ga0207707_10267570 3300025912 Bacteria 1482
829 Ga0207695_10000641 3300025913 Bacteria 69705
830 Ga0207695_10066037 3300025913 Bacteria 3717
831 Ga0207695_10116258 3300025913 Bacteria 2649
832 Ga0207671_10002738 3300025914 Bacteria 18433
833 Ga0207671_10014014 3300025914 Bacteria 6359
834 Ga0207671_10085637 3300025914 Bacteria 2368
835 Ga0207693_10016182 3300025915 Bacteria 5964
836 Ga0207693_10076342 3300025915 Bacteria 2624
837 Ga0207662_10148146 3300025918 Bacteria 1491
838 Ga0207657_10002315 3300025919 Bacteria 20657
839 Ga0207657_10003599 3300025919 Bacteria 16510
840 Ga0207657_10009014 3300025919 Bacteria 10077
841 Ga0207657_10009396 3300025919 Bacteria 9834
842 Ga0207657_10009606 3300025919 Bacteria 9708
843 Ga0207657_10012152 3300025919 Bacteria 8508
844 Ga0207657_10017890 3300025919 Bacteria 6782
845 Ga0207657_10023348 3300025919 Bacteria 5760
846 Ga0207657_10024089 3300025919 Bacteria 5651
847 Ga0207657_10165042 3300025919 Bacteria 1797
848 Ga0207657_10213159 3300025919 Bacteria 1549
849 Ga0207657_10248779 3300025919 Bacteria 1418
850 Ga0207657_10347713 3300025919 Bacteria 1169
851 Ga0207657_10446514 3300025919 Bacteria 1015
852 Ga0207649_10000055 3300025920 Bacteria 103054
853 Ga0207649_10008987 3300025920 Bacteria 5459
854 Ga0207649_10010035 3300025920 Bacteria 5194
855 Ga0207649_10066067 3300025920 Bacteria 2291
856 Ga0207649_10070774 3300025920 Bacteria 2225
857 Ga0207649_10076304 3300025920 Bacteria 2156
858 Ga0207649_10086671 3300025920 Bacteria 2041
859 Ga0207649_10116498 3300025920 Bacteria 1794
860 Ga0207649_10328363 3300025920 Bacteria 1126
861 Ga0207649_10455824 3300025920 Bacteria 966
862 Ga0207652_10000004 3300025921 Bacteria 436303
863 Ga0207652_10042570 3300025921 Bacteria 3866
864 Ga0207652_10281166 3300025921 Bacteria 1501
865 Ga0207681_10000008 3300025923 Bacteria 414329
866 Ga0207681_10000076 3300025923 Bacteria 89353
867 Ga0207681_10000579 3300025923 Bacteria 24910
868 Ga0207681_10001675 3300025923 Bacteria 14271
869 Ga0207681_10003109 3300025923 Bacteria 10435
870 Ga0207681_10007354 3300025923 Bacteria 6745
871 Ga0207681_10010287 3300025923 Bacteria 5722
872 Ga0207681_10084788 3300025923 Bacteria 2247
873 Ga0207681_10129932 3300025923 Bacteria 1861
874 Ga0207681_10131678 3300025923 Bacteria 1850
875 Ga0207681_10355329 3300025923 Bacteria 1174
876 Ga0207681_10370075 3300025923 Bacteria 1151
877 Ga0207694_10013257 3300025924 Bacteria 6207
878 Ga0207694_10050373 3300025924 Bacteria 3225
879 Ga0207694_10122805 3300025924 Bacteria 2075
880 Ga0207694_10133165 3300025924 Bacteria 1994
881 Ga0207650_10000197 3300025925 Bacteria 69480
882 Ga0207650_10004712 3300025925 Bacteria 9318
883 Ga0207650_10004787 3300025925 Bacteria 9249
884 Ga0207650_10009314 3300025925 Bacteria 6710
885 Ga0207650_10010457 3300025925 Bacteria 6361
886 Ga0207650_10013566 3300025925 Bacteria 5644
887 Ga0207650_10022713 3300025925 Bacteria 4444
888 Ga0207650_10025718 3300025925 Bacteria 4194
889 Ga0207650_10030790 3300025925 Bacteria 3869
890 Ga0207650_10037530 3300025925 Bacteria 3531
891 Ga0207650_10041602 3300025925 Bacteria 3368
892 Ga0207650_10071366 3300025925 Bacteria 2612
893 Ga0207650_10076224 3300025925 Bacteria 2533
894 Ga0207650_10077426 3300025925 Bacteria 2514
895 Ga0207650_10084652 3300025925 Bacteria 2411
896 Ga0207650_10120308 3300025925 Bacteria 2043
897 Ga0207650_10135401 3300025925 Bacteria 1932
898 Ga0207650_10138970 3300025925 Bacteria 1908
899 Ga0207650_10158687 3300025925 Bacteria 1790
900 Ga0207650_10176501 3300025925 Bacteria 1700
901 Ga0207659_10007823 3300025926 Bacteria 6603
902 Ga0207659_10009896 3300025926 Bacteria 5966
903 Ga0207659_10011067 3300025926 Bacteria 5687
904 Ga0207659_10045260 3300025926 Bacteria 3101
905 Ga0207659_10052395 3300025926 Bacteria 2907
906 Ga0207659_10120505 3300025926 Bacteria 2010
907 Ga0207659_10145364 3300025926 Bacteria 1846
908 Ga0207659_10149069 3300025926 Bacteria 1825
909 Ga0207659_10213311 3300025926 Bacteria 1548
910 Ga0207687_10003507 3300025927 Bacteria 10554
911 Ga0207687_10010460 3300025927 Bacteria 6059
912 Ga0207687_10049095 3300025927 Bacteria 2933
913 Ga0207687_10177467 3300025927 Bacteria 1648
914 Ga0207644_10000006 3300025931 Bacteria 408793
915 Ga0207644_10000025 3300025931 Bacteria 152401
916 Ga0207644_10000453 3300025931 Bacteria 26500
917 Ga0207644_10000794 3300025931 Bacteria 20032
918 Ga0207644_10001261 3300025931 Bacteria 16268
919 Ga0207644_10001803 3300025931 Bacteria 13901
920 Ga0207644_10002807 3300025931 Bacteria 11229
921 Ga0207644_10005844 3300025931 Bacteria 8017
922 Ga0207644_10006124 3300025931 Bacteria 7846
923 Ga0207644_10008227 3300025931 Bacteria 6832
924 Ga0207644_10009935 3300025931 Bacteria 6261
925 Ga0207644_10010141 3300025931 Bacteria 6207
926 Ga0207644_10010231 3300025931 Bacteria 6182
927 Ga0207644_10016335 3300025931 Bacteria 4994
928 Ga0207644_10031171 3300025931 Unclassified 3713
929 Ga0207644_10036210 3300025931 Bacteria 3463
930 Ga0207644_10044592 3300025931 Bacteria 3151
931 Ga0207644_10077958 3300025931 Bacteria 2441
932 Ga0207644_10078484 3300025931 Bacteria 2433
933 Ga0207644_10092933 3300025931 Bacteria 2251
934 Ga0207644_10095443 3300025931 Bacteria 2224
935 Ga0207644_10103773 3300025931 Bacteria 2140
936 Ga0207644_10224558 3300025931 Bacteria 1490
937 Ga0207644_10299577 3300025931 Bacteria 1295
938 Ga0207644_10333420 3300025931 Bacteria 1229
939 Ga0207644_10653399 3300025931 Bacteria 875
940 Ga0207690_10000001 3300025932 Bacteria 807539
941 Ga0207690_10002439 3300025932 Bacteria 11246
942 Ga0207690_10004274 3300025932 Bacteria 8432
943 Ga0207690_10007038 3300025932 Bacteria 6672
944 Ga0207690_10024491 3300025932 Bacteria 3780
945 Ga0207690_10025490 3300025932 Bacteria 3714
946 Ga0207690_10056101 3300025932 Bacteria 2656
947 Ga0207690_10126061 3300025932 Bacteria 1867
948 Ga0207690_10128735 3300025932 Bacteria 1850
949 Ga0207690_10150688 3300025932 Bacteria 1724
950 Ga0207690_10204941 3300025932 Bacteria 1500
951 Ga0207690_10303644 3300025932 Bacteria 1250
952 Ga0207690_10317425 3300025932 Bacteria 1224
953 Ga0207706_10000318 3300025933 Bacteria 52104
954 Ga0207706_10000675 3300025933 Bacteria 35813
955 Ga0207706_10003641 3300025933 Bacteria 14717
956 Ga0207706_10004065 3300025933 Bacteria 13830
957 Ga0207706_10005063 3300025933 Bacteria 12306
958 Ga0207706_10008846 3300025933 Bacteria 9268
959 Ga0207706_10017119 3300025933 Bacteria 6536
960 Ga0207706_10020764 3300025933 Bacteria 5901
961 Ga0207706_10024717 3300025933 Bacteria 5384
962 Ga0207706_10028692 3300025933 Bacteria 4967
963 Ga0207706_10044565 3300025933 Bacteria 3931
964 Ga0207706_10051318 3300025933 Bacteria 3642
965 Ga0207706_10055130 3300025933 Bacteria 3506
966 Ga0207706_10059182 3300025933 Bacteria 3374
967 Ga0207706_10069755 3300025933 Bacteria 3091
968 Ga0207706_10073129 3300025933 Bacteria 3014
969 Ga0207706_10080685 3300025933 Bacteria 2860
970 Ga0207706_10111662 3300025933 Bacteria 2405
971 Ga0207706_10111996 3300025933 Bacteria 2401
972 Ga0207706_10115562 3300025933 Bacteria 2360
973 Ga0207706_10117686 3300025933 Bacteria 2337
974 Ga0207706_10158234 3300025933 Bacteria 1992
975 Ga0207706_10266908 3300025933 Bacteria 1494
976 Ga0207706_10325696 3300025933 Bacteria 1337
977 Ga0207706_10336333 3300025933 Bacteria 1313
978 Ga0207706_10412427 3300025933 Bacteria 1170
979 Ga0207670_10007495 3300025936 Bacteria 6092
980 Ga0207670_10350114 3300025936 Bacteria 1169
981 Ga0207669_10007355 3300025937 Bacteria 5088
982 Ga0207669_10007557 3300025937 Bacteria 5038
983 Ga0207669_10022561 3300025937 Bacteria 3346
984 Ga0207669_10070617 3300025937 Bacteria 2190
985 Ga0207669_10089478 3300025937 Bacteria 1999
986 Ga0207669_10127963 3300025937 Bacteria 1739
987 Ga0207669_10203519 3300025937 Bacteria 1439
988 Ga0207669_10477195 3300025937 Bacteria 993
989 Ga0207704_10014390 3300025938 Bacteria 3993
990 Ga0207704_10030456 3300025938 Bacteria 3025
991 Ga0207704_10033210 3300025938 Bacteria 2931
992 Ga0207704_10058324 3300025938 Bacteria 2376
993 Ga0207691_10000593 3300025940 Bacteria 36106
994 Ga0207691_10003690 3300025940 Bacteria 14849
995 Ga0207691_10004884 3300025940 Bacteria 12961
996 Ga0207691_10014167 3300025940 Bacteria 7608
997 Ga0207691_10015349 3300025940 Bacteria 7286
998 Ga0207691_10045151 3300025940 Bacteria 4052
999 Ga0207691_10056670 3300025940 Bacteria 3569
1000 Ga0207691_10067689 3300025940 Bacteria 3228
1001 Ga0207691_10069392 3300025940 Bacteria 3184
1002 Ga0207691_10070818 3300025940 Bacteria 3148
1003 Ga0207691_10075702 3300025940 Bacteria 3035
1004 Ga0207691_10139222 3300025940 Bacteria 2139
1005 Ga0207691_10198801 3300025940 Bacteria 1745
1006 Ga0207691_10220095 3300025940 Bacteria 1646
1007 Ga0207691_10246766 3300025940 Bacteria 1542
1008 Ga0207711_10000022 3300025941 Bacteria 340441
1009 Ga0207711_10000044 3300025941 Bacteria 157113
1010 Ga0207711_10000345 3300025941 Bacteria 49338
1011 Ga0207711_10000823 3300025941 Bacteria 30322
1012 Ga0207711_10002723 3300025941 Bacteria 15582
1013 Ga0207711_10003182 3300025941 Bacteria 14318
1014 Ga0207711_10006131 3300025941 Bacteria 10154
1015 Ga0207711_10010116 3300025941 Bacteria 7836
1016 Ga0207711_10012451 3300025941 Bacteria 7070
1017 Ga0207711_10014630 3300025941 Bacteria 6520
1018 Ga0207711_10016515 3300025941 Bacteria 6132
1019 Ga0207711_10019926 3300025941 Bacteria 5590
1020 Ga0207711_10022570 3300025941 Bacteria 5264
1021 Ga0207711_10025579 3300025941 Bacteria 4951
1022 Ga0207711_10036894 3300025941 Bacteria 4148
1023 Ga0207711_10054000 3300025941 Bacteria 3446
1024 Ga0207711_10107496 3300025941 Bacteria 2477
1025 Ga0207711_10122380 3300025941 Bacteria 2324
1026 Ga0207711_10157228 3300025941 Bacteria 2055
1027 Ga0207711_10185452 3300025941 Bacteria 1894
1028 Ga0207711_10206413 3300025941 Bacteria 1794
1029 Ga0207711_10218957 3300025941 Bacteria 1740
1030 Ga0207711_10252566 3300025941 Bacteria 1619
1031 Ga0207711_10295136 3300025941 Bacteria 1494
1032 Ga0207689_10000016 3300025942 Bacteria 118140
1033 Ga0207689_10079707 3300025942 Bacteria 2691
1034 Ga0207689_10135332 3300025942 Bacteria 2029
1035 Ga0207689_10384671 3300025942 Bacteria 1168
1036 Ga0207689_10674141 3300025942 Bacteria 871
1037 Ga0207661_10140596 3300025944 Bacteria 2077
1038 Ga0207661_10316408 3300025944 Bacteria 1402
1039 Ga0207661_10324075 3300025944 Bacteria 1386
1040 Ga0207661_10490795 3300025944 Bacteria 1122
1041 Ga0207679_10004997 3300025945 Bacteria 8281
1042 Ga0207679_10010889 3300025945 Bacteria 5865
1043 Ga0207679_10027466 3300025945 Bacteria 3936
1044 Ga0207679_10056021 3300025945 Bacteria 2909
1045 Ga0207679_10068536 3300025945 Bacteria 2666
1046 Ga0207679_10101249 3300025945 Bacteria 2253
1047 Ga0207679_10106790 3300025945 Bacteria 2201
1048 Ga0207679_10121592 3300025945 Bacteria 2080
1049 Ga0207679_10156695 3300025945 Bacteria 1860
1050 Ga0207679_10205756 3300025945 Bacteria 1647
1051 Ga0207679_10374861 3300025945 Bacteria 1246
1052 Ga0207679_10407426 3300025945 Bacteria 1197
1053 Ga0207679_10483266 3300025945 Bacteria 1103
1054 Ga0207667_10006099 3300025949 Bacteria 14651
1055 Ga0207667_10007726 3300025949 Bacteria 12856
1056 Ga0207651_10000166 3300025960 Bacteria 28419
1057 Ga0207651_10000590 3300025960 Bacteria 15282
1058 Ga0207651_10003207 3300025960 Bacteria 7996
1059 Ga0207651_10004463 3300025960 Bacteria 7058
1060 Ga0207651_10006297 3300025960 Bacteria 6191
1061 Ga0207651_10047482 3300025960 Bacteria 2895
1062 Ga0207651_10092700 3300025960 Bacteria 2216
1063 Ga0207651_10105132 3300025960 Bacteria 2105
1064 Ga0207651_10160670 3300025960 Bacteria 1761
1065 Ga0207651_10201199 3300025960 Bacteria 1596
1066 Ga0207651_10237846 3300025960 Bacteria 1482
1067 Ga0207651_10287616 3300025960 Bacteria 1361
1068 Ga0207651_10361962 3300025960 Bacteria 1224
1069 Ga0207651_10411592 3300025960 Bacteria 1152
1070 Ga0207651_10483773 3300025960 Bacteria 1067
1071 Ga0207712_10000021 3300025961 Bacteria 292649
1072 Ga0207712_10000023 3300025961 Bacteria 282081
1073 Ga0207712_10000310 3300025961 Bacteria 44589
1074 Ga0207712_10006709 3300025961 Bacteria 7258
1075 Ga0207712_10009274 3300025961 Bacteria 6226
1076 Ga0207712_10011792 3300025961 Bacteria 5574
1077 Ga0207712_10048073 3300025961 Bacteria 2966
1078 Ga0207668_10000111 3300025972 Bacteria 58689
1079 Ga0207668_10000306 3300025972 Bacteria 32058
1080 Ga0207668_10000706 3300025972 Bacteria 20420
1081 Ga0207668_10003689 3300025972 Bacteria 9009
1082 Ga0207668_10006604 3300025972 Bacteria 6859
1083 Ga0207668_10013948 3300025972 Bacteria 4964
1084 Ga0207668_10017259 3300025972 Bacteria 4519
1085 Ga0207668_10054408 3300025972 Bacteria 2778
1086 Ga0207668_10096005 3300025972 Bacteria 2190
1087 Ga0207668_10160370 3300025972 Bacteria 1752
1088 Ga0207668_10175708 3300025972 Bacteria 1684
1089 Ga0207668_10202995 3300025972 Bacteria 1580
1090 Ga0207668_10280535 3300025972 Bacteria 1366
1091 Ga0207668_10293806 3300025972 Bacteria 1338
1092 Ga0207668_10309379 3300025972 Bacteria 1307
1093 Ga0207640_10008310 3300025981 Bacteria 5763
1094 Ga0207640_10010235 3300025981 Bacteria 5275
1095 Ga0207640_10023263 3300025981 Bacteria 3722
1096 Ga0207640_10034561 3300025981 Bacteria 3155
1097 Ga0207640_10036210 3300025981 Bacteria 3096
1098 Ga0207640_10129970 3300025981 Bacteria 1819
1099 Ga0207640_10324294 3300025981 Bacteria 1227
1100 Ga0207640_10478423 3300025981 Bacteria 1032
1101 Ga0207640_10589287 3300025981 Bacteria 940
1102 Ga0207658_10000069 3300025986 Bacteria 113687
