F496291
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2033 | 848 | 1819 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300061734|Ga0530510_0054880|Ga0530510_0054880_2205_2765 |
| Length | 167 |
| Sequence | MPSIARILSIASAALLVSACAANPKSAKGGTDVIDGAAVPTAPAETCALVRVAFAFDSAQLDEDAMRHLRENAECLKRRGATSLLVEGHCDERGTTEYNIALGARRAEAVKQYFLALGVGASIDSVSFGKEIPVATGSSDGAWAQNRRAELRLPGDKRSDGRLVAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 24 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 25 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 26 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 27 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355199 | |||
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 34 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 35 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 36 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 37 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 38 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 39 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 40 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 41 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 42 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 43 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 44 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 45 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 46 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 47 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 48 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 49 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 50 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 51 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 52 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 53 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 54 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 55 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 56 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 57 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 58 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 59 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 60 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 61 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 62 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 63 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 64 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 65 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 66 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 67 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 68 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 69 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 70 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 71 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 72 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 73 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 74 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 75 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 76 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 77 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 78 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 79 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 80 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 81 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 82 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 83 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 84 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 85 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 86 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 91 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 95 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 98 | 2904699407 | |||
| 99 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 100 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 101 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 102 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 103 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 104 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 105 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 106 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 107 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 108 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 109 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 110 | 2922368715 | |||
| 111 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 112 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 113 | 2922425934 | |||
| 114 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 115 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 116 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 117 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 118 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 119 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 120 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 121 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 122 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 123 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 124 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 125 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 126 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 127 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 128 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 129 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 130 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 131 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 132 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 133 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 134 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 135 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 136 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 137 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 138 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 139 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 140 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 141 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 142 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 143 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 144 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 145 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 146 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 147 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 148 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 149 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 150 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 151 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 152 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 153 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 154 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 155 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 156 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 157 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 158 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 159 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 160 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 161 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 162 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 163 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 164 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 165 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 166 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 167 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 168 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 169 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 170 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 171 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 172 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 173 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 174 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 175 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 176 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 177 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 178 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 179 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 180 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 181 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 182 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 183 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 184 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 185 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 186 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 187 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 188 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 189 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 190 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 191 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 192 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 193 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 194 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 195 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 196 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 197 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 199 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 200 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 201 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 204 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 205 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 207 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 211 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 213 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 222 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 228 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 236 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 237 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 238 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 239 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 242 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 244 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 249 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 251 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 252 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 253 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 255 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 256 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 257 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 258 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 259 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 260 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 261 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 262 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 263 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 264 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 265 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 266 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 267 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 268 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 269 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 271 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 272 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 273 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 274 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 275 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 276 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 277 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 278 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 279 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 280 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 281 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 283 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 284 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 285 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 286 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 287 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 288 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 289 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 290 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 292 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 293 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 294 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 310 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 313 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 314 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 315 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 316 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 317 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 318 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 319 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 331 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 334 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 340 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 341 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 342 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 343 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 344 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 345 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 346 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 347 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 348 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 349 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 350 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 351 | 3300023539 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 354 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 356 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 362 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 364 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 431 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 432 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 433 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 434 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 438 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 442 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 443 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 444 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 445 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 446 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 447 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 451 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 452 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 453 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 454 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 455 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 456 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 457 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 458 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 459 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 460 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 461 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 462 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 463 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 464 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 465 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 466 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 467 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 468 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 469 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 470 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 471 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 472 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 473 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 474 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 475 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 476 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 477 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 478 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 479 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 480 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 481 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 482 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 483 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 484 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 485 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 486 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 487 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 488 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 489 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 490 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 491 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 492 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 493 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 494 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 495 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 496 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 497 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 498 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 499 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 500 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 501 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 502 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 503 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 504 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 505 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 506 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 507 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 508 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 509 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 510 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 511 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 512 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 513 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 514 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 515 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 516 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 517 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 518 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 519 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 520 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 521 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 522 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 523 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 524 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 525 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 526 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 527 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 528 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 529 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 530 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 531 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 532 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 533 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 534 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 535 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 536 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 537 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 538 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 539 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 540 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 541 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 542 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 543 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 544 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 545 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 546 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 547 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 548 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 549 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 550 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 551 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 552 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 553 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 554 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 555 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 556 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 557 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 558 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 559 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 653 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 654 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 655 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 656 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 657 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 658 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 659 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 660 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 661 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 662 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 663 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 664 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 665 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 666 