1103 Ga0207658_10000089 3300025986 Bacteria 100308
1104 Ga0207658_10000143 3300025986 Bacteria 74612
1105 Ga0207658_10001109 3300025986 Bacteria 21730
1106 Ga0207658_10001417 3300025986 Bacteria 18698
1107 Ga0207658_10002034 3300025986 Bacteria 15101
1108 Ga0207658_10002505 3300025986 Bacteria 13372
1109 Ga0207658_10003067 3300025986 Bacteria 11944
1110 Ga0207658_10004197 3300025986 Bacteria 10038
1111 Ga0207658_10008803 3300025986 Bacteria 6852
1112 Ga0207658_10016750 3300025986 Bacteria 5043
1113 Ga0207658_10035837 3300025986 Bacteria 3555
1114 Ga0207658_10038177 3300025986 Bacteria 3457
1115 Ga0207658_10040712 3300025986 Unclassified 3361
1116 Ga0207658_10049038 3300025986 Bacteria 3100
1117 Ga0207658_10051001 3300025986 Bacteria 3047
1118 Ga0207658_10058980 3300025986 Bacteria 2858
1119 Ga0207658_10061287 3300025986 Bacteria 2810
1120 Ga0207658_10100991 3300025986 Bacteria 2259
1121 Ga0207658_10125541 3300025986 Bacteria 2053
1122 Ga0207658_10133618 3300025986 Bacteria 1997
1123 Ga0207658_10442388 3300025986 Bacteria 1149
1124 Ga0207658_10486858 3300025986 Bacteria 1097
1125 Ga0207677_10000176 3300026023 Bacteria 50717
1126 Ga0207677_10002823 3300026023 Bacteria 9167
1127 Ga0207677_10003739 3300026023 Bacteria 8079
1128 Ga0207677_10007243 3300026023 Bacteria 6116
1129 Ga0207677_10044492 3300026023 Bacteria 2959
1130 Ga0207677_10167602 3300026023 Bacteria 1714
1131 Ga0207677_10419495 3300026023 Bacteria 1139
1132 Ga0207703_10000661 3300026035 Bacteria 34492
1133 Ga0207703_10001894 3300026035 Bacteria 18548
1134 Ga0207703_10011005 3300026035 Bacteria 7049
1135 Ga0207703_10052938 3300026035 Bacteria 3298
1136 Ga0207703_10059134 3300026035 Bacteria 3131
1137 Ga0207703_10061577 3300026035 Bacteria 3072
1138 Ga0207703_10102414 3300026035 Bacteria 2429
1139 Ga0207703_10166804 3300026035 Bacteria 1933
1140 Ga0207703_10218538 3300026035 Bacteria 1703
1141 Ga0207639_10002373 3300026041 Bacteria 12654
1142 Ga0207639_10007876 3300026041 Bacteria 7277
1143 Ga0207639_10013026 3300026041 Bacteria 5806
1144 Ga0207639_10028307 3300026041 Bacteria 4090
1145 Ga0207639_10032860 3300026041 Bacteria 3823
1146 Ga0207639_10670994 3300026041 Bacteria 960
1147 Ga0207678_10000753 3300026067 Bacteria 29593
1148 Ga0207678_10002342 3300026067 Bacteria 17172
1149 Ga0207678_10005390 3300026067 Bacteria 11460
1150 Ga0207678_10010368 3300026067 Bacteria 8180
1151 Ga0207678_10030207 3300026067 Bacteria 4730
1152 Ga0207678_10032095 3300026067 Bacteria 4578
1153 Ga0207678_10047023 3300026067 Bacteria 3731
1154 Ga0207678_10055116 3300026067 Bacteria 3424
1155 Ga0207678_10056217 3300026067 Bacteria 3388
1156 Ga0207678_10258149 3300026067 Bacteria 1493
1157 Ga0207702_10001877 3300026078 Bacteria 20615
1158 Ga0207702_10003206 3300026078 Bacteria 15097
1159 Ga0207702_10015397 3300026078 Bacteria 6337
1160 Ga0207702_10091189 3300026078 Bacteria 2668
1161 Ga0207641_10000001 3300026088 Bacteria 1180841
1162 Ga0207641_10000022 3300026088 Bacteria 279334
1163 Ga0207641_10000060 3300026088 Bacteria 161514
1164 Ga0207641_10000081 3300026088 Bacteria 139770
1165 Ga0207641_10000414 3300026088 Bacteria 49835
1166 Ga0207641_10001621 3300026088 Bacteria 21953
1167 Ga0207641_10005695 3300026088 Bacteria 10601
1168 Ga0207641_10008003 3300026088 Bacteria 8763
1169 Ga0207641_10013054 3300026088 Bacteria 6813
1170 Ga0207641_10017065 3300026088 Bacteria 5939
1171 Ga0207641_10018477 3300026088 Bacteria 5716
1172 Ga0207641_10027241 3300026088 Bacteria 4720
1173 Ga0207641_10030199 3300026088 Bacteria 4487
1174 Ga0207641_10049935 3300026088 Bacteria 3537
1175 Ga0207641_10070258 3300026088 Bacteria 3008
1176 Ga0207641_10097851 3300026088 Bacteria 2579
1177 Ga0207641_10390052 3300026088 Bacteria 1335
1178 Ga0207641_10553198 3300026088 Bacteria 1122
1179 Ga0207648_10018597 3300026089 Bacteria 6288
1180 Ga0207648_10028525 3300026089 Bacteria 4947
1181 Ga0207648_10032359 3300026089 Bacteria 4618
1182 Ga0207648_10365562 3300026089 Bacteria 1302
1183 Ga0207676_10000209 3300026095 Bacteria 50724
1184 Ga0207676_10000446 3300026095 Bacteria 34960
1185 Ga0207676_10001572 3300026095 Bacteria 16793
1186 Ga0207676_10002414 3300026095 Bacteria 13320
1187 Ga0207676_10002991 3300026095 Bacteria 12053
1188 Ga0207676_10003099 3300026095 Bacteria 11861
1189 Ga0207676_10006322 3300026095 Bacteria 8368
1190 Ga0207676_10010552 3300026095 Bacteria 6583
1191 Ga0207676_10038302 3300026095 Bacteria 3658
1192 Ga0207676_10552690 3300026095 Bacteria 1100
1193 Ga0207676_10584148 3300026095 Bacteria 1071
1194 Ga0207674_10000114 3300026116 Bacteria 93676
1195 Ga0207674_10000308 3300026116 Bacteria 62120
1196 Ga0207674_10006480 3300026116 Bacteria 13763
1197 Ga0207674_10010730 3300026116 Bacteria 10341
1198 Ga0207674_10019146 3300026116 Bacteria 7421
1199 Ga0207674_10021666 3300026116 Bacteria 6919
1200 Ga0207674_10053295 3300026116 Bacteria 4124
1201 Ga0207674_10070446 3300026116 Bacteria 3516
1202 Ga0207674_10150695 3300026116 Bacteria 2283
1203 Ga0207674_10223048 3300026116 Bacteria 1833
1204 Ga0207674_10228530 3300026116 Bacteria 1809
1205 Ga0207674_10562286 3300026116 Bacteria 1102
1206 Ga0207674_10728442 3300026116 Bacteria 957
1207 Ga0207675_100000082 3300026118 Bacteria 74689
1208 Ga0207675_100000227 3300026118 Bacteria 53090
1209 Ga0207675_100000341 3300026118 Bacteria 44495
1210 Ga0207675_100063151 3300026118 Bacteria 3461
1211 Ga0207675_100195660 3300026118 Bacteria 1940
1212 Ga0207675_100283742 3300026118 Bacteria 1609
1213 Ga0207683_10001332 3300026121 Bacteria 22266
1214 Ga0207683_10001334 3300026121 Bacteria 22262
1215 Ga0207683_10002606 3300026121 Bacteria 15748
1216 Ga0207683_10009869 3300026121 Bacteria 8142
1217 Ga0207683_10018819 3300026121 Bacteria 5891
1218 Ga0207683_10024070 3300026121 Bacteria 5240
1219 Ga0207683_10035073 3300026121 Bacteria 4363
1220 Ga0207683_10045109 3300026121 Bacteria 3854
1221 Ga0207683_10113848 3300026121 Bacteria 2423
1222 Ga0207683_10331728 3300026121 Bacteria 1394
1223 Ga0207683_10420002 3300026121 Bacteria 1232
1224 Ga0207683_10756545 3300026121 Bacteria 901
1225 Ga0207698_10004710 3300026142 Bacteria 8341
1226 Ga0207698_10009778 3300026142 Bacteria 6126
1227 Ga0207698_10010139 3300026142 Bacteria 6037
1228 Ga0207698_10064794 3300026142 Bacteria 2866
1229 Ga0207698_10099443 3300026142 Bacteria 2406
1230 Ga0207698_10123873 3300026142 Bacteria 2194
1231 Ga0207698_10133657 3300026142 Bacteria 2124
1232 Ga0207698_10195800 3300026142 Bacteria 1805
1233 Ga0207698_10295762 3300026142 Bacteria 1505
1234 Ga0209967_1006316 3300027364 Bacteria 1607
1235 Ga0209999_1030723 3300027543 Bacteria 997
1236 Ga0210002_1026264 3300027617 Bacteria 955
1237 Ga0209971_1009311 3300027682 Bacteria 2328
1238 Ga0209813_10000069 3300027866 Bacteria 39845
1239 Ga0209974_10003898 3300027876 Bacteria 5340
1240 Ga0209974_10042592 3300027876 Bacteria 1512
1241 Ga0207428_10038188 3300027907 Bacteria 3904
1242 Ga0268266_10000054 3300028379 Bacteria 292717
1243 Ga0268266_10000083 3300028379 Bacteria 202393
1244 Ga0268266_10000212 3300028379 Bacteria 101029
1245 Ga0268266_10000315 3300028379 Bacteria 76532
1246 Ga0268266_10000865 3300028379 Bacteria 39418
1247 Ga0268266_10005586 3300028379 Bacteria 11683
1248 Ga0268266_10011728 3300028379 Bacteria 7603
1249 Ga0268266_10042808 3300028379 Bacteria 3869
1250 Ga0268266_10109541 3300028379 Bacteria 2445
1251 Ga0268266_10147564 3300028379 Bacteria 2116
1252 Ga0268266_10162589 3300028379 Bacteria 2021
1253 Ga0268266_10171907 3300028379 Bacteria 1967
1254 Ga0268266_10178929 3300028379 Bacteria 1930
1255 Ga0268266_10272932 3300028379 Bacteria 1570
1256 Ga0268266_10372955 3300028379 Bacteria 1344
1257 Ga0268265_10000049 3300028380 Bacteria 177242
1258 Ga0268265_10000090 3300028380 Bacteria 116514
1259 Ga0268265_10000292 3300028380 Bacteria 56426
1260 Ga0268265_10000433 3300028380 Bacteria 44275
1261 Ga0268265_10011527 3300028380 Bacteria 5975
1262 Ga0268265_10021200 3300028380 Bacteria 4548
1263 Ga0268265_10039349 3300028380 Bacteria 3485
1264 Ga0268265_10047888 3300028380 Bacteria 3205
1265 Ga0268265_10055180 3300028380 Bacteria 3018
1266 Ga0268265_10057011 3300028380 Bacteria 2975
1267 Ga0268265_10066103 3300028380 Bacteria 2794
1268 Ga0268265_10122870 3300028380 Bacteria 2142
1269 Ga0268264_10000010 3300028381 Bacteria 596543
1270 Ga0268264_10000018 3300028381 Bacteria 495324
1271 Ga0268264_10000074 3300028381 Bacteria 259555
1272 Ga0268264_10000217 3300028381 Bacteria 113674
1273 Ga0268264_10001254 3300028381 Bacteria 24199
1274 Ga0268264_10006851 3300028381 Bacteria 9564
1275 Ga0268264_10008386 3300028381 Bacteria 8591
1276 Ga0268264_10011425 3300028381 Bacteria 7332
1277 Ga0268264_10070651 3300028381 Bacteria 2956
1278 Ga0268264_10079513 3300028381 Bacteria 2797
1279 Ga0268264_10141641 3300028381 Bacteria 2145
1280 Ga0268264_10225871 3300028381 Bacteria 1726
1281 Ga0268264_10540216 3300028381 Bacteria 1142
1282 Ga0307515_10359930 3300028794 Bacteria 1097
1283 Ga0316182_1036746 3300030745 Bacteria 1442
1284 Ga0265327_10012032 3300031251 Bacteria 5884
1285 Ga0307513_10027142 3300031456 Bacteria 6580
1286 Ga0307408_100005100 3300031548 Bacteria 8814
1287 Ga0307408_100010122 3300031548 Bacteria 6217
1288 Ga0307408_100016027 3300031548 Bacteria 4998
1289 Ga0307408_100023689 3300031548 Bacteria 4185
1290 Ga0307408_100044684 3300031548 Bacteria 3158
1291 Ga0307408_100128503 3300031548 Bacteria 1974
1292 Ga0307408_100167945 3300031548 Bacteria 1749
1293 Ga0307408_100180018 3300031548 Bacteria 1694
1294 Ga0307408_100262257 3300031548 Bacteria 1430
1295 Ga0307408_100435706 3300031548 Bacteria 1134
1296 Ga0307408_100573878 3300031548 Bacteria 998
1297 Ga0307408_100773840 3300031548 Bacteria 869
1298 Ga0307405_10003530 3300031731 Bacteria 7204
1299 Ga0307405_10006360 3300031731 Bacteria 5806
1300 Ga0307405_10012577 3300031731 Bacteria 4488
1301 Ga0307405_10017784 3300031731 Bacteria 3908
1302 Ga0307405_10036826 3300031731 Bacteria 2935
1303 Ga0307405_10041678 3300031731 Bacteria 2789
1304 Ga0307405_10085486 3300031731 Bacteria 2074
1305 Ga0307405_10097061 3300031731 Bacteria 1967
1306 Ga0307405_10101264 3300031731 Bacteria 1932
1307 Ga0307405_10109522 3300031731 Bacteria 1868
1308 Ga0307405_10193578 3300031731 Bacteria 1470
1309 Ga0307405_10204541 3300031731 Bacteria 1436
1310 Ga0307405_10509606 3300031731 Bacteria 966
1311 Ga0307413_10008886 3300031824 Bacteria 4773
1312 Ga0307413_10103645 3300031824 Bacteria 1886
1313 Ga0307413_10157467 3300031824 Bacteria 1591
1314 Ga0307413_10176840 3300031824 Bacteria 1517
1315 Ga0307413_10244786 3300031824 Bacteria 1326
1316 Ga0307410_10012029 3300031852 Bacteria 4981
1317 Ga0307410_10013097 3300031852 Bacteria 4826
1318 Ga0307410_10014722 3300031852 Bacteria 4615
1319 Ga0307410_10014848 3300031852 Bacteria 4598
1320 Ga0307410_10024732 3300031852 Bacteria 3757
1321 Ga0307410_10028420 3300031852 Bacteria 3547
1322 Ga0307410_10032966 3300031852 Bacteria 3340
1323 Ga0307410_10033781 3300031852 Bacteria 3305
1324 Ga0307410_10037055 3300031852 Bacteria 3182
1325 Ga0307410_10058215 3300031852 Bacteria 2634
1326 Ga0307410_10090571 3300031852 Bacteria 2169
1327 Ga0307410_10096045 3300031852 Bacteria 2114
1328 Ga0307410_10103757 3300031852 Bacteria 2043
1329 Ga0307410_10354817 3300031852 Bacteria 1173
1330 Ga0307410_10361120 3300031852 Bacteria 1163
1331 Ga0307410_10400734 3300031852 Bacteria 1108
1332 Ga0307406_10017061 3300031901 Bacteria 4226
1333 Ga0307406_10154654 3300031901 Bacteria 1641
1334 Ga0307406_10164559 3300031901 Bacteria 1598
1335 Ga0307406_10336808 3300031901 Bacteria 1173
1336 Ga0307406_10572386 3300031901 Bacteria 927
1337 Ga0307407_10006564 3300031903 Bacteria 5189
1338 Ga0307407_10025709 3300031903 Bacteria 3107
1339 Ga0307407_10064759 3300031903 Bacteria 2149
1340 Ga0307407_10103448 3300031903 Bacteria 1772
1341 Ga0307407_10223186 3300031903 Bacteria 1275
1342 Ga0307412_10000453 3300031911 Bacteria 24741
1343 Ga0307412_10014537 3300031911 Bacteria 4644
1344 Ga0307412_10016258 3300031911 Bacteria 4429
1345 Ga0307412_10027552 3300031911 Bacteria 3545
1346 Ga0307412_10037841 3300031911 Bacteria 3102
1347 Ga0307412_10049151 3300031911 Bacteria 2778
1348 Ga0307412_10139709 3300031911 Bacteria 1772
1349 Ga0307412_10165364 3300031911 Bacteria 1649
1350 Ga0307412_10253623 3300031911 Bacteria 1367
1351 Ga0307412_10287989 3300031911 Bacteria 1292
1352 Ga0307412_10375353 3300031911 Bacteria 1149
1353 Ga0307409_100004194 3300031995 Bacteria 8034
1354 Ga0307409_100009517 3300031995 Bacteria 5975
1355 Ga0307409_100010878 3300031995 Bacteria 5694
1356 Ga0307409_100011847 3300031995 Bacteria 5522
1357 Ga0307409_100016462 3300031995 Bacteria 4892
1358 Ga0307409_100020197 3300031995 Bacteria 4534
1359 Ga0307409_100020452 3300031995 Bacteria 4511
1360 Ga0307409_100026363 3300031995 Bacteria 4097
1361 Ga0307409_100070335 3300031995 Bacteria 2777
1362 Ga0307409_100087664 3300031995 Bacteria 2537
1363 Ga0307409_100111557 3300031995 Bacteria 2294
1364 Ga0307409_100123567 3300031995 Bacteria 2197
1365 Ga0307409_100128067 3300031995 Bacteria 2163
1366 Ga0307409_100134518 3300031995 Bacteria 2119
1367 Ga0307409_100197064 3300031995 Bacteria 1798
1368 Ga0307409_100254855 3300031995 Bacteria 1606
1369 Ga0307409_100276002 3300031995 Bacteria 1551
1370 Ga0307409_100332092 3300031995 Bacteria 1427
1371 Ga0307409_100494782 3300031995 Bacteria 1189
1372 Ga0307409_100619543 3300031995 Bacteria 1072
1373 Ga0307409_100625008 3300031995 Bacteria 1067
1374 Ga0307416_100011951 3300032002 Bacteria 5824
1375 Ga0307416_100026591 3300032002 Bacteria 4266
1376 Ga0307416_100053761 3300032002 Bacteria 3233
1377 Ga0307416_100066972 3300032002 Bacteria 2959
1378 Ga0307416_100076929 3300032002 Bacteria 2800
1379 Ga0307416_100118038 3300032002 Bacteria 2356
1380 Ga0307416_100184141 3300032002 Bacteria 1961
1381 Ga0307416_100196647 3300032002 Bacteria 1908
1382 Ga0307416_100403027 3300032002 Bacteria 1406
1383 Ga0307416_100544095 3300032002 Bacteria 1233
1384 Ga0307416_100554514 3300032002 Bacteria 1223
1385 Ga0307416_100748869 3300032002 Bacteria 1069
1386 Ga0307416_100771238 3300032002 Bacteria 1056
1387 Ga0307416_100827693 3300032002 Bacteria 1023
1388 Ga0307414_10000248 3300032004 Bacteria 33977
1389 Ga0307414_10000523 3300032004 Bacteria 19969
1390 Ga0307414_10008564 3300032004 Bacteria 5812
1391 Ga0307414_10010480 3300032004 Bacteria 5382
1392 Ga0307414_10034830 3300032004 Bacteria 3343
1393 Ga0307414_10035078 3300032004 Bacteria 3334
1394 Ga0307414_10043471 3300032004 Bacteria 3061
1395 Ga0307414_10063631 3300032004 Bacteria 2623
1396 Ga0307414_10098991 3300032004 Bacteria 2189
1397 Ga0307414_10112019 3300032004 Bacteria 2079
1398 Ga0307414_10129340 3300032004 Bacteria 1957
1399 Ga0307414_10200354 3300032004 Bacteria 1623
1400 Ga0307414_10233641 3300032004 Bacteria 1518
1401 Ga0307414_10240870 3300032004 Bacteria 1497
1402 Ga0307414_10249458 3300032004 Bacteria 1474
1403 Ga0307414_10307293 3300032004 Bacteria 1344
1404 Ga0307414_10425270 3300032004 Bacteria 1159
1405 Ga0307414_10430559 3300032004 Bacteria 1152
1406 Ga0307414_10504907 3300032004 Bacteria 1070
1407 Ga0307414_10522650 3300032004 Bacteria 1053
1408 Ga0307411_10005498 3300032005 Bacteria 6232
1409 Ga0307411_10011441 3300032005 Bacteria 4790
1410 Ga0307411_10022927 3300032005 Bacteria 3686
1411 Ga0307411_10025794 3300032005 Bacteria 3527
1412 Ga0307411_10030508 3300032005 Bacteria 3305
1413 Ga0307411_10053194 3300032005 Bacteria 2651
1414 Ga0307411_10055192 3300032005 Bacteria 2612
1415 Ga0307411_10081676 3300032005 Bacteria 2226
1416 Ga0307411_10083996 3300032005 Bacteria 2201
1417 Ga0307411_10094247 3300032005 Bacteria 2098
1418 Ga0307411_10102035 3300032005 Bacteria 2032
1419 Ga0307411_10103255 3300032005 Bacteria 2022
1420 Ga0307411_10127876 3300032005 Bacteria 1851
1421 Ga0307411_10133265 3300032005 Bacteria 1819
1422 Ga0307411_10134665 3300032005 Bacteria 1811
1423 Ga0307411_10135633 3300032005 Bacteria 1806
1424 Ga0307411_10151698 3300032005 Bacteria 1723
1425 Ga0307411_10244921 3300032005 Bacteria 1406
1426 Ga0307411_10589021 3300032005 Bacteria 954
1427 Ga0307415_100007346 3300032126 Bacteria 6021
1428 Ga0307415_100018706 3300032126 Bacteria 4190
1429 Ga0307415_100058166 3300032126 Bacteria 2660
1430 Ga0307415_100094423 3300032126 Bacteria 2174
1431 Ga0307415_100100283 3300032126 Bacteria 2121
1432 Ga0307415_100101759 3300032126 Bacteria 2109
1433 Ga0307415_100204110 3300032126 Bacteria 1571
1434 Ga0307415_100219190 3300032126 Bacteria 1524
1435 Ga0307415_100310985 3300032126 Bacteria 1309
1436 Ga0307415_100398383 3300032126 Bacteria 1174
1437 Ga0307415_100469146 3300032126 Bacteria 1093
1438 Ga0307415_100528108 3300032126 Bacteria 1037
1439 Ga0316583_10003324 3300032133 Bacteria 5661
1440 Ga0307510_10222424 3300033180 Bacteria 1398
1441 Ga0373932_0041083 3300035112 Bacteria 1335
1442 Ga0373943_0025771 3300035170 Bacteria 2750
1443 Ga0373946_0064356 3300035171 Bacteria 1568
1444 Ga0373962_0007062 3300035242 Bacteria 2743
1445 Ga0373931_0003033 3300035691 Bacteria 7505
1446 Ga0373931_0065197 3300035691 Bacteria 1973
1447 Ga0373927_0128562 3300035695 Bacteria 1654
1448 Ga0373927_0184143 3300035695 Bacteria 1370
1449 Ga0373927_0187765 3300035695 Bacteria 1356
1450 Ga0373933_0160738 3300035724 Bacteria 1426
1451 Ga0373933_0227003 3300035724 Bacteria 1199
1452 Ga0373947_0016738 3300035725 Bacteria 4213
1453 Ga0373947_0169901 3300035725 Bacteria 1414
1454 Ga0373937_0155558 3300036401 Bacteria 2143
1455 Ga0316582_0000241 3300036647 Bacteria 18135
1456 Ga0316584_0124894 3300036712 Bacteria 1922
1457 Ga0373925_0085040 3300037068 Bacteria 2411
1458 Ga0395899_0001279 3300037312 Bacteria 21800
1459 Ga0395899_0068045 3300037312 Bacteria 2612
1460 Ga0395899_0102284 3300037312 Bacteria 2067
1461 Ga0395899_0116514 3300037312 Bacteria 1917
1462 Ga0395900_0060058 3300037418 Bacteria 3913
1463 Ga0395900_0080858 3300037418 Bacteria 3339
1464 Ga0395900_0105413 3300037418 Bacteria 2896
1465 Ga0395900_0125141 3300037418 Bacteria 2636
1466 Ga0395900_0167888 3300037418 Bacteria 2235
1467 Ga0395900_0200701 3300037418 Bacteria 2018
1468 Ga0395900_0268532 3300037418 Bacteria 1701
1469 Ga0395900_0296711 3300037418 Bacteria 1604
1470 Ga0395900_0502712 3300037418 Bacteria 1162
1471 Ga0395900_0539053 3300037418 Bacteria 1113
1472 Ga0395900_0616490 3300037418 Bacteria 1024
1473 Ga0395898_0009735 3300037466 Bacteria 10077
1474 Ga0395898_0039150 3300037466 Bacteria 4694
1475 Ga0395898_0120700 3300037466 Bacteria 2511
1476 Ga0395898_0131343 3300037466 Bacteria 2398
1477 Ga0395898_0195400 3300037466 Bacteria 1933
1478 Ga0395905_0000002 3300037471 Bacteria 1356358
1479 Ga0395905_0000259 3300037471 Bacteria 79396
1480 Ga0395905_0001268 3300037471 Bacteria 31200
1481 Ga0395905_0002116 3300037471 Bacteria 22546
1482 Ga0395905_0002525 3300037471 Bacteria 20191
1483 Ga0395905_0005106 3300037471 Bacteria 13488
1484 Ga0395905_0008973 3300037471 Bacteria 9813
1485 Ga0395905_0009309 3300037471 Bacteria 9608
1486 Ga0395905_0038888 3300037471 Bacteria 4462
1487 Ga0395905_0064086 3300037471 Bacteria 3438
1488 Ga0395905_0086961 3300037471 Bacteria 2930
1489 Ga0395905_0107590 3300037471 Bacteria 2618
1490 Ga0395905_0108523 3300037471 Bacteria 2605
1491 Ga0395905_0112432 3300037471 Bacteria 2558
1492 Ga0395905_0237278 3300037471 Bacteria 1704
1493 Ga0395905_0386644 3300037471 Bacteria 1293
1494 Ga0395905_0431506 3300037471 Bacteria 1214
1495 Ga0436364_0043906 3300037853 Bacteria 35219
1496 Ga0436364_0375606 3300037853 Bacteria 1520
1497 Ga0395901_0055144 3300038443 Bacteria 4132
1498 Ga0395901_0059700 3300038443 Bacteria 3968
1499 Ga0395901_0094907 3300038443 Bacteria 3125
1500 Ga0395901_0103236 3300038443 Bacteria 2991
1501 Ga0395901_0155426 3300038443 Bacteria 2402
1502 Ga0395901_0219745 3300038443 Bacteria 1986
1503 Ga0395901_0493556 3300038443 Bacteria 1247
1504 Ga0237819_00277 3300038705 Bacteria 18762
1505 Ga0237816_01172 3300039145 Bacteria 2156
1506 Ga0436365_0352550 3300039437 Bacteria 74350
1507 Ga0436365_0425921 3300039437 Bacteria 1869
1508 Ga0436365_0823412 3300039437 Bacteria 2074
1509 Ga0436365_1883381 3300039437 Bacteria 12721
1510 Ga0436361_0666902 3300039447 Bacteria 2458
1511 Ga0436363_0514468 3300039450 Bacteria 979
1512 Ga0436363_1088554 3300039450 Bacteria 1300
1513 Ga0436362_0976836 3300039453 Bacteria 135942
1514 Ga0439466_0022459 3300041411 Bacteria 2227
1515 Ga0439465_0005684 3300041413 Bacteria 3967
1516 Ga0451807_2673641 3300041486 Bacteria 909
1517 Ga0439431_0003890 3300041997 Bacteria 3295
1518 Ga0439431_0009412 3300041997 Bacteria 2207
1519 Ga0439431_0010561 3300041997 Bacteria 2096
1520 Ga0439443_020568 3300042003 Bacteria 1037
1521 Ga0439445_0001313 3300042004 Bacteria 5369
1522 Ga0439445_0001908 3300042004 Bacteria 4595
1523 Ga0439448_0012592 3300042005 Bacteria 2534
1524 Ga0439448_0119957 3300042005 Bacteria 902
1525 Ga0439432_003246 3300042006 Bacteria 6048
1526 Ga0439449_0035887 3300042007 Bacteria 1845
1527 Ga0439449_0136098 3300042007 Bacteria 914
1528 Ga0439455_0004340 3300042012 Bacteria 2805
1529 Ga0439455_0007576 3300042012 Bacteria 2300
1530 Ga0439462_0010288 3300042015 Bacteria 2368
1531 Ga0439462_0051902 3300042015 Bacteria 1103
1532 Ga0450920_005490 3300042122 Bacteria 2254
1533 Ga0450890_012483 3300042127 Bacteria 1103
1534 Ga0450906_019189 3300042145 Bacteria 1226
1535 Ga0439458_0000003 3300042157 Bacteria 33633
1536 Ga0439458_0000100 3300042157 Bacteria 16893
1537 Ga0439434_0000270 3300042435 Bacteria 14772
1538 Ga0450893_0015955 3300042532 Bacteria 1269
1539 Ga0466972_0014153 3300044658 Bacteria 3998
1540 Ga0466972_0124862 3300044658 Bacteria 1213
1541 Ga0466964_0030710 3300044706 Bacteria 2127
1542 Ga0453684_0186291 3300044712 Bacteria 2432
1543 Ga0466970_0041238 3300044765 Bacteria 2452
1544 Ga0466970_0102757 3300044765 Bacteria 1557
1545 Ga0466957_0013721 3300044842 Bacteria 4706
1546 Ga0466960_0013186 3300044901 Bacteria 3505
1547 Ga0466960_0072288 3300044901 Bacteria 1719
1548 Ga0451576_0778890 3300045051 Bacteria 1005
1549 Ga0466967_0434670 3300045976 Bacteria 1281
1550 Ga0495627_000197 3300046453 Bacteria 66158
1551 Ga0495627_000332 3300046453 Bacteria 45347
1552 Ga0495629_0226073 3300046459 Bacteria 1290
1553 Ga0495638_0000014 3300046460 Bacteria 417060
1554 Ga0495638_0012073 3300046460 Bacteria 5934
1555 Ga0495638_0061872 3300046460 Bacteria 2312
1556 Ga0495653_0217609 3300046463 Bacteria 1286
1557 Ga0495650_0000949 3300046471 Bacteria 33507
1558 Ga0495650_0001750 3300046471 Bacteria 19773
1559 Ga0495582_0190266 3300046473 Bacteria 1171
1560 Ga0495585_0024902 3300046492 Bacteria 3430
1561 Ga0495596_0000625 3300046500 Bacteria 22228
1562 Ga0495596_0000662 3300046500 Bacteria 21469
1563 Ga0495607_0029348 3300046501 Bacteria 3385
1564 Ga0495583_0000010 3300046506 Bacteria 353523
1565 Ga0495583_0000072 3300046506 Bacteria 182057
1566 Ga0495583_0024021 3300046506 Bacteria 3071
1567 Ga0495610_0000020 3300046512 Bacteria 344007
1568 Ga0495610_0000104 3300046512 Bacteria 98197
1569 Ga0495610_0000206 3300046512 Bacteria 65469
1570 Ga0495610_0001905 3300046512 Bacteria 18000
1571 Ga0495616_0000189 3300046513 Bacteria 51610
1572 Ga0495616_0040503 3300046513 Bacteria 2380
1573 Ga0495620_0070924 3300046515 Bacteria 1426
1574 Ga0495632_0000039 3300046519 Bacteria 150268
1575 Ga0495632_0001119 3300046519 Bacteria 22987
1576 Ga0495632_0001380 3300046519 Bacteria 20349
1577 Ga0495637_0001220 3300046520 Bacteria 15603
1578 Ga0495637_0007245 3300046520 Bacteria 5516
1579 Ga0495643_0000023 3300046522 Bacteria 288590
1580 Ga0495643_0000162 3300046522 Bacteria 106672
1581 Ga0495643_0010821 3300046522 Bacteria 5593
1582 Ga0495643_0041082 3300046522 Bacteria 2523
1583 Ga0495643_0077082 3300046522 Bacteria 1742
1584 Ga0495643_0156313 3300046522 Bacteria 1125
1585 Ga0495648_0000021 3300046524 Bacteria 246945
1586 Ga0495648_0037697 3300046524 Bacteria 3103
1587 Ga0495648_0055342 3300046524 Bacteria 2392
1588 Ga0495663_0000006 3300046525 Bacteria 306938
1589 Ga0495663_0003158 3300046525 Bacteria 4806
1590 Ga0495663_0009224 3300046525 Bacteria 2736
1591 Ga0495663_0015024 3300046525 Bacteria 2178
1592 Ga0495663_0025029 3300046525 Bacteria 1738
1593 Ga0495663_0026138 3300046525 Bacteria 1708
1594 Ga0495642_0089521 3300046528 Bacteria 1302
1595 Ga0495654_0005057 3300046530 Bacteria 7723
1596 Ga0495654_0071953 3300046530 Bacteria 1638
1597 Ga0495598_0000161 3300046537 Bacteria 11501
1598 Ga0495598_0001682 3300046537 Bacteria 4433
1599 Ga0495598_0003299 3300046537 Bacteria 3414
1600 Ga0495598_0006522 3300046537 Bacteria 2639
1601 Ga0495609_0004365 3300046538 Bacteria 7767
1602 Ga0495609_0140980 3300046538 Bacteria 1029
1603 Ga0495621_0001303 3300046539 Bacteria 6442
1604 Ga0495621_0008416 3300046539 Bacteria 3092
1605 Ga0495633_0000498 3300046558 Bacteria 39609
1606 Ga0495633_0000709 3300046558 Bacteria 30286
1607 Ga0495633_0005226 3300046558 Bacteria 8007
1608 Ga0495633_0029292 3300046558 Bacteria 2678
1609 Ga0495633_0278753 3300046558 Bacteria 761
1610 Ga0495668_0005964 3300046616 Bacteria 8095
1611 Ga0495668_0013617 3300046616 Bacteria 4790
1612 Ga0495668_0032001 3300046616 Bacteria 2961
1613 Ga0495668_0053616 3300046616 Bacteria 2229
1614 Ga0495625_0003884 3300046660 Bacteria 14427
1615 Ga0495635_0191206 3300046663 Bacteria 1390
1616 Ga0495661_0037556 3300046665 Bacteria 3023
1617 Ga0495661_0078663 3300046665 Bacteria 1907
1618 Ga0495661_0085703 3300046665 Bacteria 1805
1619 Ga0495658_0047626 3300046683 Bacteria 2415
1620 Ga0495669_0001299 3300046684 Bacteria 10357
1621 Ga0495669_0001331 3300046684 Bacteria 10219
1622 Ga0495669_0005488 3300046684 Bacteria 5294
1623 Ga0495669_0010801 3300046684 Bacteria 3864
1624 Ga0495669_0028172 3300046684 Bacteria 2459
1625 Ga0495669_0031586 3300046684 Bacteria 2326
1626 Ga0495669_0049049 3300046684 Bacteria 1890
1627 Ga0495669_0079566 3300046684 Bacteria 1503
1628 Ga0495669_0219866 3300046684 Bacteria 910
1629 Ga0495670_0000028 3300046691 Bacteria 90085
1630 Ga0495670_0002560 3300046691 Bacteria 8988
1631 Ga0495670_0002640 3300046691 Bacteria 8844
1632 Ga0495670_0004815 3300046691 Bacteria 6628
1633 Ga0495670_0014891 3300046691 Bacteria 3829
1634 Ga0495671_0000028 3300046692 Bacteria 234938
1635 Ga0495671_0000062 3300046692 Bacteria 106672
1636 Ga0495671_0047666 3300046692 Bacteria 2140
1637 Ga0495671_0179923 3300046692 Bacteria 1027
1638 Ga0495677_0017392 3300047445 Bacteria 2607
1639 Ga0495677_0035109 3300047445 Bacteria 1830
1640 Ga0495677_0038468 3300047445 Bacteria 1748
1641 Ga0495673_0000058 3300047469 Bacteria 235044
1642 Ga0495673_0025959 3300047469 Bacteria 2808
1643 Ga0495681_0000106 3300047470 Bacteria 72369
1644 Ga0495681_0000123 3300047470 Bacteria 68069
1645 Ga0495681_0012584 3300047470 Bacteria 4963
1646 Ga0495681_0022938 3300047470 Bacteria 3328
1647 Ga0495681_0128695 3300047470 Bacteria 1080