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 667 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 668 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 669 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 670 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 671 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 672 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 673 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 674 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 675 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 676 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 677 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 678 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 682 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 688 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 689 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 691 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 692 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 694 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 695 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 697 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 698 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 699 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 700 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 701 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 702 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 703 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 704 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 705 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 706 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 708 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 709 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 711 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 712 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 713 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 714 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 715 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 716 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 717 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 718 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 719 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 720 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 721 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 722 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 723 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 724 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 725 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 726 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 727 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 728 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 729 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 730 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 733 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 734 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 738 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 739 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 740 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 741 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 742 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 743 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 744 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 745 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 746 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 747 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 748 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 749 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 750 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 751 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 752 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 753 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 754 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 755 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 756 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 757 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 758 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 759 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 760 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 761 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 762 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 763 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 764 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 765 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 766 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 767 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 768 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 769 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 770 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 771 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 772 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 773 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 774 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 775 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 776 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 777 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 778 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 779 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 780 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 781 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 782 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 783 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 784 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 785 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 786 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 787 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 788 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 789 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 790 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 791 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 792 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 793 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 794 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 795 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 796 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 797 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 798 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 799 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 800 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 801 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 802 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 803 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 804 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 805 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 806 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 807 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 808 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 809 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 810 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 811 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 812 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 813 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 814 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 815 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 816 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 817 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 818 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 819 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 820 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 821 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 822 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 823 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 824 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 825 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 826 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 827 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 828 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 829 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 830 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 831 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 832 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 833 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 834 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 835 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 836 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 837 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 838 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 839 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 840 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 841 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 842 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 843 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 844 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 845 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 846 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 847 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 848 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.19 |
| Metatranscriptomes | 2.46 |
| Isolates | 10.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.92 |
| Nodule | 8.02 |
| Rhizoplane | 6.05 |
| Rhizosphere | 65.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1016355 | 3300001904 | Bacteria | 1182 |
| 2 | JGI24752J21851_1027888 | 3300001976 | Bacteria | 742 |
| 3 | JGI24740J21852_10051938 | 3300001979 | Bacteria | 1170 |
| 4 | JGI24739J22299_10057219 | 3300001989 | Bacteria | 1241 |
| 5 | JGI24737J22298_10041998 | 3300001990 | Bacteria | 1402 |
| 6 | JGI24743J22301_10022260 | 3300001991 | Bacteria | 1214 |
| 7 | JGI24735J21928_10062795 | 3300002067 | Bacteria | 1066 |
| 8 | JGI24738J21930_10138678 | 3300002075 | Bacteria | 536 |
| 9 | JGI24744J21845_10070339 | 3300002077 | Bacteria | 639 |
| 10 | JGI24742J22300_10051161 | 3300002244 | Bacteria | 748 |
| 11 | JGI25406J46586_10007497 | 3300003203 | Bacteria | 4977 |
| 12 | JGI25406J46586_10038536 | 3300003203 | Bacteria | 1712 |
| 13 | JGI25153J46596_10002652 | 3300003215 | Bacteria | 10226 |
| 14 | JGI25153J46596_10012145 | 3300003215 | Bacteria | 3744 |
| 15 | JGI25153J46596_10013197 | 3300003215 | Bacteria | 3510 |
| 16 | JGI25153J46596_10047815 | 3300003215 | Bacteria | 1255 |
| 17 | Ga0006777J48905_1033878 | 3300003308 | Bacteria | 545 |
| 18 | JGI25160J50197_1000801 | 3300003354 | Bacteria | 16953 |
| 19 | Ga0007410J51695_1046046 | 3300003574 | Bacteria | 629 |
| 20 | JGI25404J52841_10001685 | 3300003659 | Bacteria | 3973 |
| 21 | JGI25404J52841_10005572 | 3300003659 | Bacteria | 2602 |
| 22 | JGI25404J52841_10007750 | 3300003659 | Bacteria | 2276 |
| 23 | JGI25404J52841_10009204 | 3300003659 | Bacteria | 2110 |
| 24 | Ga0055539_1010616 | 3300003752 | Bacteria | 1140 |
| 25 | Ga0055526_1030287 | 3300003771 | Bacteria | 1583 |
| 26 | Ga0055526_1070283 | 3300003771 | Bacteria | 712 |
| 27 | Ga0055524_1019793 | 3300003775 | Bacteria | 2288 |
| 28 | Ga0055531_10002406 | 3300003794 | Bacteria | 12566 |
| 29 | JGI25405J52794_10003478 | 3300003911 | Bacteria | 2763 |
| 30 | JGI25405J52794_10042128 | 3300003911 | Bacteria | 967 |
| 31 | Ga0058860_12155477 | 3300004801 | Bacteria | 606 |
| 32 | Ga0058862_10098549 | 3300004803 | Bacteria | 555 |
| 33 | Ga0065165_1010861 | 3300005262 | Bacteria | 3877 |
| 34 | Ga0065165_1084460 | 3300005262 | Bacteria | 818 |
| 35 | Ga0065165_1124716 | 3300005262 | Bacteria | 621 |
| 36 | Ga0065712_10342346 | 3300005290 | Bacteria | 799 |
| 37 | Ga0065707_10323728 | 3300005295 | Bacteria | 960 |
| 38 | Ga0070658_10058031 | 3300005327 | Bacteria | 3149 |
| 39 | Ga0070658_10204382 | 3300005327 | Bacteria | 1667 |
| 40 | Ga0070658_10250102 | 3300005327 | Bacteria | 1504 |
| 41 | Ga0070676_10488034 | 3300005328 | Bacteria | 872 |
| 42 | Ga0070683_100130474 | 3300005329 | Bacteria | 2378 |
| 43 | Ga0070683_100229107 | 3300005329 | Bacteria | 1766 |
| 44 | Ga0070683_100358105 | 3300005329 | Bacteria | 1390 |
| 45 | Ga0070683_100879377 | 3300005329 | Bacteria | 859 |
| 46 | Ga0070683_101800119 | 3300005329 | Bacteria | 589 |
| 47 | Ga0070690_100228645 | 3300005330 | Bacteria | 1307 |
| 48 | Ga0070670_100197497 | 3300005331 | Bacteria | 1748 |
| 49 | Ga0070670_100202840 | 3300005331 | Bacteria | 1723 |
| 50 | Ga0070670_101826782 | 3300005331 | Bacteria | 560 |
| 51 | Ga0068869_100027419 | 3300005334 | Bacteria | 3971 |
| 52 | Ga0068869_100455881 | 3300005334 | Bacteria | 1061 |
| 53 | Ga0068869_100575987 | 3300005334 | Bacteria | 948 |
| 54 | Ga0070666_10046350 | 3300005335 | Bacteria | 2915 |
| 55 | Ga0070680_100025590 | 3300005336 | Bacteria | 4717 |
| 56 | Ga0070680_100026931 | 3300005336 | Bacteria | 4601 |
| 57 | Ga0070680_100098059 | 3300005336 | Bacteria | 2430 |
| 58 | Ga0070682_100310424 | 3300005337 | Bacteria | 1161 |
| 59 | Ga0070682_100563447 | 3300005337 | Bacteria | 893 |
| 60 | Ga0070682_101518708 | 3300005337 | Bacteria | 576 |
| 61 | Ga0068868_100026005 | 3300005338 | Bacteria | 4457 |
| 62 | Ga0068868_100295349 | 3300005338 | Bacteria | 1375 |
| 63 | Ga0070660_100007638 | 3300005339 | Bacteria | 7536 |
| 64 | Ga0070660_100321361 | 3300005339 | Bacteria | 1271 |
| 65 | Ga0070660_100451376 | 3300005339 | Bacteria | 1067 |
| 66 | Ga0070660_101633481 | 3300005339 | Bacteria | 548 |
| 67 | Ga0070689_100089135 | 3300005340 | Bacteria | 2429 |
| 68 | Ga0070691_10050182 | 3300005341 | Bacteria | 1990 |
| 69 | Ga0070687_100178221 | 3300005343 | Bacteria | 1271 |
| 70 | Ga0070661_100075696 | 3300005344 | Bacteria | 2480 |
| 71 | Ga0070661_100094549 | 3300005344 | Bacteria | 2215 |
| 72 | Ga0070668_100024092 | 3300005347 | Bacteria | 4609 |
| 73 | Ga0070668_100028776 | 3300005347 | Bacteria | 4216 |
| 74 | Ga0070668_100408476 | 3300005347 | Bacteria | 1161 |
| 75 | Ga0070668_100481582 | 3300005347 | Bacteria | 1072 |
| 76 | Ga0070669_100414435 | 3300005353 | Bacteria | 1104 |
| 77 | Ga0070675_100418602 | 3300005354 | Bacteria | 1198 |
| 78 | Ga0070671_100011405 | 3300005355 | Bacteria | 7146 |
| 79 | Ga0070671_100038562 | 3300005355 | Bacteria | 3965 |
| 80 | Ga0070674_100440283 | 3300005356 | Bacteria | 1073 |
| 81 | Ga0070674_100690527 | 3300005356 | Bacteria | 871 |
| 82 | Ga0070688_100377884 | 3300005365 | Bacteria | 1044 |
| 83 | Ga0070688_100519886 | 3300005365 | Bacteria | 900 |
| 84 | Ga0070659_100025503 | 3300005366 | Bacteria | 4541 |
| 85 | Ga0070659_100226056 | 3300005366 | Bacteria | 1546 |
| 86 | Ga0070667_100032367 | 3300005367 | Bacteria | 4361 |
| 87 | Ga0070667_100035551 | 3300005367 | Bacteria | 4174 |
| 88 | Ga0070667_100530762 | 3300005367 | Bacteria | 1080 |
| 89 | Ga0070703_10065908 | 3300005406 | Bacteria | 1197 |
| 90 | Ga0070709_10001487 | 3300005434 | Bacteria | 12659 |
| 91 | Ga0070709_10005197 | 3300005434 | Bacteria | 7039 |
| 92 | Ga0070709_10512808 | 3300005434 | Bacteria | 912 |
| 93 | Ga0070714_100008988 | 3300005435 | Bacteria | 7823 |
| 94 | Ga0070714_100015426 | 3300005435 | Bacteria | 6149 |
| 95 | Ga0070714_100064213 | 3300005435 | Bacteria | 3159 |
| 96 | Ga0070714_100286854 | 3300005435 | Bacteria | 1531 |
| 97 | Ga0070714_100336897 | 3300005435 | Bacteria | 1414 |
| 98 | Ga0070714_101703807 | 3300005435 | Bacteria | 616 |
| 99 | Ga0070713_100007532 | 3300005436 | Bacteria | 7649 |
| 100 | Ga0070713_100012854 | 3300005436 | Bacteria | 6158 |
| 101 | Ga0070713_100030133 | 3300005436 | Bacteria | 4305 |
| 102 | Ga0070710_10001558 | 3300005437 | Bacteria | 10845 |
| 103 | Ga0070710_10015094 | 3300005437 | Bacteria | 3901 |
| 104 | Ga0070710_10089854 | 3300005437 | Bacteria | 1810 |
| 105 | Ga0070701_10211593 | 3300005438 | Bacteria | 1151 |
| 106 | Ga0070711_100003888 | 3300005439 | Bacteria | 8772 |
| 107 | Ga0070711_100004290 | 3300005439 | Bacteria | 8392 |
| 108 | Ga0070711_100011060 | 3300005439 | Bacteria | 5598 |
| 109 | Ga0070711_100054430 | 3300005439 | Bacteria | 2761 |
| 110 | Ga0070711_100492219 | 3300005439 | Bacteria | 1010 |
| 111 | Ga0070711_100520735 | 3300005439 | Bacteria | 983 |
| 112 | Ga0070708_100566755 | 3300005445 | Bacteria | 1071 |
| 113 | Ga0070708_100999514 | 3300005445 | Bacteria | 784 |
| 114 | Ga0070663_100023617 | 3300005455 | Bacteria | 4123 |
| 115 | Ga0070663_100063772 | 3300005455 | Bacteria | 2662 |
| 116 | Ga0070663_100096273 | 3300005455 | Bacteria | 2201 |
| 117 | Ga0070663_100165493 | 3300005455 | Bacteria | 1705 |
| 118 | Ga0070663_100169739 | 3300005455 | Bacteria | 1685 |
| 119 | Ga0070663_100222670 | 3300005455 | Bacteria | 1482 |
| 120 | Ga0070663_100283222 | 3300005455 | Bacteria | 1321 |
| 121 | Ga0070678_100021041 | 3300005456 | Bacteria | 4292 |
| 122 | Ga0070678_100153379 | 3300005456 | Bacteria | 1858 |
| 123 | Ga0070678_100212714 | 3300005456 | Bacteria | 1603 |
| 124 | Ga0070678_100687392 | 3300005456 | Bacteria | 921 |
| 125 | Ga0070662_100035970 | 3300005457 | Bacteria | 3500 |
| 126 | Ga0070662_100352249 | 3300005457 | Bacteria | 1206 |
| 127 | Ga0070681_10066584 | 3300005458 | Bacteria | 3571 |
| 128 | Ga0070681_10705787 | 3300005458 | Bacteria | 924 |
| 129 | Ga0068867_100049036 | 3300005459 | Bacteria | 3108 |
| 130 | Ga0068867_100416018 | 3300005459 | Bacteria | 1138 |
| 131 | Ga0068867_100616004 | 3300005459 | Bacteria | 948 |
| 132 | Ga0070685_10899823 | 3300005466 | Bacteria | 659 |
| 133 | Ga0070679_100010119 | 3300005530 | Bacteria | 8939 |
| 134 | Ga0070679_100032426 | 3300005530 | Bacteria | 5167 |
| 135 | Ga0070679_100038144 | 3300005530 | Bacteria | 4776 |
| 136 | Ga0070679_100341553 | 3300005530 | Bacteria | 1445 |
| 137 | Ga0070679_100378215 | 3300005530 | Bacteria | 1363 |
| 138 | Ga0070679_100472346 | 3300005530 | Bacteria | 1198 |
| 139 | Ga0070684_100007774 | 3300005535 | Bacteria | 8357 |
| 140 | Ga0070684_100217994 | 3300005535 | Bacteria | 1741 |
| 141 | Ga0070684_100328492 | 3300005535 | Bacteria | 1405 |
| 142 | Ga0070697_100341878 | 3300005536 | Bacteria | 1291 |
| 143 | Ga0068853_100084746 | 3300005539 | Bacteria | 2777 |
| 144 | Ga0068853_100262986 | 3300005539 | Bacteria | 1587 |
| 145 | Ga0068853_100404833 | 3300005539 | Bacteria | 1278 |
| 146 | Ga0068853_100784911 | 3300005539 | Bacteria | 911 |
| 147 | Ga0068853_100814497 | 3300005539 | Bacteria | 894 |
| 148 | Ga0068853_101272831 | 3300005539 | Bacteria | 711 |
| 149 | Ga0070672_100249900 | 3300005543 | Bacteria | 1493 |
| 150 | Ga0070695_100049535 | 3300005545 | Bacteria | 2690 |
| 151 | Ga0070696_100314910 | 3300005546 | Bacteria | 1202 |
| 152 | Ga0070693_100178160 | 3300005547 | Bacteria | 1367 |
| 153 | Ga0070693_100211510 | 3300005547 | Bacteria | 1265 |
| 154 | Ga0070693_100410130 | 3300005547 | Bacteria | 942 |
| 155 | Ga0070693_100675471 | 3300005547 | Bacteria | 754 |
| 156 | Ga0070665_100055417 | 3300005548 | Bacteria | 3976 |
| 157 | Ga0070665_100212627 | 3300005548 | Bacteria | 1935 |
| 158 | Ga0070665_100367872 | 3300005548 | Bacteria | 1444 |
| 159 | Ga0070665_100546511 | 3300005548 | Bacteria | 1170 |
| 160 | Ga0070665_100707365 | 3300005548 | Bacteria | 1021 |
| 161 | Ga0070665_101491396 | 3300005548 | Bacteria | 685 |
| 162 | Ga0070665_101636392 | 3300005548 | Bacteria | 651 |
| 163 | Ga0070665_102400575 | 3300005548 | Bacteria | 530 |
| 164 | Ga0070704_100271835 | 3300005549 | Bacteria | 1400 |
| 165 | Ga0068855_100107261 | 3300005563 | Bacteria | 3209 |
| 166 | Ga0068855_100130222 | 3300005563 | Bacteria | 2874 |
| 167 | Ga0068855_100243740 | 3300005563 | Bacteria | 2007 |
| 168 | Ga0068855_100250102 | 3300005563 | Bacteria | 1977 |
| 169 | Ga0068855_100779407 | 3300005563 | Bacteria | 1018 |
| 170 | Ga0068855_100855162 | 3300005563 | Bacteria | 964 |
| 171 | Ga0068855_101249750 | 3300005563 | Bacteria | 770 |
| 172 | Ga0068855_101455680 | 3300005563 | Bacteria | 704 |
| 173 | Ga0070664_100126011 | 3300005564 | Bacteria | 2247 |
| 174 | Ga0068857_100199140 | 3300005577 | Bacteria | 1825 |
| 175 | Ga0068857_100233289 | 3300005577 | Bacteria | 1683 |
| 176 | Ga0068857_100742562 | 3300005577 | Bacteria | 934 |
| 177 | Ga0068854_100063189 | 3300005578 | Bacteria | 2687 |
| 178 | Ga0068854_100064694 | 3300005578 | Bacteria | 2657 |
| 179 | Ga0068854_100077690 | 3300005578 | Bacteria | 2443 |
| 180 | Ga0068854_100126778 | 3300005578 | Bacteria | 1945 |
| 181 | Ga0068854_100184482 | 3300005578 | Bacteria | 1631 |
| 182 | Ga0068854_100272890 | 3300005578 | Bacteria | 1359 |
| 183 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 184 | Ga0068856_100002036 | 3300005614 | Bacteria | 20996 |
| 185 | Ga0068856_100023673 | 3300005614 | Bacteria | 5971 |
| 186 | Ga0068856_100049006 | 3300005614 | Bacteria | 4163 |
| 187 | Ga0068856_100129943 | 3300005614 | Bacteria | 2523 |
| 188 | Ga0068856_100150564 | 3300005614 | Bacteria | 2336 |
| 189 | Ga0068856_100343214 | 3300005614 | Bacteria | 1512 |
| 190 | Ga0068856_100852120 | 3300005614 | Bacteria | 930 |
| 191 | Ga0068856_101640490 | 3300005614 | Bacteria | 656 |
| 192 | Ga0070702_100026334 | 3300005615 | Bacteria | 3124 |
| 193 | Ga0068852_100144875 | 3300005616 | Bacteria | 2202 |
| 194 | Ga0068852_100571491 | 3300005616 | Bacteria | 1132 |
| 195 | Ga0068852_100590158 | 3300005616 | Bacteria | 1114 |
| 196 | Ga0068852_101391581 | 3300005616 | Bacteria | 723 |
| 197 | Ga0068859_100142154 | 3300005617 | Bacteria | 2473 |
| 198 | Ga0068859_100286671 | 3300005617 | Bacteria | 1740 |
| 199 | Ga0068864_100065929 | 3300005618 | Bacteria | 3141 |
| 200 | Ga0068864_100084851 | 3300005618 | Bacteria | 2783 |
| 201 | Ga0068864_100389493 | 3300005618 | Bacteria | 1322 |
| 202 | Ga0068864_100491185 | 3300005618 | Bacteria | 1180 |
| 203 | Ga0068866_10679990 | 3300005718 | Bacteria | 704 |
| 204 | Ga0068861_100068901 | 3300005719 | Bacteria | 2735 |
| 205 | Ga0068861_100236282 | 3300005719 | Bacteria | 1552 |
| 206 | Ga0068861_100952270 | 3300005719 | Bacteria | 816 |
| 207 | Ga0068861_100988474 | 3300005719 | Bacteria | 802 |
| 208 | Ga0068851_10006976 | 3300005834 | Bacteria | 5180 |
| 209 | Ga0068851_10318005 | 3300005834 | Bacteria | 899 |
| 210 | Ga0068851_10417729 | 3300005834 | Bacteria | 792 |
| 211 | Ga0068870_10082280 | 3300005840 | Bacteria | 1782 |
| 212 | Ga0068863_100104494 | 3300005841 | Bacteria | 2694 |
| 213 | Ga0068863_100334870 | 3300005841 | Bacteria | 1472 |
| 214 | Ga0068863_100437314 | 3300005841 | Bacteria | 1282 |
| 215 | Ga0068863_100600051 | 3300005841 | Bacteria | 1090 |
| 216 | Ga0068858_100052617 | 3300005842 | Bacteria | 3767 |
| 217 | Ga0068858_100104845 | 3300005842 | Bacteria | 2638 |
| 218 | Ga0068858_100142352 | 3300005842 | Bacteria | 2252 |
| 219 | Ga0068858_100219263 | 3300005842 | Bacteria | 1801 |
| 220 | Ga0068858_100222596 | 3300005842 | Bacteria | 1787 |
| 221 | Ga0068858_100226013 | 3300005842 | Bacteria | 1773 |
| 222 | Ga0068858_100240836 | 3300005842 | Bacteria | 1716 |
| 223 | Ga0068858_100468892 | 3300005842 | Bacteria | 1214 |
| 224 | Ga0068860_100000543 | 3300005843 | Bacteria | 45937 |
| 225 | Ga0068860_100148500 | 3300005843 | Bacteria | 2256 |
| 226 | Ga0068860_100154933 | 3300005843 | Bacteria | 2208 |
| 227 | Ga0068862_101215715 | 3300005844 | Bacteria | 752 |
| 228 | Ga0081455_10005036 | 3300005937 | Bacteria | 14601 |
| 229 | Ga0081455_10006141 | 3300005937 | Bacteria | 12978 |
| 230 | Ga0081455_10012018 | 3300005937 | Bacteria | 8664 |
| 231 | Ga0081455_10032421 | 3300005937 | Bacteria | 4707 |
| 232 | Ga0081455_10053843 | 3300005937 | Bacteria | 3435 |
| 233 | Ga0081455_10067710 | 3300005937 | Bacteria | 2974 |
| 234 | Ga0081538_10030894 | 3300005981 | Bacteria | 3626 |
| 235 | Ga0081538_10094308 | 3300005981 | Bacteria | 1533 |
| 236 | Ga0081540_1003764 | 3300005983 | Bacteria | 11882 |
| 237 | Ga0081540_1004015 | 3300005983 | Bacteria | 11394 |
| 238 | Ga0081540_1005838 | 3300005983 | Bacteria | 9103 |
| 239 | Ga0081540_1005865 | 3300005983 | Bacteria | 9086 |
| 240 | Ga0081540_1006857 | 3300005983 | Bacteria | 8222 |
| 241 | Ga0081540_1009326 | 3300005983 | Bacteria | 6768 |
| 242 | Ga0081540_1013901 | 3300005983 | Bacteria | 5199 |
| 243 | Ga0081540_1015784 | 3300005983 | Bacteria | 4764 |
| 244 | Ga0081540_1023846 | 3300005983 | Bacteria | 3566 |
| 245 | Ga0081540_1024265 | 3300005983 | Bacteria | 3522 |
| 246 | Ga0081540_1029953 | 3300005983 | Bacteria | 3022 |
| 247 | Ga0081540_1035231 | 3300005983 | Bacteria | 2687 |
| 248 | Ga0081540_1056247 | 3300005983 | Bacteria | 1911 |
| 249 | Ga0081540_1094487 | 3300005983 | Bacteria | 1306 |
| 250 | Ga0081540_1134583 | 3300005983 | Bacteria | 1003 |
| 251 | Ga0081540_1183712 | 3300005983 | Bacteria | 779 |
| 252 | Ga0081539_10000585 | 3300005985 | Bacteria | 74791 |
| 253 | Ga0081539_10006073 | 3300005985 | Bacteria | 11812 |
| 254 | Ga0081539_10085162 | 3300005985 | Bacteria | 1650 |
| 255 | Ga0081539_10256092 | 3300005985 | Bacteria | 775 |
| 256 | Ga0070717_10028586 | 3300006028 | Bacteria | 4464 |
| 257 | Ga0070717_10051868 | 3300006028 | Bacteria | 3378 |
| 258 | Ga0070717_10202597 | 3300006028 | Bacteria | 1739 |
| 259 | Ga0070717_10947944 | 3300006028 | Bacteria | 784 |
| 260 | Ga0070717_11097200 | 3300006028 | Bacteria | 725 |
| 261 | Ga0070717_11111106 | 3300006028 | Bacteria | 720 |
| 262 | Ga0075365_10013400 | 3300006038 | Bacteria | 4901 |
| 263 | Ga0075365_10028198 | 3300006038 | Bacteria | 3579 |
| 264 | Ga0075365_10059311 | 3300006038 | Bacteria | 2550 |
| 265 | Ga0075365_10085140 | 3300006038 | Bacteria | 2147 |
| 266 | Ga0075365_10104372 | 3300006038 | Bacteria | 1943 |
| 267 | Ga0075365_10125516 | 3300006038 | Bacteria | 1773 |
| 268 | Ga0075365_10182498 | 3300006038 | Bacteria | 1467 |
| 269 | Ga0075365_10189421 | 3300006038 | Bacteria | 1439 |
| 270 | Ga0075365_10265449 | 3300006038 | Bacteria | 1207 |
| 271 | Ga0075365_10313193 | 3300006038 | Bacteria | 1105 |
| 272 | Ga0075365_10484139 | 3300006038 | Bacteria | 874 |
| 273 | Ga0075368_10005666 | 3300006042 | Bacteria | 4312 |
| 274 | Ga0075368_10096087 | 3300006042 | Bacteria | 1214 |
| 275 | Ga0075368_10101761 | 3300006042 | Bacteria | 1180 |
| 276 | Ga0075368_10427174 | 3300006042 | Bacteria | 585 |
| 277 | Ga0075363_100021660 | 3300006048 | Bacteria | 3241 |
| 278 | Ga0075363_100214812 | 3300006048 | Bacteria | 1101 |
| 279 | Ga0075363_100281853 | 3300006048 | Bacteria | 962 |
| 280 | Ga0075363_100359413 | 3300006048 | Bacteria | 851 |
| 281 | Ga0075363_100445348 | 3300006048 | Bacteria | 764 |
| 282 | Ga0075363_100473861 | 3300006048 | Bacteria | 741 |
| 283 | Ga0075364_10067065 | 3300006051 | Bacteria | 2358 |
| 284 | Ga0075364_10120053 | 3300006051 | Bacteria | 1759 |
| 285 | Ga0075364_10219000 | 3300006051 | Bacteria | 1291 |
| 286 | Ga0075364_10282442 | 3300006051 | Bacteria | 1129 |
| 287 | Ga0070715_10134483 | 3300006163 | Bacteria | 1194 |
| 288 | Ga0070715_10149762 | 3300006163 | Bacteria | 1142 |
| 289 | Ga0070716_100506455 | 3300006173 | Bacteria | 892 |
| 290 | Ga0070712_100008298 | 3300006175 | Bacteria | 6527 |
| 291 | Ga0070712_100025559 | 3300006175 | Bacteria | 3926 |
| 292 | Ga0070712_100043262 | 3300006175 | Bacteria | 3100 |
| 293 | Ga0070712_100663906 | 3300006175 | Bacteria | 887 |
| 294 | Ga0070712_100888627 | 3300006175 | Bacteria | 768 |
| 295 | Ga0075362_10045442 | 3300006177 | Bacteria | 1950 |
| 296 | Ga0075362_10051962 | 3300006177 | Bacteria | 1835 |
| 297 | Ga0075362_10116343 | 3300006177 | Bacteria | 1262 |
| 298 | Ga0075367_10004639 | 3300006178 | Bacteria | 6733 |
| 299 | Ga0075367_10026149 | 3300006178 | Bacteria | 3307 |
| 300 | Ga0075367_10094648 | 3300006178 | Bacteria | 1821 |
| 301 | Ga0075367_10180948 | 3300006178 | Bacteria | 1314 |
| 302 | Ga0075367_10352144 | 3300006178 | Bacteria | 929 |
| 303 | Ga0075369_10016546 | 3300006186 | Bacteria | 2978 |
| 304 | Ga0075369_10031782 | 3300006186 | Bacteria | 2230 |
| 305 | Ga0075369_10057521 | 3300006186 | Bacteria | 1691 |
| 306 | Ga0075369_10125612 | 3300006186 | Bacteria | 1163 |
| 307 | Ga0075366_10015283 | 3300006195 | Bacteria | 4396 |
| 308 | Ga0075366_10147749 | 3300006195 | Bacteria | 1423 |
| 309 | Ga0075366_10227491 | 3300006195 | Bacteria | 1136 |
| 310 | Ga0075366_10249960 | 3300006195 | Bacteria | 1081 |
| 311 | Ga0075366_10383386 | 3300006195 | Bacteria | 864 |
| 312 | Ga0097621_100378693 | 3300006237 | Bacteria | 1263 |
| 313 | Ga0097621_100515645 | 3300006237 | Bacteria | 1084 |
| 314 | Ga0097621_100892512 | 3300006237 | Bacteria | 828 |
| 315 | Ga0075370_10018061 | 3300006353 | Bacteria | 3821 |
| 316 | Ga0075370_10107592 | 3300006353 | Bacteria | 1617 |
| 317 | Ga0075370_10130719 | 3300006353 | Bacteria | 1465 |
| 318 | Ga0075370_10383285 | 3300006353 | Bacteria | 842 |
| 319 | Ga0075370_10400341 | 3300006353 | Bacteria | 823 |
| 320 | Ga0068871_100245345 | 3300006358 | Bacteria | 1558 |
| 321 | Ga0068871_100662671 | 3300006358 | Bacteria | 953 |
| 322 | Ga0075428_100709422 | 3300006844 | Bacteria | 1071 |
| 323 | Ga0075430_100184334 | 3300006846 | Bacteria | 1736 |
| 324 | Ga0075434_100297723 | 3300006871 | Bacteria | 1633 |
| 325 | Ga0075434_101292010 | 3300006871 | Bacteria | 741 |
| 326 | Ga0075429_100153011 | 3300006880 | Bacteria | 2020 |
| 327 | Ga0068865_100093045 | 3300006881 | Bacteria | 2191 |
| 328 | Ga0075436_100297621 | 3300006914 | Bacteria | 1156 |
| 329 | Ga0075436_100496251 | 3300006914 | Bacteria | 893 |
| 330 | Ga0097620_100070150 | 3300006931 | Bacteria | 3540 |
| 331 | Ga0097620_100142152 | 3300006931 | Bacteria | 2473 |
| 332 | Ga0097620_100286663 | 3300006931 | Bacteria | 1740 |
| 333 | Ga0075435_100363348 | 3300007076 | Bacteria | 1242 |
| 334 | Ga0075435_100827196 | 3300007076 | Bacteria | 807 |
| 335 | Ga0099794_10081198 | 3300007265 | Bacteria | 1600 |
| 336 | Ga0099795_10299093 | 3300007788 | Bacteria | 707 |
| 337 | Ga0099795_10303414 | 3300007788 | Bacteria | 703 |
| 338 | Ga0105251_10137145 | 3300009011 | Bacteria | 1107 |
| 339 | Ga0105251_10329894 | 3300009011 | Bacteria | 694 |
| 340 | Ga0105244_10292586 | 3300009036 | Bacteria | 754 |
| 341 | Ga0105250_10052188 | 3300009092 | Bacteria | 1641 |
| 342 | Ga0105240_10004881 | 3300009093 | Bacteria | 20178 |
| 343 | Ga0105240_10022030 | 3300009093 | Bacteria | 8460 |
| 344 | Ga0105240_10055436 | 3300009093 | Bacteria | 4962 |
| 345 | Ga0105240_10178270 | 3300009093 | Bacteria | 2510 |
| 346 | Ga0105240_10196901 | 3300009093 | Bacteria | 2364 |
| 347 | Ga0111539_10768888 | 3300009094 | Bacteria | 1121 |
| 348 | Ga0105245_10082903 | 3300009098 | Bacteria | 2934 |
| 349 | Ga0105247_10013326 | 3300009101 | Bacteria | 4935 |
| 350 | Ga0105247_10053876 | 3300009101 | Bacteria | 2482 |
| 351 | Ga0105247_10083743 | 3300009101 | Bacteria | 2015 |
| 352 | Ga0105247_10173764 | 3300009101 | Bacteria | 1434 |
| 353 | Ga0105247_10196167 | 3300009101 | Bacteria | 1354 |
| 354 | Ga0105247_10206311 | 3300009101 | Bacteria | 1323 |
| 355 | Ga0105247_11283193 | 3300009101 | Bacteria | 587 |
| 356 | Ga0114129_11068240 | 3300009147 | Bacteria | 1012 |
| 357 | Ga0105243_10313425 | 3300009148 | Bacteria | 1426 |
| 358 | Ga0105243_10321370 | 3300009148 | Bacteria | 1410 |
| 359 | Ga0105241_10001011 | 3300009174 | Bacteria | 21377 |
| 360 | Ga0105241_10098771 | 3300009174 | Bacteria | 2317 |
| 361 | Ga0105242_10052705 | 3300009176 | Bacteria | 3321 |
| 362 | Ga0105242_10138449 | 3300009176 | Bacteria | 2109 |
| 363 | Ga0105242_11419862 | 3300009176 | Bacteria | 722 |
| 364 | Ga0105248_10050701 | 3300009177 | Bacteria | 4656 |
| 365 | Ga0105248_10076907 | 3300009177 | Bacteria | 3751 |
| 366 | Ga0105248_10284311 | 3300009177 | Bacteria | 1862 |
| 367 | Ga0105248_10340817 | 3300009177 | Bacteria | 1688 |
| 368 | Ga0105248_11565230 | 3300009177 | Bacteria | 747 |
| 369 | Ga0105248_11840372 | 3300009177 | Bacteria | 687 |
| 370 | Ga0105237_10030019 | 3300009545 | Bacteria | 5523 |
| 371 | Ga0105237_10080441 | 3300009545 | Bacteria | 3249 |
| 372 | Ga0105237_10085961 | 3300009545 | Bacteria | 3135 |
| 373 | Ga0105237_10148901 | 3300009545 | Bacteria | 2336 |
| 374 | Ga0105237_10175188 | 3300009545 | Bacteria | 2145 |
| 375 | Ga0105237_10198097 | 3300009545 | Bacteria | 2008 |
| 376 | Ga0105237_10250743 | 3300009545 | Bacteria | 1772 |
| 377 | Ga0105237_10368248 | 3300009545 | Bacteria | 1442 |
| 378 | Ga0105237_10408376 | 3300009545 | Bacteria | 1363 |
| 379 | Ga0105237_11563517 | 3300009545 | Bacteria | 666 |
| 380 | Ga0105238_10001743 | 3300009551 | Bacteria | 21842 |
| 381 | Ga0105238_10004073 | 3300009551 | Bacteria | 14490 |
| 382 | Ga0105238_10076517 | 3300009551 | Bacteria | 3338 |
| 383 | Ga0105238_10095850 | 3300009551 | Bacteria | 2953 |
| 384 | Ga0105238_10475945 | 3300009551 | Bacteria | 1248 |
| 385 | Ga0105249_10021525 | 3300009553 | Bacteria | 5773 |
| 386 | Ga0105249_10138873 | 3300009553 | Bacteria | 2328 |
| 387 | Ga0105249_11562683 | 3300009553 | Bacteria | 732 |
| 388 | Ga0099796_10050035 | 3300010159 | Bacteria | 1447 |
| 389 | Ga0099796_10480559 | 3300010159 | Bacteria | 555 |
| 390 | Ga0105239_10014303 | 3300010375 | Bacteria | 8805 |
| 391 | Ga0105239_10025293 | 3300010375 | Bacteria | 6537 |
| 392 | Ga0105239_10032123 | 3300010375 | Bacteria | 5770 |
| 393 | Ga0105239_10149087 | 3300010375 | Bacteria | 2610 |
| 394 | Ga0105239_10202613 | 3300010375 | Bacteria | 2223 |
| 395 | Ga0105239_10300709 | 3300010375 | Bacteria | 1807 |
| 396 | Ga0105239_10314536 | 3300010375 | Bacteria | 1765 |
| 397 | Ga0105239_10549330 | 3300010375 | Bacteria | 1315 |
| 398 | Ga0105239_11323901 | 3300010375 | Bacteria | 831 |
| 399 | Ga0105246_10030767 | 3300011119 | Bacteria | 3548 |
| 400 | Ga0105246_10064349 | 3300011119 | Bacteria | 2561 |
| 401 | Ga0105246_10201239 | 3300011119 | Bacteria | 1548 |
| 402 | Ga0105246_10439702 | 3300011119 | Bacteria | 1093 |
| 403 | Ga0157336_1004394 | 3300012477 | Bacteria | 888 |
| 404 | Ga0157337_1002162 | 3300012483 | Bacteria | 1089 |
| 405 | Ga0157335_1008624 | 3300012492 | Bacteria | 786 |
| 406 | Ga0157341_1012094 | 3300012494 | Bacteria | 755 |
| 407 | Ga0157323_1006910 | 3300012495 | Bacteria | 805 |
| 408 | Ga0157314_1048444 | 3300012500 | Bacteria | 536 |
| 409 | Ga0157324_1008745 | 3300012506 | Bacteria | 822 |
| 410 | Ga0157373_10098153 | 3300013100 | Bacteria | 2062 |
| 411 | Ga0157373_10189650 | 3300013100 | Bacteria | 1449 |
| 412 | Ga0157371_10021912 | 3300013102 | Bacteria | 4689 |
| 413 | Ga0157370_10012254 | 3300013104 | Bacteria | 8903 |
| 414 | Ga0157370_10061921 | 3300013104 | Bacteria | 3550 |
| 415 | Ga0157370_10144710 | 3300013104 | Bacteria | 2214 |
| 416 | Ga0157370_10146307 | 3300013104 | Bacteria | 2200 |
| 417 | Ga0157369_10018060 | 3300013105 | Bacteria | 7911 |
| 418 | Ga0157369_10356237 | 3300013105 | Bacteria | 1519 |
| 419 | Ga0157369_10792865 | 3300013105 | Bacteria | 973 |
| 420 | Ga0157374_10094363 | 3300013296 | Bacteria | 2859 |
| 421 | Ga0157374_10113743 | 3300013296 | Bacteria | 2605 |
| 422 | Ga0157374_10608527 | 3300013296 | Bacteria | 1103 |
| 423 | Ga0157374_11022564 | 3300013296 | Bacteria | 846 |
| 424 | Ga0157374_11683894 | 3300013296 | Bacteria | 659 |
| 425 | Ga0157378_10002682 | 3300013297 | Bacteria | 15859 |
| 426 | Ga0157378_10056434 | 3300013297 | Bacteria | 3500 |
| 427 | Ga0157378_10451812 | 3300013297 | Bacteria | 1275 |
| 428 | Ga0157378_10644094 | 3300013297 | Bacteria | 1075 |
| 429 | Ga0163162_10187803 | 3300013306 | Bacteria | 2194 |
| 430 | Ga0163162_10271475 | 3300013306 | Bacteria | 1828 |
| 431 | Ga0163162_10396541 | 3300013306 | Bacteria | 1513 |
| 432 | Ga0163162_10467696 | 3300013306 | Bacteria | 1392 |
| 433 | Ga0163162_10656178 | 3300013306 | Bacteria | 1173 |
| 434 | Ga0157372_10069722 | 3300013307 | Bacteria | 3954 |
| 435 | Ga0157372_10278211 | 3300013307 | Bacteria | 1946 |
| 436 | Ga0157372_10557912 | 3300013307 | Bacteria | 1335 |
| 437 | Ga0157372_10559542 | 3300013307 | Bacteria | 1333 |
| 438 | Ga0157372_11715616 | 3300013307 | Bacteria | 722 |
| 439 | Ga0157375_10014388 | 3300013308 | Bacteria | 7056 |
| 440 | Ga0157375_10044068 | 3300013308 | Bacteria | 4331 |
| 441 | Ga0157375_12003884 | 3300013308 | Bacteria | 688 |
| 442 | Ga0163163_10108554 | 3300014325 | Bacteria | 2802 |
| 443 | Ga0163163_10109477 | 3300014325 | Bacteria | 2790 |
| 444 | Ga0163163_10119609 | 3300014325 | Bacteria | 2667 |
| 445 | Ga0163163_10370333 | 3300014325 | Bacteria | 1489 |
| 446 | Ga0163163_11577188 | 3300014325 | Bacteria | 718 |
| 447 | Ga0157380_10793653 | 3300014326 | Bacteria | 963 |
| 448 | Ga0157380_11589697 | 3300014326 | Bacteria | 709 |
| 449 | Ga0182008_10094769 | 3300014497 | Bacteria | 1473 |
| 450 | Ga0157379_10157542 | 3300014968 | Bacteria | 2049 |
| 451 | Ga0157379_10374052 | 3300014968 | Bacteria | 1307 |
| 452 | Ga0157376_10291071 | 3300014969 | Bacteria | 1542 |
| 453 | Ga0157376_12011778 | 3300014969 | Bacteria | 615 |
| 454 | Ga0182005_1056718 | 3300015265 | Bacteria | 1068 |
| 455 | Ga0163161_10054336 | 3300017792 | Bacteria | 2906 |
| 456 | Ga0163161_10346375 | 3300017792 | Bacteria | 1180 |
| 457 | Ga0163161_10432229 | 3300017792 | Bacteria | 1061 |
| 458 | Ga0163161_11122265 | 3300017792 | Bacteria | 677 |
| 459 | Ga0184595_129802 | 3300019166 | Bacteria | 624 |
| 460 | Ga0184601_116584 | 3300019183 | Bacteria | 628 |
| 461 | Ga0184601_135068 | 3300019183 | Bacteria | 553 |
| 462 | Ga0184599_119650 | 3300019188 | Bacteria | 575 |
| 463 | Ga0184600_141600 | 3300019190 | Bacteria | 709 |
| 464 | Ga0197907_11339043 | 3300020069 | Bacteria | 613 |
| 465 | Ga0206356_10346957 | 3300020070 | Bacteria | 830 |
| 466 | Ga0206355_1436607 | 3300020076 | Bacteria | 775 |
| 467 | Ga0206353_11312172 | 3300020082 | Bacteria | 633 |
| 468 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 469 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 470 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 471 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 472 | Ga0213873_10179336 | 3300021358 | Bacteria | 649 |
| 473 | Ga0213872_10079111 | 3300021361 | Bacteria | 1478 |
| 474 | Ga0213876_10001491 | 3300021384 | Bacteria | 14550 |
| 475 | Ga0213875_10046868 | 3300021388 | Bacteria | 2028 |
| 476 | Ga0247555_102493 | 3300023539 | Bacteria | 615 |
| 477 | Ga0247550_102757 | 3300023660 | Bacteria | 611 |
| 478 | Ga0247527_111926 | 3300023664 | Bacteria | 600 |
| 479 | Ga0209563_104277 | 3300025230 | Bacteria | 2759 |
| 480 | Ga0207425_1023944 | 3300025245 | Bacteria | 1272 |
| 481 | Ga0209677_110545 | 3300025253 | Bacteria | 1525 |
| 482 | Ga0209148_1000672 | 3300025254 | Bacteria | 28919 |
| 483 | Ga0209233_1010915 | 3300025261 | Bacteria | 2696 |
| 484 | Ga0209233_1012117 | 3300025261 | Bacteria | 2512 |
| 485 | Ga0209233_1013292 | 3300025261 | Bacteria | 2354 |
| 486 | Ga0207666_1028629 | 3300025271 | Bacteria | 846 |
| 487 | Ga0209455_1013267 | 3300025272 | Bacteria | 1922 |
| 488 | Ga0209564_1000971 | 3300025295 | Bacteria | 36259 |
| 489 | Ga0209564_1049345 | 3300025295 | Bacteria | 1042 |
| 490 | Ga0209564_1050154 | 3300025295 | Bacteria | 1025 |
| 491 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 492 | Ga0209758_1007481 | 3300025297 | Bacteria | 7415 |
| 493 | Ga0209758_1009586 | 3300025297 | Bacteria | 5982 |
| 494 | Ga0209758_1009879 | 3300025297 | Bacteria | 5825 |
| 495 | Ga0209758_1018978 | 3300025297 | Bacteria | 3341 |
| 496 | Ga0209758_1031515 | 3300025297 | Bacteria | 2172 |
| 497 | Ga0209758_1032221 | 3300025297 | Bacteria | 2132 |
| 498 | Ga0209256_1005673 | 3300025299 | Bacteria | 7029 |
| 499 | Ga0207426_1008961 | 3300025302 | Bacteria | 3991 |
| 500 | Ga0209257_1005774 | 3300025304 | Bacteria | 8443 |
| 501 | Ga0207697_10052681 | 3300025315 | Bacteria | 1684 |
| 502 | Ga0207656_10129719 | 3300025321 | Bacteria | 1180 |
| 503 | Ga0207656_10169680 | 3300025321 | Bacteria | 1042 |
| 504 | Ga0207656_10520900 | 3300025321 | Bacteria | 604 |
| 505 | Ga0207653_10037282 | 3300025885 | Bacteria | 1585 |
| 506 | Ga0207682_10296969 | 3300025893 | Bacteria | 757 |
| 507 | Ga0207692_10002983 | 3300025898 | Bacteria | 6554 |
| 508 | Ga0207692_10016278 | 3300025898 | Bacteria | 3288 |
| 509 | Ga0207692_10058429 | 3300025898 | Bacteria | 1987 |
| 510 | Ga0207692_10181206 | 3300025898 | Bacteria | 1227 |
| 511 | Ga0207692_10531136 | 3300025898 | Bacteria | 750 |
| 512 | Ga0207692_10666405 | 3300025898 | Bacteria | 673 |
| 513 | Ga0207642_10096607 | 3300025899 | Bacteria | 1473 |
| 514 | Ga0207710_10015469 | 3300025900 | Bacteria | 3225 |
| 515 | Ga0207688_10021039 | 3300025901 | Bacteria | 3563 |
| 516 | Ga0207680_10533688 | 3300025903 | Bacteria | 837 |
| 517 | Ga0207680_10553326 | 3300025903 | Bacteria | 821 |
| 518 | Ga0207680_10777693 | 3300025903 | Bacteria | 686 |
| 519 | Ga0207647_10022659 | 3300025904 | Bacteria | 4168 |
| 520 | Ga0207647_10067001 | 3300025904 | Bacteria | 2176 |
| 521 | Ga0207647_10285510 | 3300025904 | Bacteria | 941 |
| 522 | Ga0207699_10001381 | 3300025906 | Bacteria | 11546 |
| 523 | Ga0207699_10010672 | 3300025906 | Bacteria | 4619 |
| 524 | Ga0207699_10340301 | 3300025906 | Bacteria | 1057 |
| 525 | Ga0207645_10075858 | 3300025907 | Bacteria | 2152 |
| 526 | Ga0207645_10104548 | 3300025907 | Bacteria | 1829 |
| 527 | Ga0207643_10099208 | 3300025908 | Bacteria | 1707 |
| 528 | Ga0207705_10327578 | 3300025909 | Bacteria | 1177 |
| 529 | Ga0207705_10431236 | 3300025909 | Bacteria | 1021 |
| 530 | Ga0207684_10295307 | 3300025910 | Bacteria | 1397 |
| 531 | Ga0207654_10000468 | 3300025911 | Bacteria | 23099 |
| 532 | Ga0207654_10033630 | 3300025911 | Bacteria | 2843 |
| 533 | Ga0207654_10077665 | 3300025911 | Bacteria | 1991 |
| 534 | Ga0207654_10125342 | 3300025911 | Bacteria | 1619 |
| 535 | Ga0207707_10000386 | 3300025912 | Bacteria | 46013 |
| 536 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 537 | Ga0207707_10109693 | 3300025912 | Bacteria | 2412 |
| 538 | Ga0207707_10585625 | 3300025912 | Bacteria | 945 |
| 539 | Ga0207707_10921723 | 3300025912 | Bacteria | 721 |
| 540 | Ga0207695_10001480 | 3300025913 | Bacteria | 39293 |
| 541 | Ga0207695_10390884 | 3300025913 | Bacteria | 1276 |
| 542 | Ga0207671_10101317 | 3300025914 | Bacteria | 2182 |
| 543 | Ga0207671_10116065 | 3300025914 | Bacteria | 2042 |
| 544 | Ga0207671_10163523 | 3300025914 | Bacteria | 1725 |
| 545 | Ga0207671_10165850 | 3300025914 | Bacteria | 1713 |
| 546 | Ga0207671_10248006 | 3300025914 | Bacteria | 1400 |
| 547 | Ga0207671_10510307 | 3300025914 | Bacteria | 959 |
| 548 | Ga0207671_10616271 | 3300025914 | Bacteria | 865 |
| 549 | Ga0207671_11062931 | 3300025914 | Bacteria | 637 |
| 550 | Ga0207693_10025202 | 3300025915 | Bacteria | 4716 |
| 551 | Ga0207693_10030083 | 3300025915 | Bacteria | 4287 |
| 552 | Ga0207693_10058734 | 3300025915 | Bacteria | 3013 |
| 553 | Ga0207693_10104955 | 3300025915 | Bacteria | 2216 |
| 554 | Ga0207663_10020005 | 3300025916 | Bacteria | 3784 |
| 555 | Ga0207663_10026864 | 3300025916 | Bacteria | 3346 |
| 556 | Ga0207663_10048221 | 3300025916 | Bacteria | 2635 |
| 557 | Ga0207663_10074325 | 3300025916 | Bacteria | 2202 |
| 558 | Ga0207663_10286215 | 3300025916 | Bacteria | 1226 |
| 559 | Ga0207660_10000887 | 3300025917 | Bacteria | 19699 |
| 560 | Ga0207660_10020990 | 3300025917 | Bacteria | 4389 |
| 561 | Ga0207660_10065453 | 3300025917 | Bacteria | 2627 |
| 562 | Ga0207660_10067863 | 3300025917 | Bacteria | 2585 |
| 563 | Ga0207662_10082475 | 3300025918 | Bacteria | 1964 |
| 564 | Ga0207662_10333127 | 3300025918 | Bacteria | 1016 |
| 565 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 566 | Ga0207657_10036976 | 3300025919 | Bacteria | 4366 |
| 567 | Ga0207657_10065225 | 3300025919 | Bacteria | 3105 |
| 568 | Ga0207657_10135259 | 3300025919 | Bacteria | 2017 |
| 569 | Ga0207657_11231683 | 3300025919 | Bacteria | 568 |
| 570 | Ga0207649_10093891 | 3300025920 | Bacteria | 1970 |
| 571 | Ga0207649_10366562 | 3300025920 | Bacteria | 1070 |
| 572 | Ga0207649_11316394 | 3300025920 | Bacteria | 571 |
| 573 | Ga0207652_10053035 | 3300025921 | Bacteria | 3483 |
| 574 | Ga0207652_10076797 | 3300025921 | Bacteria | 2913 |