1648 Ga0495686_0000514 3300047472 Bacteria 55968
1649 Ga0495686_0000753 3300047472 Bacteria 42718
1650 Ga0495686_0000986 3300047472 Bacteria 34762
1651 Ga0495686_0002233 3300047472 Bacteria 18721
1652 Ga0495686_0075740 3300047472 Bacteria 2062
1653 Ga0495686_0170483 3300047472 Bacteria 1266
1654 Ga0495602_0103333 3300048088 Bacteria 2333
1655 Ga0495626_0001250 3300048091 Bacteria 20852
1656 Ga0496100_0001699 3300048903 Bacteria 10943
1657 Ga0496100_0029472 3300048903 Bacteria 3395
1658 Ga0496100_0137390 3300048903 Bacteria 1728
1659 Ga0496100_0157070 3300048903 Bacteria 1627
1660 Ga0496100_0282196 3300048903 Bacteria 1238
1661 Ga0496101_0001043 3300048904 Bacteria 16361
1662 Ga0496101_0092964 3300048904 Bacteria 2246
1663 Ga0496101_0235144 3300048904 Bacteria 1425
1664 Ga0496102_0013225 3300048905 Bacteria 7142
1665 Ga0496102_0032753 3300048905 Bacteria 4670
1666 Ga0496102_0133620 3300048905 Bacteria 2324
1667 Ga0496102_0299015 3300048905 Bacteria 1517
1668 Ga0496102_0508489 3300048905 Bacteria 1127
1669 Ga0496102_0531325 3300048905 Bacteria 1099
1670 Ga0496103_0001126 3300048906 Bacteria 18573
1671 Ga0496103_0003725 3300048906 Bacteria 9269
1672 Ga0496103_0004335 3300048906 Bacteria 8615
1673 Ga0496103_0057642 3300048906 Bacteria 2412
1674 Ga0496103_0143676 3300048906 Bacteria 1527
1675 Ga0496103_0205930 3300048906 Bacteria 1265
1676 Ga0496104_0000047 3300048907 Bacteria 148896
1677 Ga0496104_0023274 3300048907 Bacteria 5696
1678 Ga0496104_0028059 3300048907 Bacteria 5215
1679 Ga0496104_0066451 3300048907 Bacteria 3424
1680 Ga0496104_0595656 3300048907 Bacteria 1016
1681 Ga0496105_0001043 3300048908 Bacteria 19173
1682 Ga0496105_0001439 3300048908 Bacteria 16760
1683 Ga0496105_0110409 3300048908 Bacteria 2270
1684 Ga0496106_0019778 3300048909 Bacteria 4993
1685 Ga0496106_0020015 3300048909 Bacteria 4963
1686 Ga0496106_0073822 3300048909 Bacteria 2610
1687 Ga0496107_0001011 3300048910 Bacteria 16782
1688 Ga0496107_0002753 3300048910 Bacteria 11567
1689 Ga0496107_0041154 3300048910 Bacteria 3317
1690 Ga0496107_0198033 3300048910 Bacteria 1493
1691 Ga0496107_0232921 3300048910 Bacteria 1370
1692 Ga0496108_0001754 3300048911 Bacteria 17237
1693 Ga0496108_0022034 3300048911 Bacteria 5238
1694 Ga0496108_0038475 3300048911 Bacteria 3985
1695 Ga0496108_0055839 3300048911 Bacteria 3317
1696 Ga0496108_0106734 3300048911 Bacteria 2391
1697 Ga0496108_0274981 3300048911 Bacteria 1466
1698 Ga0496108_0651458 3300048911 Bacteria 915
1699 Ga0496109_0001104 3300048912 Bacteria 22373
1700 Ga0496109_0008312 3300048912 Bacteria 8812
1701 Ga0496109_0020089 3300048912 Bacteria 5900
1702 Ga0496109_0032414 3300048912 Bacteria 4697
1703 Ga0496109_0046122 3300048912 Bacteria 3957
1704 Ga0496109_0063952 3300048912 Bacteria 3365
1705 Ga0496109_0067547 3300048912 Bacteria 3275
1706 Ga0496109_0071548 3300048912 Bacteria 3184
1707 Ga0496109_0228013 3300048912 Bacteria 1752
1708 Ga0496109_0233278 3300048912 Bacteria 1731
1709 Ga0496110_0004034 3300048913 Bacteria 11327
1710 Ga0496110_0005807 3300048913 Bacteria 9700
1711 Ga0496110_0008722 3300048913 Bacteria 8164
1712 Ga0496110_0009970 3300048913 Bacteria 7707
1713 Ga0496110_0026705 3300048913 Bacteria 4944
1714 Ga0496110_0027060 3300048913 Bacteria 4913
1715 Ga0496110_0047313 3300048913 Bacteria 3766
1716 Ga0496110_0056901 3300048913 Bacteria 3441
1717 Ga0496110_0090418 3300048913 Bacteria 2737
1718 Ga0496110_0106894 3300048913 Bacteria 2511
1719 Ga0496110_0631579 3300048913 Bacteria 970
1720 Ga0496110_0841419 3300048913 Bacteria 823
1721 Ga0496111_0009177 3300048914 Bacteria 6585
1722 Ga0496111_0012281 3300048914 Bacteria 5795
1723 Ga0496111_0026202 3300048914 Bacteria 4116
1724 Ga0496111_0077937 3300048914 Bacteria 2416
1725 Ga0496111_0093633 3300048914 Bacteria 2203
1726 Ga0496111_0195647 3300048914 Bacteria 1503
1727 Ga0496111_0213581 3300048914 Bacteria 1433
1728 Ga0496112_0000161 3300048915 Bacteria 42407
1729 Ga0496112_0005612 3300048915 Bacteria 10883
1730 Ga0496112_0014867 3300048915 Bacteria 7241
1731 Ga0496112_0034388 3300048915 Bacteria 4932
1732 Ga0496112_0053964 3300048915 Bacteria 3948
1733 Ga0496112_0598451 3300048915 Bacteria 1035
1734 Ga0496113_0001466 3300048916 Bacteria 13158
1735 Ga0496113_0009375 3300048916 Bacteria 6418
1736 Ga0496113_0011871 3300048916 Bacteria 5837
1737 Ga0496113_0032533 3300048916 Bacteria 3790
1738 Ga0496113_0056057 3300048916 Bacteria 2957
1739 Ga0496113_0107681 3300048916 Bacteria 2166
1740 Ga0496113_0119114 3300048916 Bacteria 2062
1741 Ga0496114_0033907 3300048917 Unclassified 4209
1742 Ga0496114_0048078 3300048917 Bacteria 3548
1743 Ga0496114_0517653 3300048917 Bacteria 1055
1744 Ga0496115_0000488 3300048918 Bacteria 31339
1745 Ga0496115_0002623 3300048918 Bacteria 12905
1746 Ga0496115_0069593 3300048918 Bacteria 2851
1747 Ga0496115_0302378 3300048918 Bacteria 1311
1748 Ga0496115_0492362 3300048918 Bacteria 986
1749 Ga0496116_0000035 3300048919 Bacteria 402424
1750 Ga0496117_0003304 3300048920 Bacteria 18866
1751 Ga0496117_0003615 3300048920 Bacteria 17814
1752 Ga0496117_0007605 3300048920 Bacteria 10528
1753 Ga0496117_0039575 3300048920 Bacteria 3477
1754 Ga0496117_0061024 3300048920 Bacteria 2594
1755 Ga0496117_0094746 3300048920 Bacteria 1910
1756 Ga0496117_0095736 3300048920 Bacteria 1896
1757 Ga0496118_0000855 3300048921 Bacteria 48305
1758 Ga0496118_0003803 3300048921 Bacteria 18599
1759 Ga0496118_0042759 3300048921 Bacteria 3570
1760 Ga0496118_0055355 3300048921 Bacteria 2994
1761 Ga0496118_0172868 3300048921 Bacteria 1317
1762 Ga0496119_0000928 3300048922 Bacteria 37926
1763 Ga0496119_0026186 3300048922 Bacteria 4050
1764 Ga0496120_0000668 3300048923 Bacteria 50396
1765 Ga0496120_0047655 3300048923 Bacteria 2470
1766 Ga0496120_0148217 3300048923 Bacteria 1182
1767 Ga0496121_0000175 3300048924 Bacteria 142910
1768 Ga0496121_0000312 3300048924 Bacteria 101230
1769 Ga0496121_0009343 3300048924 Bacteria 11299
1770 Ga0496121_0012998 3300048924 Bacteria 8997
1771 Ga0496121_0025370 3300048924 Bacteria 5627
1772 Ga0496122_0001715 3300048925 Bacteria 34006
1773 Ga0496122_0004533 3300048925 Bacteria 17136
1774 Ga0496122_0009956 3300048925 Bacteria 9901
1775 Ga0496122_0009978 3300048925 Bacteria 9887
1776 Ga0496122_0011300 3300048925 Bacteria 9065
1777 Ga0496122_0031446 3300048925 Bacteria 4417
1778 Ga0496123_0000518 3300048926 Bacteria 67308
1779 Ga0496123_0002019 3300048926 Bacteria 26197
1780 Ga0496123_0003213 3300048926 Bacteria 18627
1781 Ga0496123_0004657 3300048926 Bacteria 14241
1782 Ga0496123_0004960 3300048926 Bacteria 13639
1783 Ga0496123_0019762 3300048926 Bacteria 5296
1784 Ga0496124_0001659 3300048927 Bacteria 31806
1785 Ga0496124_0002396 3300048927 Bacteria 24661
1786 Ga0496124_0002918 3300048927 Bacteria 21559
1787 Ga0496124_0032910 3300048927 Bacteria 4570
1788 Ga0496124_0108951 3300048927 Bacteria 2233
1789 Ga0496124_0132985 3300048927 Bacteria 1974
1790 Ga0496124_0138649 3300048927 Bacteria 1922
1791 Ga0496125_0000445 3300048928 Bacteria 75404
1792 Ga0496125_0015492 3300048928 Bacteria 7368
1793 Ga0496125_0051107 3300048928 Bacteria 3412
1794 Ga0496125_0065170 3300048928 Bacteria 2889
1795 Ga0496125_0134658 3300048928 Bacteria 1731
1796 Ga0496125_0254882 3300048928 Bacteria 1104
1797 Ga0496126_0000084 3300048929 Bacteria 217111
1798 Ga0496126_0002967 3300048929 Bacteria 22043
1799 Ga0496126_0004125 3300048929 Bacteria 17579
1800 Ga0496126_0004926 3300048929 Bacteria 15584
1801 Ga0496126_0061377 3300048929 Bacteria 3377
1802 Ga0496126_0168250 3300048929 Bacteria 1869
1803 Ga0501306_003025 3300049127 Bacteria 1779
1804 Ga0501292_000042 3300049515 Bacteria 29474
1805 Ga0501294_000486 3300049517 Bacteria 4648
1806 Ga0501300_002184 3300049523 Bacteria 2917
1807 Ga0501300_003888 3300049523 Bacteria 2223
1808 Ga0501314_001059 3300049530 Bacteria 1897
1809 Ga0501315_002109 3300049531 Bacteria 1826
1810 Ga0501317_000383 3300049533 Bacteria 3007
1811 Ga0501317_002040 3300049533 Bacteria 1849
1812 Ga0501317_007458 3300049533 Bacteria 1235
1813 Ga0501322_000752 3300049538 Bacteria 1631
1814 Ga0501334_01319 3300049550 Bacteria 1352
1815 Ga0501335_000754 3300049551 Bacteria 2236
1816 Ga0501337_004439 3300049553 Bacteria 918
1817 Ga0501033_0031970 3300049570 Bacteria 3950
1818 Ga0501034_0032864 3300049571 Bacteria 5268
1819 Ga0501034_0110535 3300049571 Bacteria 2739
1820 Ga0501038_0013428 3300049574 Bacteria 7466
1821 Ga0501043_0077725 3300049579 Bacteria 2607
1822 Ga0501046_0377809 3300049580 Bacteria 1026
1823 Ga0501047_0096087 3300049581 Bacteria 2842
1824 Ga0501047_0322356 3300049581 Bacteria 1385
1825 Ga0501067_0010970 3300049583 Bacteria 5018
1826 Ga0501067_0033983 3300049583 Bacteria 2830
1827 Ga0501069_0160372 3300049585 Bacteria 1295
1828 Ga0501074_0604401 3300049590 Bacteria 776
1829 Ga0501206_001035 3300049653 Bacteria 3471
1830 Ga0501209_087797 3300049656 Bacteria 902
1831 Ga0501211_002141 3300049658 Bacteria 2101
1832 Ga0501217_014154 3300049661 Bacteria 1798
1833 Ga0501222_001125 3300049662 Bacteria 3791
1834 Ga0501223_000040 3300049663 Bacteria 45036
1835 Ga0501223_001502 3300049663 Bacteria 5379
1836 Ga0501224_000547 3300049664 Bacteria 4613
1837 Ga0501227_005914 3300049665 Bacteria 2624
1838 Ga0501233_004107 3300049668 Bacteria 2651
1839 Ga0501235_003519 3300049669 Bacteria 3387
1840 Ga0501235_005414 3300049669 Bacteria 2779
1841 Ga0501235_010556 3300049669 Bacteria 2018
1842 Ga0501235_014088 3300049669 Bacteria 1763
1843 Ga0501235_028025 3300049669 Bacteria 1265
1844 Ga0501240_001954 3300049673 Bacteria 2106
1845 Ga0501246_000435 3300049676 Bacteria 3033
1846 Ga0501257_000016 3300049686 Bacteria 49821
1847 Ga0501257_038348 3300049686 Bacteria 1171
1848 Ga0501259_003663 3300049688 Bacteria 2440
1849 Ga0501261_000888 3300049690 Bacteria 3710
1850 Ga0501221_003159 3300049704 Bacteria 2706
1851 Ga0501225_0000053 3300049705 Bacteria 39246
1852 Ga0501225_0002859 3300049705 Bacteria 5297
1853 Ga0501225_0024835 3300049705 Bacteria 1649
1854 Ga0501229_029699 3300049706 Bacteria 746
1855 Ga0501245_002123 3300049708 Bacteria 2634
1856 Ga0501245_018145 3300049708 Bacteria 1080
1857 Ga0501241_017473 3300049758 Bacteria 1310
1858 Ga0501262_003203 3300049759 Bacteria 1868
1859 Ga0501263_004581 3300049760 Bacteria 1531
1860 Ga0501272_001630 3300049769 Bacteria 2149
1861 Ga0501279_000010 3300049775 Bacteria 103375
1862 Ga0501280_000454 3300049776 Bacteria 9805
1863 Ga0501281_00264 3300049777 Bacteria 5566
1864 Ga0501283_006335 3300049779 Bacteria 1655
1865 Ga0501035_0014952 3300049822 Bacteria 7160
1866 Ga0501035_0370956 3300049822 Bacteria 1195
1867 Ga0501044_0021900 3300049823 Bacteria 6815
1868 Ga0501044_0415012 3300049823 Bacteria 1257
1869 nmdc:mga03683_39170_c1 3300050489 Bacteria 1939
1870 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
1871 nmdc:mga00v17_1542_c3 3300050491 Bacteria 3659
1872 nmdc:mga00v17_38485_c1 3300050491 Bacteria 2860
1873 nmdc:mga00v17_67014_c1 3300050491 Bacteria 2217
1874 nmdc:mga0k408_102718_c1 3300050493 Bacteria 1686
1875 nmdc:mga0k408_119665_c1 3300050493 Bacteria 1089
1876 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
1877 nmdc:mga06z11_204_c1 3300050494 Bacteria 23811
1878 nmdc:mga07m45_154229_c1 3300050496 Bacteria 1332
1879 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
1880 nmdc:mga07m45_5078_c1 3300050496 Bacteria 2553
1881 nmdc:mga07m45_53_c1 3300050496 Bacteria 50852
1882 nmdc:mga0qj67_90903_c1 3300050509 Bacteria 2453
1883 nmdc:mga08y16_23018_c1 3300050511 Bacteria 6577
1884 nmdc:mga08y16_439029_c1 3300050511 Bacteria 1332
1885 nmdc:mga08y16_493074_c1 3300050511 Bacteria 1245
1886 nmdc:mga0n895_27447_c1 3300050512 Bacteria 5408
1887 nmdc:mga0sz30_404_c1 3300050516 Bacteria 16465
1888 nmdc:mga0sz30_61144_c1 3300050516 Bacteria 1609
1889 Ga0500643_000381 3300053087 Bacteria 34648
1890 Ga0500643_000474 3300053087 Bacteria 29409
1891 Ga0500643_000974 3300053087 Bacteria 17711
1892 Ga0500643_002487 3300053087 Bacteria 9462
1893 Ga0500643_003402 3300053087 Bacteria 7679
1894 Ga0500643_004831 3300053087 Bacteria 5954
1895 Ga0500643_024706 3300053087 Bacteria 1904
1896 Ga0500643_033914 3300053087 Bacteria 1540
1897 Ga0500643_051825 3300053087 Bacteria 1171
1898 Ga0500651_0114443 3300053093 Bacteria 1643
1899 Ga0500566_0011688 3300053094 Bacteria 5170
1900 Ga0500566_0034909 3300053094 Bacteria 2923
1901 Ga0500650_0034419 3300053098 Bacteria 2315
1902 Ga0500555_000032 3300053103 Bacteria 97468
1903 Ga0500556_0000049 3300053104 Bacteria 122572
1904 Ga0500556_0004319 3300053104 Bacteria 4054
1905 Ga0500562_019537 3300053108 Bacteria 1753
1906 Ga0500592_000243 3300053116 Bacteria 9903
1907 Ga0500594_0057108 3300053118 Bacteria 1115
1908 Ga0500595_002004 3300053119 Bacteria 10438
1909 Ga0500607_001022 3300053121 Bacteria 26553
1910 Ga0500608_000489 3300053122 Bacteria 14841
1911 Ga0500618_002084 3300053125 Bacteria 7975
1912 Ga0500618_007779 3300053125 Bacteria 3032
1913 Ga0500618_015238 3300053125 Bacteria 1946
1914 Ga0500642_0000002 3300053130 Bacteria 795093
1915 Ga0500642_0000573 3300053130 Bacteria 11104
1916 Ga0500655_000364 3300053133 Bacteria 9786
1917 Ga0500658_0001729 3300053134 Bacteria 8640
1918 Ga0500559_0001213 3300053136 Bacteria 15293
1919 Ga0500559_0002216 3300053136 Bacteria 10268
1920 Ga0500559_0007095 3300053136 Bacteria 4998
1921 Ga0500559_0184649 3300053136 Bacteria 983
1922 Ga0500564_000978 3300053138 Bacteria 9309
1923 Ga0500568_0003198 3300053139 Bacteria 9310