| 575 | Ga0207652_10432150 | 3300025921 | Bacteria | 1187 |
| 576 | Ga0207652_10679409 | 3300025921 | Bacteria | 920 |
| 577 | Ga0207652_11038235 | 3300025921 | Bacteria | 719 |
| 578 | Ga0207681_10829963 | 3300025923 | Bacteria | 773 |
| 579 | Ga0207681_11143768 | 3300025923 | Bacteria | 654 |
| 580 | Ga0207694_10000136 | 3300025924 | Bacteria | 74908 |
| 581 | Ga0207694_10683096 | 3300025924 | Bacteria | 866 |
| 582 | Ga0207650_10325003 | 3300025925 | Bacteria | 1260 |
| 583 | Ga0207650_10545986 | 3300025925 | Bacteria | 971 |
| 584 | Ga0207687_10255587 | 3300025927 | Bacteria | 1395 |
| 585 | Ga0207700_10026090 | 3300025928 | Bacteria | 4070 |
| 586 | Ga0207700_10043132 | 3300025928 | Bacteria | 3312 |
| 587 | Ga0207700_10084384 | 3300025928 | Bacteria | 2490 |
| 588 | Ga0207700_10208204 | 3300025928 | Bacteria | 1652 |
| 589 | Ga0207700_10286764 | 3300025928 | Bacteria | 1418 |
| 590 | Ga0207700_10340516 | 3300025928 | Bacteria | 1304 |
| 591 | Ga0207664_10011265 | 3300025929 | Bacteria | 6344 |
| 592 | Ga0207664_10073307 | 3300025929 | Bacteria | 2763 |
| 593 | Ga0207664_10214384 | 3300025929 | Bacteria | 1667 |
| 594 | Ga0207664_10386272 | 3300025929 | Bacteria | 1243 |
| 595 | Ga0207664_10548649 | 3300025929 | Bacteria | 1037 |
| 596 | Ga0207664_10622360 | 3300025929 | Bacteria | 970 |
| 597 | Ga0207664_10855239 | 3300025929 | Bacteria | 817 |
| 598 | Ga0207644_10145803 | 3300025931 | Bacteria | 1827 |
| 599 | Ga0207690_10069163 | 3300025932 | Bacteria | 2428 |
| 600 | Ga0207690_10131980 | 3300025932 | Bacteria | 1829 |
| 601 | Ga0207706_10258032 | 3300025933 | Bacteria | 1522 |
| 602 | Ga0207686_10049076 | 3300025934 | Bacteria | 2618 |
| 603 | Ga0207686_10187654 | 3300025934 | Bacteria | 1471 |
| 604 | Ga0207686_10212848 | 3300025934 | Bacteria | 1390 |
| 605 | Ga0207686_10448393 | 3300025934 | Bacteria | 992 |
| 606 | Ga0207709_10250971 | 3300025935 | Bacteria | 1292 |
| 607 | Ga0207670_10891513 | 3300025936 | Bacteria | 745 |
| 608 | Ga0207669_10051215 | 3300025937 | Bacteria | 2472 |
| 609 | Ga0207669_10266158 | 3300025937 | Bacteria | 1285 |
| 610 | Ga0207669_10401877 | 3300025937 | Bacteria | 1073 |
| 611 | Ga0207704_10103541 | 3300025938 | Bacteria | 1904 |
| 612 | Ga0207665_10007889 | 3300025939 | Bacteria | 7031 |
| 613 | Ga0207665_10071628 | 3300025939 | Bacteria | 2366 |
| 614 | Ga0207665_10542820 | 3300025939 | Bacteria | 902 |
| 615 | Ga0207691_10048268 | 3300025940 | Bacteria | 3904 |
| 616 | Ga0207691_10342081 | 3300025940 | Bacteria | 1280 |
| 617 | Ga0207691_11046933 | 3300025940 | Bacteria | 680 |
| 618 | Ga0207711_10022786 | 3300025941 | Bacteria | 5240 |
| 619 | Ga0207711_10066864 | 3300025941 | Bacteria | 3109 |
| 620 | Ga0207711_10236216 | 3300025941 | Bacteria | 1675 |
| 621 | Ga0207689_10218876 | 3300025942 | Bacteria | 1573 |
| 622 | Ga0207661_10057962 | 3300025944 | Bacteria | 3116 |
| 623 | Ga0207661_10349837 | 3300025944 | Bacteria | 1333 |
| 624 | Ga0207661_11095126 | 3300025944 | Bacteria | 733 |
| 625 | Ga0207679_10095936 | 3300025945 | Bacteria | 2306 |
| 626 | Ga0207667_10067553 | 3300025949 | Bacteria | 3724 |
| 627 | Ga0207667_10086340 | 3300025949 | Bacteria | 3247 |
| 628 | Ga0207667_10114401 | 3300025949 | Bacteria | 2781 |
| 629 | Ga0207667_10116984 | 3300025949 | Bacteria | 2747 |
| 630 | Ga0207667_10121092 | 3300025949 | Bacteria | 2696 |
| 631 | Ga0207667_10362445 | 3300025949 | Bacteria | 1478 |
| 632 | Ga0207667_10708353 | 3300025949 | Bacteria | 1009 |
| 633 | Ga0207667_10875507 | 3300025949 | Bacteria | 891 |
| 634 | Ga0207667_10961465 | 3300025949 | Bacteria | 843 |
| 635 | Ga0207667_11218994 | 3300025949 | Bacteria | 731 |
| 636 | Ga0207651_10211442 | 3300025960 | Bacteria | 1562 |
| 637 | Ga0207712_10238503 | 3300025961 | Bacteria | 1464 |
| 638 | Ga0207712_10417571 | 3300025961 | Bacteria | 1131 |
| 639 | Ga0207712_10895107 | 3300025961 | Bacteria | 784 |
| 640 | Ga0207712_11695026 | 3300025961 | Bacteria | 567 |
| 641 | Ga0207668_10021619 | 3300025972 | Bacteria | 4105 |
| 642 | Ga0207668_10202012 | 3300025972 | Bacteria | 1583 |
| 643 | Ga0207668_10736949 | 3300025972 | Bacteria | 868 |
| 644 | Ga0207668_10853781 | 3300025972 | Bacteria | 808 |
| 645 | Ga0207640_10038275 | 3300025981 | Bacteria | 3025 |
| 646 | Ga0207640_10128290 | 3300025981 | Bacteria | 1829 |
| 647 | Ga0207640_10157239 | 3300025981 | Bacteria | 1677 |
| 648 | Ga0207640_10266409 | 3300025981 | Bacteria | 1338 |
| 649 | Ga0207640_10700434 | 3300025981 | Bacteria | 868 |
| 650 | Ga0207658_10026231 | 3300025986 | Bacteria | 4084 |
| 651 | Ga0207658_10570791 | 3300025986 | Bacteria | 1014 |
| 652 | Ga0207658_11113830 | 3300025986 | Bacteria | 721 |
| 653 | Ga0207658_11239127 | 3300025986 | Bacteria | 682 |
| 654 | Ga0207677_10042292 | 3300026023 | Bacteria | 3020 |
| 655 | Ga0207677_10086019 | 3300026023 | Bacteria | 2271 |
| 656 | Ga0207677_10123824 | 3300026023 | Bacteria | 1950 |
| 657 | Ga0207677_10626293 | 3300026023 | Bacteria | 947 |
| 658 | Ga0207703_10072541 | 3300026035 | Bacteria | 2846 |
| 659 | Ga0207703_10073571 | 3300026035 | Bacteria | 2827 |
| 660 | Ga0207703_10284721 | 3300026035 | Bacteria | 1502 |
| 661 | Ga0207703_10294615 | 3300026035 | Bacteria | 1478 |
| 662 | Ga0207703_10586882 | 3300026035 | Bacteria | 1053 |
| 663 | Ga0207703_10762167 | 3300026035 | Bacteria | 922 |
| 664 | Ga0207703_11128065 | 3300026035 | Bacteria | 753 |
| 665 | Ga0207639_10056384 | 3300026041 | Bacteria | 3011 |
| 666 | Ga0207639_10107023 | 3300026041 | Bacteria | 2271 |
| 667 | Ga0207639_10184900 | 3300026041 | Bacteria | 1776 |
| 668 | Ga0207639_10258006 | 3300026041 | Bacteria | 1523 |
| 669 | Ga0207639_10486672 | 3300026041 | Bacteria | 1125 |
| 670 | Ga0207639_10657954 | 3300026041 | Bacteria | 970 |
| 671 | Ga0207678_10035839 | 3300026067 | Bacteria | 4319 |
| 672 | Ga0207678_10121627 | 3300026067 | Bacteria | 2228 |
| 673 | Ga0207678_10132853 | 3300026067 | Bacteria | 2123 |
| 674 | Ga0207678_10397020 | 3300026067 | Bacteria | 1194 |
| 675 | Ga0207678_10401691 | 3300026067 | Bacteria | 1186 |
| 676 | Ga0207678_10761171 | 3300026067 | Bacteria | 854 |
| 677 | Ga0207708_10055363 | 3300026075 | Bacteria | 3024 |
| 678 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 679 | Ga0207702_10000688 | 3300026078 | Bacteria | 36556 |
| 680 | Ga0207702_10053029 | 3300026078 | Bacteria | 3433 |
| 681 | Ga0207702_10880150 | 3300026078 | Bacteria | 887 |
| 682 | Ga0207641_10181389 | 3300026088 | Bacteria | 1929 |
| 683 | Ga0207641_11759583 | 3300026088 | Bacteria | 622 |
| 684 | Ga0207648_10014624 | 3300026089 | Bacteria | 7245 |
| 685 | Ga0207648_10105614 | 3300026089 | Bacteria | 2471 |
| 686 | Ga0207676_10006429 | 3300026095 | Bacteria | 8303 |
| 687 | Ga0207676_10092423 | 3300026095 | Bacteria | 2488 |
| 688 | Ga0207676_10469317 | 3300026095 | Bacteria | 1190 |
| 689 | Ga0207676_10571703 | 3300026095 | Bacteria | 1082 |
| 690 | Ga0207674_10011177 | 3300026116 | Bacteria | 10096 |
| 691 | Ga0207674_10119218 | 3300026116 | Bacteria | 2608 |
| 692 | Ga0207674_10289970 | 3300026116 | Bacteria | 1585 |
| 693 | Ga0207674_10552509 | 3300026116 | Bacteria | 1112 |
| 694 | Ga0207674_10588818 | 3300026116 | Bacteria | 1074 |
| 695 | Ga0207674_10697076 | 3300026116 | Bacteria | 980 |
| 696 | Ga0207683_10015315 | 3300026121 | Bacteria | 6530 |
| 697 | Ga0207683_10103193 | 3300026121 | Bacteria | 2547 |
| 698 | Ga0207698_10042920 | 3300026142 | Bacteria | 3384 |
| 699 | Ga0207698_10116835 | 3300026142 | Bacteria | 2249 |
| 700 | Ga0207698_10134117 | 3300026142 | Bacteria | 2121 |
| 701 | Ga0207698_10416383 | 3300026142 | Bacteria | 1288 |
| 702 | Ga0207698_11168659 | 3300026142 | Bacteria | 783 |
| 703 | Ga0207698_12042653 | 3300026142 | Bacteria | 587 |
| 704 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 705 | Ga0209389_1000120 | 3300027296 | Bacteria | 70535 |
| 706 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 707 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 708 | Ga0209489_100742 | 3300027361 | Bacteria | 64218 |
| 709 | Ga0209700_100134 | 3300027363 | Bacteria | 112846 |
| 710 | Ga0209179_1008998 | 3300027512 | Bacteria | 1699 |
| 711 | Ga0209179_1038088 | 3300027512 | Bacteria | 1006 |
| 712 | Ga0209588_1013577 | 3300027671 | Bacteria | 2485 |
| 713 | Ga0209813_10022272 | 3300027866 | Bacteria | 1790 |
| 714 | Ga0209813_10076709 | 3300027866 | Bacteria | 1097 |
| 715 | Ga0207428_10618016 | 3300027907 | Bacteria | 780 |
| 716 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 717 | Ga0268266_10067714 | 3300028379 | Bacteria | 3090 |
| 718 | Ga0268266_10109126 | 3300028379 | Bacteria | 2450 |
| 719 | Ga0268266_10121335 | 3300028379 | Bacteria | 2326 |
| 720 | Ga0268266_10192392 | 3300028379 | Bacteria | 1863 |
| 721 | Ga0268266_10212435 | 3300028379 | Bacteria | 1775 |
| 722 | Ga0268266_10290107 | 3300028379 | Bacteria | 1524 |
| 723 | Ga0268266_10330486 | 3300028379 | Bacteria | 1428 |
| 724 | Ga0268266_10437635 | 3300028379 | Bacteria | 1241 |
| 725 | Ga0268266_11013333 | 3300028379 | Bacteria | 803 |
| 726 | Ga0268266_11230077 | 3300028379 | Bacteria | 724 |
| 727 | Ga0268265_10076118 | 3300028380 | Bacteria | 2631 |
| 728 | Ga0268264_10000185 | 3300028381 | Bacteria | 131374 |
| 729 | Ga0268264_10072563 | 3300028381 | Bacteria | 2919 |
| 730 | Ga0268264_12074603 | 3300028381 | Bacteria | 577 |
| 731 | Ga0265334_10005906 | 3300028573 | Bacteria | 5325 |
| 732 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 733 | Ga0307515_10016400 | 3300028794 | Bacteria | 13559 |
| 734 | Ga0307515_10319246 | 3300028794 | Bacteria | 1221 |
| 735 | Ga0265338_11010540 | 3300028800 | Bacteria | 563 |
| 736 | Ga0307511_10033050 | 3300030521 | Bacteria | 4578 |
| 737 | Ga0307511_10114077 | 3300030521 | Bacteria | 1705 |
| 738 | Ga0307512_10311289 | 3300030522 | Bacteria | 724 |
| 739 | Ga0265766_1009582 | 3300030863 | Bacteria | 680 |
| 740 | Ga0265770_1056325 | 3300030878 | Bacteria | 722 |
| 741 | Ga0265760_10135028 | 3300031090 | Bacteria | 800 |
| 742 | Ga0265330_10025088 | 3300031235 | Bacteria | 2703 |
| 743 | Ga0265330_10027675 | 3300031235 | Bacteria | 2560 |
| 744 | Ga0265330_10046914 | 3300031235 | Bacteria | 1902 |
| 745 | Ga0265330_10143046 | 3300031235 | Bacteria | 1017 |
| 746 | Ga0265332_10020705 | 3300031238 | Bacteria | 2905 |
| 747 | Ga0265328_10045647 | 3300031239 | Bacteria | 1611 |
| 748 | Ga0265325_10073023 | 3300031241 | Bacteria | 1718 |
| 749 | Ga0265329_10085283 | 3300031242 | Bacteria | 1001 |
| 750 | Ga0265329_10088338 | 3300031242 | Bacteria | 983 |
| 751 | Ga0265340_10003780 | 3300031247 | Bacteria | 8527 |
| 752 | Ga0265339_10041054 | 3300031249 | Bacteria | 2570 |
| 753 | Ga0265339_10149432 | 3300031249 | Bacteria | 1183 |
| 754 | Ga0265331_10030929 | 3300031250 | Bacteria | 2663 |
| 755 | Ga0265316_10120267 | 3300031344 | Bacteria | 1984 |
| 756 | Ga0307513_10258126 | 3300031456 | Bacteria | 1534 |
| 757 | Ga0307513_10269695 | 3300031456 | Bacteria | 1486 |
| 758 | Ga0307509_10192424 | 3300031507 | Bacteria | 1889 |
| 759 | Ga0307509_10201925 | 3300031507 | Bacteria | 1823 |
| 760 | Ga0307509_10279568 | 3300031507 | Bacteria | 1431 |
| 761 | Ga0307509_10314853 | 3300031507 | Bacteria | 1305 |
| 762 | Ga0307509_10783763 | 3300031507 | Bacteria | 618 |
| 763 | Ga0307408_101629302 | 3300031548 | Bacteria | 613 |
| 764 | Ga0265313_10007792 | 3300031595 | Bacteria | 7234 |
| 765 | Ga0265313_10102201 | 3300031595 | Bacteria | 1271 |
| 766 | Ga0307508_10027398 | 3300031616 | Bacteria | 5158 |
| 767 | Ga0307508_10054901 | 3300031616 | Bacteria | 3529 |
| 768 | Ga0307508_10142818 | 3300031616 | Bacteria | 1997 |
| 769 | Ga0307508_10179015 | 3300031616 | Bacteria | 1723 |
| 770 | Ga0265314_10034496 | 3300031711 | Bacteria | 3699 |
| 771 | Ga0265314_10231505 | 3300031711 | Bacteria | 1071 |
| 772 | Ga0265314_10247378 | 3300031711 | Bacteria | 1025 |
| 773 | Ga0265342_10003016 | 3300031712 | Bacteria | 14114 |
| 774 | Ga0265342_10163286 | 3300031712 | Bacteria | 1230 |
| 775 | Ga0307516_10018054 | 3300031730 | Bacteria | 7339 |
| 776 | Ga0307516_10087197 | 3300031730 | Bacteria | 2956 |
| 777 | Ga0307516_10181324 | 3300031730 | Bacteria | 1839 |
| 778 | Ga0307516_10248542 | 3300031730 | Bacteria | 1474 |
| 779 | Ga0307516_10285423 | 3300031730 | Bacteria | 1331 |
| 780 | Ga0307405_11404721 | 3300031731 | Bacteria | 610 |
| 781 | Ga0316044_116803 | 3300031810 | Bacteria | 795 |
| 782 | Ga0316045_119733 | 3300031815 | Bacteria | 652 |
| 783 | Ga0307413_10067220 | 3300031824 | Bacteria | 2240 |
| 784 | Ga0307410_10883114 | 3300031852 | Bacteria | 765 |
| 785 | Ga0307410_11234063 | 3300031852 | Bacteria | 652 |
| 786 | Ga0307406_11865368 | 3300031901 | Bacteria | 535 |
| 787 | Ga0307407_10089969 | 3300031903 | Bacteria | 1879 |
| 788 | Ga0307412_10041561 | 3300031911 | Bacteria | 2981 |
| 789 | Ga0307416_100347484 | 3300032002 | Bacteria | 1499 |
| 790 | Ga0307416_100808858 | 3300032002 | Bacteria | 1033 |
| 791 | Ga0307414_10291570 | 3300032004 | Bacteria | 1376 |
| 792 | Ga0307414_10634989 | 3300032004 | Bacteria | 961 |
| 793 | Ga0307411_10146037 | 3300032005 | Bacteria | 1751 |
| 794 | Ga0307411_10608888 | 3300032005 | Bacteria | 940 |
| 795 | Ga0316053_111976 | 3300032120 | Bacteria | 617 |
| 796 | Ga0307415_100048349 | 3300032126 | Bacteria | 2870 |
| 797 | Ga0307415_100520667 | 3300032126 | Bacteria | 1044 |
| 798 | Ga0307415_100585758 | 3300032126 | Bacteria | 990 |
| 799 | Ga0307507_10014035 | 3300033179 | Bacteria | 9619 |
| 800 | Ga0307507_10361650 | 3300033179 | Bacteria | 847 |
| 801 | Ga0307507_10362116 | 3300033179 | Bacteria | 846 |
| 802 | Ga0307510_10047477 | 3300033180 | Bacteria | 4599 |
| 803 | Ga0307510_10061680 | 3300033180 | Bacteria | 3840 |
| 804 | Ga0307510_10325426 | 3300033180 | Bacteria | 993 |
| 805 | Ga0315911_1000022 | 3300033442 | Bacteria | 118114 |
| 806 | Ga0316215_1001011 | 3300033544 | Bacteria | 2731 |
| 807 | Ga0373959_0098391 | 3300034820 | Bacteria | 694 |
| 808 | Ga0373938_0011772 | 3300034957 | Bacteria | 1633 |
| 809 | Ga0373926_0018331 | 3300035083 | Bacteria | 2406 |
| 810 | Ga0373926_0068981 | 3300035083 | Bacteria | 1297 |
| 811 | Ga0373926_0198761 | 3300035083 | Bacteria | 771 |
| 812 | Ga0373926_0334613 | 3300035083 | Bacteria | 593 |
| 813 | Ga0373928_0024614 | 3300035084 | Bacteria | 1292 |
| 814 | Ga0373928_0169218 | 3300035084 | Bacteria | 615 |
| 815 | Ga0373929_0052464 | 3300035085 | Bacteria | 935 |
| 816 | Ga0373934_0009072 | 3300035086 | Bacteria | 3721 |
| 817 | Ga0373934_0115232 | 3300035086 | Bacteria | 1092 |
| 818 | Ga0373940_0023822 | 3300035088 | Bacteria | 1583 |
| 819 | Ga0373944_0014978 | 3300035089 | Bacteria | 2171 |
| 820 | Ga0373944_0299376 | 3300035089 | Bacteria | 603 |
| 821 | Ga0373923_0011449 | 3300035111 | Bacteria | 3252 |
| 822 | Ga0373923_0025959 | 3300035111 | Bacteria | 2327 |
| 823 | Ga0373923_0055004 | 3300035111 | Bacteria | 1676 |
| 824 | Ga0373923_0092372 | 3300035111 | Bacteria | 1325 |
| 825 | Ga0373923_0472518 | 3300035111 | Bacteria | 609 |
| 826 | Ga0373932_0126544 | 3300035112 | Bacteria | 857 |
| 827 | Ga0373936_0000642 | 3300035113 | Bacteria | 12077 |
| 828 | Ga0373936_0021327 | 3300035113 | Bacteria | 2519 |
| 829 | Ga0373936_0361681 | 3300035113 | Bacteria | 662 |
| 830 | Ga0373941_0018775 | 3300035115 | Bacteria | 1915 |
| 831 | Ga0373945_0015097 | 3300035116 | Bacteria | 2596 |
| 832 | Ga0373945_0197663 | 3300035116 | Bacteria | 834 |
| 833 | Ga0373953_0000731 | 3300035117 | Bacteria | 9082 |
| 834 | Ga0373953_0030094 | 3300035117 | Bacteria | 2103 |
| 835 | Ga0373953_0040403 | 3300035117 | Bacteria | 1852 |
| 836 | Ga0373953_0060668 | 3300035117 | Bacteria | 1546 |
| 837 | Ga0373953_0227634 | 3300035117 | Bacteria | 808 |
| 838 | Ga0373954_0000496 | 3300035118 | Bacteria | 14775 |
| 839 | Ga0373954_0001719 | 3300035118 | Bacteria | 8964 |
| 840 | Ga0373954_0019062 | 3300035118 | Bacteria | 3092 |
| 841 | Ga0373954_0029859 | 3300035118 | Bacteria | 2513 |
| 842 | Ga0373954_0275395 | 3300035118 | Bacteria | 829 |
| 843 | Ga0373956_0002420 | 3300035119 | Bacteria | 7612 |
| 844 | Ga0373956_0015439 | 3300035119 | Bacteria | 3198 |
| 845 | Ga0373956_0066740 | 3300035119 | Bacteria | 1637 |
| 846 | Ga0373956_0259385 | 3300035119 | Bacteria | 826 |
| 847 | Ga0373957_0000218 | 3300035120 | Bacteria | 14250 |
| 848 | Ga0373957_0003907 | 3300035120 | Bacteria | 4475 |
| 849 | Ga0373957_0010840 | 3300035120 | Bacteria | 3025 |
| 850 | Ga0373957_0201047 | 3300035120 | Bacteria | 830 |
| 851 | Ga0373960_0063909 | 3300035121 | Bacteria | 1123 |
| 852 | Ga0373943_0000806 | 3300035170 | Bacteria | 13730 |
| 853 | Ga0373943_0009912 | 3300035170 | Bacteria | 4268 |
| 854 | Ga0373943_0050860 | 3300035170 | Bacteria | 2038 |
| 855 | Ga0373946_0002589 | 3300035171 | Bacteria | 6392 |
| 856 | Ga0373946_0005160 | 3300035171 | Bacteria | 4708 |
| 857 | Ga0373955_0003024 | 3300035172 | Bacteria | 7372 |
| 858 | Ga0373955_0006844 | 3300035172 | Bacteria | 5211 |
| 859 | Ga0373955_0039016 | 3300035172 | Bacteria | 2532 |
| 860 | Ga0373955_0061584 | 3300035172 | Bacteria | 2073 |
| 861 | Ga0373955_0124277 | 3300035172 | Bacteria | 1502 |
| 862 | Ga0373955_0357048 | 3300035172 | Bacteria | 885 |
| 863 | Ga0373961_0166916 | 3300035241 | Bacteria | 759 |
| 864 | Ga0373924_0001915 | 3300035410 | Bacteria | 6921 |
| 865 | Ga0373924_0005387 | 3300035410 | Bacteria | 4526 |
| 866 | Ga0373924_0041117 | 3300035410 | Bacteria | 1894 |
| 867 | Ga0373931_0000654 | 3300035691 | Bacteria | 14304 |
| 868 | Ga0373931_0051450 | 3300035691 | Bacteria | 2194 |
| 869 | Ga0373931_0219072 | 3300035691 | Bacteria | 1145 |
| 870 | Ga0373931_0337003 | 3300035691 | Bacteria | 941 |
| 871 | Ga0373935_0001176 | 3300035692 | Bacteria | 14365 |
| 872 | Ga0373935_0006965 | 3300035692 | Bacteria | 6749 |
| 873 | Ga0373935_0012134 | 3300035692 | Bacteria | 5182 |
| 874 | Ga0373935_0361161 | 3300035692 | Bacteria | 1037 |
| 875 | Ga0373935_1311443 | 3300035692 | Bacteria | 540 |
| 876 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 877 | Ga0373927_0015261 | 3300035695 | Bacteria | 5074 |
| 878 | Ga0373927_0021714 | 3300035695 | Bacteria | 4207 |
| 879 | Ga0373927_0027284 | 3300035695 | Bacteria | 3729 |
| 880 | Ga0373927_0068952 | 3300035695 | Bacteria | 2288 |
| 881 | Ga0373927_0283242 | 3300035695 | Bacteria | 1090 |
| 882 | Ga0373927_0369592 | 3300035695 | Bacteria | 945 |
| 883 | Ga0373927_0443969 | 3300035695 | Bacteria | 857 |
| 884 | Ga0373933_0000026 | 3300035724 | Bacteria | 90309 |
| 885 | Ga0373933_0001354 | 3300035724 | Bacteria | 14445 |
| 886 | Ga0373933_0011360 | 3300035724 | Bacteria | 4905 |
| 887 | Ga0373933_0038950 | 3300035724 | Bacteria | 2795 |
| 888 | Ga0373933_0048118 | 3300035724 | Bacteria | 2538 |
| 889 | Ga0373933_0049018 | 3300035724 | Bacteria | 2517 |
| 890 | Ga0373933_0406371 | 3300035724 | Bacteria | 888 |
| 891 | Ga0373947_0003991 | 3300035725 | Bacteria | 8665 |
| 892 | Ga0373947_0007461 | 3300035725 | Bacteria | 6329 |
| 893 | Ga0373947_0157312 | 3300035725 | Bacteria | 1467 |
| 894 | Ga0373947_0227647 | 3300035725 | Bacteria | 1227 |
| 895 | Ga0310104_11267 | 3300036242 | Bacteria | 719 |
| 896 | Ga0310104_14568 | 3300036242 | Bacteria | 615 |
| 897 | Ga0373937_0000356 | 3300036401 | Bacteria | 42503 |
| 898 | Ga0373937_0011908 | 3300036401 | Bacteria | 7634 |
| 899 | Ga0373937_0023752 | 3300036401 | Bacteria | 5525 |
| 900 | Ga0373937_0039228 | 3300036401 | Bacteria | 4317 |
| 901 | Ga0373937_0048069 | 3300036401 | Bacteria | 3904 |
| 902 | Ga0373937_0051162 | 3300036401 | Bacteria | 3786 |
| 903 | Ga0373937_0075352 | 3300036401 | Bacteria | 3114 |
| 904 | Ga0373937_0192183 | 3300036401 | Bacteria | 1918 |
| 905 | Ga0373937_0720775 | 3300036401 | Bacteria | 944 |
| 906 | Ga0310112_041518 | 3300036458 | Bacteria | 625 |
| 907 | Ga0310112_043340 | 3300036458 | Bacteria | 611 |
| 908 | Ga0310109_025226 | 3300036534 | Bacteria | 797 |
| 909 | Ga0373925_0000462 | 3300037068 | Bacteria | 40936 |
| 910 | Ga0373925_0011487 | 3300037068 | Bacteria | 6408 |
| 911 | Ga0373925_0033423 | 3300037068 | Bacteria | 3790 |
| 912 | Ga0373925_0115773 | 3300037068 | Bacteria | 2076 |
| 913 | Ga0373925_0255216 | 3300037068 | Bacteria | 1407 |
| 914 | Ga0373925_0333023 | 3300037068 | Bacteria | 1230 |
| 915 | Ga0373925_0380369 | 3300037068 | Bacteria | 1149 |
| 916 | Ga0373925_0399786 | 3300037068 | Bacteria | 1120 |
| 917 | Ga0373925_1104536 | 3300037068 | Bacteria | 652 |
| 918 | Ga0395900_0009031 | 3300037418 | Bacteria | 10220 |
| 919 | Ga0395900_0158767 | 3300037418 | Bacteria | 2308 |
| 920 | Ga0395900_0453880 | 3300037418 | Bacteria | 1238 |
| 921 | Ga0395898_0008119 | 3300037466 | Bacteria | 11113 |
| 922 | Ga0395898_0113253 | 3300037466 | Bacteria | 2600 |
| 923 | Ga0395898_0151868 | 3300037466 | Bacteria | 2216 |
| 924 | Ga0395898_0348507 | 3300037466 | Bacteria | 1412 |
| 925 | Ga0395905_0003811 | 3300037471 | Bacteria | 15942 |
| 926 | Ga0395905_0024981 | 3300037471 | Bacteria | 5635 |
| 927 | Ga0395905_0489194 | 3300037471 | Bacteria | 1130 |
| 928 | Ga0436364_1112930 | 3300037853 | Bacteria | 3994 |
| 929 | Ga0395901_0190253 | 3300038443 | Bacteria | 2152 |
| 930 | Ga0395901_0430847 | 3300038443 | Bacteria | 1351 |
| 931 | Ga0436365_0042070 | 3300039437 | Bacteria | 803 |
| 932 | Ga0436365_0085392 | 3300039437 | Bacteria | 1248 |
| 933 | Ga0436365_0245742 | 3300039437 | Bacteria | 809 |
| 934 | Ga0436365_0266253 | 3300039437 | Bacteria | 1092 |
| 935 | Ga0436365_0380670 | 3300039437 | Bacteria | 1669 |
| 936 | Ga0436365_0405335 | 3300039437 | Bacteria | 642 |
| 937 | Ga0436365_0593482 | 3300039437 | Bacteria | 857 |
| 938 | Ga0436365_0594053 | 3300039437 | Bacteria | 722 |
| 939 | Ga0436365_0823182 | 3300039437 | Bacteria | 721 |
| 940 | Ga0436365_0921625 | 3300039437 | Bacteria | 24575 |
| 941 | Ga0436365_1532080 | 3300039437 | Bacteria | 1280 |
| 942 | Ga0436361_0999682 | 3300039447 | Bacteria | 526 |
| 943 | Ga0436363_0033464 | 3300039450 | Bacteria | 793 |
| 944 | Ga0436363_0726793 | 3300039450 | Bacteria | 1666 |
| 945 | Ga0436363_0767229 | 3300039450 | Bacteria | 1464 |
| 946 | Ga0436363_1660925 | 3300039450 | Bacteria | 2753 |
| 947 | Ga0436362_0629335 | 3300039453 | Bacteria | 3750 |
| 948 | Ga0436362_0985474 | 3300039453 | Bacteria | 776 |
| 949 | Ga0436362_1147499 | 3300039453 | Bacteria | 563 |
| 950 | Ga0439465_0125004 | 3300041413 | Bacteria | 904 |
| 951 | Ga0451789_0003421 | 3300041443 | Bacteria | 911 |
| 952 | Ga0451793_1933064 | 3300041452 | Bacteria | 2432 |
| 953 | Ga0451800_0254077 | 3300041459 | Bacteria | 1015 |
| 954 | Ga0451802_0631769 | 3300041460 | Bacteria | 650 |
| 955 | Ga0451802_0679946 | 3300041460 | Bacteria | 1027 |
| 956 | Ga0451802_1086364 | 3300041460 | Bacteria | 1630 |
| 957 | Ga0451804_0307913 | 3300041463 | Bacteria | 1464 |
| 958 | Ga0451807_0993385 | 3300041486 | Bacteria | 1044 |
| 959 | Ga0451807_1734372 | 3300041486 | Bacteria | 704 |
| 960 | Ga0451837_1625367 | 3300041494 | Bacteria | 1157 |
| 961 | Ga0451839_0776644 | 3300041496 | Bacteria | 930 |
| 962 | Ga0451841_0591288 | 3300041498 | Bacteria | 827 |
| 963 | Ga0451849_0032440 | 3300041505 | Bacteria | 953 |
| 964 | Ga0451851_0715062 | 3300041507 | Bacteria | 759 |
| 965 | Ga0451843_0159796 | 3300041509 | Bacteria | 883 |
| 966 | Ga0451853_2893679 | 3300041512 | Bacteria | 660 |
| 967 | Ga0451853_3226891 | 3300041512 | Bacteria | 1480 |
| 968 | Ga0439431_0255678 | 3300041997 | Bacteria | 520 |
| 969 | Ga0439448_0204978 | 3300042005 | Bacteria | 692 |
| 970 | Ga0439455_0134205 | 3300042012 | Bacteria | 699 |
| 971 | Ga0451577_0062346 | 3300042876 | Bacteria | 3325 |
| 972 | Ga0451577_0384233 | 3300042876 | Bacteria | 1274 |
| 973 | Ga0451577_0398228 | 3300042876 | Bacteria | 1249 |
| 974 | Ga0451577_0549311 | 3300042876 | Bacteria | 1049 |
| 975 | Ga0451577_0693797 | 3300042876 | Unclassified | 922 |
| 976 | Ga0451577_0715825 | 3300042876 | Bacteria | 906 |
| 977 | Ga0451577_1008073 | 3300042876 | Bacteria | 747 |
| 978 | Ga0466969_0158615 | 3300044656 | Bacteria | 1040 |
| 979 | Ga0466969_0313346 | 3300044656 | Bacteria | 710 |
| 980 | Ga0466972_0000274 | 3300044658 | Bacteria | 32491 |
| 981 | Ga0466972_0168721 | 3300044658 | Bacteria | 1027 |
| 982 | Ga0466965_0159700 | 3300044683 | Bacteria | 1181 |
| 983 | Ga0466965_0400087 | 3300044683 | Bacteria | 759 |
| 984 | Ga0466966_0366777 | 3300044684 | Bacteria | 865 |
| 985 | Ga0466963_0020169 | 3300044694 | Bacteria | 4190 |
| 986 | Ga0466964_0018182 | 3300044706 | Bacteria | 2695 |
| 987 | Ga0466964_0065526 | 3300044706 | Bacteria | 1522 |
| 988 | Ga0466964_0125688 | 3300044706 | Bacteria | 1161 |
| 989 | Ga0466964_0242361 | 3300044706 | Bacteria | 885 |
| 990 | Ga0453684_0001512 | 3300044712 | Bacteria | 65271 |
| 991 | Ga0453684_0008350 | 3300044712 | Bacteria | 18605 |
| 992 | Ga0453684_0171982 | 3300044712 | Bacteria | 2552 |
| 993 | Ga0453684_0269919 | 3300044712 | Bacteria | 1944 |
| 994 | Ga0466971_0108755 | 3300044719 | Bacteria | 1278 |
| 995 | Ga0466968_0063903 | 3300044735 | Bacteria | 1591 |
| 996 | Ga0466970_0056792 | 3300044765 | Bacteria | 2092 |
| 997 | Ga0466970_0329598 | 3300044765 | Bacteria | 864 |
| 998 | Ga0466957_0216315 | 3300044842 | Bacteria | 1264 |
| 999 | Ga0466960_0027592 | 3300044901 | Bacteria | 2591 |
| 1000 | Ga0466960_0601018 | 3300044901 | Bacteria | 653 |
| 1001 | Ga0466959_0492938 | 3300045049 | Bacteria | 828 |
| 1002 | Ga0451576_0066823 | 3300045051 | Bacteria | 3742 |
| 1003 | Ga0451576_0249144 | 3300045051 | Bacteria | 1856 |
| 1004 | Ga0451576_0271232 | 3300045051 | Bacteria | 1774 |
| 1005 | Ga0466967_0024320 | 3300045976 | Bacteria | 4978 |
| 1006 | Ga0466967_0040143 | 3300045976 | Bacteria | 4028 |
| 1007 | Ga0495627_067260 | 3300046453 | Bacteria | 1051 |
| 1008 | Ga0495592_0000090 | 3300046454 | Bacteria | 80171 |
| 1009 | Ga0495592_0001238 | 3300046454 | Bacteria | 17695 |
| 1010 | Ga0495592_0012178 | 3300046454 | Bacteria | 6527 |
| 1011 | Ga0495592_0051683 | 3300046454 | Bacteria | 3052 |
| 1012 | Ga0495592_0464700 | 3300046454 | Bacteria | 791 |
| 1013 | Ga0495592_0520146 | 3300046454 | Bacteria | 736 |
| 1014 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 1015 | Ga0495603_0024048 | 3300046455 | Bacteria | 3685 |
| 1016 | Ga0495603_0025337 | 3300046455 | Bacteria | 3587 |
| 1017 | Ga0495603_0052399 | 3300046455 | Bacteria | 2423 |
| 1018 | Ga0495603_0381656 | 3300046455 | Bacteria | 808 |
| 1019 | Ga0495603_0458406 | 3300046455 | Bacteria | 730 |
| 1020 | Ga0495603_0619393 | 3300046455 | Bacteria | 619 |
| 1021 | Ga0495591_049105 | 3300046458 | Bacteria | 1161 |
| 1022 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 1023 | Ga0495629_0000750 | 3300046459 | Bacteria | 26239 |
| 1024 | Ga0495629_0017208 | 3300046459 | Bacteria | 5185 |
| 1025 | Ga0495629_0116031 | 3300046459 | Bacteria | 1866 |
| 1026 | Ga0495629_0305515 | 3300046459 | Bacteria | 1089 |
| 1027 | Ga0495638_0010821 | 3300046460 | Bacteria | 6308 |
| 1028 | Ga0495638_0020879 | 3300046460 | Bacteria | 4324 |
| 1029 | Ga0495638_0195596 | 3300046460 | Bacteria | 1145 |
| 1030 | Ga0495638_0299920 | 3300046460 | Bacteria | 866 |
| 1031 | Ga0495641_0006669 | 3300046461 | Bacteria | 7421 |
| 1032 | Ga0495651_0000682 | 3300046462 | Bacteria | 26412 |
| 1033 | Ga0495651_0013418 | 3300046462 | Bacteria | 6336 |
| 1034 | Ga0495651_0014625 | 3300046462 | Bacteria | 6067 |
| 1035 | Ga0495653_0000322 | 3300046463 | Bacteria | 38965 |
| 1036 | Ga0495653_0007956 | 3300046463 | Bacteria | 8681 |
| 1037 | Ga0495653_0025338 | 3300046463 | Bacteria | 4769 |
| 1038 | Ga0495650_0072313 | 3300046471 | Bacteria | 1350 |
| 1039 | Ga0495580_0017526 | 3300046472 | Bacteria | 5355 |
| 1040 | Ga0495580_0082309 | 3300046472 | Bacteria | 2243 |
| 1041 | Ga0495580_0424619 | 3300046472 | Bacteria | 894 |
| 1042 | Ga0495582_0000025 | 3300046473 | Bacteria | 82063 |
| 1043 | Ga0495582_0428192 | 3300046473 | Bacteria | 764 |
| 1044 | Ga0495605_0046241 | 3300046474 | Bacteria | 2141 |
| 1045 | Ga0495639_0007403 | 3300046475 | Bacteria | 4714 |
| 1046 | Ga0495639_0047306 | 3300046475 | Bacteria | 1948 |
| 1047 | Ga0495639_0061595 | 3300046475 | Bacteria | 1721 |
| 1048 | Ga0495639_0077710 | 3300046475 | Bacteria | 1541 |
| 1049 | Ga0495639_0212430 | 3300046475 | Bacteria | 949 |
| 1050 | Ga0495639_0581458 | 3300046475 | Bacteria | 575 |
| 1051 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 1052 | Ga0495662_0059952 | 3300046476 | Bacteria | 1838 |
| 1053 | Ga0495662_0087373 | 3300046476 | Bacteria | 1519 |
| 1054 | Ga0495662_0332578 | 3300046476 | Bacteria | 747 |
| 1055 | Ga0495664_0000078 | 3300046477 | Bacteria | 47377 |
| 1056 | Ga0495664_0004145 | 3300046477 | Bacteria | 7913 |
| 1057 | Ga0495664_0004921 | 3300046477 | Bacteria | 7309 |
| 1058 | Ga0495664_0218356 | 3300046477 | Bacteria | 1154 |
| 1059 | Ga0495664_0222054 | 3300046477 | Bacteria | 1144 |
| 1060 | Ga0495584_0182774 | 3300046491 | Bacteria | 1065 |
| 1061 | Ga0495584_0205217 | 3300046491 | Bacteria | 1002 |
| 1062 | Ga0495585_0093083 | 3300046492 | Bacteria | 1621 |
| 1063 | Ga0495585_0248900 | 3300046492 | Bacteria | 887 |
| 1064 | Ga0495594_0002799 | 3300046499 | Bacteria | 9050 |
| 1065 | Ga0495594_0149558 | 3300046499 | Bacteria | 1326 |
| 1066 | Ga0495594_0212459 | 3300046499 | Bacteria | 1103 |
| 1067 | Ga0495594_0249305 | 3300046499 | Bacteria | 1012 |
| 1068 | Ga0495594_0348315 | 3300046499 | Bacteria | 843 |
| 1069 | Ga0495596_0069274 | 3300046500 | Bacteria | 1371 |
| 1070 | Ga0495607_0038824 | 3300046501 | Bacteria | 2849 |
| 1071 | Ga0495583_0047989 | 3300046506 | Bacteria | 1961 |
| 1072 | Ga0495606_0001505 | 3300046507 | Bacteria | 30975 |
| 1073 | Ga0495606_0064386 | 3300046507 | Bacteria | 2333 |
| 1074 | Ga0495606_0270265 | 3300046507 | Bacteria | 934 |
| 1075 | Ga0495608_0000022 | 3300046511 | Bacteria | 165111 |
| 1076 | Ga0495608_0000738 | 3300046511 | Bacteria | 22828 |
| 1077 | Ga0495608_0056748 | 3300046511 | Bacteria | 2585 |
| 1078 | Ga0495610_0067542 | 3300046512 | Bacteria | 1679 |
| 1079 | Ga0495610_0082229 | 3300046512 | Bacteria | 1476 |
| 1080 | Ga0495610_0127697 | 3300046512 | Bacteria | 1107 |
| 1081 | Ga0495616_0054584 | 3300046513 | Bacteria | 1981 |
| 1082 | Ga0495616_0065146 | 3300046513 | Bacteria | 1776 |
| 1083 | Ga0495616_0134315 | 3300046513 | Bacteria | 1131 |
| 1084 | Ga0495618_0000229 | 3300046514 | Bacteria | 40948 |
| 1085 | Ga0495618_0185562 | 3300046514 | Bacteria | 1320 |
| 1086 | Ga0495620_0067580 | 3300046515 | Bacteria | 1470 |
| 1087 | Ga0495620_0155379 | 3300046515 | Bacteria | 890 |
| 1088 | Ga0495620_0208563 | 3300046515 | Bacteria | 750 |
| 1089 | Ga0495628_0000035 | 3300046516 | Bacteria | 111560 |
| 1090 | Ga0495628_0005837 | 3300046516 | Bacteria | 10785 |
| 1091 | Ga0495628_0025875 | 3300046516 | Bacteria | 4792 |
| 1092 | Ga0495628_0042830 | 3300046516 | Bacteria | 3609 |
| 1093 | Ga0495628_0281424 | 3300046516 | Bacteria | 1235 |
| 1094 | Ga0495630_0000377 | 3300046517 | Bacteria | 35153 |
| 1095 | Ga0495630_0034359 | 3300046517 | Bacteria | 3786 |
| 1096 | Ga0495630_0222377 | 3300046517 | Bacteria | 1441 |
| 1097 | Ga0495630_0903802 | 3300046517 | Bacteria | 672 |
| 1098 | Ga0495631_0033956 | 3300046518 | Bacteria | 2288 |
| 1099 | Ga0495632_0195446 | 3300046519 | Bacteria | 923 |
| 1100 | Ga0495632_0212873 | 3300046519 | Bacteria | 876 |
| 1101 | Ga0495632_0239056 | 3300046519 | Bacteria | 817 |
| 1102 | Ga0495637_0179522 | 3300046520 | Bacteria | 785 |
| 1103 | Ga0495637_0314914 | 3300046520 | Bacteria | 553 |
| 1104 | Ga0495643_0047558 | 3300046522 | Bacteria | 2322 |
| 1105 | Ga0495643_0171789 | 3300046522 | Bacteria | 1059 |
| 1106 | Ga0495643_0239919 | 3300046522 | Bacteria | 851 |
| 1107 | Ga0495643_0413887 | 3300046522 | Bacteria | 592 |
| 1108 | Ga0495644_0023135 | 3300046523 | Bacteria | 2366 |
| 1109 | Ga0495644_0341994 | 3300046523 | Bacteria | 588 |
| 1110 | Ga0495644_0374016 | 3300046523 | Bacteria | 562 |
| 1111 | Ga0495648_0052870 | 3300046524 | Bacteria | 2464 |
| 1112 | Ga0495648_0067297 | 3300046524 | Bacteria | 2095 |
| 1113 | Ga0495648_0190885 | 3300046524 | Bacteria | 1033 |
| 1114 | Ga0495648_0214321 | 3300046524 | Bacteria | 954 |
| 1115 | Ga0495648_0299264 | 3300046524 | Bacteria | 754 |
| 1116 | Ga0495666_0033207 | 3300046526 | Bacteria | 2522 |
| 1117 | Ga0495652_0000062 | 3300046529 | Bacteria | 111572 |
| 1118 | Ga0495652_0004125 | 3300046529 | Bacteria | 14021 |
| 1119 | Ga0495652_0028961 | 3300046529 | Bacteria | 4865 |
| 1120 | Ga0495652_0807334 | 3300046529 | Bacteria | 624 |
| 1121 | Ga0495654_0016687 | 3300046530 | Bacteria | 3873 |
| 1122 | Ga0495665_0000195 | 3300046531 | Bacteria | 31231 |
| 1123 | Ga0495665_0057443 | 3300046531 | Bacteria | 2054 |
| 1124 | Ga0495640_0000021 | 3300046533 | Bacteria | 110511 |
| 1125 | Ga0495640_0023048 | 3300046533 | Bacteria | 4545 |
| 1126 | Ga0495640_0035969 | 3300046533 | Bacteria | 3502 |
| 1127 | Ga0495640_0148669 | 3300046533 | Bacteria | 1506 |
| 1128 | Ga0495586_0151857 | 3300046535 | Bacteria | 1303 |
| 1129 | Ga0495586_0737604 | 3300046535 | Bacteria | 568 |
| 1130 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 1131 | Ga0495587_0006945 | 3300046536 | Bacteria | 7353 |
| 1132 | Ga0495587_0304296 | 3300046536 | Bacteria | 891 |
| 1133 | Ga0495587_0333946 | 3300046536 | Bacteria | 846 |
| 1134 | Ga0495609_0019137 | 3300046538 | Bacteria | 3170 |
| 1135 | Ga0495609_0279273 | 3300046538 | Bacteria | 683 |
| 1136 | Ga0495597_0009354 | 3300046542 | Bacteria | 4847 |
| 1137 | Ga0495597_0211011 | 3300046542 | Bacteria | 774 |
| 1138 | Ga0495645_0000174 | 3300046543 | Bacteria | 44827 |
| 1139 | Ga0495645_0046137 | 3300046543 | Bacteria | 3177 |
| 1140 | Ga0495645_0053146 | 3300046543 | Bacteria | 2945 |
| 1141 | Ga0495645_0102777 | 3300046543 | Bacteria | 2031 |
| 1142 | Ga0495622_0001733 | 3300046557 | Bacteria | 10791 |
| 1143 | Ga0495622_0031540 | 3300046557 | Bacteria | 2476 |
| 1144 | Ga0495622_0186043 | 3300046557 | Bacteria | 930 |
| 1145 | Ga0495633_0085037 | 3300046558 | Bacteria | 1471 |
| 1146 | Ga0495633_0139098 | 3300046558 | Bacteria | 1123 |
| 1147 | Ga0495633_0156673 | 3300046558 | Bacteria | 1051 |
| 1148 | Ga0495633_0212747 | 3300046558 | Bacteria | 886 |
| 1149 | Ga0495633_0373406 | 3300046558 | Bacteria | 645 |
| 1150 | Ga0495667_0000161 | 3300046559 | Bacteria | 45781 |
| 1151 | Ga0495667_0004219 | 3300046559 | Bacteria | 9686 |
| 1152 | Ga0495667_0014506 | 3300046559 | Bacteria | 5322 |
| 1153 | Ga0495667_0052392 | 3300046559 | Bacteria | 2688 |
| 1154 | Ga0495667_0059306 | 3300046559 | Bacteria | 2512 |
| 1155 | Ga0495667_0366042 | 3300046559 | Bacteria | 910 |
| 1156 | Ga0495667_1019128 | 3300046559 | Bacteria | 504 |
| 1157 | Ga0495656_0014978 | 3300046615 | Bacteria | 2917 |
| 1158 | Ga0495656_0098347 | 3300046615 | Bacteria | 1349 |
| 1159 | Ga0495656_0115210 | 3300046615 | Bacteria | 1262 |
| 1160 | Ga0495668_0122222 | 3300046616 | Bacteria | 1424 |
| 1161 | Ga0495668_0145889 | 3300046616 | Bacteria | 1295 |
| 1162 | Ga0495668_0161016 | 3300046616 | Bacteria | 1229 |
| 1163 | Ga0495634_0000350 | 3300046642 | Bacteria | 44772 |
| 1164 | Ga0495634_0005743 | 3300046642 | Bacteria | 9475 |
| 1165 | Ga0495634_0052709 | 3300046642 | Bacteria | 2727 |
| 1166 | Ga0495634_0056209 | 3300046642 | Bacteria | 2630 |
| 1167 | Ga0495634_0081282 | 3300046642 | Bacteria | 2119 |
| 1168 | Ga0495611_0095356 | 3300046648 | Bacteria | 1377 |
| 1169 | Ga0495611_0269718 | 3300046648 | Bacteria | 787 |
| 1170 | Ga0495611_0297521 | 3300046648 | Bacteria | 744 |
| 1171 | Ga0495611_0383120 | 3300046648 | Bacteria | 643 |
| 1172 | Ga0495625_0101947 | 3300046660 | Bacteria | 1970 |
| 1173 | Ga0495625_0221036 | 3300046660 | Bacteria | 1241 |
| 1174 | Ga0495625_0300109 | 3300046660 | Bacteria | 1028 |
| 1175 | Ga0495635_0000018 | 3300046663 | Bacteria | 193591 |
| 1176 | Ga0495635_0000166 | 3300046663 | Bacteria | 40939 |
| 1177 | Ga0495635_0004315 | 3300046663 | Bacteria | 9844 |
| 1178 | Ga0495635_0018719 | 3300046663 | Bacteria | 4831 |
| 1179 | Ga0495635_0102091 | 3300046663 | Bacteria | 1960 |
| 1180 | Ga0495661_0091077 | 3300046665 | Bacteria | 1734 |
| 1181 | Ga0495661_0091627 | 3300046665 | Bacteria | 1728 |
| 1182 | Ga0495588_0002009 | 3300046674 | Bacteria | 8695 |
| 1183 | Ga0495588_0009190 | 3300046674 | Bacteria | 4563 |
| 1184 | Ga0495588_0016010 | 3300046674 | Bacteria | 3619 |
| 1185 | Ga0495588_0204504 | 3300046674 | Bacteria | 1043 |
| 1186 | Ga0495657_0000245 | 3300046675 | Bacteria | 49381 |
| 1187 | Ga0495657_0005822 | 3300046675 | Bacteria | 9704 |
| 1188 | Ga0495657_0016378 | 3300046675 | Bacteria | 5402 |
| 1189 | Ga0495657_0054952 | 3300046675 | Bacteria | 2658 |
| 1190 | Ga0495657_0527437 | 3300046675 | Bacteria | 687 |
| 1191 | Ga0495599_0000032 | 3300046678 | Bacteria | 108178 |
| 1192 | Ga0495599_0014529 | 3300046678 | Bacteria | 4875 |
| 1193 | Ga0495599_0166242 | 3300046678 | Bacteria | 1362 |
| 1194 | Ga0495599_0328783 | 3300046678 | Bacteria | 919 |
| 1195 | Ga0495623_0000004 | 3300046679 | Bacteria | 142249 |
| 1196 | Ga0495623_0002267 | 3300046679 | Bacteria | 12801 |
| 1197 | Ga0495646_0000083 | 3300046680 | Bacteria | 45193 |
| 1198 | Ga0495646_0002103 | 3300046680 | Bacteria | 12076 |
| 1199 | Ga0495647_0002805 | 3300046681 | Bacteria | 5527 |
| 1200 | Ga0495647_0281574 | 3300046681 | Bacteria | 746 |
| 1201 | Ga0495658_0002361 | 3300046683 | Bacteria | 9539 |
| 1202 | Ga0495658_0015804 | 3300046683 | Bacteria | 3877 |
| 1203 | Ga0495658_0043206 | 3300046683 | Bacteria | 2520 |
| 1204 | Ga0495658_0208075 | 3300046683 | Bacteria | 1221 |
| 1205 | Ga0495669_0248088 | 3300046684 | Bacteria | 855 |
| 1206 | Ga0495669_0292643 | 3300046684 | Bacteria | 784 |
| 1207 | Ga0495669_0366981 | 3300046684 | Bacteria | 696 |
| 1208 | Ga0495613_0006158 | 3300046689 | Bacteria | 8979 |
| 1209 | Ga0495613_0025336 | 3300046689 | Bacteria | 4420 |
| 1210 | Ga0495613_0026055 | 3300046689 | Bacteria | 4357 |
| 1211 | Ga0495613_0767128 | 3300046689 | Bacteria | 631 |
| 1212 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 1213 | Ga0495624_0263353 | 3300046690 | Bacteria | 1042 |
| 1214 | Ga0495624_0411268 | 3300046690 | Bacteria | 812 |
| 1215 | Ga0495624_0483252 | 3300046690 | Bacteria | 741 |
| 1216 | Ga0495670_0015791 | 3300046691 | Bacteria | 3711 |
| 1217 | Ga0495670_0073621 | 3300046691 | Bacteria | 1731 |
| 1218 | Ga0495671_0212948 | 3300046692 | Bacteria | 936 |
| 1219 | Ga0495671_0256829 | 3300046692 | Bacteria | 843 |
| 1220 | Ga0495671_0417277 | 3300046692 | Bacteria | 642 |
| 1221 | Ga0495671_0490135 | 3300046692 | Bacteria | 586 |
| 1222 | Ga0495649_0215041 | 3300046694 | Bacteria | 995 |
| 1223 | Ga0495649_0385658 | 3300046694 | Bacteria | 705 |
| 1224 | Ga0495649_0388659 | 3300046694 | Bacteria | 701 |
| 1225 | Ga0495589_0219698 | 3300046794 | Bacteria | 893 |
| 1226 | Ga0495589_0259198 | 3300046794 | Bacteria | 811 |
| 1227 | Ga0495589_0265535 | 3300046794 | Bacteria | 800 |
| 1228 | Ga0495589_0369885 | 3300046794 | Bacteria | 659 |
| 1229 | Ga0495589_0395888 | 3300046794 | Bacteria | 634 |
| 1230 | Ga0495600_0000022 | 3300046809 | Bacteria | 94789 |
| 1231 | Ga0495600_0005583 | 3300046809 | Bacteria | 7596 |
| 1232 | Ga0495600_0347429 | 3300046809 | Bacteria | 930 |
| 1233 | Ga0495600_0790411 | 3300046809 | Bacteria | 566 |
| 1234 | Ga0495660_0053737 | 3300046810 | Bacteria | 2185 |
| 1235 | Ga0495581_0000187 | 3300047315 | Bacteria | 28682 |
| 1236 | Ga0495581_0034768 | 3300047315 | Bacteria | 2916 |
| 1237 | Ga0495581_0127338 | 3300047315 | Bacteria | 1483 |
| 1238 | Ga0495581_0460226 | 3300047315 | Bacteria | 741 |
| 1239 | Ga0495604_0000011 | 3300047317 | Bacteria | 292024 |
| 1240 | Ga0495604_0004924 | 3300047317 | Bacteria | 10588 |
| 1241 | Ga0495604_0117147 | 3300047317 | Bacteria | 1932 |
| 1242 | Ga0495604_0378628 | 3300047317 | Bacteria | 935 |
| 1243 | Ga0495604_0455490 | 3300047317 | Bacteria | 835 |
| 1244 | Ga0495636_0238697 | 3300047318 | Bacteria | 838 |
| 1245 | Ga0495674_0000034 | 3300047319 | Bacteria | 110674 |
| 1246 | Ga0495674_0003575 | 3300047319 | Bacteria | 15109 |
| 1247 | Ga0495674_0005019 | 3300047319 | Bacteria | 12726 |
| 1248 | Ga0495674_0013003 | 3300047319 | Bacteria | 7835 |
| 1249 | Ga0495674_0079738 | 3300047319 | Bacteria | 2811 |
| 1250 | Ga0495674_0232372 | 3300047319 | Bacteria | 1521 |
| 1251 | Ga0495674_0460149 | 3300047319 | Bacteria | 1021 |
| 1252 | Ga0495672_0050924 | 3300047320 | Bacteria | 2441 |
| 1253 | Ga0495672_0155002 | 3300047320 | Bacteria | 1184 |
| 1254 | Ga0495672_0179053 | 3300047320 | Bacteria | 1075 |
| 1255 | Ga0495672_0201003 | 3300047320 | Bacteria | 996 |
| 1256 | Ga0495672_0259049 | 3300047320 | Bacteria | 840 |
| 1257 | Ga0495672_0263491 | 3300047320 | Bacteria | 831 |
| 1258 | Ga0495676_0013511 | 3300047321 | Bacteria | 7338 |
| 1259 | Ga0495676_0060198 | 3300047321 | Bacteria | 2978 |
| 1260 | Ga0495676_0077799 | 3300047321 | Bacteria | 2528 |
| 1261 | Ga0495676_0417491 | 3300047321 | Bacteria | 888 |
| 1262 | Ga0495680_0000290 | 3300047322 | Bacteria | 56506 |
| 1263 | Ga0495680_0004903 | 3300047322 | Bacteria | 12674 |
| 1264 | Ga0495680_0132741 | 3300047322 | Bacteria | 1828 |
| 1265 | Ga0495680_0334977 | 3300047322 | Bacteria | 1056 |
| 1266 | Ga0495680_0909340 | 3300047322 | Bacteria | 568 |
| 1267 | Ga0495680_0937984 | 3300047322 | Bacteria | 557 |
| 1268 | Ga0495683_0047102 | 3300047323 | Bacteria | 2163 |
| 1269 | Ga0495683_0285280 | 3300047323 | Bacteria | 713 |
| 1270 | Ga0495687_011239 | 3300047443 | Bacteria | 4828 |
| 1271 | Ga0495675_0000352 | 3300047444 | Bacteria | 32304 |
| 1272 | Ga0495675_0000770 | 3300047444 | Bacteria | 19951 |
| 1273 | Ga0495675_0012692 | 3300047444 | Bacteria | 5302 |
| 1274 | Ga0495675_0710794 | 3300047444 | Bacteria | 562 |
| 1275 | Ga0495679_143817 | 3300047446 | Bacteria | 643 |
| 1276 | Ga0495685_081282 | 3300047447 | Bacteria | 1079 |
| 1277 | Ga0495685_195857 | 3300047447 | Bacteria | 648 |
| 1278 | Ga0495673_0046688 | 3300047469 | Bacteria | 1918 |
| 1279 | Ga0495673_0165924 | 3300047469 | Bacteria | 844 |
| 1280 | Ga0495673_0235178 | 3300047469 | Bacteria | 673 |
| 1281 | Ga0495673_0309667 | 3300047469 | Bacteria | 564 |
| 1282 | Ga0495681_0274420 | 3300047470 | Bacteria | 659 |
| 1283 | Ga0495684_0000012 | 3300047471 | Bacteria | 187118 |
| 1284 | Ga0495684_0000501 | 3300047471 | Bacteria | 31747 |
| 1285 | Ga0495684_0117831 | 3300047471 | Bacteria | 2001 |
| 1286 | Ga0495684_0731871 | 3300047471 | Bacteria | 653 |
| 1287 | Ga0495686_0049725 | 3300047472 | Bacteria | 2636 |
| 1288 | Ga0495686_0139108 | 3300047472 | Bacteria | 1433 |
| 1289 | Ga0495686_0180773 | 3300047472 | Bacteria | 1222 |
| 1290 | Ga0495686_0195326 | 3300047472 | Bacteria | 1164 |
| 1291 | Ga0495686_0453986 | 3300047472 | Bacteria | 680 |
| 1292 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 1293 | Ga0495593_0005905 | 3300047673 | Bacteria | 7211 |
| 1294 | Ga0495593_0006360 | 3300047673 | Bacteria | 6928 |
| 1295 | Ga0495593_0011797 | 3300047673 | Bacteria | 5011 |
| 1296 | Ga0495602_0000064 | 3300048088 | Bacteria | 104858 |
| 1297 | Ga0495602_0019776 | 3300048088 | Bacteria | 6673 |
| 1298 | Ga0495602_0050110 | 3300048088 | Bacteria | 3734 |
| 1299 | Ga0495602_0370624 | 3300048088 | Bacteria | 1028 |
| 1300 | Ga0495602_0842467 | 3300048088 | Bacteria | 613 |
| 1301 | Ga0495614_0092802 | 3300048089 | Bacteria | 1314 |
| 1302 | Ga0495614_0206171 | 3300048089 | Bacteria | 891 |
| 1303 | Ga0495615_0154977 | 3300048090 | Bacteria | 684 |
| 1304 | Ga0495626_0123901 | 3300048091 | Bacteria | 1108 |
| 1305 | Ga0496100_0026252 | 3300048903 | Bacteria | 3570 |
| 1306 | Ga0496100_0045083 | 3300048903 | Bacteria | 2828 |
| 1307 | Ga0496100_0239782 | 3300048903 | Bacteria | 1337 |
| 1308 | Ga0496100_0441582 | 3300048903 | Bacteria | 996 |
| 1309 | Ga0496100_0536630 | 3300048903 | Bacteria | 904 |
| 1310 | Ga0496100_0670279 | 3300048903 | Bacteria | 808 |
| 1311 | Ga0496100_0945233 | 3300048903 | Bacteria | 677 |
| 1312 | Ga0496101_0001656 | 3300048904 | Bacteria | 13367 |
| 1313 | Ga0496101_0038367 | 3300048904 | Bacteria | 3402 |
| 1314 | Ga0496101_0040994 | 3300048904 | Bacteria | 3299 |
| 1315 | Ga0496101_0090035 | 3300048904 | Bacteria | 2281 |
| 1316 | Ga0496101_0160302 | 3300048904 | Bacteria | 1725 |
| 1317 | Ga0496101_0662701 | 3300048904 | Bacteria | 824 |
| 1318 | Ga0496101_0915158 | 3300048904 | Bacteria | 690 |