1924 Ga0500568_0008749 3300053139 Bacteria 4855
1925 Ga0500573_0000065 3300053140 Bacteria 64628
1926 Ga0500590_000420 3300053148 Bacteria 14315
1927 Ga0500604_0000054 3300053151 Bacteria 41167
1928 Ga0500604_0002552 3300053151 Bacteria 4967
1929 Ga0500604_0010442 3300053151 Bacteria 2486
1930 Ga0500616_0000352 3300053153 Bacteria 65784
1931 Ga0500616_0016845 3300053153 Bacteria 4152
1932 Ga0500622_0148688 3300053156 Bacteria 1110
1933 Ga0500624_000084 3300053157 Bacteria 47961
1934 Ga0500624_000324 3300053157 Bacteria 16298
1935 Ga0500627_0001473 3300053158 Bacteria 6592
1936 Ga0500627_0104568 3300053158 Bacteria 1272
1937 Ga0500636_0009782 3300053177 Bacteria 5583
1938 Ga0500637_0005165 3300053178 Bacteria 6295
1939 Ga0500567_000681 3300053723 Bacteria 12398
1940 Ga0500570_000703 3300053724 Bacteria 13759
1941 Ga0500625_000039 3300053729 Bacteria 43868
1942 Ga0500645_000173 3300053730 Bacteria 50903
1943 Ga0500645_001421 3300053730 Bacteria 12187
1944 Ga0500645_004447 3300053730 Bacteria 5378
1945 Ga0500645_014668 3300053730 Bacteria 2493
1946 Ga0500601_005159 3300053737 Bacteria 1429
1947 Ga0500587_000206 3300053739 Bacteria 6217
1948 Ga0500661_000156 3300055283 Bacteria 11729
1949 Ga0587084_005868 3300059477 Bacteria 1470
1950 Ga0587084_008867 3300059477 Bacteria 1284
1951 Ga0587066_007812 3300059490 Bacteria 1465
1952 Ga0587070_033331 3300059491 Bacteria 947
1953 Ga0587077_002003 3300059493 Bacteria 2329
1954 Ga0587085_031811 3300059506 Bacteria 872
1955 Ga0587090_000907 3300059510 Bacteria 2767
1956 Ga0587090_005892 3300059510 Bacteria 1555
1957 Ga0587090_026896 3300059510 Bacteria 938
1958 Ga0587091_008696 3300059511 Bacteria 1507
1959 Ga0587106_003149 3300059605 Bacteria 1699
1960 Ga0587101_002333 3300059623 Bacteria 1795
1961 Ga0587109_012673 3300059624 Bacteria 1386
1962 Ga0587062_005604 3300059639 Bacteria 1394
1963 Ga0587062_006120 3300059639 Bacteria 1356
1964 Ga0587067_008117 3300059640 Bacteria 1524
1965 Ga0587068_007851 3300059641 Bacteria 1531
1966 Ga0587069_003920 3300059642 Bacteria 1644
1967 Ga0587072_003436 3300059643 Bacteria 2226
1968 Ga0587076_010442 3300059645 Bacteria 1342
1969 Ga0587076_018565 3300059645 Bacteria 1122
1970 Ga0587111_0011290 3300060346 Bacteria 1553
1971 Ga0466962_0096849 3300061719 Bacteria 1415
1972 2511126187 2510917021 Bacteria 5705459
1973 2512644928 2512564014 Bacteria 4639632
1974 2585259902 2582581305 Bacteria 4895574
1975 2600200661 2599185354 Bacteria 4398675
1976 2600225785 2599185359 Bacteria 4772316
1977 2643823529 2643221560 Bacteria 4801179
1978 2643948977 2643221588 Bacteria 3692460
1979 2738709490 2738541275 Bacteria 4830863
1980 2738847915 2738541301 Bacteria 4834102
1981 2738863644 2738541304 Bacteria 4833665
1982 2739296162 2738543022 Bacteria 4835059
1983 2739357840 2738543033 Bacteria 4833336
1984 2739649466 2739367664 Bacteria 4114334
1985 2740027939 2739367865 Bacteria 4114482
1986 2753765276 2751185897 Bacteria 5322941
1987 2778124422 2775507255 Bacteria 3945731
1988 2809064381 2808606401 Bacteria 4586670
1989 2809080454 2808606404 Bacteria 4652788
1990 2809084713 2808606405 Bacteria 4586632
1991 2819552659 2818991438 Bacteria 5793701
1992 2819716414 2818991466 Bacteria 4748179
1993 2848299145 2848297114 Bacteria 3608511
1994 2852655305 2852653556 Bacteria 4050083
1995 2852681098 2852680915 Bacteria 4100189
1996 2879165191 2879163058 Bacteria 4223965
1997 2880519154 2880518877 Bacteria 5012590
1998 2885427834 2885427238 Bacteria 2291351
1999 2896185106 2896184354 Bacteria 3258548
2000 2896255497 2896253425 Bacteria 3418029
2001 2919141176 2919138771 Bacteria 5281312
2002 2919713328 2919709256 Bacteria 4318106
2003 2928030464 2928027323 Bacteria 4382488
2004 2928102625 2928100450 Bacteria 4837635
2005 2928528778 2928526807 Bacteria 4760224
2006 2928959288 2928959182 Bacteria 4725774
2007 2928970333 2928968154 Bacteria 4633371
2008 2984557316 2984555340 Bacteria 4247089
2009 2990266899 2990265787 Bacteria 3943888
2010 2993359366 2993356040 Bacteria 4247105
2011 2993693844 2993693658 Bacteria 4040749
2012 3000865741 3000865235 Bacteria 3106258
2013 8054302643 8054302542 Bacteria 5698134
2014 8057104475 8057101203 Bacteria 5034064
2015 Ga0070670_100025942
2016 SwRhRL2b_contig_2373431
2017 SwRhRL2b_contig_3240803
2018 ARcpr5yngRDRAFT_c002310
2019 ARcpr5yngRDRAFT_c002397
2020 JGI24736J21556_1000024
2021 JGI24736J21556_1000894
2022 JGI24741J21665_1001581
2023 JGI24741J21665_1005779
2024 JGI24741J21665_1014952
2025 JGI24752J21851_1000048
2026 JGI24752J21851_1003668
2027 JGI24740J21852_10013244
2028 JGI24740J21852_10015928
2029 JGI24740J21852_10017907
2030 JGI24739J22299_10001507
2031 JGI24739J22299_10002125
2032 JGI24739J22299_10005863
2033 JGI24739J22299_10013077
2034 JGI24739J22299_10033675
2035 JGI24737J22298_10000013
2036 JGI24737J22298_10001009
2037 JGI24737J22298_10001298
2038 JGI24737J22298_10004537
2039 JGI24737J22298_10004568
2040 JGI24735J21928_10000956
2041 JGI24735J21928_10004910
2042 JGI24750J21931_1000042
2043 JGI24748J21848_1000063
2044 JGI24748J21848_1003743
2045 JGI24738J21930_10000465
2046 JGI24738J21930_10002029
2047 JGI24738J21930_10002782
2048 JGI24749J21850_1003782
2049 JGI24749J21850_1011040
2050 JGI24744J21845_10018508
2051 JGI24034J26672_10000007
2052 JGI24742J22300_10030958
2053 JGI24751J29686_10000403
2054 JGI24751J29686_10012533
2055 JGI25150J39212_1000452
2056 JGI25153J46596_10000028
2057 JGI25153J46596_10012957
2058 Ga0055526_1000478
2059 Ga0055537_1000941
2060 Ga0055524_1000457
2061 Ga0055536_1013568
2062 Ga0055530_10006631
2063 Ga0055540_1001525
2064 Ga0055531_10020476
2065 Ga0065165_1002415
2066 Ga0065165_1003218
2067 Ga0065165_1018400
2068 Ga0065704_10000222
2069 Ga0065704_10004971
2070 Ga0065704_10007669
2071 Ga0065704_10070636
2072 Ga0065704_10080687
2073 Ga0065704_10149602
2074 Ga0065712_10082469
2075 Ga0065712_10088469
2076 Ga0065712_10093077
2077 Ga0065712_10118555
2078 Ga0065712_10160270
2079 Ga0065712_10177062
2080 Ga0065712_10193525
2081 Ga0065712_10210627
2082 Ga0065712_10223652
2083 Ga0065715_10005958
2084 Ga0065715_10006570
2085 Ga0065715_10018753
2086 Ga0065715_10243137
2087 Ga0065715_10258268
2088 Ga0065715_10282226
2089 Ga0065715_10334563
2090 Ga0065707_10082480
2091 Ga0065707_10089384
2092 Ga0065707_10116477
2093 Ga0065707_10186858
2094 Ga0070658_10000033
2095 Ga0070658_10000450
2096 Ga0070658_10042460
2097 Ga0070658_10071309
2098 Ga0070658_10078982
2099 Ga0070658_10234508
2100 Ga0070658_10337144
2101 Ga0070658_10356516
2102 Ga0070658_10676806
2103 Ga0070676_10014750
2104 Ga0070676_10014961
2105 Ga0070676_10067228
2106 Ga0070683_100059705
2107 Ga0070683_100136330
2108 Ga0070690_100000110
2109 Ga0070690_100004829
2110 Ga0070690_100020417
2111 Ga0070690_100053095
2112 Ga0070690_100163954
2113 Ga0070690_100184473
2114 Ga0070670_100000125
2115 Ga0070670_100000333
2116 Ga0070670_100001778
2117 Ga0070670_100002586
2118 Ga0070670_100012077
2119 Ga0070670_100013439
2120 Ga0070670_100015489
2121 Ga0070670_100029264
2122 Ga0070670_100029441
2123 Ga0070670_100051457
2124 Ga0070670_100052537
2125 Ga0070670_100078442
2126 Ga0070670_100086470
2127 Ga0070670_100159477
2128 Ga0070670_100203684
2129 Ga0070670_100229536
2130 Ga0070670_100236887
2131 Ga0070670_100496537
2132 Ga0070677_10001545
2133 Ga0070677_10001946
2134 Ga0070677_10011715
2135 Ga0070677_10047149
2136 Ga0070677_10098879
2137 Ga0068869_100000237
2138 Ga0068869_100189511
2139 Ga0068869_100262403
2140 Ga0070666_10000417
2141 Ga0070666_10000676
2142 Ga0070666_10003972
2143 Ga0070666_10006036
2144 Ga0070666_10006758
2145 Ga0070666_10014173
2146 Ga0070666_10052740
2147 Ga0070666_10054102
2148 Ga0070666_10067242
2149 Ga0070666_10083831
2150 Ga0070666_10087865
2151 Ga0070666_10108440
2152 Ga0070666_10127509
2153 Ga0070682_100083698
2154 Ga0068868_100000122
2155 Ga0068868_100001091
2156 Ga0068868_100005075
2157 Ga0068868_100006917
2158 Ga0068868_100258934
2159 Ga0068868_100278324
2160 Ga0070660_100000521
2161 Ga0070660_100001018
2162 Ga0070660_100001039
2163 Ga0070660_100012193
2164 Ga0070660_100022443
2165 Ga0070660_100031061
2166 Ga0070660_100057483
2167 Ga0070660_100076306
2168 Ga0070660_100161037
2169 Ga0070660_100223256
2170 Ga0070660_100467001
2171 Ga0070689_100006341
2172 Ga0070689_100088407
2173 Ga0070687_100132272
2174 Ga0070661_100000189
2175 Ga0070661_100011834
2176 Ga0070661_100015278
2177 Ga0070661_100033583
2178 Ga0070661_100039406
2179 Ga0070661_100048565
2180 Ga0070661_100055642
2181 Ga0070661_100059752
2182 Ga0070661_100073323
2183 Ga0070661_100106867
2184 Ga0070661_100126139
2185 Ga0070692_10100948
2186 Ga0070692_10183445
2187 Ga0070668_100000240
2188 Ga0070668_100004440
2189 Ga0070668_100008123
2190 Ga0070668_100011693
2191 Ga0070668_100061502
2192 Ga0070668_100063714
2193 Ga0070668_100075481
2194 Ga0070668_100197650
2195 Ga0070668_100289955
2196 Ga0070668_100393140
2197 Ga0070669_100000018
2198 Ga0070669_100000319
2199 Ga0070669_100000332
2200 Ga0070669_100000421
2201 Ga0070669_100007923
2202 Ga0070669_100011907
2203 Ga0070669_100036616
2204 Ga0070669_100089598
2205 Ga0070669_100373508
2206 Ga0070675_100001409
2207 Ga0070675_100002655
2208 Ga0070675_100003126
2209 Ga0070675_100021791
2210 Ga0070675_100026876
2211 Ga0070675_100091721
2212 Ga0070675_100133004
2213 Ga0070675_100145506
2214 Ga0070675_100152366
2215 Ga0070675_100163368
2216 Ga0070675_100201155
2217 Ga0070671_100000011
2218 Ga0070671_100000356
2219 Ga0070671_100000499
2220 Ga0070671_100000884
2221 Ga0070671_100001310
2222 Ga0070671_100002896
2223 Ga0070671_100002925
2224 Ga0070671_100004838
2225 Ga0070671_100005998
2226 Ga0070671_100008440
2227 Ga0070671_100009391
2228 Ga0070671_100014649
2229 Ga0070671_100019425
2230 Ga0070671_100028054
2231 Ga0070671_100030482
2232 Ga0070671_100044108
2233 Ga0070671_100047259
2234 Ga0070671_100052754
2235 Ga0070671_100061374
2236 Ga0070671_100074596
2237 Ga0070671_100075715
2238 Ga0070671_100078812
2239 Ga0070671_100081221
2240 Ga0070671_100088570
2241 Ga0070671_100132006
2242 Ga0070671_100160893
2243 Ga0070671_100183576
2244 Ga0070671_100215263
2245 Ga0070671_100348675
2246 Ga0070671_100612328
2247 Ga0070674_100014686
2248 Ga0070674_100019587
2249 Ga0070674_100022907
2250 Ga0070674_100024081
2251 Ga0070673_100000113
2252 Ga0070673_100000300
2253 Ga0070673_100010659
2254 Ga0070673_100010748
2255 Ga0070673_100017136
2256 Ga0070673_100022961
2257 Ga0070673_100031959
2258 Ga0070673_100049806
2259 Ga0070673_100053601
2260 Ga0070673_100097735
2261 Ga0070673_100121797
2262 Ga0070673_100254267
2263 Ga0070673_100308737
2264 Ga0070673_100371098
2265 Ga0070673_100542636
2266 Ga0070673_100561120
2267 Ga0070688_100003977
2268 Ga0070659_100000032
2269 Ga0070659_100003411
2270 Ga0070659_100009984
2271 Ga0070659_100015331
2272 Ga0070659_100016094
2273 Ga0070659_100029044
2274 Ga0070659_100037070
2275 Ga0070659_100050930
2276 Ga0070659_100057371
2277 Ga0070659_100080529
2278 Ga0070659_100085498
2279 Ga0070659_100089581
2280 Ga0070659_100098113
2281 Ga0070659_100315935
2282 Ga0070667_100000067
2283 Ga0070667_100000089
2284 Ga0070667_100000261
2285 Ga0070667_100001008
2286 Ga0070667_100001137
2287 Ga0070667_100001520
2288 Ga0070667_100003895
2289 Ga0070667_100007223
2290 Ga0070667_100010244
2291 Ga0070667_100012492
2292 Ga0070667_100015024
2293 Ga0070667_100020274
2294 Ga0070667_100023912
2295 Ga0070667_100035579
2296 Ga0070667_100045987
2297 Ga0070667_100138763
2298 Ga0070667_100159829
2299 Ga0070667_100168236
2300 Ga0070667_100173332
2301 Ga0070667_100179058
2302 Ga0070667_100421899
2303 Ga0070713_100059809
2304 Ga0070710_10301363
2305 Ga0070701_10015542
2306 Ga0070711_100038436
2307 Ga0070700_100145153
2308 Ga0070663_100003135
2309 Ga0070663_100008334
2310 Ga0070663_100023406
2311 Ga0070663_100025649
2312 Ga0070663_100027770
2313 Ga0070663_100031033
2314 Ga0070663_100074842
2315 Ga0070663_100240729
2316 Ga0070663_100244673
2317 Ga0070663_100457887
2318 Ga0070678_100008369
2319 Ga0070678_100016001
2320 Ga0070678_100016815
2321 Ga0070678_100054824
2322 Ga0070678_100106622
2323 Ga0070678_100107671
2324 Ga0070678_100319178
2325 Ga0070678_100515892
2326 Ga0070662_100001355
2327 Ga0070662_100006282
2328 Ga0070662_100012806
2329 Ga0070662_100014394
2330 Ga0070662_100018571
2331 Ga0070662_100018704
2332 Ga0070662_100028342
2333 Ga0070662_100037861
2334 Ga0070662_100049488
2335 Ga0070662_100068924
2336 Ga0070662_100070505
2337 Ga0070662_100071576
2338 Ga0070662_100075743
2339 Ga0070662_100079880
2340 Ga0070662_100082084
2341 Ga0070662_100090727
2342 Ga0070662_100192360
2343 Ga0070662_100294000
2344 Ga0070662_100301571
2345 Ga0070681_10391235
2346 Ga0068867_100001291
2347 Ga0068867_100003727
2348 Ga0068867_100011300
2349 Ga0068867_100015079
2350 Ga0068867_100027370
2351 Ga0068867_100323198
2352 Ga0070685_10001239
2353 Ga0070685_10042572
2354 Ga0070685_10350626
2355 Ga0070679_100000019
2356 Ga0070679_100179814
2357 Ga0070684_100106919
2358 Ga0070684_100513986
2359 Ga0068853_100003210
2360 Ga0068853_100004246
2361 Ga0068853_100015290
2362 Ga0068853_100016799
2363 Ga0068853_100065729
2364 Ga0068853_100570741
2365 Ga0070672_100000668
2366 Ga0070672_100003275
2367 Ga0070672_100022559
2368 Ga0070672_100029021
2369 Ga0070672_100038782
2370 Ga0070672_100071810
2371 Ga0070672_100174384
2372 Ga0070672_100236100
2373 Ga0070672_100342632
2374 Ga0070686_100000045
2375 Ga0070686_100000526
2376 Ga0070686_100014525
2377 Ga0070686_100050543
2378 Ga0070696_100004394
2379 Ga0070693_100017586
2380 Ga0070693_100066901
2381 Ga0070665_100000042
2382 Ga0070665_100000089
2383 Ga0070665_100000195
2384 Ga0070665_100000319
2385 Ga0070665_100000785
2386 Ga0070665_100006145
2387 Ga0070665_100017694
2388 Ga0070665_100043566
2389 Ga0070665_100045299
2390 Ga0070665_100065445
2391 Ga0070665_100086216
2392 Ga0070665_100185646
2393 Ga0070665_100445100
2394 Ga0070665_100447304
2395 Ga0068855_100250516
2396 Ga0068855_100576541
2397 Ga0068855_100581624
2398 Ga0070664_100002420
2399 Ga0070664_100003416
2400 Ga0070664_100003923
2401 Ga0070664_100004556
2402 Ga0070664_100005620
2403 Ga0070664_100009795
2404 Ga0070664_100033345
2405 Ga0070664_100042865
2406 Ga0070664_100089834
2407 Ga0070664_100153901
2408 Ga0070664_100167731
2409 Ga0070664_100178032
2410 Ga0070664_100197637
2411 Ga0070664_100247559
2412 Ga0068857_100000246
2413 Ga0068857_100022941
2414 Ga0068857_100038715
2415 Ga0068857_100039894
2416 Ga0068857_100055371
2417 Ga0068857_100063783
2418 Ga0068857_100167621
2419 Ga0068857_100197369
2420 Ga0068857_100367189
2421 Ga0068857_100369914
2422 Ga0068857_100413912
2423 Ga0068854_100000337
2424 Ga0068854_100002354
2425 Ga0068854_100004453
2426 Ga0068854_100016873
2427 Ga0068854_100020055
2428 Ga0068854_100027186
2429 Ga0068854_100062081
2430 Ga0068854_100087993
2431 Ga0068854_100434772
2432 Ga0068854_100726430
2433 Ga0068856_100010754
2434 Ga0068856_100048193
2435 Ga0068856_100261898
2436 Ga0068852_100002096
2437 Ga0068852_100024440
2438 Ga0068852_100046560
2439 Ga0068852_100058884
2440 Ga0068852_100067394
2441 Ga0068852_100121525
2442 Ga0068852_100167825
2443 Ga0068852_100173499
2444 Ga0068852_100192935
2445 Ga0068852_100299961
2446 Ga0068852_100378888
2447 Ga0068859_100000689
2448 Ga0068859_100001164
2449 Ga0068859_100016217
2450 Ga0068859_100037559
2451 Ga0068859_100064861
2452 Ga0068859_100101995
2453 Ga0068859_100217336
2454 Ga0068859_100257482
2455 Ga0068859_100475868
2456 Ga0068864_100000098
2457 Ga0068864_100000713
2458 Ga0068864_100000764
2459 Ga0068864_100001740
2460 Ga0068864_100003303
2461 Ga0068864_100003505
2462 Ga0068864_100005845
2463 Ga0068864_100009867
2464 Ga0068864_100010212
2465 Ga0068864_100025846
2466 Ga0068864_100026270
2467 Ga0068864_100033224
2468 Ga0068864_100033807
2469 Ga0068864_100172246
2470 Ga0068864_100452560
2471 Ga0068864_100538256
2472 Ga0068866_10025209
2473 Ga0068861_100000965
2474 Ga0068861_100002114
2475 Ga0068861_100005488
2476 Ga0068861_100024325
2477 Ga0068861_100227883
2478 Ga0068851_10004263
2479 Ga0068851_10008936
2480 Ga0068851_10025204
2481 Ga0068851_10160235
2482 Ga0068870_10115804
2483 Ga0068870_10151832
2484 Ga0068863_100000001
2485 Ga0068863_100000038
2486 Ga0068863_100000063
2487 Ga0068863_100000127
2488 Ga0068863_100000280
2489 Ga0068863_100002103
2490 Ga0068863_100002105
2491 Ga0068863_100003894
2492 Ga0068863_100006391
2493 Ga0068863_100016297
2494 Ga0068863_100024705
2495 Ga0068863_100027733
2496 Ga0068863_100032298
2497 Ga0068863_100032822
2498 Ga0068863_100070455
2499 Ga0068863_100097598
2500 Ga0068863_100157129
2501 Ga0068858_100001032
2502 Ga0068858_100001398
2503 Ga0068858_100001407
2504 Ga0068858_100024878
2505 Ga0068858_100026940
2506 Ga0068858_100029006
2507 Ga0068858_100043741
2508 Ga0068858_100076726
2509 Ga0068858_100081039
2510 Ga0068858_100100293
2511 Ga0068858_100100369
2512 Ga0068858_100112533
2513 Ga0068858_100136890
2514 Ga0068858_100283853
2515 Ga0068860_100000008
2516 Ga0068860_100000148
2517 Ga0068860_100000182
2518 Ga0068860_100004003
2519 Ga0068860_100009788
2520 Ga0068860_100013876
2521 Ga0068860_100039467
2522 Ga0068860_100057702
2523 Ga0068860_100061998
2524 Ga0068860_100066553
2525 Ga0068860_100255839
2526 Ga0068860_100386012
2527 Ga0068860_100497677
2528 Ga0068862_100000133
2529 Ga0068862_100000308
2530 Ga0068862_100000543
2531 Ga0068862_100001324
2532 Ga0068862_100001693
2533 Ga0068862_100010712
2534 Ga0068862_100033955
2535 Ga0068862_100036543
2536 Ga0068862_100082265
2537 Ga0068862_100093340
2538 Ga0068862_100172255
2539 Ga0068862_100230793
2540 Ga0068862_100557699
2541 Ga0081455_10000187
2542 Ga0081455_10140246
2543 Ga0081538_10144448
2544 Ga0081540_1072233
2545 Ga0081539_10012087
2546 Ga0075365_10010968
2547 Ga0075368_10002950
2548 Ga0075363_100023909
2549 Ga0075364_10039882
2550 Ga0075364_10048589
2551 Ga0075432_10001783
2552 Ga0070712_100008962
2553 Ga0075362_10000006
2554 Ga0075362_10011696
2555 Ga0075367_10000008
2556 Ga0075367_10000771
2557 Ga0075369_10018821
2558 Ga0075366_10000394
2559 Ga0075366_10097161
2560 Ga0075366_10130738
2561 Ga0075366_10152353
2562 Ga0075366_10299303
2563 Ga0097621_100134928
2564 Ga0097621_100159472
2565 Ga0075370_10000005
2566 Ga0075370_10018602
2567 Ga0075370_10023684
2568 Ga0075370_10041302
2569 Ga0075370_10071400
2570 Ga0075370_10294902
2571 Ga0068871_100044840
2572 Ga0068871_100086210
2573 Ga0068871_100117985
2574 Ga0068871_100206546
2575 Ga0068871_100355010
2576 Ga0075430_100040948
2577 Ga0075434_100212640
2578 Ga0068865_100000374
2579 Ga0068865_100001644
2580 Ga0097620_100000689
2581 Ga0097620_100001164
2582 Ga0097620_100005488
2583 Ga0097620_100016219
2584 Ga0097620_100037559
2585 Ga0097620_100064861
2586 Ga0097620_100101993
2587 Ga0097620_100217347
2588 Ga0097620_100257479
2589 Ga0097620_100475860
2590 Ga0075435_100383554
2591 Ga0105251_10003236
2592 Ga0105251_10006607
2593 Ga0105251_10021929
2594 Ga0105251_10120967
2595 Ga0105250_10009124
2596 Ga0105250_10111883
2597 Ga0105240_10029132
2598 Ga0111539_10033582
2599 Ga0111539_10391531
2600 Ga0111539_10516094
2601 Ga0105245_10000275
2602 Ga0105245_10016442
2603 Ga0105245_10083269
2604 Ga0105245_10109571
2605 Ga0105245_10347077
2606 Ga0105247_10001942
2607 Ga0105247_10011194
2608 Ga0105247_10071249
2609 Ga0105247_10079231
2610 Ga0105247_10393315
2611 Ga0105243_10014560
2612 Ga0105243_10186412
2613 Ga0105241_10016657
2614 Ga0105241_10698525
2615 Ga0105242_10235765
2616 Ga0105248_10001002
2617 Ga0105248_10001403
2618 Ga0105248_10001965
2619 Ga0105248_10003027
2620 Ga0105248_10005405
2621 Ga0105248_10005700
2622 Ga0105248_10006421
2623 Ga0105248_10008541
2624 Ga0105248_10009274
2625 Ga0105248_10012003
2626 Ga0105248_10013496
2627 Ga0105248_10013676
2628 Ga0105248_10022196
2629 Ga0105248_10034272
2630 Ga0105248_10042302
2631 Ga0105248_10047594
2632 Ga0105248_10057189
2633 Ga0105248_10058159
2634 Ga0105248_10098913
2635 Ga0105248_10120281
2636 Ga0105248_10144286
2637 Ga0105248_10156923
2638 Ga0105248_10160618
2639 Ga0105248_10166711
2640 Ga0105248_10211019
2641 Ga0105248_10322256
2642 Ga0105248_10419741
2643 Ga0105248_10993465
2644 Ga0105237_10148496
2645 Ga0105237_10412435
2646 Ga0105238_10043518
2647 Ga0105238_10152221
2648 Ga0105238_10201835
2649 Ga0105238_10325014
2650 Ga0105238_10344119
2651 Ga0105238_10345599
2652 Ga0105249_10000012
2653 Ga0105249_10000015
2654 Ga0105249_10000116
2655 Ga0105249_10001380
2656 Ga0105249_10006062
2657 Ga0105249_10048489
2658 Ga0105249_10101523
2659 Ga0105249_10127151
2660 Ga0105148_100034
2661 Ga0105239_10893646
2662 Ga0105246_10073371
2663 Ga0105246_10148737
2664 Ga0157373_10028185
2665 Ga0157373_10031420
2666 Ga0157373_10077816
2667 Ga0157373_10095623
2668 Ga0157373_10100257
2669 Ga0157373_10119728
2670 Ga0157373_10187991
2671 Ga0157373_10262063
2672 Ga0157371_10000637
2673 Ga0157371_10080987
2674 Ga0157371_10498472
2675 Ga0157370_10055122
2676 Ga0157370_10197093
2677 Ga0157369_10005661
2678 Ga0157369_10037584
2679 Ga0157374_10203983
2680 Ga0157374_10276447
2681 Ga0157378_10011608
2682 Ga0157378_10023980
2683 Ga0157378_10025514
2684 Ga0157378_10050299
2685 Ga0157378_10063086
2686 Ga0157378_10097008
2687 Ga0157378_10181343
2688 Ga0163162_10006001
2689 Ga0163162_10019524
2690 Ga0163162_10030175
2691 Ga0163162_10074201
2692 Ga0163162_10118832
2693 Ga0163162_10145916
2694 Ga0163162_10167088
2695 Ga0163162_10260008
2696 Ga0163162_10344263
2697 Ga0163162_10351276
2698 Ga0163162_10559005
2699 Ga0157372_10012231
2700 Ga0157372_10018134
2701 Ga0157372_10100537
2702 Ga0157372_10130571
2703 Ga0157372_10233796
2704 Ga0157372_10592026
2705 Ga0157372_10990163
2706 Ga0157372_11227584
2707 Ga0157375_10012598
2708 Ga0157375_10021073
2709 Ga0157375_10033612
2710 Ga0157375_10060400
2711 Ga0157375_10161062
2712 Ga0157375_10236474
2713 Ga0157375_10500687
2714 Ga0157375_10840585
2715 Ga0163163_10000991
2716 Ga0163163_10013315
2717 Ga0163163_10048754
2718 Ga0163163_10073655
2719 Ga0163163_10244188
2720 Ga0157380_10000151
2721 Ga0157380_10002954
2722 Ga0157380_10010723
2723 Ga0157380_10021843
2724 Ga0157380_10032670
2725 Ga0157380_10046302
2726 Ga0157380_10171626
2727 Ga0157377_10112943
2728 Ga0157377_10155302
2729 Ga0157379_10001787
2730 Ga0157379_10003144
2731 Ga0157379_10032029
2732 Ga0157379_10075276
2733 Ga0157379_10177479
2734 Ga0157379_10185964
2735 Ga0157379_10242412
2736 Ga0157376_10011982
2737 Ga0163161_10000202
2738 Ga0163161_10008736
2739 Ga0163161_10092128
2740 Ga0163161_10185132
2741 Ga0163161_10391341
2742 Ga0213873_10000007
2743 Ga0213876_10000005
2744 Ga0213876_10000310
2745 Ga0213875_10000460
2746 Ga0209436_115525
2747 Ga0207672_1001078
2748 Ga0209147_100573
2749 Ga0207425_1000005
2750 Ga0209129_1000825
2751 Ga0209565_1000007
2752 Ga0209565_1013651
2753 Ga0209673_1003508
2754 Ga0207673_1004992
2755 Ga0207673_1009775
2756 Ga0209675_1012946
2757 Ga0209676_1007137
2758 Ga0209676_1030091
2759 Ga0209025_1000296
2760 Ga0209564_1002668
2761 Ga0209564_1029926
2762 Ga0209758_1000002
2763 Ga0209758_1007072
2764 Ga0209050_1000005
2765 Ga0209050_1000119
2766 Ga0209050_1000196
2767 Ga0209256_1000009
2768 Ga0209051_1000153
2769 Ga0209257_1018969
2770 Ga0207697_10000112
2771 Ga0207697_10000184
2772 Ga0207697_10003055
2773 Ga0207697_10012939
2774 Ga0207697_10016926
2775 Ga0207697_10052980
2776 Ga0207656_10006655
2777 Ga0207656_10010153
2778 Ga0207656_10012184
2779 Ga0207656_10015878
2780 Ga0207656_10017245
2781 Ga0207696_1002415
2782 Ga0207696_1037019
2783 Ga0207713_1002886
2784 Ga0207713_1003622
2785 Ga0207713_1006188
2786 Ga0207713_1087456
2787 Ga0207682_10002710
2788 Ga0207682_10002860
2789 Ga0207682_10002893
2790 Ga0207682_10014144
2791 Ga0207682_10015047
2792 Ga0207682_10015327
2793 Ga0207642_10015476
2794 Ga0207710_10001597
2795 Ga0207710_10009552
2796 Ga0207710_10047974
2797 Ga0207688_10008979
2798 Ga0207688_10029435
2799 Ga0207688_10093816
2800 Ga0207688_10114629
2801 Ga0207688_10177804
2802 Ga0207680_10000012
2803 Ga0207680_10000271
2804 Ga0207680_10000692
2805 Ga0207680_10001034
2806 Ga0207680_10008180
2807 Ga0207680_10011756
2808 Ga0207680_10017042
2809 Ga0207680_10044831
2810 Ga0207680_10052973
2811 Ga0207680_10072919
2812 Ga0207680_10161883
2813 Ga0207680_10378752
2814 Ga0207647_10000101
2815 Ga0207647_10001349
2816 Ga0207647_10001622
2817 Ga0207647_10002227
2818 Ga0207647_10002787
2819 Ga0207647_10021433
2820 Ga0207647_10052249
2821 Ga0207645_10006401
2822 Ga0207645_10043390
2823 Ga0207645_10064820
2824 Ga0207645_10071597
2825 Ga0207645_10185867
2826 Ga0207643_10110725
2827 Ga0207643_10153402
2828 Ga0207643_10156445
2829 Ga0207643_10163656
2830 Ga0207705_10000002
2831 Ga0207705_10000004
2832 Ga0207705_10001792
2833 Ga0207705_10043949
2834 Ga0207705_10047919
2835 Ga0207705_10107495
2836 Ga0207705_10191879
2837 Ga0207705_10211405
2838 Ga0207705_10345878
2839 Ga0207705_10470606
2840 Ga0207654_10000293
2841 Ga0207654_10006254
2842 Ga0207707_10267570
2843 Ga0207695_10000641
2844 Ga0207695_10066037
2845 Ga0207695_10116258
2846 Ga0207671_10002738
2847 Ga0207671_10014014
2848 Ga0207671_10085637
2849 Ga0207693_10016182
2850 Ga0207693_10076342
2851 Ga0207662_10148146
2852 Ga0207657_10002315
2853 Ga0207657_10003599
2854 Ga0207657_10009014
2855 Ga0207657_10009396
2856 Ga0207657_10009606
2857 Ga0207657_10012152
2858 Ga0207657_10017890
2859 Ga0207657_10023348
2860 Ga0207657_10024089
2861 Ga0207657_10165042
2862 Ga0207657_10213159
2863 Ga0207657_10248779
2864 Ga0207657_10347713
2865 Ga0207657_10446514
2866 Ga0207649_10000055
2867 Ga0207649_10008987
2868 Ga0207649_10010035
2869 Ga0207649_10066067
2870 Ga0207649_10070774
2871 Ga0207649_10076304
2872 Ga0207649_10086671
2873 Ga0207649_10116498
2874 Ga0207649_10328363
2875 Ga0207649_10455824
2876 Ga0207652_10000004
2877 Ga0207652_10042570
2878 Ga0207652_10281166
2879 Ga0207681_10000008
2880 Ga0207681_10000076
2881 Ga0207681_10000579
2882 Ga0207681_10001675
2883 Ga0207681_10003109
2884 Ga0207681_10007354
2885 Ga0207681_10010287
2886 Ga0207681_10084788
2887 Ga0207681_10129932
2888 Ga0207681_10131678
2889 Ga0207681_10355329
2890 Ga0207681_10370075
2891 Ga0207694_10013257
2892 Ga0207694_10050373
2893 Ga0207694_10122805
2894 Ga0207694_10133165
2895 Ga0207650_10000197
2896 Ga0207650_10004712
2897 Ga0207650_10004787
2898 Ga0207650_10009314
2899 Ga0207650_10010457
2900 Ga0207650_10013566
2901 Ga0207650_10022713
2902 Ga0207650_10025718
2903 Ga0207650_10030790
2904 Ga0207650_10037530
2905 Ga0207650_10041602
2906 Ga0207650_10071366
2907 Ga0207650_10076224
2908 Ga0207650_10077426
2909 Ga0207650_10084652
2910 Ga0207650_10120308
2911 Ga0207650_10135401
2912 Ga0207650_10138970
2913 Ga0207650_10158687
2914 Ga0207650_10176501
2915 Ga0207659_10007823
2916 Ga0207659_10009896
2917 Ga0207659_10011067
2918 Ga0207659_10045260
2919 Ga0207659_10052395
2920 Ga0207659_10120505
2921 Ga0207659_10145364
2922 Ga0207659_10149069
2923 Ga0207659_10213311
2924 Ga0207687_10003507
2925 Ga0207687_10010460
2926 Ga0207687_10049095
2927 Ga0207687_10177467
2928 Ga0207644_10000006