| 1319 | Ga0496101_1309443 | 3300048904 | Bacteria | 566 |
| 1320 | Ga0496102_0003166 | 3300048905 | Bacteria | 13960 |
| 1321 | Ga0496102_0010759 | 3300048905 | Bacteria | 7880 |
| 1322 | Ga0496102_0015959 | 3300048905 | Bacteria | 6553 |
| 1323 | Ga0496102_0098200 | 3300048905 | Bacteria | 2717 |
| 1324 | Ga0496102_0107507 | 3300048905 | Bacteria | 2597 |
| 1325 | Ga0496102_0157479 | 3300048905 | Bacteria | 2135 |
| 1326 | Ga0496102_0514920 | 3300048905 | Bacteria | 1119 |
| 1327 | Ga0496102_0553494 | 3300048905 | Bacteria | 1073 |
| 1328 | Ga0496102_1382650 | 3300048905 | Bacteria | 623 |
| 1329 | Ga0496103_0004565 | 3300048906 | Bacteria | 8385 |
| 1330 | Ga0496103_0016825 | 3300048906 | Bacteria | 4367 |
| 1331 | Ga0496103_0026693 | 3300048906 | Bacteria | 3496 |
| 1332 | Ga0496103_0163899 | 3300048906 | Bacteria | 1426 |
| 1333 | Ga0496103_0675293 | 3300048906 | Bacteria | 655 |
| 1334 | Ga0496104_0004595 | 3300048907 | Bacteria | 12035 |
| 1335 | Ga0496104_0018749 | 3300048907 | Bacteria | 6318 |
| 1336 | Ga0496104_0028670 | 3300048907 | Bacteria | 5160 |
| 1337 | Ga0496104_0137623 | 3300048907 | Bacteria | 2346 |
| 1338 | Ga0496105_0017472 | 3300048908 | Bacteria | 5753 |
| 1339 | Ga0496105_0040208 | 3300048908 | Bacteria | 3854 |
| 1340 | Ga0496105_0049487 | 3300048908 | Bacteria | 3470 |
| 1341 | Ga0496105_0058959 | 3300048908 | Bacteria | 3167 |
| 1342 | Ga0496105_0243128 | 3300048908 | Bacteria | 1460 |
| 1343 | Ga0496106_0002121 | 3300048909 | Bacteria | 14838 |
| 1344 | Ga0496106_0004829 | 3300048909 | Bacteria | 9973 |
| 1345 | Ga0496106_0026288 | 3300048909 | Bacteria | 4333 |
| 1346 | Ga0496106_0041586 | 3300048909 | Bacteria | 3444 |
| 1347 | Ga0496106_0067637 | 3300048909 | Bacteria | 2724 |
| 1348 | Ga0496106_0111063 | 3300048909 | Bacteria | 2134 |
| 1349 | Ga0496106_0132597 | 3300048909 | Bacteria | 1954 |
| 1350 | Ga0496106_0166558 | 3300048909 | Bacteria | 1745 |
| 1351 | Ga0496106_0324648 | 3300048909 | Bacteria | 1236 |
| 1352 | Ga0496107_0005918 | 3300048910 | Bacteria | 8380 |
| 1353 | Ga0496107_0008140 | 3300048910 | Bacteria | 7252 |
| 1354 | Ga0496107_0053637 | 3300048910 | Bacteria | 2908 |
| 1355 | Ga0496107_0110036 | 3300048910 | Bacteria | 2024 |
| 1356 | Ga0496107_0120945 | 3300048910 | Bacteria | 1929 |
| 1357 | Ga0496107_0180421 | 3300048910 | Bacteria | 1568 |
| 1358 | Ga0496107_0656418 | 3300048910 | Bacteria | 773 |
| 1359 | Ga0496108_0022903 | 3300048911 | Bacteria | 5139 |
| 1360 | Ga0496108_0115465 | 3300048911 | Bacteria | 2299 |
| 1361 | Ga0496108_0159548 | 3300048911 | Bacteria | 1948 |
| 1362 | Ga0496108_0236735 | 3300048911 | Bacteria | 1588 |
| 1363 | Ga0496108_0308673 | 3300048911 | Bacteria | 1378 |
| 1364 | Ga0496108_1190035 | 3300048911 | Bacteria | 645 |
| 1365 | Ga0496109_0010165 | 3300048912 | Bacteria | 8032 |
| 1366 | Ga0496109_0088490 | 3300048912 | Bacteria | 2862 |
| 1367 | Ga0496109_0105241 | 3300048912 | Bacteria | 2620 |
| 1368 | Ga0496109_0256482 | 3300048912 | Bacteria | 1647 |
| 1369 | Ga0496109_0506568 | 3300048912 | Bacteria | 1139 |
| 1370 | Ga0496109_0787100 | 3300048912 | Bacteria | 889 |
| 1371 | Ga0496110_0020972 | 3300048913 | Bacteria | 5521 |
| 1372 | Ga0496110_0028359 | 3300048913 | Bacteria | 4808 |
| 1373 | Ga0496110_0051881 | 3300048913 | Bacteria | 3605 |
| 1374 | Ga0496110_0193956 | 3300048913 | Bacteria | 1844 |
| 1375 | Ga0496110_0197535 | 3300048913 | Bacteria | 1827 |
| 1376 | Ga0496110_0283861 | 3300048913 | Bacteria | 1508 |
| 1377 | Ga0496110_0321622 | 3300048913 | Bacteria | 1409 |
| 1378 | Ga0496110_0663164 | 3300048913 | Bacteria | 943 |
| 1379 | Ga0496111_0092714 | 3300048914 | Bacteria | 2214 |
| 1380 | Ga0496111_0138489 | 3300048914 | Bacteria | 1803 |
| 1381 | Ga0496111_0180072 | 3300048914 | Bacteria | 1571 |
| 1382 | Ga0496111_0251012 | 3300048914 | Bacteria | 1313 |
| 1383 | Ga0496111_0554542 | 3300048914 | Bacteria | 843 |
| 1384 | Ga0496112_0000040 | 3300048915 | Bacteria | 89057 |
| 1385 | Ga0496112_0002949 | 3300048915 | Bacteria | 13878 |
| 1386 | Ga0496112_0020266 | 3300048915 | Bacteria | 6299 |
| 1387 | Ga0496112_0040204 | 3300048915 | Bacteria | 4572 |
| 1388 | Ga0496112_0048391 | 3300048915 | Bacteria | 4168 |
| 1389 | Ga0496112_0068339 | 3300048915 | Bacteria | 3508 |
| 1390 | Ga0496112_0183612 | 3300048915 | Bacteria | 2055 |
| 1391 | Ga0496112_0202992 | 3300048915 | Bacteria | 1941 |
| 1392 | Ga0496112_0667664 | 3300048915 | Bacteria | 968 |
| 1393 | Ga0496113_0015214 | 3300048916 | Bacteria | 5279 |
| 1394 | Ga0496113_0020040 | 3300048916 | Bacteria | 4693 |
| 1395 | Ga0496113_0047223 | 3300048916 | Bacteria | 3199 |
| 1396 | Ga0496113_0539310 | 3300048916 | Bacteria | 936 |
| 1397 | Ga0496113_0820392 | 3300048916 | Bacteria | 738 |
| 1398 | Ga0496113_1163731 | 3300048916 | Bacteria | 603 |
| 1399 | Ga0496114_0008695 | 3300048917 | Bacteria | 8045 |
| 1400 | Ga0496114_0193148 | 3300048917 | Bacteria | 1782 |
| 1401 | Ga0496114_0334842 | 3300048917 | Bacteria | 1338 |
| 1402 | Ga0496114_0386257 | 3300048917 | Bacteria | 1239 |
| 1403 | Ga0496114_0640754 | 3300048917 | Bacteria | 935 |
| 1404 | Ga0496114_1186606 | 3300048917 | Bacteria | 649 |
| 1405 | Ga0496114_1248625 | 3300048917 | Bacteria | 629 |
| 1406 | Ga0496114_1308302 | 3300048917 | Bacteria | 612 |
| 1407 | Ga0496114_1424215 | 3300048917 | Bacteria | 580 |
| 1408 | Ga0496115_0002383 | 3300048918 | Bacteria | 13482 |
| 1409 | Ga0496115_0042374 | 3300048918 | Bacteria | 3626 |
| 1410 | Ga0496115_0057832 | 3300048918 | Bacteria | 3119 |
| 1411 | Ga0496115_0114644 | 3300048918 | Bacteria | 2215 |
| 1412 | Ga0496115_0134764 | 3300048918 | Bacteria | 2036 |
| 1413 | Ga0496115_0139755 | 3300048918 | Bacteria | 1998 |
| 1414 | Ga0496115_0210492 | 3300048918 | Bacteria | 1606 |
| 1415 | Ga0496115_0329545 | 3300048918 | Bacteria | 1247 |
| 1416 | Ga0496115_0819038 | 3300048918 | Bacteria | 723 |
| 1417 | Ga0496116_0004777 | 3300048919 | Bacteria | 12787 |
| 1418 | Ga0496116_0091944 | 3300048919 | Bacteria | 1842 |
| 1419 | Ga0496116_0322649 | 3300048919 | Bacteria | 722 |
| 1420 | Ga0496117_0013721 | 3300048920 | Bacteria | 7040 |
| 1421 | Ga0496117_0025524 | 3300048920 | Bacteria | 4645 |
| 1422 | Ga0496117_0111358 | 3300048920 | Bacteria | 1704 |
| 1423 | Ga0496117_0377298 | 3300048920 | Bacteria | 723 |
| 1424 | Ga0496117_0536984 | 3300048920 | Bacteria | 559 |
| 1425 | Ga0496118_0002570 | 3300048921 | Bacteria | 24239 |
| 1426 | Ga0496118_0033149 | 3300048921 | Bacteria | 4244 |
| 1427 | Ga0496118_0040696 | 3300048921 | Bacteria | 3692 |
| 1428 | Ga0496118_0054679 | 3300048921 | Bacteria | 3021 |
| 1429 | Ga0496118_0216079 | 3300048921 | Bacteria | 1120 |
| 1430 | Ga0496118_0445083 | 3300048921 | Bacteria | 659 |
| 1431 | Ga0496119_0046119 | 3300048922 | Bacteria | 2725 |
| 1432 | Ga0496119_0082079 | 3300048922 | Bacteria | 1854 |
| 1433 | Ga0496119_0092898 | 3300048922 | Bacteria | 1710 |
| 1434 | Ga0496119_0222786 | 3300048922 | Bacteria | 964 |
| 1435 | Ga0496120_0144788 | 3300048923 | Bacteria | 1202 |
| 1436 | Ga0496120_0164907 | 3300048923 | Bacteria | 1101 |
| 1437 | Ga0496120_0181023 | 3300048923 | Bacteria | 1035 |
| 1438 | Ga0496120_0200703 | 3300048923 | Bacteria | 966 |
| 1439 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 1440 | Ga0496121_0001125 | 3300048924 | Bacteria | 47001 |
| 1441 | Ga0496121_0002837 | 3300048924 | Bacteria | 25561 |
| 1442 | Ga0496121_0003837 | 3300048924 | Bacteria | 20905 |
| 1443 | Ga0496121_0009685 | 3300048924 | Bacteria | 11034 |
| 1444 | Ga0496121_0016535 | 3300048924 | Bacteria | 7610 |
| 1445 | Ga0496121_0017138 | 3300048924 | Bacteria | 7421 |
| 1446 | Ga0496121_0020230 | 3300048924 | Bacteria | 6602 |
| 1447 | Ga0496121_0073946 | 3300048924 | Bacteria | 2728 |
| 1448 | Ga0496121_0083038 | 3300048924 | Bacteria | 2530 |
| 1449 | Ga0496121_0141250 | 3300048924 | Bacteria | 1786 |
| 1450 | Ga0496121_0155050 | 3300048924 | Bacteria | 1681 |
| 1451 | Ga0496121_0331373 | 3300048924 | Bacteria | 1021 |
| 1452 | Ga0496121_0453592 | 3300048924 | Bacteria | 825 |
| 1453 | Ga0496121_0583948 | 3300048924 | Bacteria | 693 |
| 1454 | Ga0496121_0644707 | 3300048924 | Bacteria | 646 |
| 1455 | Ga0496122_0074814 | 3300048925 | Bacteria | 2393 |
| 1456 | Ga0496122_0114191 | 3300048925 | Bacteria | 1762 |
| 1457 | Ga0496122_0129062 | 3300048925 | Bacteria | 1611 |
| 1458 | Ga0496122_0193780 | 3300048925 | Bacteria | 1196 |
| 1459 | Ga0496124_0022017 | 3300048927 | Bacteria | 5857 |
| 1460 | Ga0496124_0234874 | 3300048927 | Bacteria | 1368 |
| 1461 | Ga0496124_0293589 | 3300048927 | Bacteria | 1178 |
| 1462 | Ga0496124_0627200 | 3300048927 | Bacteria | 694 |
| 1463 | Ga0496124_0700163 | 3300048927 | Bacteria | 642 |
| 1464 | Ga0496125_0002054 | 3300048928 | Bacteria | 27194 |
| 1465 | Ga0496125_0016454 | 3300048928 | Bacteria | 7099 |
| 1466 | Ga0496125_0047446 | 3300048928 | Bacteria | 3591 |
| 1467 | Ga0496125_0252537 | 3300048928 | Bacteria | 1111 |
| 1468 | Ga0496125_0561169 | 3300048928 | Bacteria | 631 |
| 1469 | Ga0496126_0005480 | 3300048929 | Bacteria | 14467 |
| 1470 | Ga0496126_0011540 | 3300048929 | Bacteria | 9128 |
| 1471 | Ga0496126_0031487 | 3300048929 | Bacteria | 5010 |
| 1472 | Ga0496126_0051010 | 3300048929 | Bacteria | 3769 |
| 1473 | Ga0496126_0082566 | 3300048929 | Bacteria | 2839 |
| 1474 | Ga0496126_0173318 | 3300048929 | Bacteria | 1836 |
| 1475 | Ga0496126_0212625 | 3300048929 | Bacteria | 1627 |
| 1476 | Ga0496126_0323879 | 3300048929 | Bacteria | 1266 |
| 1477 | Ga0496126_0326786 | 3300048929 | Bacteria | 1259 |
| 1478 | Ga0496126_0350187 | 3300048929 | Bacteria | 1208 |
| 1479 | Ga0496126_0354501 | 3300048929 | Bacteria | 1199 |
| 1480 | Ga0496126_0419105 | 3300048929 | Bacteria | 1083 |
| 1481 | Ga0496126_0639311 | 3300048929 | Bacteria | 834 |
| 1482 | Ga0496126_1064547 | 3300048929 | Bacteria | 603 |
| 1483 | Ga0495678_086058 | 3300049459 | Bacteria | 1118 |
| 1484 | Ga0495682_0222629 | 3300049460 | Bacteria | 668 |
| 1485 | Ga0495682_0223451 | 3300049460 | Bacteria | 667 |
| 1486 | Ga0501031_0005620 | 3300049568 | Bacteria | 8169 |
| 1487 | Ga0501031_0037214 | 3300049568 | Bacteria | 3174 |
| 1488 | Ga0501031_0130145 | 3300049568 | Bacteria | 1644 |
| 1489 | Ga0501032_0001270 | 3300049569 | Bacteria | 20219 |
| 1490 | Ga0501032_0004513 | 3300049569 | Bacteria | 10476 |
| 1491 | Ga0501032_0056453 | 3300049569 | Bacteria | 2639 |
| 1492 | Ga0501032_0600840 | 3300049569 | Bacteria | 700 |
| 1493 | Ga0501033_0000175 | 3300049570 | Bacteria | 60845 |
| 1494 | Ga0501033_0015137 | 3300049570 | Bacteria | 5852 |
| 1495 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 1496 | Ga0501034_0047397 | 3300049571 | Bacteria | 4339 |
| 1497 | Ga0501034_0114578 | 3300049571 | Bacteria | 2684 |
| 1498 | Ga0501036_0000042 | 3300049572 | Bacteria | 79876 |
| 1499 | Ga0501036_0022055 | 3300049572 | Bacteria | 5355 |
| 1500 | Ga0501036_0122464 | 3300049572 | Bacteria | 2196 |
| 1501 | Ga0501036_0363694 | 3300049572 | Bacteria | 1208 |
| 1502 | Ga0501036_0628188 | 3300049572 | Bacteria | 890 |
| 1503 | Ga0501037_0000100 | 3300049573 | Bacteria | 81013 |
| 1504 | Ga0501037_0034827 | 3300049573 | Bacteria | 3714 |
| 1505 | Ga0501037_0117071 | 3300049573 | Bacteria | 1917 |
| 1506 | Ga0501037_0716007 | 3300049573 | Bacteria | 665 |
| 1507 | Ga0501038_0000157 | 3300049574 | Bacteria | 58169 |
| 1508 | Ga0501038_0004335 | 3300049574 | Bacteria | 13194 |
| 1509 | Ga0501038_0093604 | 3300049574 | Bacteria | 2513 |
| 1510 | Ga0501039_0000216 | 3300049575 | Bacteria | 42349 |
| 1511 | Ga0501039_0069527 | 3300049575 | Bacteria | 2734 |
| 1512 | Ga0501039_0070882 | 3300049575 | Bacteria | 2707 |
| 1513 | Ga0501039_0356563 | 3300049575 | Bacteria | 1149 |
| 1514 | Ga0501040_0009591 | 3300049576 | Bacteria | 6314 |
| 1515 | Ga0501040_0198285 | 3300049576 | Bacteria | 1425 |
| 1516 | Ga0501040_0362394 | 3300049576 | Bacteria | 1039 |
| 1517 | Ga0501040_0549875 | 3300049576 | Bacteria | 833 |
| 1518 | Ga0501041_0383483 | 3300049577 | Bacteria | 889 |
| 1519 | Ga0501041_0423790 | 3300049577 | Bacteria | 844 |
| 1520 | Ga0501041_0757479 | 3300049577 | Bacteria | 622 |
| 1521 | Ga0501041_0932845 | 3300049577 | Bacteria | 558 |
| 1522 | Ga0501042_0008128 | 3300049578 | Bacteria | 6911 |
| 1523 | Ga0501042_0019198 | 3300049578 | Bacteria | 4743 |
| 1524 | Ga0501043_0004658 | 3300049579 | Bacteria | 11117 |
| 1525 | Ga0501043_0073021 | 3300049579 | Bacteria | 2694 |
| 1526 | Ga0501043_0149557 | 3300049579 | Bacteria | 1827 |
| 1527 | Ga0501043_0602857 | 3300049579 | Bacteria | 811 |
| 1528 | Ga0501046_0011426 | 3300049580 | Bacteria | 7589 |
| 1529 | Ga0501046_0022043 | 3300049580 | Bacteria | 5250 |
| 1530 | Ga0501046_0072850 | 3300049580 | Bacteria | 2666 |
| 1531 | Ga0501047_0000159 | 3300049581 | Bacteria | 82106 |
| 1532 | Ga0501047_0006707 | 3300049581 | Bacteria | 10824 |
| 1533 | Ga0501047_0092163 | 3300049581 | Bacteria | 2908 |
| 1534 | Ga0501047_0767039 | 3300049581 | Bacteria | 780 |
| 1535 | Ga0501048_0005267 | 3300049582 | Bacteria | 9849 |
| 1536 | Ga0501048_0010436 | 3300049582 | Bacteria | 6936 |
| 1537 | Ga0501048_0102291 | 3300049582 | Bacteria | 2021 |
| 1538 | Ga0501048_0238023 | 3300049582 | Bacteria | 1292 |
| 1539 | Ga0501067_0002974 | 3300049583 | Bacteria | 9351 |
| 1540 | Ga0501067_0017732 | 3300049583 | Bacteria | 3942 |
| 1541 | Ga0501067_0035174 | 3300049583 | Bacteria | 2781 |
| 1542 | Ga0501067_0082621 | 3300049583 | Bacteria | 1781 |
| 1543 | Ga0501068_0000168 | 3300049584 | Bacteria | 30562 |
| 1544 | Ga0501068_0010825 | 3300049584 | Bacteria | 5132 |
| 1545 | Ga0501068_0028519 | 3300049584 | Bacteria | 3302 |
| 1546 | Ga0501069_0011906 | 3300049585 | Bacteria | 4615 |
| 1547 | Ga0501069_0039165 | 3300049585 | Bacteria | 2618 |
| 1548 | Ga0501069_0088588 | 3300049585 | Bacteria | 1749 |
| 1549 | Ga0501070_0016415 | 3300049586 | Bacteria | 6221 |
| 1550 | Ga0501070_0089095 | 3300049586 | Bacteria | 2553 |
| 1551 | Ga0501070_0209207 | 3300049586 | Bacteria | 1601 |
| 1552 | Ga0501070_0319337 | 3300049586 | Bacteria | 1263 |
| 1553 | Ga0501071_0039988 | 3300049587 | Bacteria | 3356 |
| 1554 | Ga0501071_0052969 | 3300049587 | Bacteria | 2926 |
| 1555 | Ga0501071_0109211 | 3300049587 | Bacteria | 2044 |
| 1556 | Ga0501071_0155255 | 3300049587 | Bacteria | 1709 |
| 1557 | Ga0501071_0335709 | 3300049587 | Bacteria | 1149 |
| 1558 | Ga0501071_0658246 | 3300049587 | Bacteria | 806 |
| 1559 | Ga0501072_0000475 | 3300049588 | Bacteria | 28798 |
| 1560 | Ga0501072_0025195 | 3300049588 | Bacteria | 4632 |
| 1561 | Ga0501072_0174662 | 3300049588 | Bacteria | 1714 |
| 1562 | Ga0501072_0647005 | 3300049588 | Bacteria | 832 |
| 1563 | Ga0501072_0700086 | 3300049588 | Bacteria | 796 |
| 1564 | Ga0501073_0000678 | 3300049589 | Bacteria | 23931 |
| 1565 | Ga0501073_0029036 | 3300049589 | Bacteria | 3951 |
| 1566 | Ga0501073_0206051 | 3300049589 | Bacteria | 1359 |
| 1567 | Ga0501074_0000117 | 3300049590 | Bacteria | 40113 |
| 1568 | Ga0501074_0001904 | 3300049590 | Bacteria | 14331 |
| 1569 | Ga0501074_0064795 | 3300049590 | Bacteria | 2631 |
| 1570 | Ga0501074_0264454 | 3300049590 | Bacteria | 1223 |
| 1571 | Ga0501075_0169216 | 3300049591 | Bacteria | 1667 |
| 1572 | Ga0501075_0332019 | 3300049591 | Bacteria | 1159 |
| 1573 | Ga0501076_0016262 | 3300049592 | Bacteria | 5638 |
| 1574 | Ga0501076_0030457 | 3300049592 | Bacteria | 4203 |
| 1575 | Ga0501076_0032845 | 3300049592 | Bacteria | 4053 |
| 1576 | Ga0501076_0126661 | 3300049592 | Bacteria | 2070 |
| 1577 | Ga0501076_0848963 | 3300049592 | Bacteria | 753 |
| 1578 | Ga0501077_0100262 | 3300049593 | Bacteria | 1835 |
| 1579 | Ga0501077_0120879 | 3300049593 | Bacteria | 1660 |
| 1580 | Ga0501079_0009895 | 3300049741 | Bacteria | 7234 |
| 1581 | Ga0501079_0077852 | 3300049741 | Bacteria | 2565 |
| 1582 | Ga0501079_0141351 | 3300049741 | Bacteria | 1875 |
| 1583 | Ga0501079_0205176 | 3300049741 | Bacteria | 1539 |
| 1584 | Ga0501080_0004449 | 3300049742 | Bacteria | 12471 |
| 1585 | Ga0501080_0015418 | 3300049742 | Bacteria | 7044 |
| 1586 | Ga0501080_0086703 | 3300049742 | Bacteria | 2909 |
| 1587 | Ga0501080_0095483 | 3300049742 | Bacteria | 2761 |
| 1588 | Ga0501080_1308971 | 3300049742 | Bacteria | 620 |
| 1589 | Ga0501081_0035611 | 3300049743 | Bacteria | 3389 |
| 1590 | Ga0501081_0156336 | 3300049743 | Bacteria | 1641 |
| 1591 | Ga0501083_0004228 | 3300049744 | Bacteria | 10110 |
| 1592 | Ga0501083_0049179 | 3300049744 | Bacteria | 2843 |
| 1593 | Ga0501083_0134404 | 3300049744 | Bacteria | 1621 |
| 1594 | Ga0501035_0000172 | 3300049822 | Bacteria | 79203 |
| 1595 | Ga0501035_0320325 | 3300049822 | Bacteria | 1303 |
| 1596 | Ga0501035_0336754 | 3300049822 | Bacteria | 1265 |
| 1597 | Ga0501035_0397773 | 3300049822 | Bacteria | 1146 |
| 1598 | Ga0501035_0562782 | 3300049822 | Bacteria | 932 |
| 1599 | Ga0501035_0945897 | 3300049822 | Bacteria | 680 |
| 1600 | Ga0501044_0000282 | 3300049823 | Bacteria | 64640 |
| 1601 | Ga0501044_0359332 | 3300049823 | Bacteria | 1374 |
| 1602 | Ga0501044_0465141 | 3300049823 | Bacteria | 1169 |
| 1603 | Ga0501044_0817800 | 3300049823 | Bacteria | 810 |
| 1604 | Ga0501045_0030903 | 3300049824 | Bacteria | 3877 |
| 1605 | Ga0501045_0099371 | 3300049824 | Bacteria | 2153 |
| 1606 | Ga0501045_0257507 | 3300049824 | Bacteria | 1299 |
| 1607 | Ga0501045_0275163 | 3300049824 | Bacteria | 1253 |
| 1608 | Ga0501045_0500555 | 3300049824 | Bacteria | 902 |
| 1609 | Ga0501045_0544144 | 3300049824 | Bacteria | 861 |
| 1610 | Ga0501045_0605906 | 3300049824 | Bacteria | 811 |
| 1611 | nmdc:mga03683_170414_c1 | 3300050489 | Bacteria | 989 |
| 1612 | nmdc:mga03683_87890_c1 | 3300050489 | Bacteria | 1351 |
| 1613 | nmdc:mga03n38_1311_c1 | 3300050490 | Bacteria | 7027 |
| 1614 | nmdc:mga03n38_197867_c1 | 3300050490 | Bacteria | 1039 |
| 1615 | nmdc:mga03n38_357684_c1 | 3300050490 | Bacteria | 796 |
| 1616 | nmdc:mga03n38_74157_c1 | 3300050490 | Bacteria | 1582 |
| 1617 | nmdc:mga00v17_105861_c1 | 3300050491 | Bacteria | 1780 |
| 1618 | nmdc:mga00v17_20915_c1 | 3300050491 | Bacteria | 2847 |
| 1619 | nmdc:mga00v17_260639_c1 | 3300050491 | Bacteria | 1125 |
| 1620 | nmdc:mga00v17_336215_c1 | 3300050491 | Bacteria | 982 |
| 1621 | nmdc:mga00v17_741630_c1 | 3300050491 | Bacteria | 628 |
| 1622 | nmdc:mga00v17_90873_c1 | 3300050491 | Bacteria | 1917 |
| 1623 | nmdc:mga0yw44_100616_c1 | 3300050492 | Bacteria | 1841 |
| 1624 | nmdc:mga0yw44_175931_c1 | 3300050492 | Bacteria | 1407 |
| 1625 | nmdc:mga0yw44_202540_c1 | 3300050492 | Bacteria | 1311 |
| 1626 | nmdc:mga0yw44_24529_c1 | 3300050492 | Bacteria | 2317 |
| 1627 | nmdc:mga0yw44_31673_c1 | 3300050492 | Bacteria | 3077 |
| 1628 | nmdc:mga0yw44_48177_c1 | 3300050492 | Bacteria | 2569 |
| 1629 | nmdc:mga0yw44_628579_c1 | 3300050492 | Bacteria | 730 |
| 1630 | nmdc:mga0yw44_62959_c1 | 3300050492 | Bacteria | 2280 |
| 1631 | nmdc:mga0yw44_841546_c1 | 3300050492 | Bacteria | 623 |
| 1632 | nmdc:mga0yw44_967079_c1 | 3300050492 | Bacteria | 577 |
| 1633 | nmdc:mga0k408_11902_c1 | 3300050493 | Bacteria | 3393 |
| 1634 | nmdc:mga0k408_126789_c1 | 3300050493 | Bacteria | 1514 |
| 1635 | nmdc:mga0k408_262781_c1 | 3300050493 | Bacteria | 1031 |
| 1636 | nmdc:mga0k408_294138_c1 | 3300050493 | Bacteria | 969 |
| 1637 | nmdc:mga0k408_715058_c1 | 3300050493 | Bacteria | 586 |
| 1638 | nmdc:mga06z11_117592_c1 | 3300050494 | Bacteria | 1480 |
| 1639 | nmdc:mga06z11_18937_c1 | 3300050494 | Bacteria | 3155 |
| 1640 | nmdc:mga04h51_19459_c1 | 3300050495 | Bacteria | 1790 |
| 1641 | nmdc:mga04h51_195161_c1 | 3300050495 | Bacteria | 793 |
| 1642 | nmdc:mga04h51_91122_c1 | 3300050495 | Bacteria | 1097 |
| 1643 | nmdc:mga07m45_18987_c1 | 3300050496 | Bacteria | 3720 |
| 1644 | nmdc:mga07m45_30607_c1 | 3300050496 | Bacteria | 2982 |
| 1645 | nmdc:mga07m45_3363_c1 | 3300050496 | Bacteria | 7708 |
| 1646 | nmdc:mga07m45_430032_c1 | 3300050496 | Bacteria | 766 |
| 1647 | nmdc:mga07m45_683442_c1 | 3300050496 | Bacteria | 591 |
| 1648 | nmdc:mga05p37_214291_c1 | 3300050507 | Bacteria | 2326 |
| 1649 | nmdc:mga0qj67_754949_c1 | 3300050509 | Bacteria | 772 |
| 1650 | nmdc:mga06r32_218511_c1 | 3300050510 | Bacteria | 1894 |
| 1651 | nmdc:mga08y16_356564_c1 | 3300050511 | Bacteria | 1502 |
| 1652 | nmdc:mga08y16_449587_c1 | 3300050511 | Bacteria | 1314 |
| 1653 | nmdc:mga0n895_113627_c1 | 3300050512 | Bacteria | 2725 |
| 1654 | nmdc:mga0n895_1272174_c1 | 3300050512 | Bacteria | 707 |
| 1655 | nmdc:mga0n895_1449844_c1 | 3300050512 | Bacteria | 654 |
| 1656 | nmdc:mga0n895_228943_c1 | 3300050512 | Bacteria | 1887 |
| 1657 | nmdc:mga0n895_728338_c1 | 3300050512 | Bacteria | 986 |
| 1658 | nmdc:mga0rr50_202685_c1 | 3300050513 | Bacteria | 1631 |
| 1659 | nmdc:mga08x19_1052831_c1 | 3300050514 | Bacteria | 578 |
| 1660 | nmdc:mga08x19_5246_c1 | 3300050514 | Bacteria | 7669 |
| 1661 | nmdc:mga0a205_246805_c1 | 3300050515 | Bacteria | 1665 |
| 1662 | nmdc:mga0sz30_11871_c1 | 3300050516 | Bacteria | 3378 |
| 1663 | nmdc:mga0sz30_159126_c1 | 3300050516 | Bacteria | 1000 |
| 1664 | nmdc:mga0sz30_1763_c1 | 3300050516 | Bacteria | 7683 |
| 1665 | nmdc:mga0sz30_20156_c1 | 3300050516 | Bacteria | 2688 |
| 1666 | nmdc:mga0sz30_34913_c1 | 3300050516 | Bacteria | 2096 |
| 1667 | Ga0495601_0000015 | 3300053077 | Bacteria | 213851 |
| 1668 | Ga0495601_0014124 | 3300053077 | Bacteria | 4811 |
| 1669 | Ga0495601_0100600 | 3300053077 | Bacteria | 1867 |
| 1670 | Ga0495612_0000096 | 3300053078 | Bacteria | 38017 |
| 1671 | Ga0495612_0081702 | 3300053078 | Bacteria | 1358 |
| 1672 | Ga0495612_0170846 | 3300053078 | Bacteria | 952 |
| 1673 | Ga0495612_0255806 | 3300053078 | Bacteria | 779 |
| 1674 | Ga0500610_0119506 | 3300053079 | Bacteria | 1349 |
| 1675 | Ga0500635_0024895 | 3300053080 | Bacteria | 1882 |
| 1676 | Ga0495655_0040535 | 3300053083 | Bacteria | 1186 |
| 1677 | Ga0495655_0054133 | 3300053083 | Bacteria | 1073 |
| 1678 | Ga0495655_0127672 | 3300053083 | Bacteria | 780 |
| 1679 | Ga0495595_0000035 | 3300053084 | Bacteria | 79822 |
| 1680 | Ga0495595_0000332 | 3300053084 | Bacteria | 18218 |
| 1681 | Ga0495595_0173013 | 3300053084 | Bacteria | 1069 |
| 1682 | Ga0495595_0389504 | 3300053084 | Bacteria | 706 |
| 1683 | Ga0495619_0000044 | 3300053085 | Bacteria | 108581 |
| 1684 | Ga0495619_0000633 | 3300053085 | Bacteria | 23194 |
| 1685 | Ga0495619_0305695 | 3300053085 | Bacteria | 1101 |
| 1686 | Ga0495619_0378986 | 3300053085 | Bacteria | 977 |
| 1687 | Ga0495619_0445476 | 3300053085 | Bacteria | 893 |
| 1688 | Ga0495619_0887235 | 3300053085 | Bacteria | 600 |
| 1689 | Ga0500578_0428989 | 3300053086 | Bacteria | 756 |
| 1690 | Ga0500578_0622617 | 3300053086 | Bacteria | 590 |
| 1691 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1692 | Ga0500643_039291 | 3300053087 | Bacteria | 1398 |
| 1693 | Ga0500644_0011683 | 3300053088 | Bacteria | 2407 |
| 1694 | Ga0500644_0374348 | 3300053088 | Bacteria | 618 |
| 1695 | Ga0500646_0084705 | 3300053090 | Bacteria | 972 |
| 1696 | Ga0500647_0164594 | 3300053091 | Bacteria | 1027 |
| 1697 | Ga0500651_0001377 | 3300053093 | Bacteria | 12178 |
| 1698 | Ga0500651_0050027 | 3300053093 | Bacteria | 2624 |
| 1699 | Ga0500566_0002104 | 3300053094 | Bacteria | 11745 |
| 1700 | Ga0500566_0037299 | 3300053094 | Bacteria | 2817 |
| 1701 | Ga0500641_0001219 | 3300053096 | Bacteria | 9151 |
| 1702 | Ga0500641_0011540 | 3300053096 | Bacteria | 3207 |
| 1703 | Ga0500641_0021459 | 3300053096 | Bacteria | 2462 |
| 1704 | Ga0500641_0038330 | 3300053096 | Bacteria | 1925 |
| 1705 | Ga0500650_0016352 | 3300053098 | Bacteria | 3180 |
| 1706 | Ga0500553_229283 | 3300053101 | Bacteria | 594 |
| 1707 | Ga0500556_0000195 | 3300053104 | Bacteria | 49800 |
| 1708 | Ga0500556_0007068 | 3300053104 | Bacteria | 3204 |
| 1709 | Ga0500556_0224956 | 3300053104 | Bacteria | 740 |
| 1710 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 1711 | Ga0500557_031893 | 3300053105 | Bacteria | 1602 |
| 1712 | Ga0500562_010064 | 3300053108 | Bacteria | 2393 |
| 1713 | Ga0500562_095183 | 3300053108 | Bacteria | 809 |
| 1714 | Ga0500569_153803 | 3300053109 | Bacteria | 776 |
| 1715 | Ga0500592_000692 | 3300053116 | Bacteria | 5549 |
| 1716 | Ga0500593_193951 | 3300053117 | Bacteria | 740 |
| 1717 | Ga0500594_0027401 | 3300053118 | Bacteria | 1475 |
| 1718 | Ga0500594_0053663 | 3300053118 | Bacteria | 1142 |
| 1719 | Ga0500595_002179 | 3300053119 | Bacteria | 9946 |
| 1720 | Ga0500595_003662 | 3300053119 | Bacteria | 7111 |
| 1721 | Ga0500595_005876 | 3300053119 | Bacteria | 5286 |
| 1722 | Ga0500595_012929 | 3300053119 | Bacteria | 3211 |
| 1723 | Ga0500595_016261 | 3300053119 | Bacteria | 2775 |
| 1724 | Ga0500597_071190 | 3300053120 | Bacteria | 1504 |
| 1725 | Ga0500607_139392 | 3300053121 | Bacteria | 1143 |
| 1726 | Ga0500608_251870 | 3300053122 | Bacteria | 688 |
| 1727 | Ga0500608_350386 | 3300053122 | Bacteria | 523 |
| 1728 | Ga0500618_008174 | 3300053125 | Bacteria | 2939 |
| 1729 | Ga0500618_046364 | 3300053125 | Bacteria | 990 |
| 1730 | Ga0500621_038365 | 3300053126 | Bacteria | 1928 |
| 1731 | Ga0500628_095836 | 3300053129 | Bacteria | 779 |
| 1732 | Ga0500642_0000012 | 3300053130 | Bacteria | 206424 |
| 1733 | Ga0500642_0000090 | 3300053130 | Bacteria | 46849 |
| 1734 | Ga0500642_0004650 | 3300053130 | Bacteria | 4326 |
| 1735 | Ga0500652_000146 | 3300053131 | Bacteria | 26947 |
| 1736 | Ga0500652_228319 | 3300053131 | Bacteria | 746 |
| 1737 | Ga0500658_0410241 | 3300053134 | Bacteria | 619 |
| 1738 | Ga0500559_0005374 | 3300053136 | Bacteria | 5895 |
| 1739 | Ga0500559_0043687 | 3300053136 | Bacteria | 1958 |
| 1740 | Ga0500559_0475973 | 3300053136 | Bacteria | 575 |
| 1741 | Ga0500564_127084 | 3300053138 | Bacteria | 1106 |
| 1742 | Ga0500568_0002038 | 3300053139 | Bacteria | 12288 |
| 1743 | Ga0500568_0008058 | 3300053139 | Bacteria | 5114 |
| 1744 | Ga0500573_0080592 | 3300053140 | Bacteria | 1849 |
| 1745 | Ga0500577_0001485 | 3300053142 | Bacteria | 5986 |
| 1746 | Ga0500577_0040634 | 3300053142 | Bacteria | 1693 |
| 1747 | Ga0500577_0268383 | 3300053142 | Bacteria | 743 |
| 1748 | Ga0500577_0518601 | 3300053142 | Bacteria | 520 |
| 1749 | Ga0500586_004216 | 3300053145 | Bacteria | 3490 |
| 1750 | Ga0500589_024473 | 3300053147 | Bacteria | 2788 |
| 1751 | Ga0500590_064864 | 3300053148 | Bacteria | 1828 |
| 1752 | Ga0500590_212917 | 3300053148 | Bacteria | 805 |
| 1753 | Ga0500590_342407 | 3300053148 | Bacteria | 539 |
| 1754 | Ga0500603_004752 | 3300053150 | Bacteria | 2907 |
| 1755 | Ga0500604_0043149 | 3300053151 | Bacteria | 1369 |
| 1756 | Ga0500604_0093832 | 3300053151 | Bacteria | 983 |
| 1757 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 1758 | Ga0500616_0001093 | 3300053153 | Bacteria | 28182 |
| 1759 | Ga0500616_0018046 | 3300053153 | Bacteria | 3993 |
| 1760 | Ga0500622_0003795 | 3300053156 | Bacteria | 9840 |
| 1761 | Ga0500622_0121696 | 3300053156 | Bacteria | 1265 |
| 1762 | Ga0500622_0137669 | 3300053156 | Bacteria | 1168 |
| 1763 | Ga0500633_0015028 | 3300053160 | Bacteria | 2212 |
| 1764 | Ga0500633_0022339 | 3300053160 | Bacteria | 1937 |
| 1765 | Ga0500636_0014194 | 3300053177 | Bacteria | 4683 |
| 1766 | Ga0500636_0019749 | 3300053177 | Bacteria | 3984 |
| 1767 | Ga0500636_0097505 | 3300053177 | Bacteria | 1675 |
| 1768 | Ga0500636_0166334 | 3300053177 | Bacteria | 1197 |
| 1769 | Ga0500636_0276343 | 3300053177 | Bacteria | 841 |
| 1770 | Ga0500637_0029315 | 3300053178 | Bacteria | 3052 |
| 1771 | Ga0500611_007308 | 3300053727 | Bacteria | 1654 |
| 1772 | Ga0500611_079236 | 3300053727 | Bacteria | 816 |
| 1773 | Ga0500657_119015 | 3300053728 | Bacteria | 1050 |
| 1774 | Ga0500625_062174 | 3300053729 | Bacteria | 1690 |
| 1775 | Ga0500645_010480 | 3300053730 | Bacteria | 3063 |
| 1776 | Ga0500645_025797 | 3300053730 | Bacteria | 1791 |
| 1777 | Ga0500645_031444 | 3300053730 | Bacteria | 1595 |
| 1778 | Ga0500645_033030 | 3300053730 | Bacteria | 1549 |
| 1779 | Ga0500645_048293 | 3300053730 | Bacteria | 1247 |
| 1780 | Ga0500656_034772 | 3300053732 | Bacteria | 685 |
| 1781 | Ga0500599_001833 | 3300053736 | Bacteria | 2498 |
| 1782 | Ga0500601_034627 | 3300053737 | Bacteria | 605 |
| 1783 | Ga0501084_0002863 | 3300054114 | Bacteria | 13951 |
| 1784 | Ga0501084_0032538 | 3300054114 | Bacteria | 4362 |
| 1785 | Ga0501084_0334479 | 3300054114 | Bacteria | 1279 |
| 1786 | Ga0501084_0692783 | 3300054114 | Bacteria | 859 |
| 1787 | Ga0501084_1167141 | 3300054114 | Bacteria | 646 |
| 1788 | Ga0500661_018957 | 3300055283 | Bacteria | 1225 |
| 1789 | Ga0590077_081133 | 3300059426 | Bacteria | 747 |
| 1790 | Ga0587070_114810 | 3300059491 | Bacteria | 636 |
| 1791 | Ga0587073_0192516 | 3300059492 | Bacteria | 606 |
| 1792 | Ga0587077_134966 | 3300059493 | Bacteria | 630 |
| 1793 | Ga0587077_142152 | 3300059493 | Bacteria | 619 |
| 1794 | Ga0587077_195595 | 3300059493 | Bacteria | 556 |
| 1795 | Ga0587080_047642 | 3300059503 | Bacteria | 800 |
| 1796 | Ga0587083_0077395 | 3300059505 | Bacteria | 785 |
| 1797 | Ga0587085_092389 | 3300059506 | Bacteria | 627 |
| 1798 | Ga0587085_096377 | 3300059506 | Bacteria | 618 |
| 1799 | Ga0587088_103635 | 3300059508 | Bacteria | 638 |
| 1800 | Ga0587088_110329 | 3300059508 | Bacteria | 625 |
| 1801 | Ga0587088_165574 | 3300059508 | Bacteria | 545 |
| 1802 | Ga0587128_089277 | 3300059630 | Bacteria | 630 |
| 1803 | Ga0587062_042191 | 3300059639 | Bacteria | 744 |
| 1804 | Ga0587067_124011 | 3300059640 | Bacteria | 623 |
| 1805 | Ga0587068_088907 | 3300059641 | Bacteria | 634 |
| 1806 | Ga0587069_066389 | 3300059642 | Bacteria | 676 |
| 1807 | Ga0587075_082314 | 3300059644 | Bacteria | 616 |
| 1808 | Ga0587102_036813 | 3300059649 | Bacteria | 618 |
| 1809 | Ga0587107_051245 | 3300059652 | Bacteria | 701 |
| 1810 | Ga0587124_020525 | 3300059660 | Bacteria | 672 |
| 1811 | Ga0587071_072381 | 3300060344 | Bacteria | 753 |
| 1812 | Ga0587111_0093287 | 3300060346 | Bacteria | 738 |
| 1813 | Ga0501082_0024686 | 3300060353 | Bacteria | 5181 |
| 1814 | Ga0501082_0178335 | 3300060353 | Bacteria | 1848 |
| 1815 | Ga0501082_0792387 | 3300060353 | Bacteria | 829 |
| 1816 | Ga0501082_1188637 | 3300060353 | Bacteria | 666 |
| 1817 | Ga0530510_0017394 | 3300061734 | Bacteria | 5096 |
| 1818 | Ga0530510_0054880 | 3300061734 | Bacteria | 2879 |
| 1819 | Ga0530510_0070488 | 3300061734 | Bacteria | 2537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0693797 | Ga0451577_0693797_157_756 | 118 |
| 2 | 3300044712 | Ga0453684_0001512 | Ga0453684_0001512_55108_55707 | 120 |
| 3 | 3300045051 | Ga0451576_0271232 | Ga0451576_0271232_312_908 | 130 |
| 4 | 3300042876 | Ga0451577_0715825 | Ga0451577_0715825_111_713 | 131 |
| 5 | 3300041997 | Ga0439431_0255678 | Ga0439431_0255678_70_501 | 139 |
| 6 | 3300045051 | Ga0451576_0066823 | Ga0451576_0066823_2423_3013 | 140 |
| 7 | 3300005445 | Ga0070708_100566755 | Ga0070708_1005667552 | 141 |
| 8 | 3300042876 | Ga0451577_0384233 | Ga0451577_0384233_269_859 | 141 |
| 9 | 3300042876 | Ga0451577_0398228 | Ga0451577_0398228_478_1071 | 143 |
| 10 | 3300044712 | Ga0453684_0008350 | Ga0453684_0008350_4879_5475 | 143 |
| 11 | 3300045051 | Ga0451576_0249144 | Ga0451576_0249144_1166_1759 | 143 |
| 12 | 3300042876 | Ga0451577_0062346 | Ga0451577_0062346_1767_2366 | 144 |
| 13 | 3300042876 | Ga0451577_1008073 | Ga0451577_1008073_135_734 | 144 |
| 14 | 3300044712 | Ga0453684_0171982 | Ga0453684_0171982_1100_1699 | 144 |
| 15 | 3300046558 | Ga0495633_0212747 | Ga0495633_0212747_11_487 | 144 |
| 16 | 3300049576 | Ga0501040_0549875 | Ga0501040_0549875_334_774 | 144 |
| 17 | 3300044712 | Ga0453684_0269919 | Ga0453684_0269919_651_1238 | 145 |
| 18 | 3300046559 | Ga0495667_1019128 | Ga0495667_1019128_36_488 | 145 |
| 19 | 3300046473 | Ga0495582_0428192 | Ga0495582_0428192_304_750 | 146 |
| 20 | 3300047469 | Ga0495673_0309667 | Ga0495673_0309667_25_471 | 146 |
| 21 | 3300049744 | Ga0501083_0134404 | Ga0501083_0134404_875_1378 | 146 |
| 22 | 3300050492 | nmdc:mga0yw44_967079_c1 | nmdc:mga0yw44_967079_c1_102_548 | 146 |
| 23 | 3300050507 | nmdc:mga05p37_214291_c1 | nmdc:mga05p37_214291_c1_1870_2316 | 146 |
| 24 | iso_pu_bacteria | 8019586578 | 8019597051 | 146 |
| 25 | 3300046492 | Ga0495585_0248900 | Ga0495585_0248900_164_658 | 147 |
| 26 | 3300046520 | Ga0495637_0314914 | Ga0495637_0314914_38_532 | 147 |
| 27 | 3300046523 | Ga0495644_0341994 | Ga0495644_0341994_43_537 | 147 |
| 28 | 3300046558 | Ga0495633_0139098 | Ga0495633_0139098_246_740 | 147 |
| 29 | 3300046684 | Ga0495669_0248088 | Ga0495669_0248088_285_779 | 147 |
| 30 | 3300047318 | Ga0495636_0238697 | Ga0495636_0238697_52_546 | 147 |
| 31 | 3300050496 | nmdc:mga07m45_683442_c1 | nmdc:mga07m45_683442_c1_11_460 | 147 |
| 32 | 3300053122 | Ga0500608_350386 | Ga0500608_350386_40_489 | 147 |
| 33 | 3300061734 | Ga0530510_0054880 | Ga0530510_0054880_2205_2765 | 147 |
| 34 | 3300037068 | Ga0373925_0333023 | Ga0373925_0333023_112_570 | 149 |
| 35 | 3300042876 | Ga0451577_0549311 | Ga0451577_0549311_128_694 | 149 |
| 36 | 3300020069 | Ga0197907_11339043 | Ga0197907_113390431 | 150 |
| 37 | 3300048906 | Ga0496103_0675293 | Ga0496103_0675293_170_625 | 150 |
| 38 | 3300049581 | Ga0501047_0767039 | Ga0501047_0767039_11_469 | 150 |
| 39 | 3300047322 | Ga0495680_0937984 | Ga0495680_0937984_83_541 | 151 |
| 40 | 3300005983 | Ga0081540_1134583 | Ga0081540_11345831 | 152 |
| 41 | 3300039447 | Ga0436361_0999682 | Ga0436361_0999682_57_515 | 152 |
| 42 | 3300046460 | Ga0495638_0299920 | Ga0495638_0299920_396_854 | 152 |
| 43 | 3300046475 | Ga0495639_0581458 | Ga0495639_0581458_98_559 | 152 |
| 44 | 3300046809 | Ga0495600_0790411 | Ga0495600_0790411_14_475 | 152 |
| 45 | 3300048910 | Ga0496107_0180421 | Ga0496107_0180421_1090_1554 | 152 |
| 46 | 3300048924 | Ga0496121_0644707 | Ga0496121_0644707_12_476 | 152 |
| 47 | 3300049572 | Ga0501036_0363694 | Ga0501036_0363694_706_1179 | 152 |
| 48 | 3300049576 | Ga0501040_0198285 | Ga0501040_0198285_385_858 | 152 |
| 49 | 3300049577 | Ga0501041_0932845 | Ga0501041_0932845_66_524 | 152 |
| 50 | 3300049582 | Ga0501048_0238023 | Ga0501048_0238023_138_611 | 152 |
| 51 | 3300049586 | Ga0501070_0319337 | Ga0501070_0319337_634_1098 | 152 |
| 52 | 3300049591 | Ga0501075_0169216 | Ga0501075_0169216_184_657 | 152 |
| 53 | 3300049592 | Ga0501076_0016262 | Ga0501076_0016262_2785_3258 | 152 |
| 54 | 3300049741 | Ga0501079_0141351 | Ga0501079_0141351_875_1348 | 152 |
| 55 | 3300049822 | Ga0501035_0945897 | Ga0501035_0945897_159_632 | 152 |
| 56 | 3300061734 | Ga0530510_0017394 | Ga0530510_0017394_4576_5049 | 152 |
| 57 | 3300050514 | nmdc:mga08x19_5246_c1 | nmdc:mga08x19_5246_c1_2114_2581 | 153 |
| 58 | 3300053096 | Ga0500641_0021459 | Ga0500641_0021459_1541_2044 | 153 |
| 59 | 3300059508 | Ga0587088_165574 | Ga0587088_165574_31_525 | 153 |
| 60 | 3300006028 | Ga0070717_11097200 | Ga0070717_110972002 | 154 |
| 61 | 3300021361 | Ga0213872_10079111 | Ga0213872_100791112 | 154 |
| 62 | 3300039450 | Ga0436363_1660925 | Ga0436363_1660925_2004_2513 | 154 |
| 63 | 3300039453 | Ga0436362_0985474 | Ga0436362_0985474_102_611 | 154 |
| 64 | 3300046794 | Ga0495589_0265535 | Ga0495589_0265535_85_576 | 154 |
| 65 | iso_pu_bacteria | 2513237096 | 2513659120 | 154 |
| 66 | iso_pu_bacteria | 2513237137 | 2513859158 | 154 |
| 67 | iso_pu_bacteria | 2513237145 | 2513920552 | 154 |
| 68 | iso_pu_bacteria | 2517572143 | 2517887421 | 154 |
| 69 | iso_pu_bacteria | 2667528175 | 2671120840 | 154 |
| 70 | iso_pu_bacteria | 2824732956 | 2824736412 | 154 |
| 71 | iso_pu_bacteria | 2885374607 | 2885382908 | 154 |
| 72 | iso_pu_bacteria | 2903748898 | 2903754098 | 154 |
| 73 | iso_pu_bacteria | 2904690495 | 2904691714 | 154 |
| 74 | iso_pu_bacteria | 2906635258 | 2906637421 | 154 |
| 75 | iso_pu_bacteria | 2906660503 | 2906663650 | 154 |
| 76 | iso_pu_bacteria | 2908739725 | 2908745863 | 154 |
| 77 | iso_pu_bacteria | 2908756301 | 2908763770 | 154 |
| 78 | iso_pu_bacteria | 3005474847 | 3005482750 | 154 |
| 79 | iso_pu_bacteria | 8056689827 | 8056696095 | 154 |
| 80 | 3300013307 | Ga0157372_10278211 | Ga0157372_102782112 | 156 |
| 81 | 3300035118 | Ga0373954_0029859 | Ga0373954_0029859_835_1311 | 156 |
| 82 | 3300035118 | Ga0373954_0275395 | Ga0373954_0275395_57_557 | 156 |
| 83 | 3300035120 | Ga0373957_0201047 | Ga0373957_0201047_258_734 | 156 |
| 84 | 3300035172 | Ga0373955_0124277 | Ga0373955_0124277_820_1296 | 156 |
| 85 | 3300035724 | Ga0373933_0049018 | Ga0373933_0049018_89_565 | 156 |
| 86 | 3300035724 | Ga0373933_0406371 | Ga0373933_0406371_277_777 | 156 |
| 87 | 3300036401 | Ga0373937_0051162 | Ga0373937_0051162_3171_3671 | 156 |
| 88 | 3300036401 | Ga0373937_0192183 | Ga0373937_0192183_1396_1872 | 156 |
| 89 | 3300037068 | Ga0373925_0115773 | Ga0373925_0115773_1134_1634 | 156 |
| 90 | 3300048088 | Ga0495602_0842467 | Ga0495602_0842467_77_553 | 156 |
| 91 | 3300048921 | Ga0496118_0445083 | Ga0496118_0445083_41_559 | 156 |
| 92 | 3300048924 | Ga0496121_0331373 | Ga0496121_0331373_414_932 | 156 |
| 93 | 3300053084 | Ga0495595_0173013 | Ga0495595_0173013_24_524 | 156 |
| 94 | 3300009545 | Ga0105237_10080441 | Ga0105237_100804413 | 157 |
| 95 | 3300013297 | Ga0157378_10644094 | Ga0157378_106440941 | 157 |
| 96 | 3300035117 | Ga0373953_0060668 | Ga0373953_0060668_870_1346 | 157 |
| 97 | 3300036401 | Ga0373937_0039228 | Ga0373937_0039228_1250_1726 | 157 |
| 98 | 3300036401 | Ga0373937_0720775 | Ga0373937_0720775_312_788 | 157 |
| 99 | 3300036458 | Ga0310112_041518 | Ga0310112_041518_131_607 | 157 |
| 100 | 3300036534 | Ga0310109_025226 | Ga0310109_025226_232_708 | 157 |
| 101 | 3300037068 | Ga0373925_0033423 | Ga0373925_0033423_2437_2913 | 157 |
| 102 | 3300039437 | Ga0436365_0042070 | Ga0436365_0042070_56_532 | 157 |
| 103 | 3300041413 | Ga0439465_0125004 | Ga0439465_0125004_359_838 | 157 |
| 104 | 3300044656 | Ga0466969_0158615 | Ga0466969_0158615_113_589 | 157 |
| 105 | 3300044656 | Ga0466969_0313346 | Ga0466969_0313346_24_497 | 157 |
| 106 | 3300044684 | Ga0466966_0366777 | Ga0466966_0366777_97_570 | 157 |
| 107 | 3300044706 | Ga0466964_0242361 | Ga0466964_0242361_85_558 | 157 |
| 108 | 3300046462 | Ga0495651_0013418 | Ga0495651_0013418_3942_4418 | 157 |
| 109 | 3300046477 | Ga0495664_0222054 | Ga0495664_0222054_465_941 | 157 |
| 110 | 3300046536 | Ga0495587_0304296 | Ga0495587_0304296_192_668 | 157 |
| 111 | 3300046559 | Ga0495667_0366042 | Ga0495667_0366042_346_822 | 157 |
| 112 | 3300046675 | Ga0495657_0527437 | Ga0495657_0527437_14_490 | 157 |
| 113 | 3300047322 | Ga0495680_0132741 | Ga0495680_0132741_37_513 | 157 |
| 114 | 3300047471 | Ga0495684_0731871 | Ga0495684_0731871_47_523 | 157 |
| 115 | 3300048090 | Ga0495615_0154977 | Ga0495615_0154977_10_489 | 157 |
| 116 | 3300048904 | Ga0496101_0160302 | Ga0496101_0160302_1189_1665 | 157 |
| 117 | 3300048904 | Ga0496101_0662701 | Ga0496101_0662701_134_610 | 157 |
| 118 | 3300048912 | Ga0496109_0088490 | Ga0496109_0088490_2013_2489 | 157 |
| 119 | 3300048914 | Ga0496111_0554542 | Ga0496111_0554542_131_607 | 157 |
| 120 | 3300048917 | Ga0496114_0640754 | Ga0496114_0640754_204_680 | 157 |
| 121 | 3300048918 | Ga0496115_0329545 | Ga0496115_0329545_323_799 | 157 |
| 122 | 3300048929 | Ga0496126_0031487 | Ga0496126_0031487_268_747 | 157 |
| 123 | 3300048929 | Ga0496126_0173318 | Ga0496126_0173318_59_535 | 157 |
| 124 | 3300048929 | Ga0496126_0212625 | Ga0496126_0212625_239_715 | 157 |
| 125 | 3300050490 | nmdc:mga03n38_357684_c1 | nmdc:mga03n38_357684_c1_76_555 | 157 |
| 126 | 3300050492 | nmdc:mga0yw44_628579_c1 | nmdc:mga0yw44_628579_c1_201_680 | 157 |
| 127 | 3300050493 | nmdc:mga0k408_715058_c1 | nmdc:mga0k408_715058_c1_14_493 | 157 |
| 128 | 3300050494 | nmdc:mga06z11_18937_c1 | nmdc:mga06z11_18937_c1_482_961 | 157 |
| 129 | 3300050495 | nmdc:mga04h51_91122_c1 | nmdc:mga04h51_91122_c1_519_998 | 157 |
| 130 | 3300053083 | Ga0495655_0054133 | Ga0495655_0054133_78_557 | 157 |
| 131 | 3300053728 | Ga0500657_119015 | Ga0500657_119015_469_945 | 157 |
| 132 | iso_pu_bacteria | 2513237101 | 2513698561 | 157 |
| 133 | iso_pu_bacteria | 2721755755 | 2723848821 | 157 |
| 134 | iso_pu_bacteria | 2791355199 | 2793078823 | 157 |
| 135 | iso_pu_bacteria | 2874604998 | 2874606048 | 157 |
| 136 | iso_pu_bacteria | 2876808645 | 2876817839 | 157 |
| 137 | iso_pu_bacteria | 2879110137 | 2879116788 | 157 |
| 138 | iso_pu_bacteria | 2889033259 | 2889034443 | 157 |
| 139 | iso_pu_bacteria | 2922361189 | 2922363436 | 157 |
| 140 | iso_pu_bacteria | 2922386360 | 2922389553 | 157 |
| 141 | iso_pu_bacteria | 8006964411 | 8006970037 | 157 |
| 142 | iso_pu_bacteria | 8006984368 | 8006986245 | 157 |
| 143 | iso_pu_bacteria | 8006994254 | 8006998926 | 157 |
| 144 | iso_pu_bacteria | 8056673599 | 8056675388 | 157 |
| 145 | 3300009036 | Ga0105244_10292586 | Ga0105244_102925861 | 158 |
| 146 | 3300009093 | Ga0105240_10196901 | Ga0105240_101969012 | 158 |
| 147 | 3300009101 | Ga0105247_10083743 | Ga0105247_100837433 | 158 |
| 148 | 3300009101 | Ga0105247_10196167 | Ga0105247_101961672 | 158 |
| 149 | 3300009148 | Ga0105243_10313425 | Ga0105243_103134252 | 158 |
| 150 | 3300009174 | Ga0105241_10098771 | Ga0105241_100987712 | 158 |
| 151 | 3300009176 | Ga0105242_10138449 | Ga0105242_101384491 | 158 |
| 152 | 3300009177 | Ga0105248_10050701 | Ga0105248_100507014 | 158 |
| 153 | 3300009545 | Ga0105237_10250743 | Ga0105237_102507432 | 158 |
| 154 | 3300009545 | Ga0105237_10368248 | Ga0105237_103682482 | 158 |
| 155 | 3300009551 | Ga0105238_10475945 | Ga0105238_104759452 | 158 |
| 156 | 3300009553 | Ga0105249_10138873 | Ga0105249_101388732 | 158 |
| 157 | 3300010375 | Ga0105239_10149087 | Ga0105239_101490872 | 158 |
| 158 | 3300010375 | Ga0105239_10202613 | Ga0105239_102026132 | 158 |
| 159 | 3300010375 | Ga0105239_10300709 | Ga0105239_103007091 | 158 |
| 160 | 3300011119 | Ga0105246_10439702 | Ga0105246_104397022 | 158 |
| 161 | 3300013100 | Ga0157373_10098153 | Ga0157373_100981532 | 158 |
| 162 | 3300013104 | Ga0157370_10144710 | Ga0157370_101447103 | 158 |
| 163 | 3300013105 | Ga0157369_10018060 | Ga0157369_100180606 | 158 |
| 164 | 3300013105 | Ga0157369_10792865 | Ga0157369_107928652 | 158 |
| 165 | 3300013296 | Ga0157374_11022564 | Ga0157374_110225642 | 158 |
| 166 | 3300013296 | Ga0157374_11683894 | Ga0157374_116838942 | 158 |
| 167 | 3300013306 | Ga0163162_10187803 | Ga0163162_101878032 | 158 |
| 168 | 3300013306 | Ga0163162_10467696 | Ga0163162_104676962 | 158 |
| 169 | 3300014325 | Ga0163163_10108554 | Ga0163163_101085543 | 158 |
| 170 | 3300014325 | Ga0163163_10370333 | Ga0163163_103703332 | 158 |
| 171 | 3300014968 | Ga0157379_10374052 | Ga0157379_103740522 | 158 |
| 172 | 3300015265 | Ga0182005_1056718 | Ga0182005_10567181 | 158 |
| 173 | 3300023660 | Ga0247550_102757 | Ga0247550_1027571 | 158 |
| 174 | 3300025913 | Ga0207695_10390884 | Ga0207695_103908841 | 158 |
| 175 | 3300033442 | Ga0315911_1000022 | Ga0315911_1000022117 | 158 |
| 176 | 3300034957 | Ga0373938_0011772 | Ga0373938_0011772_319_798 | 158 |
| 177 | 3300035083 | Ga0373926_0334613 | Ga0373926_0334613_101_577 | 158 |
| 178 | 3300035084 | Ga0373928_0024614 | Ga0373928_0024614_567_1046 | 158 |
| 179 | 3300035085 | Ga0373929_0052464 | Ga0373929_0052464_275_754 | 158 |
| 180 | 3300035088 | Ga0373940_0023822 | Ga0373940_0023822_742_1221 | 158 |
| 181 | 3300035089 | Ga0373944_0299376 | Ga0373944_0299376_100_576 | 158 |
| 182 | 3300035111 | Ga0373923_0055004 | Ga0373923_0055004_204_680 | 158 |
| 183 | 3300035113 | Ga0373936_0021327 | Ga0373936_0021327_135_611 | 158 |
| 184 | 3300035115 | Ga0373941_0018775 | Ga0373941_0018775_279_758 | 158 |
| 185 | 3300035117 | Ga0373953_0227634 | Ga0373953_0227634_170_646 | 158 |
| 186 | 3300035119 | Ga0373956_0066740 | Ga0373956_0066740_224_700 | 158 |
| 187 | 3300035170 | Ga0373943_0050860 | Ga0373943_0050860_363_839 | 158 |
| 188 | 3300035172 | Ga0373955_0357048 | Ga0373955_0357048_57_533 | 158 |
| 189 | 3300035241 | Ga0373961_0166916 | Ga0373961_0166916_186_665 | 158 |
| 190 | 3300035691 | Ga0373931_0000654 | Ga0373931_0000654_7633_8112 | 158 |
| 191 | 3300035692 | Ga0373935_1311443 | Ga0373935_1311443_23_499 | 158 |
| 192 | 3300035695 | Ga0373927_0027284 | Ga0373927_0027284_1397_1876 | 158 |
| 193 | 3300035695 | Ga0373927_0068952 | Ga0373927_0068952_465_941 | 158 |
| 194 | 3300035724 | Ga0373933_0038950 | Ga0373933_0038950_280_756 | 158 |
| 195 | 3300035725 | Ga0373947_0007461 | Ga0373947_0007461_1368_1844 | 158 |