2929 Ga0207644_10000025
2930 Ga0207644_10000453
2931 Ga0207644_10000794
2932 Ga0207644_10001261
2933 Ga0207644_10001803
2934 Ga0207644_10002807
2935 Ga0207644_10005844
2936 Ga0207644_10006124
2937 Ga0207644_10008227
2938 Ga0207644_10009935
2939 Ga0207644_10010141
2940 Ga0207644_10010231
2941 Ga0207644_10016335
2942 Ga0207644_10031171
2943 Ga0207644_10036210
2944 Ga0207644_10044592
2945 Ga0207644_10077958
2946 Ga0207644_10078484
2947 Ga0207644_10092933
2948 Ga0207644_10095443
2949 Ga0207644_10103773
2950 Ga0207644_10224558
2951 Ga0207644_10299577
2952 Ga0207644_10333420
2953 Ga0207644_10653399
2954 Ga0207690_10000001
2955 Ga0207690_10002439
2956 Ga0207690_10004274
2957 Ga0207690_10007038
2958 Ga0207690_10024491
2959 Ga0207690_10025490
2960 Ga0207690_10056101
2961 Ga0207690_10126061
2962 Ga0207690_10128735
2963 Ga0207690_10150688
2964 Ga0207690_10204941
2965 Ga0207690_10303644
2966 Ga0207690_10317425
2967 Ga0207706_10000318
2968 Ga0207706_10000675
2969 Ga0207706_10003641
2970 Ga0207706_10004065
2971 Ga0207706_10005063
2972 Ga0207706_10008846
2973 Ga0207706_10017119
2974 Ga0207706_10020764
2975 Ga0207706_10024717
2976 Ga0207706_10028692
2977 Ga0207706_10044565
2978 Ga0207706_10051318
2979 Ga0207706_10055130
2980 Ga0207706_10059182
2981 Ga0207706_10069755
2982 Ga0207706_10073129
2983 Ga0207706_10080685
2984 Ga0207706_10111662
2985 Ga0207706_10111996
2986 Ga0207706_10115562
2987 Ga0207706_10117686
2988 Ga0207706_10158234
2989 Ga0207706_10266908
2990 Ga0207706_10325696
2991 Ga0207706_10336333
2992 Ga0207706_10412427
2993 Ga0207670_10007495
2994 Ga0207670_10350114
2995 Ga0207669_10007355
2996 Ga0207669_10007557
2997 Ga0207669_10022561
2998 Ga0207669_10070617
2999 Ga0207669_10089478
3000 Ga0207669_10127963
3001 Ga0207669_10203519
3002 Ga0207669_10477195
3003 Ga0207704_10014390
3004 Ga0207704_10030456
3005 Ga0207704_10033210
3006 Ga0207704_10058324
3007 Ga0207691_10000593
3008 Ga0207691_10003690
3009 Ga0207691_10004884
3010 Ga0207691_10014167
3011 Ga0207691_10015349
3012 Ga0207691_10045151
3013 Ga0207691_10056670
3014 Ga0207691_10067689
3015 Ga0207691_10069392
3016 Ga0207691_10070818
3017 Ga0207691_10075702
3018 Ga0207691_10139222
3019 Ga0207691_10198801
3020 Ga0207691_10220095
3021 Ga0207691_10246766
3022 Ga0207711_10000022
3023 Ga0207711_10000044
3024 Ga0207711_10000345
3025 Ga0207711_10000823
3026 Ga0207711_10002723
3027 Ga0207711_10003182
3028 Ga0207711_10006131
3029 Ga0207711_10010116
3030 Ga0207711_10012451
3031 Ga0207711_10014630
3032 Ga0207711_10016515
3033 Ga0207711_10019926
3034 Ga0207711_10022570
3035 Ga0207711_10025579
3036 Ga0207711_10036894
3037 Ga0207711_10054000
3038 Ga0207711_10107496
3039 Ga0207711_10122380
3040 Ga0207711_10157228
3041 Ga0207711_10185452
3042 Ga0207711_10206413
3043 Ga0207711_10218957
3044 Ga0207711_10252566
3045 Ga0207711_10295136
3046 Ga0207689_10000016
3047 Ga0207689_10079707
3048 Ga0207689_10135332
3049 Ga0207689_10384671
3050 Ga0207689_10674141
3051 Ga0207661_10140596
3052 Ga0207661_10316408
3053 Ga0207661_10324075
3054 Ga0207661_10490795
3055 Ga0207679_10004997
3056 Ga0207679_10010889
3057 Ga0207679_10027466
3058 Ga0207679_10056021
3059 Ga0207679_10068536
3060 Ga0207679_10101249
3061 Ga0207679_10106790
3062 Ga0207679_10121592
3063 Ga0207679_10156695
3064 Ga0207679_10205756
3065 Ga0207679_10374861
3066 Ga0207679_10407426
3067 Ga0207679_10483266
3068 Ga0207667_10006099
3069 Ga0207667_10007726
3070 Ga0207651_10000166
3071 Ga0207651_10000590
3072 Ga0207651_10003207
3073 Ga0207651_10004463
3074 Ga0207651_10006297
3075 Ga0207651_10047482
3076 Ga0207651_10092700
3077 Ga0207651_10105132
3078 Ga0207651_10160670
3079 Ga0207651_10201199
3080 Ga0207651_10237846
3081 Ga0207651_10287616
3082 Ga0207651_10361962
3083 Ga0207651_10411592
3084 Ga0207651_10483773
3085 Ga0207712_10000021
3086 Ga0207712_10000023
3087 Ga0207712_10000310
3088 Ga0207712_10006709
3089 Ga0207712_10009274
3090 Ga0207712_10011792
3091 Ga0207712_10048073
3092 Ga0207668_10000111
3093 Ga0207668_10000306
3094 Ga0207668_10000706
3095 Ga0207668_10003689
3096 Ga0207668_10006604
3097 Ga0207668_10013948
3098 Ga0207668_10017259
3099 Ga0207668_10054408
3100 Ga0207668_10096005
3101 Ga0207668_10160370
3102 Ga0207668_10175708
3103 Ga0207668_10202995
3104 Ga0207668_10280535
3105 Ga0207668_10293806
3106 Ga0207668_10309379
3107 Ga0207640_10008310
3108 Ga0207640_10010235
3109 Ga0207640_10023263
3110 Ga0207640_10034561
3111 Ga0207640_10036210
3112 Ga0207640_10129970
3113 Ga0207640_10324294
3114 Ga0207640_10478423
3115 Ga0207640_10589287
3116 Ga0207658_10000069
3117 Ga0207658_10000089
3118 Ga0207658_10000143
3119 Ga0207658_10001109
3120 Ga0207658_10001417
3121 Ga0207658_10002034
3122 Ga0207658_10002505
3123 Ga0207658_10003067
3124 Ga0207658_10004197
3125 Ga0207658_10008803
3126 Ga0207658_10016750
3127 Ga0207658_10035837
3128 Ga0207658_10038177
3129 Ga0207658_10040712
3130 Ga0207658_10049038
3131 Ga0207658_10051001
3132 Ga0207658_10058980
3133 Ga0207658_10061287
3134 Ga0207658_10100991
3135 Ga0207658_10125541
3136 Ga0207658_10133618
3137 Ga0207658_10442388
3138 Ga0207658_10486858
3139 Ga0207677_10000176
3140 Ga0207677_10002823
3141 Ga0207677_10003739
3142 Ga0207677_10007243
3143 Ga0207677_10044492
3144 Ga0207677_10167602
3145 Ga0207677_10419495
3146 Ga0207703_10000661
3147 Ga0207703_10001894
3148 Ga0207703_10011005
3149 Ga0207703_10052938
3150 Ga0207703_10059134
3151 Ga0207703_10061577
3152 Ga0207703_10102414
3153 Ga0207703_10166804
3154 Ga0207703_10218538
3155 Ga0207639_10002373
3156 Ga0207639_10007876
3157 Ga0207639_10013026
3158 Ga0207639_10028307
3159 Ga0207639_10032860
3160 Ga0207639_10670994
3161 Ga0207678_10000753
3162 Ga0207678_10002342
3163 Ga0207678_10005390
3164 Ga0207678_10010368
3165 Ga0207678_10030207
3166 Ga0207678_10032095
3167 Ga0207678_10047023
3168 Ga0207678_10055116
3169 Ga0207678_10056217
3170 Ga0207678_10258149
3171 Ga0207702_10001877
3172 Ga0207702_10003206
3173 Ga0207702_10015397
3174 Ga0207702_10091189
3175 Ga0207641_10000001
3176 Ga0207641_10000022
3177 Ga0207641_10000060
3178 Ga0207641_10000081
3179 Ga0207641_10000414
3180 Ga0207641_10001621
3181 Ga0207641_10005695
3182 Ga0207641_10008003
3183 Ga0207641_10013054
3184 Ga0207641_10017065
3185 Ga0207641_10018477
3186 Ga0207641_10027241
3187 Ga0207641_10030199
3188 Ga0207641_10049935
3189 Ga0207641_10070258
3190 Ga0207641_10097851
3191 Ga0207641_10390052
3192 Ga0207641_10553198
3193 Ga0207648_10018597
3194 Ga0207648_10028525
3195 Ga0207648_10032359
3196 Ga0207648_10365562
3197 Ga0207676_10000209
3198 Ga0207676_10000446
3199 Ga0207676_10001572
3200 Ga0207676_10002414
3201 Ga0207676_10002991
3202 Ga0207676_10003099
3203 Ga0207676_10006322
3204 Ga0207676_10010552
3205 Ga0207676_10038302
3206 Ga0207676_10552690
3207 Ga0207676_10584148
3208 Ga0207674_10000114
3209 Ga0207674_10000308
3210 Ga0207674_10006480
3211 Ga0207674_10010730
3212 Ga0207674_10019146
3213 Ga0207674_10021666
3214 Ga0207674_10053295
3215 Ga0207674_10070446
3216 Ga0207674_10150695
3217 Ga0207674_10223048
3218 Ga0207674_10228530
3219 Ga0207674_10562286
3220 Ga0207674_10728442
3221 Ga0207675_100000082
3222 Ga0207675_100000227
3223 Ga0207675_100000341
3224 Ga0207675_100063151
3225 Ga0207675_100195660
3226 Ga0207675_100283742
3227 Ga0207683_10001332
3228 Ga0207683_10001334
3229 Ga0207683_10002606
3230 Ga0207683_10009869
3231 Ga0207683_10018819
3232 Ga0207683_10024070
3233 Ga0207683_10035073
3234 Ga0207683_10045109
3235 Ga0207683_10113848
3236 Ga0207683_10331728
3237 Ga0207683_10420002
3238 Ga0207683_10756545
3239 Ga0207698_10004710
3240 Ga0207698_10009778
3241 Ga0207698_10010139
3242 Ga0207698_10064794
3243 Ga0207698_10099443
3244 Ga0207698_10123873
3245 Ga0207698_10133657
3246 Ga0207698_10195800
3247 Ga0207698_10295762
3248 Ga0209967_1006316
3249 Ga0209999_1030723
3250 Ga0210002_1026264
3251 Ga0209971_1009311
3252 Ga0209813_10000069
3253 Ga0209974_10003898
3254 Ga0209974_10042592
3255 Ga0207428_10038188
3256 Ga0268266_10000054
3257 Ga0268266_10000083
3258 Ga0268266_10000212
3259 Ga0268266_10000315
3260 Ga0268266_10000865
3261 Ga0268266_10005586
3262 Ga0268266_10011728
3263 Ga0268266_10042808
3264 Ga0268266_10109541
3265 Ga0268266_10147564
3266 Ga0268266_10162589
3267 Ga0268266_10171907
3268 Ga0268266_10178929
3269 Ga0268266_10272932
3270 Ga0268266_10372955
3271 Ga0268265_10000049
3272 Ga0268265_10000090
3273 Ga0268265_10000292
3274 Ga0268265_10000433
3275 Ga0268265_10011527
3276 Ga0268265_10021200
3277 Ga0268265_10039349
3278 Ga0268265_10047888
3279 Ga0268265_10055180
3280 Ga0268265_10057011
3281 Ga0268265_10066103
3282 Ga0268265_10122870
3283 Ga0268264_10000010
3284 Ga0268264_10000018
3285 Ga0268264_10000074
3286 Ga0268264_10000217
3287 Ga0268264_10001254
3288 Ga0268264_10006851
3289 Ga0268264_10008386
3290 Ga0268264_10011425
3291 Ga0268264_10070651
3292 Ga0268264_10079513
3293 Ga0268264_10141641
3294 Ga0268264_10225871
3295 Ga0268264_10540216
3296 Ga0307515_10359930
3297 Ga0316182_1036746
3298 Ga0265327_10012032
3299 Ga0307513_10027142
3300 Ga0307408_100005100
3301 Ga0307408_100010122
3302 Ga0307408_100016027
3303 Ga0307408_100023689
3304 Ga0307408_100044684
3305 Ga0307408_100128503
3306 Ga0307408_100167945
3307 Ga0307408_100180018
3308 Ga0307408_100262257
3309 Ga0307408_100435706
3310 Ga0307408_100573878
3311 Ga0307408_100773840
3312 Ga0307405_10003530
3313 Ga0307405_10006360
3314 Ga0307405_10012577
3315 Ga0307405_10017784
3316 Ga0307405_10036826
3317 Ga0307405_10041678
3318 Ga0307405_10085486
3319 Ga0307405_10097061
3320 Ga0307405_10101264
3321 Ga0307405_10109522
3322 Ga0307405_10193578
3323 Ga0307405_10204541
3324 Ga0307405_10509606
3325 Ga0307413_10008886
3326 Ga0307413_10103645
3327 Ga0307413_10157467
3328 Ga0307413_10176840
3329 Ga0307413_10244786
3330 Ga0307410_10012029
3331 Ga0307410_10013097
3332 Ga0307410_10014722
3333 Ga0307410_10014848
3334 Ga0307410_10024732
3335 Ga0307410_10028420
3336 Ga0307410_10032966
3337 Ga0307410_10033781
3338 Ga0307410_10037055
3339 Ga0307410_10058215
3340 Ga0307410_10090571
3341 Ga0307410_10096045
3342 Ga0307410_10103757
3343 Ga0307410_10354817
3344 Ga0307410_10361120
3345 Ga0307410_10400734
3346 Ga0307406_10017061
3347 Ga0307406_10154654
3348 Ga0307406_10164559
3349 Ga0307406_10336808
3350 Ga0307406_10572386
3351 Ga0307407_10006564
3352 Ga0307407_10025709
3353 Ga0307407_10064759
3354 Ga0307407_10103448
3355 Ga0307407_10223186
3356 Ga0307412_10000453
3357 Ga0307412_10014537
3358 Ga0307412_10016258
3359 Ga0307412_10027552
3360 Ga0307412_10037841
3361 Ga0307412_10049151
3362 Ga0307412_10139709
3363 Ga0307412_10165364
3364 Ga0307412_10253623
3365 Ga0307412_10287989
3366 Ga0307412_10375353
3367 Ga0307409_100004194
3368 Ga0307409_100009517
3369 Ga0307409_100010878
3370 Ga0307409_100011847
3371 Ga0307409_100016462
3372 Ga0307409_100020197
3373 Ga0307409_100020452
3374 Ga0307409_100026363
3375 Ga0307409_100070335
3376 Ga0307409_100087664
3377 Ga0307409_100111557
3378 Ga0307409_100123567
3379 Ga0307409_100128067
3380 Ga0307409_100134518
3381 Ga0307409_100197064
3382 Ga0307409_100254855
3383 Ga0307409_100276002
3384 Ga0307409_100332092
3385 Ga0307409_100494782
3386 Ga0307409_100619543
3387 Ga0307409_100625008
3388 Ga0307416_100011951
3389 Ga0307416_100026591
3390 Ga0307416_100053761
3391 Ga0307416_100066972
3392 Ga0307416_100076929
3393 Ga0307416_100118038
3394 Ga0307416_100184141
3395 Ga0307416_100196647
3396 Ga0307416_100403027
3397 Ga0307416_100544095
3398 Ga0307416_100554514
3399 Ga0307416_100748869
3400 Ga0307416_100771238
3401 Ga0307416_100827693
3402 Ga0307414_10000248
3403 Ga0307414_10000523
3404 Ga0307414_10008564
3405 Ga0307414_10010480
3406 Ga0307414_10034830
3407 Ga0307414_10035078
3408 Ga0307414_10043471
3409 Ga0307414_10063631
3410 Ga0307414_10098991
3411 Ga0307414_10112019
3412 Ga0307414_10129340
3413 Ga0307414_10200354
3414 Ga0307414_10233641
3415 Ga0307414_10240870
3416 Ga0307414_10249458
3417 Ga0307414_10307293
3418 Ga0307414_10425270
3419 Ga0307414_10430559
3420 Ga0307414_10504907
3421 Ga0307414_10522650
3422 Ga0307411_10005498
3423 Ga0307411_10011441
3424 Ga0307411_10022927
3425 Ga0307411_10025794
3426 Ga0307411_10030508
3427 Ga0307411_10053194
3428 Ga0307411_10055192
3429 Ga0307411_10081676
3430 Ga0307411_10083996
3431 Ga0307411_10094247
3432 Ga0307411_10102035
3433 Ga0307411_10103255
3434 Ga0307411_10127876
3435 Ga0307411_10133265
3436 Ga0307411_10134665
3437 Ga0307411_10135633
3438 Ga0307411_10151698
3439 Ga0307411_10244921
3440 Ga0307411_10589021
3441 Ga0307415_100007346
3442 Ga0307415_100018706
3443 Ga0307415_100058166
3444 Ga0307415_100094423
3445 Ga0307415_100100283
3446 Ga0307415_100101759
3447 Ga0307415_100204110
3448 Ga0307415_100219190
3449 Ga0307415_100310985
3450 Ga0307415_100398383
3451 Ga0307415_100469146
3452 Ga0307415_100528108
3453 Ga0316583_10003324
3454 Ga0307510_10222424
3455 Ga0373932_0041083
3456 Ga0373943_0025771
3457 Ga0373946_0064356
3458 Ga0373962_0007062
3459 Ga0373931_0003033
3460 Ga0373931_0065197
3461 Ga0373927_0128562
3462 Ga0373927_0184143
3463 Ga0373927_0187765
3464 Ga0373933_0160738
3465 Ga0373933_0227003
3466 Ga0373947_0016738
3467 Ga0373947_0169901
3468 Ga0373937_0155558
3469 Ga0316582_0000241
3470 Ga0316584_0124894
3471 Ga0373925_0085040
3472 Ga0395899_0001279
3473 Ga0395899_0068045
3474 Ga0395899_0102284
3475 Ga0395899_0116514
3476 Ga0395900_0060058
3477 Ga0395900_0080858
3478 Ga0395900_0105413
3479 Ga0395900_0125141
3480 Ga0395900_0167888
3481 Ga0395900_0200701
3482 Ga0395900_0268532
3483 Ga0395900_0296711
3484 Ga0395900_0502712
3485 Ga0395900_0539053
3486 Ga0395900_0616490
3487 Ga0395898_0009735
3488 Ga0395898_0039150
3489 Ga0395898_0120700
3490 Ga0395898_0131343
3491 Ga0395898_0195400
3492 Ga0395905_0000002
3493 Ga0395905_0000259
3494 Ga0395905_0001268
3495 Ga0395905_0002116
3496 Ga0395905_0002525
3497 Ga0395905_0005106
3498 Ga0395905_0008973
3499 Ga0395905_0009309
3500 Ga0395905_0038888
3501 Ga0395905_0064086
3502 Ga0395905_0086961
3503 Ga0395905_0107590
3504 Ga0395905_0108523
3505 Ga0395905_0112432
3506 Ga0395905_0237278
3507 Ga0395905_0386644
3508 Ga0395905_0431506
3509 Ga0436364_0043906
3510 Ga0436364_0375606
3511 Ga0395901_0055144
3512 Ga0395901_0059700
3513 Ga0395901_0094907
3514 Ga0395901_0103236
3515 Ga0395901_0155426
3516 Ga0395901_0219745
3517 Ga0395901_0493556
3518 Ga0237819_00277
3519 Ga0237816_01172
3520 Ga0436365_0352550
3521 Ga0436365_0425921
3522 Ga0436365_0823412
3523 Ga0436365_1883381
3524 Ga0436361_0666902
3525 Ga0436363_0514468
3526 Ga0436363_1088554
3527 Ga0436362_0976836
3528 Ga0439466_0022459
3529 Ga0439465_0005684
3530 Ga0451807_2673641
3531 Ga0439431_0003890
3532 Ga0439431_0009412
3533 Ga0439431_0010561
3534 Ga0439443_020568
3535 Ga0439445_0001313
3536 Ga0439445_0001908
3537 Ga0439448_0012592
3538 Ga0439448_0119957
3539 Ga0439432_003246
3540 Ga0439449_0035887
3541 Ga0439449_0136098
3542 Ga0439455_0004340
3543 Ga0439455_0007576
3544 Ga0439462_0010288
3545 Ga0439462_0051902
3546 Ga0450920_005490
3547 Ga0450890_012483
3548 Ga0450906_019189
3549 Ga0439458_0000003
3550 Ga0439458_0000100
3551 Ga0439434_0000270
3552 Ga0450893_0015955
3553 Ga0466972_0014153
3554 Ga0466972_0124862
3555 Ga0466964_0030710
3556 Ga0453684_0186291
3557 Ga0466970_0041238
3558 Ga0466970_0102757
3559 Ga0466957_0013721
3560 Ga0466960_0013186
3561 Ga0466960_0072288
3562 Ga0451576_0778890
3563 Ga0466967_0434670
3564 Ga0495627_000197
3565 Ga0495627_000332
3566 Ga0495629_0226073
3567 Ga0495638_0000014
3568 Ga0495638_0012073
3569 Ga0495638_0061872
3570 Ga0495653_0217609
3571 Ga0495650_0000949
3572 Ga0495650_0001750
3573 Ga0495582_0190266
3574 Ga0495585_0024902
3575 Ga0495596_0000625
3576 Ga0495596_0000662
3577 Ga0495607_0029348
3578 Ga0495583_0000010
3579 Ga0495583_0000072
3580 Ga0495583_0024021
3581 Ga0495610_0000020
3582 Ga0495610_0000104
3583 Ga0495610_0000206
3584 Ga0495610_0001905
3585 Ga0495616_0000189
3586 Ga0495616_0040503
3587 Ga0495620_0070924
3588 Ga0495632_0000039
3589 Ga0495632_0001119
3590 Ga0495632_0001380
3591 Ga0495637_0001220
3592 Ga0495637_0007245
3593 Ga0495643_0000023
3594 Ga0495643_0000162
3595 Ga0495643_0010821
3596 Ga0495643_0041082
3597 Ga0495643_0077082
3598 Ga0495643_0156313
3599 Ga0495648_0000021
3600 Ga0495648_0037697
3601 Ga0495648_0055342
3602 Ga0495663_0000006
3603 Ga0495663_0003158
3604 Ga0495663_0009224
3605 Ga0495663_0015024
3606 Ga0495663_0025029
3607 Ga0495663_0026138
3608 Ga0495642_0089521
3609 Ga0495654_0005057
3610 Ga0495654_0071953
3611 Ga0495598_0000161
3612 Ga0495598_0001682
3613 Ga0495598_0003299
3614 Ga0495598_0006522
3615 Ga0495609_0004365
3616 Ga0495609_0140980
3617 Ga0495621_0001303
3618 Ga0495621_0008416
3619 Ga0495633_0000498
3620 Ga0495633_0000709
3621 Ga0495633_0005226
3622 Ga0495633_0029292
3623 Ga0495633_0278753
3624 Ga0495668_0005964
3625 Ga0495668_0013617
3626 Ga0495668_0032001
3627 Ga0495668_0053616
3628 Ga0495625_0003884
3629 Ga0495635_0191206
3630 Ga0495661_0037556
3631 Ga0495661_0078663
3632 Ga0495661_0085703
3633 Ga0495658_0047626
3634 Ga0495669_0001299
3635 Ga0495669_0001331
3636 Ga0495669_0005488
3637 Ga0495669_0010801
3638 Ga0495669_0028172
3639 Ga0495669_0031586
3640 Ga0495669_0049049
3641 Ga0495669_0079566
3642 Ga0495669_0219866
3643 Ga0495670_0000028
3644 Ga0495670_0002560
3645 Ga0495670_0002640
3646 Ga0495670_0004815
3647 Ga0495670_0014891
3648 Ga0495671_0000028
3649 Ga0495671_0000062
3650 Ga0495671_0047666
3651 Ga0495671_0179923
3652 Ga0495677_0017392
3653 Ga0495677_0035109
3654 Ga0495677_0038468
3655 Ga0495673_0000058
3656 Ga0495673_0025959
3657 Ga0495681_0000106
3658 Ga0495681_0000123
3659 Ga0495681_0012584
3660 Ga0495681_0022938
3661 Ga0495681_0128695
3662 Ga0495686_0000514
3663 Ga0495686_0000753
3664 Ga0495686_0000986
3665 Ga0495686_0002233
3666 Ga0495686_0075740
3667 Ga0495686_0170483
3668 Ga0495602_0103333
3669 Ga0495626_0001250
3670 Ga0496100_0001699
3671 Ga0496100_0029472
3672 Ga0496100_0137390
3673 Ga0496100_0157070
3674 Ga0496100_0282196
3675 Ga0496101_0001043
3676 Ga0496101_0092964
3677 Ga0496101_0235144
3678 Ga0496102_0013225
3679 Ga0496102_0032753
3680 Ga0496102_0133620
3681 Ga0496102_0299015
3682 Ga0496102_0508489
3683 Ga0496102_0531325
3684 Ga0496103_0001126
3685 Ga0496103_0003725
3686 Ga0496103_0004335
3687 Ga0496103_0057642
3688 Ga0496103_0143676
3689 Ga0496103_0205930
3690 Ga0496104_0000047
3691 Ga0496104_0023274
3692 Ga0496104_0028059
3693 Ga0496104_0066451
3694 Ga0496104_0595656
3695 Ga0496105_0001043
3696 Ga0496105_0001439
3697 Ga0496105_0110409
3698 Ga0496106_0019778
3699 Ga0496106_0020015
3700 Ga0496106_0073822
3701 Ga0496107_0001011
3702 Ga0496107_0002753
3703 Ga0496107_0041154
3704 Ga0496107_0198033
3705 Ga0496107_0232921
3706 Ga0496108_0001754
3707 Ga0496108_0022034
3708 Ga0496108_0038475
3709 Ga0496108_0055839
3710 Ga0496108_0106734
3711 Ga0496108_0274981
3712 Ga0496108_0651458
3713 Ga0496109_0001104
3714 Ga0496109_0008312
3715 Ga0496109_0020089
3716 Ga0496109_0032414
3717 Ga0496109_0046122
3718 Ga0496109_0063952
3719 Ga0496109_0067547
3720 Ga0496109_0071548
3721 Ga0496109_0228013
3722 Ga0496109_0233278
3723 Ga0496110_0004034
3724 Ga0496110_0005807
3725 Ga0496110_0008722
3726 Ga0496110_0009970
3727 Ga0496110_0026705
3728 Ga0496110_0027060
3729 Ga0496110_0047313
3730 Ga0496110_0056901
3731 Ga0496110_0090418
3732 Ga0496110_0106894
3733 Ga0496110_0631579
3734 Ga0496110_0841419
3735 Ga0496111_0009177
3736 Ga0496111_0012281
3737 Ga0496111_0026202
3738 Ga0496111_0077937
3739 Ga0496111_0093633
3740 Ga0496111_0195647
3741 Ga0496111_0213581
3742 Ga0496112_0000161
3743 Ga0496112_0005612
3744 Ga0496112_0014867
3745 Ga0496112_0034388
3746 Ga0496112_0053964
3747 Ga0496112_0598451
3748 Ga0496113_0001466
3749 Ga0496113_0009375
3750 Ga0496113_0011871
3751 Ga0496113_0032533
3752 Ga0496113_0056057
3753 Ga0496113_0107681
3754 Ga0496113_0119114
3755 Ga0496114_0033907
3756 Ga0496114_0048078
3757 Ga0496114_0517653
3758 Ga0496115_0000488
3759 Ga0496115_0002623
3760 Ga0496115_0069593
3761 Ga0496115_0302378
3762 Ga0496115_0492362
3763 Ga0496116_0000035
3764 Ga0496117_0003304
3765 Ga0496117_0003615
3766 Ga0496117_0007605
3767 Ga0496117_0039575
3768 Ga0496117_0061024
3769 Ga0496117_0094746
3770 Ga0496117_0095736
3771 Ga0496118_0000855
3772 Ga0496118_0003803
3773 Ga0496118_0042759
3774 Ga0496118_0055355
3775 Ga0496118_0172868
3776 Ga0496119_0000928
3777 Ga0496119_0026186
3778 Ga0496120_0000668
3779 Ga0496120_0047655
3780 Ga0496120_0148217
3781 Ga0496121_0000175
3782 Ga0496121_0000312
3783 Ga0496121_0009343
3784 Ga0496121_0012998
3785 Ga0496121_0025370
3786 Ga0496122_0001715
3787 Ga0496122_0004533
3788 Ga0496122_0009956
3789 Ga0496122_0009978
3790 Ga0496122_0011300
3791 Ga0496122_0031446
3792 Ga0496123_0000518
3793 Ga0496123_0002019
3794 Ga0496123_0003213
3795 Ga0496123_0004657
3796 Ga0496123_0004960
3797 Ga0496123_0019762
3798 Ga0496124_0001659
3799 Ga0496124_0002396
3800 Ga0496124_0002918
3801 Ga0496124_0032910
3802 Ga0496124_0108951
3803 Ga0496124_0132985
3804 Ga0496124_0138649
3805 Ga0496125_0000445
3806 Ga0496125_0015492
3807 Ga0496125_0051107
3808 Ga0496125_0065170
3809 Ga0496125_0134658
3810 Ga0496125_0254882
3811 Ga0496126_0000084
3812 Ga0496126_0002967
3813 Ga0496126_0004125
3814 Ga0496126_0004926
3815 Ga0496126_0061377
3816 Ga0496126_0168250
3817 Ga0501306_003025
3818 Ga0501292_000042
3819 Ga0501294_000486
3820 Ga0501300_002184
3821 Ga0501300_003888
3822 Ga0501314_001059
3823 Ga0501315_002109
3824 Ga0501317_000383
3825 Ga0501317_002040
3826 Ga0501317_007458
3827 Ga0501322_000752
3828 Ga0501334_01319
3829 Ga0501335_000754
3830 Ga0501337_004439
3831 Ga0501033_0031970
3832 Ga0501034_0032864
3833 Ga0501034_0110535
3834 Ga0501038_0013428
3835 Ga0501043_0077725
3836 Ga0501046_0377809
3837 Ga0501047_0096087
3838 Ga0501047_0322356
3839 Ga0501067_0010970
3840 Ga0501067_0033983
3841 Ga0501069_0160372
3842 Ga0501074_0604401
3843 Ga0501206_001035
3844 Ga0501209_087797
3845 Ga0501211_002141
3846 Ga0501217_014154
3847 Ga0501222_001125
3848 Ga0501223_000040
3849 Ga0501223_001502
3850 Ga0501224_000547
3851 Ga0501227_005914
3852 Ga0501233_004107
3853 Ga0501235_003519
3854 Ga0501235_005414
3855 Ga0501235_010556
3856 Ga0501235_014088
3857 Ga0501235_028025
3858 Ga0501240_001954
3859 Ga0501246_000435
3860 Ga0501257_000016
3861 Ga0501257_038348
3862 Ga0501259_003663
3863 Ga0501261_000888
3864 Ga0501221_003159
3865 Ga0501225_0000053
3866 Ga0501225_0002859
3867 Ga0501225_0024835
3868 Ga0501229_029699
3869 Ga0501245_002123
3870 Ga0501245_018145
3871 Ga0501241_017473
3872 Ga0501262_003203
3873 Ga0501263_004581
3874 Ga0501272_001630
3875 Ga0501279_000010
3876 Ga0501280_000454
3877 Ga0501281_00264
3878 Ga0501283_006335
3879 Ga0501035_0014952
3880 Ga0501035_0370956
3881 Ga0501044_0021900
3882 Ga0501044_0415012
3883 nmdc:mga03683_39170_c1
3884 nmdc:mga03683_3_c1
3885 nmdc:mga00v17_1542_c3
3886 nmdc:mga00v17_38485_c1
3887 nmdc:mga00v17_67014_c1
3888 nmdc:mga0k408_102718_c1
3889 nmdc:mga0k408_119665_c1
3890 nmdc:mga0k408_20_c1
3891 nmdc:mga06z11_204_c1
3892 nmdc:mga07m45_154229_c1
3893 nmdc:mga07m45_1_c1
3894 nmdc:mga07m45_5078_c1
3895 nmdc:mga07m45_53_c1
3896 nmdc:mga0qj67_90903_c1
3897 nmdc:mga08y16_23018_c1
3898 nmdc:mga08y16_439029_c1
3899 nmdc:mga08y16_493074_c1
3900 nmdc:mga0n895_27447_c1
3901 nmdc:mga0sz30_404_c1
3902 nmdc:mga0sz30_61144_c1
3903 Ga0500643_000381
3904 Ga0500643_000474
3905 Ga0500643_000974
3906 Ga0500643_002487
3907 Ga0500643_003402
3908 Ga0500643_004831
3909 Ga0500643_024706
3910 Ga0500643_033914
3911 Ga0500643_051825
3912 Ga0500651_0114443
3913 Ga0500566_0011688
3914 Ga0500566_0034909
3915 Ga0500650_0034419
3916 Ga0500555_000032
3917 Ga0500556_0000049
3918 Ga0500556_0004319
3919 Ga0500562_019537
3920 Ga0500592_000243
3921 Ga0500594_0057108
3922 Ga0500595_002004
3923 Ga0500607_001022
3924 Ga0500608_000489
3925 Ga0500618_002084
3926 Ga0500618_007779
3927 Ga0500618_015238
3928 Ga0500642_0000002
3929 Ga0500642_0000573
3930 Ga0500655_000364
3931 Ga0500658_0001729
3932 Ga0500559_0001213
3933 Ga0500559_0002216
3934 Ga0500559_0007095
3935 Ga0500559_0184649
3936 Ga0500564_000978
3937 Ga0500568_0003198
3938 Ga0500568_0008749
3939 Ga0500573_0000065
3940 Ga0500590_000420
3941 Ga0500604_0000054
3942 Ga0500604_0002552
3943 Ga0500604_0010442
3944 Ga0500616_0000352
3945 Ga0500616_0016845
3946 Ga0500622_0148688
3947 Ga0500624_000084
3948 Ga0500624_000324
3949 Ga0500627_0001473
3950 Ga0500627_0104568
3951 Ga0500636_0009782
3952 Ga0500637_0005165
3953 Ga0500567_000681
3954 Ga0500570_000703
3955 Ga0500625_000039
3956 Ga0500645_000173
3957 Ga0500645_001421
3958 Ga0500645_004447
3959 Ga0500645_014668
3960 Ga0500601_005159
3961 Ga0500587_000206
3962 Ga0500661_000156
3963 Ga0587084_005868
3964 Ga0587084_008867
3965 Ga0587066_007812
3966 Ga0587070_033331
3967 Ga0587077_002003
3968 Ga0587085_031811
3969 Ga0587090_000907
3970 Ga0587090_005892
3971 Ga0587090_026896
3972 Ga0587091_008696
3973 Ga0587106_003149
3974 Ga0587101_002333
3975 Ga0587109_012673
3976 Ga0587062_005604
3977 Ga0587062_006120
3978 Ga0587067_008117
3979 Ga0587068_007851
3980 Ga0587069_003920
3981 Ga0587072_003436
3982 Ga0587076_010442
3983 Ga0587076_018565
3984 Ga0587111_0011290
3985 Ga0466962_0096849
3986 2511126187
3987 2512644928
3988 2585259902
3989 2600200661
3990 2600225785
3991 2643823529
3992 2643948977
3993 2738709490
3994 2738847915
3995 2738863644
3996 2739296162
3997 2739357840
3998 2739649466
3999 2740027939
4000 2753765276
4001 2778124422
4002 2809064381
4003 2809080454
4004 2809084713
4005 2819552659
4006 2819716414
4007 2848299145
4008 2852655305
4009 2852681098
4010 2879165191
4011 2880519154
4012 2885427834
4013 2896185106
4014 2896255497
4015 2919141176
4016 2919713328
4017 2928030464
4018 2928102625
4019 2928528778
4020 2928959288
4021 2928970333
4022 2984557316
4023 2990266899
4024 2993359366
4025 2993693844
4026 3000865741
4027 8054302643
4028 8057104475

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

54

273

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8379 33 260
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8312 33 260
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.8258 33 260
6vol-assembly1.cif.gz_a chloroplast atp synthase (r2, cf1fo) 0.8256 34 256
6cp6-assembly1.cif.gz_X monomer yeast atp synthase (f1fo) reconstituted in nanodisc. 0.8192 33 260
ID Description Score Start End Superfamily
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.9125 87 260 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.9037 89 260 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8926 87 260 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8882 89 260 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8384 89 260 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A4Q3F2V2-F1-model_v4 deleted 0.9386 78 260
AF-A0A4Q3E736-F1-model_v4 deleted 0.9363 89 260
AF-A0A2H5UGR1-F1-model_v4 deleted 0.9356 122 260
AF-A0A4Q3E1I6-F1-model_v4 deleted 0.9337 101 260
AF-A0A3F2RDH4-F1-model_v4 F-ATPase protein 6 0.9309 70 260 GO:0045263
GO:0046933

Map