| 196 | 3300036401 | Ga0373937_0048069 | Ga0373937_0048069_708_1184 | 158 |
| 197 | 3300037068 | Ga0373925_0255216 | Ga0373925_0255216_401_880 | 158 |
| 198 | 3300037068 | Ga0373925_0380369 | Ga0373925_0380369_517_993 | 158 |
| 199 | 3300037068 | Ga0373925_0399786 | Ga0373925_0399786_271_747 | 158 |
| 200 | 3300037418 | Ga0395900_0009031 | Ga0395900_0009031_8714_9190 | 158 |
| 201 | 3300037418 | Ga0395900_0158767 | Ga0395900_0158767_552_1028 | 158 |
| 202 | 3300037466 | Ga0395898_0008119 | Ga0395898_0008119_3361_3837 | 158 |
| 203 | 3300037466 | Ga0395898_0348507 | Ga0395898_0348507_885_1361 | 158 |
| 204 | 3300037471 | Ga0395905_0003811 | Ga0395905_0003811_11625_12101 | 158 |
| 205 | 3300037471 | Ga0395905_0024981 | Ga0395905_0024981_4254_4730 | 158 |
| 206 | 3300037853 | Ga0436364_1112930 | Ga0436364_1112930_1942_2418 | 158 |
| 207 | 3300038443 | Ga0395901_0430847 | Ga0395901_0430847_186_662 | 158 |
| 208 | 3300039437 | Ga0436365_0085392 | Ga0436365_0085392_167_649 | 158 |
| 209 | 3300039437 | Ga0436365_0380670 | Ga0436365_0380670_460_936 | 158 |
| 210 | 3300041443 | Ga0451789_0003421 | Ga0451789_0003421_97_573 | 158 |
| 211 | 3300041452 | Ga0451793_1933064 | Ga0451793_1933064_230_706 | 158 |
| 212 | 3300041460 | Ga0451802_0631769 | Ga0451802_0631769_116_601 | 158 |
| 213 | 3300041460 | Ga0451802_0679946 | Ga0451802_0679946_375_851 | 158 |
| 214 | 3300041463 | Ga0451804_0307913 | Ga0451804_0307913_99_575 | 158 |
| 215 | 3300041486 | Ga0451807_0993385 | Ga0451807_0993385_210_689 | 158 |
| 216 | 3300041496 | Ga0451839_0776644 | Ga0451839_0776644_416_904 | 158 |
| 217 | 3300041505 | Ga0451849_0032440 | Ga0451849_0032440_132_614 | 158 |
| 218 | 3300041512 | Ga0451853_2893679 | Ga0451853_2893679_12_491 | 158 |
| 219 | 3300041512 | Ga0451853_3226891 | Ga0451853_3226891_455_931 | 158 |
| 220 | 3300044658 | Ga0466972_0000274 | Ga0466972_0000274_6032_6508 | 158 |
| 221 | 3300044658 | Ga0466972_0168721 | Ga0466972_0168721_15_491 | 158 |
| 222 | 3300044683 | Ga0466965_0159700 | Ga0466965_0159700_579_1055 | 158 |
| 223 | 3300044683 | Ga0466965_0400087 | Ga0466965_0400087_272_748 | 158 |
| 224 | 3300044694 | Ga0466963_0020169 | Ga0466963_0020169_2404_2880 | 158 |
| 225 | 3300044706 | Ga0466964_0018182 | Ga0466964_0018182_1451_1927 | 158 |
| 226 | 3300044706 | Ga0466964_0065526 | Ga0466964_0065526_318_794 | 158 |
| 227 | 3300044706 | Ga0466964_0125688 | Ga0466964_0125688_647_1123 | 158 |
| 228 | 3300044719 | Ga0466971_0108755 | Ga0466971_0108755_152_628 | 158 |
| 229 | 3300044735 | Ga0466968_0063903 | Ga0466968_0063903_953_1429 | 158 |
| 230 | 3300044765 | Ga0466970_0056792 | Ga0466970_0056792_1091_1567 | 158 |
| 231 | 3300044765 | Ga0466970_0329598 | Ga0466970_0329598_178_654 | 158 |
| 232 | 3300044842 | Ga0466957_0216315 | Ga0466957_0216315_156_638 | 158 |
| 233 | 3300044901 | Ga0466960_0027592 | Ga0466960_0027592_1734_2210 | 158 |
| 234 | 3300044901 | Ga0466960_0601018 | Ga0466960_0601018_10_486 | 158 |
| 235 | 3300045049 | Ga0466959_0492938 | Ga0466959_0492938_163_639 | 158 |
| 236 | 3300045976 | Ga0466967_0024320 | Ga0466967_0024320_3255_3731 | 158 |
| 237 | 3300046454 | Ga0495592_0520146 | Ga0495592_0520146_95_574 | 158 |
| 238 | 3300046455 | Ga0495603_0052399 | Ga0495603_0052399_382_858 | 158 |
| 239 | 3300046459 | Ga0495629_0305515 | Ga0495629_0305515_64_540 | 158 |
| 240 | 3300046460 | Ga0495638_0010821 | Ga0495638_0010821_1474_1950 | 158 |
| 241 | 3300046472 | Ga0495580_0082309 | Ga0495580_0082309_1508_1984 | 158 |
| 242 | 3300046474 | Ga0495605_0046241 | Ga0495605_0046241_980_1456 | 158 |
| 243 | 3300046475 | Ga0495639_0047306 | Ga0495639_0047306_385_861 | 158 |
| 244 | 3300046477 | Ga0495664_0004921 | Ga0495664_0004921_4933_5409 | 158 |
| 245 | 3300046499 | Ga0495594_0149558 | Ga0495594_0149558_46_522 | 158 |
| 246 | 3300046500 | Ga0495596_0069274 | Ga0495596_0069274_585_1061 | 158 |
| 247 | 3300046507 | Ga0495606_0064386 | Ga0495606_0064386_279_755 | 158 |
| 248 | 3300046507 | Ga0495606_0270265 | Ga0495606_0270265_375_851 | 158 |
| 249 | 3300046512 | Ga0495610_0067542 | Ga0495610_0067542_209_685 | 158 |
| 250 | 3300046513 | Ga0495616_0065146 | Ga0495616_0065146_1141_1617 | 158 |
| 251 | 3300046516 | Ga0495628_0042830 | Ga0495628_0042830_208_684 | 158 |
| 252 | 3300046517 | Ga0495630_0222377 | Ga0495630_0222377_691_1167 | 158 |
| 253 | 3300046522 | Ga0495643_0047558 | Ga0495643_0047558_1036_1512 | 158 |
| 254 | 3300046522 | Ga0495643_0239919 | Ga0495643_0239919_36_512 | 158 |
| 255 | 3300046524 | Ga0495648_0067297 | Ga0495648_0067297_1498_1974 | 158 |
| 256 | 3300046524 | Ga0495648_0190885 | Ga0495648_0190885_94_570 | 158 |
| 257 | 3300046524 | Ga0495648_0214321 | Ga0495648_0214321_369_845 | 158 |
| 258 | 3300046526 | Ga0495666_0033207 | Ga0495666_0033207_1782_2258 | 158 |
| 259 | 3300046529 | Ga0495652_0807334 | Ga0495652_0807334_99_575 | 158 |
| 260 | 3300046531 | Ga0495665_0057443 | Ga0495665_0057443_758_1234 | 158 |
| 261 | 3300046535 | Ga0495586_0151857 | Ga0495586_0151857_442_918 | 158 |
| 262 | 3300046542 | Ga0495597_0009354 | Ga0495597_0009354_3337_3813 | 158 |
| 263 | 3300046543 | Ga0495645_0102777 | Ga0495645_0102777_65_541 | 158 |
| 264 | 3300046557 | Ga0495622_0186043 | Ga0495622_0186043_273_749 | 158 |
| 265 | 3300046559 | Ga0495667_0059306 | Ga0495667_0059306_1199_1675 | 158 |
| 266 | 3300046616 | Ga0495668_0122222 | Ga0495668_0122222_450_926 | 158 |
| 267 | 3300046642 | Ga0495634_0056209 | Ga0495634_0056209_1876_2352 | 158 |
| 268 | 3300046648 | Ga0495611_0095356 | Ga0495611_0095356_583_1059 | 158 |
| 269 | 3300046648 | Ga0495611_0383120 | Ga0495611_0383120_103_579 | 158 |
| 270 | 3300046663 | Ga0495635_0102091 | Ga0495635_0102091_852_1328 | 158 |
| 271 | 3300046674 | Ga0495588_0016010 | Ga0495588_0016010_2916_3392 | 158 |
| 272 | 3300046681 | Ga0495647_0281574 | Ga0495647_0281574_175_651 | 158 |
| 273 | 3300046683 | Ga0495658_0015804 | Ga0495658_0015804_2026_2502 | 158 |
| 274 | 3300046684 | Ga0495669_0292643 | Ga0495669_0292643_200_676 | 158 |
| 275 | 3300046692 | Ga0495671_0212948 | Ga0495671_0212948_144_620 | 158 |
| 276 | 3300046694 | Ga0495649_0215041 | Ga0495649_0215041_364_840 | 158 |
| 277 | 3300046694 | Ga0495649_0388659 | Ga0495649_0388659_47_523 | 158 |
| 278 | 3300046794 | Ga0495589_0219698 | Ga0495589_0219698_18_494 | 158 |
| 279 | 3300047315 | Ga0495581_0127338 | Ga0495581_0127338_414_890 | 158 |
| 280 | 3300047315 | Ga0495581_0460226 | Ga0495581_0460226_106_582 | 158 |
| 281 | 3300047317 | Ga0495604_0378628 | Ga0495604_0378628_79_555 | 158 |
| 282 | 3300047319 | Ga0495674_0013003 | Ga0495674_0013003_5786_6262 | 158 |
| 283 | 3300047320 | Ga0495672_0050924 | Ga0495672_0050924_449_928 | 158 |
| 284 | 3300047320 | Ga0495672_0179053 | Ga0495672_0179053_476_952 | 158 |
| 285 | 3300047320 | Ga0495672_0263491 | Ga0495672_0263491_132_608 | 158 |
| 286 | 3300047321 | Ga0495676_0060198 | Ga0495676_0060198_934_1410 | 158 |
| 287 | 3300047321 | Ga0495676_0417491 | Ga0495676_0417491_131_607 | 158 |
| 288 | 3300047323 | Ga0495683_0285280 | Ga0495683_0285280_14_490 | 158 |
| 289 | 3300047443 | Ga0495687_011239 | Ga0495687_011239_898_1374 | 158 |
| 290 | 3300047469 | Ga0495673_0046688 | Ga0495673_0046688_896_1372 | 158 |
| 291 | 3300047469 | Ga0495673_0165924 | Ga0495673_0165924_207_683 | 158 |
| 292 | 3300047471 | Ga0495684_0117831 | Ga0495684_0117831_1391_1867 | 158 |
| 293 | 3300047472 | Ga0495686_0139108 | Ga0495686_0139108_195_671 | 158 |
| 294 | 3300047472 | Ga0495686_0453986 | Ga0495686_0453986_167_643 | 158 |
| 295 | 3300047673 | Ga0495593_0005905 | Ga0495593_0005905_478_954 | 158 |
| 296 | 3300048091 | Ga0495626_0123901 | Ga0495626_0123901_605_1081 | 158 |
| 297 | 3300048903 | Ga0496100_0239782 | Ga0496100_0239782_434_910 | 158 |
| 298 | 3300048903 | Ga0496100_0670279 | Ga0496100_0670279_134_613 | 158 |
| 299 | 3300048904 | Ga0496101_0001656 | Ga0496101_0001656_6400_6879 | 158 |
| 300 | 3300048904 | Ga0496101_0040994 | Ga0496101_0040994_1806_2282 | 158 |
| 301 | 3300048904 | Ga0496101_0090035 | Ga0496101_0090035_1285_1761 | 158 |
| 302 | 3300048905 | Ga0496102_0010759 | Ga0496102_0010759_190_669 | 158 |
| 303 | 3300048905 | Ga0496102_0015959 | Ga0496102_0015959_3316_3792 | 158 |
| 304 | 3300048905 | Ga0496102_0107507 | Ga0496102_0107507_2110_2586 | 158 |
| 305 | 3300048905 | Ga0496102_0514920 | Ga0496102_0514920_215_691 | 158 |
| 306 | 3300048906 | Ga0496103_0004565 | Ga0496103_0004565_3458_3934 | 158 |
| 307 | 3300048906 | Ga0496103_0016825 | Ga0496103_0016825_3753_4232 | 158 |
| 308 | 3300048906 | Ga0496103_0026693 | Ga0496103_0026693_1838_2314 | 158 |
| 309 | 3300048907 | Ga0496104_0004595 | Ga0496104_0004595_4451_4930 | 158 |
| 310 | 3300048907 | Ga0496104_0028670 | Ga0496104_0028670_3463_3939 | 158 |
| 311 | 3300048908 | Ga0496105_0017472 | Ga0496105_0017472_5004_5480 | 158 |
| 312 | 3300048908 | Ga0496105_0040208 | Ga0496105_0040208_499_978 | 158 |
| 313 | 3300048908 | Ga0496105_0049487 | Ga0496105_0049487_1227_1703 | 158 |
| 314 | 3300048909 | Ga0496106_0026288 | Ga0496106_0026288_2111_2590 | 158 |
| 315 | 3300048909 | Ga0496106_0041586 | Ga0496106_0041586_1314_1790 | 158 |
| 316 | 3300048910 | Ga0496107_0005918 | Ga0496107_0005918_4007_4486 | 158 |
| 317 | 3300048910 | Ga0496107_0053637 | Ga0496107_0053637_203_679 | 158 |
| 318 | 3300048911 | Ga0496108_0159548 | Ga0496108_0159548_401_880 | 158 |
| 319 | 3300048911 | Ga0496108_0236735 | Ga0496108_0236735_880_1356 | 158 |
| 320 | 3300048912 | Ga0496109_0105241 | Ga0496109_0105241_938_1414 | 158 |
| 321 | 3300048912 | Ga0496109_0506568 | Ga0496109_0506568_291_770 | 158 |
| 322 | 3300048913 | Ga0496110_0020972 | Ga0496110_0020972_4212_4691 | 158 |
| 323 | 3300048913 | Ga0496110_0028359 | Ga0496110_0028359_722_1198 | 158 |
| 324 | 3300048913 | Ga0496110_0197535 | Ga0496110_0197535_568_1044 | 158 |
| 325 | 3300048913 | Ga0496110_0321622 | Ga0496110_0321622_600_1076 | 158 |
| 326 | 3300048915 | Ga0496112_0002949 | Ga0496112_0002949_7207_7686 | 158 |
| 327 | 3300048915 | Ga0496112_0068339 | Ga0496112_0068339_1931_2407 | 158 |
| 328 | 3300048915 | Ga0496112_0183612 | Ga0496112_0183612_662_1138 | 158 |
| 329 | 3300048916 | Ga0496113_0020040 | Ga0496113_0020040_2057_2536 | 158 |
| 330 | 3300048916 | Ga0496113_0047223 | Ga0496113_0047223_1512_1988 | 158 |
| 331 | 3300048916 | Ga0496113_0820392 | Ga0496113_0820392_170_646 | 158 |
| 332 | 3300048917 | Ga0496114_0008695 | Ga0496114_0008695_4751_5230 | 158 |
| 333 | 3300048917 | Ga0496114_0386257 | Ga0496114_0386257_576_1052 | 158 |
| 334 | 3300048918 | Ga0496115_0057832 | Ga0496115_0057832_2508_2987 | 158 |
| 335 | 3300048918 | Ga0496115_0134764 | Ga0496115_0134764_628_1104 | 158 |
| 336 | 3300048918 | Ga0496115_0210492 | Ga0496115_0210492_1057_1533 | 158 |
| 337 | 3300048919 | Ga0496116_0091944 | Ga0496116_0091944_918_1394 | 158 |
| 338 | 3300048920 | Ga0496117_0025524 | Ga0496117_0025524_3187_3663 | 158 |
| 339 | 3300048920 | Ga0496117_0377298 | Ga0496117_0377298_181_657 | 158 |
| 340 | 3300048921 | Ga0496118_0033149 | Ga0496118_0033149_1802_2278 | 158 |
| 341 | 3300048921 | Ga0496118_0054679 | Ga0496118_0054679_1242_1718 | 158 |
| 342 | 3300048922 | Ga0496119_0046119 | Ga0496119_0046119_358_834 | 158 |
| 343 | 3300048923 | Ga0496120_0144788 | Ga0496120_0144788_39_518 | 158 |
| 344 | 3300048924 | Ga0496121_0009685 | Ga0496121_0009685_1063_1539 | 158 |
| 345 | 3300048924 | Ga0496121_0017138 | Ga0496121_0017138_2248_2733 | 158 |
| 346 | 3300048924 | Ga0496121_0020230 | Ga0496121_0020230_5455_5931 | 158 |
| 347 | 3300048925 | Ga0496122_0129062 | Ga0496122_0129062_760_1236 | 158 |
| 348 | 3300048927 | Ga0496124_0234874 | Ga0496124_0234874_44_520 | 158 |
| 349 | 3300048928 | Ga0496125_0016454 | Ga0496125_0016454_4091_4567 | 158 |
| 350 | 3300048928 | Ga0496125_0252537 | Ga0496125_0252537_74_550 | 158 |
| 351 | 3300048929 | Ga0496126_0082566 | Ga0496126_0082566_37_513 | 158 |
| 352 | 3300048929 | Ga0496126_0323879 | Ga0496126_0323879_206_682 | 158 |
| 353 | 3300048929 | Ga0496126_0639311 | Ga0496126_0639311_259_741 | 158 |
| 354 | 3300049460 | Ga0495682_0223451 | Ga0495682_0223451_99_575 | 158 |
| 355 | 3300049568 | Ga0501031_0130145 | Ga0501031_0130145_483_965 | 158 |
| 356 | 3300049569 | Ga0501032_0056453 | Ga0501032_0056453_1460_1942 | 158 |
| 357 | 3300049571 | Ga0501034_0114578 | Ga0501034_0114578_1997_2479 | 158 |
| 358 | 3300049572 | Ga0501036_0122464 | Ga0501036_0122464_829_1311 | 158 |
| 359 | 3300049573 | Ga0501037_0117071 | Ga0501037_0117071_829_1311 | 158 |
| 360 | 3300049574 | Ga0501038_0093604 | Ga0501038_0093604_1048_1530 | 158 |
| 361 | 3300049575 | Ga0501039_0070882 | Ga0501039_0070882_1384_1866 | 158 |
| 362 | 3300049576 | Ga0501040_0362394 | Ga0501040_0362394_90_572 | 158 |
| 363 | 3300049577 | Ga0501041_0757479 | Ga0501041_0757479_40_522 | 158 |
| 364 | 3300049579 | Ga0501043_0149557 | Ga0501043_0149557_491_973 | 158 |
| 365 | 3300049580 | Ga0501046_0072850 | Ga0501046_0072850_1419_1901 | 158 |
| 366 | 3300049581 | Ga0501047_0092163 | Ga0501047_0092163_1559_2041 | 158 |
| 367 | 3300049582 | Ga0501048_0102291 | Ga0501048_0102291_1096_1578 | 158 |
| 368 | 3300049583 | Ga0501067_0082621 | Ga0501067_0082621_482_964 | 158 |
| 369 | 3300049584 | Ga0501068_0028519 | Ga0501068_0028519_1288_1770 | 158 |
| 370 | 3300049585 | Ga0501069_0088588 | Ga0501069_0088588_1081_1563 | 158 |
| 371 | 3300049586 | Ga0501070_0209207 | Ga0501070_0209207_1081_1563 | 158 |
| 372 | 3300049587 | Ga0501071_0155255 | Ga0501071_0155255_1039_1521 | 158 |
| 373 | 3300049588 | Ga0501072_0174662 | Ga0501072_0174662_843_1325 | 158 |
| 374 | 3300049589 | Ga0501073_0206051 | Ga0501073_0206051_613_1095 | 158 |
| 375 | 3300049590 | Ga0501074_0064795 | Ga0501074_0064795_463_945 | 158 |
| 376 | 3300049741 | Ga0501079_0077852 | Ga0501079_0077852_863_1345 | 158 |
| 377 | 3300049742 | Ga0501080_0086703 | Ga0501080_0086703_1763_2245 | 158 |
| 378 | 3300049822 | Ga0501035_0562782 | Ga0501035_0562782_246_728 | 158 |
| 379 | 3300049823 | Ga0501044_0465141 | Ga0501044_0465141_32_514 | 158 |
| 380 | 3300049824 | Ga0501045_0099371 | Ga0501045_0099371_257_739 | 158 |
| 381 | 3300050489 | nmdc:mga03683_87890_c1 | nmdc:mga03683_87890_c1_61_537 | 158 |
| 382 | 3300050490 | nmdc:mga03n38_197867_c1 | nmdc:mga03n38_197867_c1_110_586 | 158 |
| 383 | 3300050491 | nmdc:mga00v17_20915_c1 | nmdc:mga00v17_20915_c1_2071_2547 | 158 |
| 384 | 3300050491 | nmdc:mga00v17_260639_c1 | nmdc:mga00v17_260639_c1_574_1050 | 158 |
| 385 | 3300050492 | nmdc:mga0yw44_31673_c1 | nmdc:mga0yw44_31673_c1_1056_1532 | 158 |
| 386 | 3300050492 | nmdc:mga0yw44_62959_c1 | nmdc:mga0yw44_62959_c1_769_1245 | 158 |
| 387 | 3300050492 | nmdc:mga0yw44_841546_c1 | nmdc:mga0yw44_841546_c1_44_520 | 158 |
| 388 | 3300050493 | nmdc:mga0k408_11902_c1 | nmdc:mga0k408_11902_c1_1591_2067 | 158 |
| 389 | 3300050495 | nmdc:mga04h51_19459_c1 | nmdc:mga04h51_19459_c1_858_1334 | 158 |
| 390 | 3300050495 | nmdc:mga04h51_195161_c1 | nmdc:mga04h51_195161_c1_46_522 | 158 |
| 391 | 3300050496 | nmdc:mga07m45_18987_c1 | nmdc:mga07m45_18987_c1_948_1424 | 158 |
| 392 | 3300050496 | nmdc:mga07m45_30607_c1 | nmdc:mga07m45_30607_c1_1378_1854 | 158 |
| 393 | 3300050516 | nmdc:mga0sz30_11871_c1 | nmdc:mga0sz30_11871_c1_2627_3103 | 158 |
| 394 | 3300050516 | nmdc:mga0sz30_34913_c1 | nmdc:mga0sz30_34913_c1_396_872 | 158 |
| 395 | 3300053078 | Ga0495612_0081702 | Ga0495612_0081702_511_987 | 158 |
| 396 | 3300053079 | Ga0500610_0119506 | Ga0500610_0119506_521_997 | 158 |
| 397 | 3300053083 | Ga0495655_0040535 | Ga0495655_0040535_347_823 | 158 |
| 398 | 3300053085 | Ga0495619_0445476 | Ga0495619_0445476_134_610 | 158 |
| 399 | 3300053086 | Ga0500578_0428989 | Ga0500578_0428989_212_688 | 158 |
| 400 | 3300053086 | Ga0500578_0622617 | Ga0500578_0622617_16_492 | 158 |
| 401 | 3300053087 | Ga0500643_000016 | Ga0500643_000016_63588_64064 | 158 |
| 402 | 3300053101 | Ga0500553_229283 | Ga0500553_229283_12_488 | 158 |
| 403 | 3300053104 | Ga0500556_0007068 | Ga0500556_0007068_2102_2578 | 158 |
| 404 | 3300053105 | Ga0500557_000011 | Ga0500557_000011_30083_30559 | 158 |
| 405 | 3300053108 | Ga0500562_010064 | Ga0500562_010064_1432_1908 | 158 |
| 406 | 3300053120 | Ga0500597_071190 | Ga0500597_071190_783_1259 | 158 |
| 407 | 3300053122 | Ga0500608_251870 | Ga0500608_251870_109_585 | 158 |
| 408 | 3300053126 | Ga0500621_038365 | Ga0500621_038365_1037_1513 | 158 |
| 409 | 3300053130 | Ga0500642_0000090 | Ga0500642_0000090_21631_22107 | 158 |
| 410 | 3300053142 | Ga0500577_0268383 | Ga0500577_0268383_11_493 | 158 |
| 411 | 3300053153 | Ga0500616_0018046 | Ga0500616_0018046_639_1115 | 158 |
| 412 | 3300053156 | Ga0500622_0003795 | Ga0500622_0003795_8873_9349 | 158 |
| 413 | 3300053160 | Ga0500633_0015028 | Ga0500633_0015028_144_620 | 158 |
| 414 | 3300053177 | Ga0500636_0014194 | Ga0500636_0014194_2384_2866 | 158 |
| 415 | 3300053727 | Ga0500611_007308 | Ga0500611_007308_429_905 | 158 |
| 416 | 3300053729 | Ga0500625_062174 | Ga0500625_062174_23_499 | 158 |
| 417 | 3300053730 | Ga0500645_025797 | Ga0500645_025797_1304_1780 | 158 |
| 418 | 3300053732 | Ga0500656_034772 | Ga0500656_034772_158_634 | 158 |
| 419 | 3300053736 | Ga0500599_001833 | Ga0500599_001833_1530_2006 | 158 |
| 420 | 3300053737 | Ga0500601_034627 | Ga0500601_034627_18_494 | 158 |
| 421 | 3300060353 | Ga0501082_0178335 | Ga0501082_0178335_1303_1785 | 158 |
| 422 | iso_pu_bacteria | 2507262055 | 2507511457 | 158 |
| 423 | iso_pu_bacteria | 2508501009 | 2508545264 | 158 |
| 424 | iso_pu_bacteria | 2508501042 | 2508694096 | 158 |
| 425 | iso_pu_bacteria | 2511231028 | 2511397238 | 158 |
| 426 | iso_pu_bacteria | 2513237092 | 2513624051 | 158 |
| 427 | iso_pu_bacteria | 2513237095 | 2513648431 | 158 |
| 428 | iso_pu_bacteria | 2513237098 | 2513673282 | 158 |
| 429 | iso_pu_bacteria | 2513237102 | 2513703651 | 158 |
| 430 | iso_pu_bacteria | 2513237104 | 2513716386 | 158 |
| 431 | iso_pu_bacteria | 2513237139 | 2513875059 | 158 |
| 432 | iso_pu_bacteria | 2513237161 | 2514013869 | 158 |
| 433 | iso_pu_bacteria | 2515154112 | 2515624969 | 158 |
| 434 | iso_pu_bacteria | 2517093001 | 2517101217 | 158 |
| 435 | iso_pu_bacteria | 2524023205 | 2524439851 | 158 |
| 436 | iso_pu_bacteria | 2524023210 | 2524465850 | 158 |
| 437 | iso_pu_bacteria | 2524023228 | 2524539237 | 158 |
| 438 | iso_pu_bacteria | 2528768022 | 2528855436 | 158 |
| 439 | iso_pu_bacteria | 2602042107 | 2603857458 | 158 |
| 440 | iso_pu_bacteria | 2617270735 | 2617348376 | 158 |
| 441 | iso_pu_bacteria | 2617270741 | 2617374917 | 158 |
| 442 | iso_pu_bacteria | 2744054633 | 2745075872 | 158 |
| 443 | iso_pu_bacteria | 2791355196 | 2793061352 | 158 |
| 444 | iso_pu_bacteria | 2802429603 | 2805916351 | 158 |
| 445 | iso_pu_bacteria | 2816332527 | 2818240013 | 158 |
| 446 | iso_pu_bacteria | 2824600985 | 2824607034 | 158 |
| 447 | iso_pu_bacteria | 2824609381 | 2824614295 | 158 |
| 448 | iso_pu_bacteria | 2824617872 | 2824622295 | 158 |
| 449 | iso_pu_bacteria | 2824626560 | 2824631492 | 158 |
| 450 | iso_pu_bacteria | 2824635225 | 2824638012 | 158 |
| 451 | iso_pu_bacteria | 2824644064 | 2824651115 | 158 |
| 452 | iso_pu_bacteria | 2824653114 | 2824660642 | 158 |
| 453 | iso_pu_bacteria | 2824661429 | 2824664126 | 158 |
| 454 | iso_pu_bacteria | 2824671348 | 2824674554 | 158 |
| 455 | iso_pu_bacteria | 2824679649 | 2824681581 | 158 |
| 456 | iso_pu_bacteria | 2824687955 | 2824690517 | 158 |
| 457 | iso_pu_bacteria | 2824696289 | 2824697901 | 158 |
| 458 | iso_pu_bacteria | 2824704595 | 2824711250 | 158 |
| 459 | iso_pu_bacteria | 2824714736 | 2824721088 | 158 |
| 460 | iso_pu_bacteria | 2824723954 | 2824726694 | 158 |
| 461 | iso_pu_bacteria | 2824746037 | 2824752049 | 158 |
| 462 | iso_pu_bacteria | 2824753945 | 2824762908 | 158 |
| 463 | iso_pu_bacteria | 2824763712 | 2824770279 | 158 |
| 464 | iso_pu_bacteria | 2824773399 | 2824776220 | 158 |
| 465 | iso_pu_bacteria | 2838122688 | 2838129984 | 158 |
| 466 | iso_pu_bacteria | 2841941048 | 2841947023 | 158 |
| 467 | iso_pu_bacteria | 2841949485 | 2841955046 | 158 |
| 468 | iso_pu_bacteria | 2841957949 | 2841964937 | 158 |
| 469 | iso_pu_bacteria | 2841966195 | 2841970003 | 158 |
| 470 | iso_pu_bacteria | 2841974524 | 2841977355 | 158 |
| 471 | iso_pu_bacteria | 2841983080 | 2841990231 | 158 |
| 472 | iso_pu_bacteria | 2842038055 | 2842042232 | 158 |
| 473 | iso_pu_bacteria | 2842045827 | 2842050275 | 158 |
| 474 | iso_pu_bacteria | 2844315083 | 2844316450 | 158 |
| 475 | iso_pu_bacteria | 2847930680 | 2847939250 | 158 |
| 476 | iso_pu_bacteria | 2847939898 | 2847943789 | 158 |
| 477 | iso_pu_bacteria | 2849076700 | 2849081979 | 158 |
| 478 | iso_pu_bacteria | 2857509624 | 2857513542 | 158 |
| 479 | iso_pu_bacteria | 2857524615 | 2857526839 | 158 |
| 480 | iso_pu_bacteria | 2874590934 | 2874594672 | 158 |
| 481 | iso_pu_bacteria | 2874612657 | 2874615265 | 158 |
| 482 | iso_pu_bacteria | 2874620515 | 2874622674 | 158 |
| 483 | iso_pu_bacteria | 2874645413 | 2874647248 | 158 |
| 484 | iso_pu_bacteria | 2876761206 | 2876765437 | 158 |
| 485 | iso_pu_bacteria | 2876771140 | 2876773804 | 158 |
| 486 | iso_pu_bacteria | 2876818435 | 2876819958 | 158 |
| 487 | iso_pu_bacteria | 2879074833 | 2879075163 | 158 |
| 488 | iso_pu_bacteria | 2879083081 | 2879086922 | 158 |
| 489 | iso_pu_bacteria | 2879099564 | 2879103047 | 158 |
| 490 | iso_pu_bacteria | 2879127579 | 2879129317 | 158 |
| 491 | iso_pu_bacteria | 2879142872 | 2879142918 | 158 |
| 492 | iso_pu_bacteria | 2881364244 | 2881369405 | 158 |
| 493 | iso_pu_bacteria | 2881665667 | 2881668257 | 158 |
| 494 | iso_pu_bacteria | 2885366525 | 2885373666 | 158 |
| 495 | iso_pu_bacteria | 2885409591 | 2885411082 | 158 |
| 496 | iso_pu_bacteria | 2888378607 | 2888387035 | 158 |
| 497 | iso_pu_bacteria | 2888388044 | 2888389718 | 158 |
| 498 | iso_pu_bacteria | 2888419890 | 2888421370 | 158 |
| 499 | iso_pu_bacteria | 2893066018 | 2893070002 | 158 |
| 500 | iso_pu_bacteria | 2903727486 | 2903732331 | 158 |
| 501 | iso_pu_bacteria | 2903768456 | 2903777305 | 158 |
| 502 | iso_pu_bacteria | 2904666416 | 2904671319 | 158 |
| 503 | iso_pu_bacteria | 2904699407 | 2904707225 | 158 |
| 504 | iso_pu_bacteria | 2904711408 | 2904719618 | 158 |
| 505 | iso_pu_bacteria | 2906602504 | 2906606356 | 158 |
| 506 | iso_pu_bacteria | 2906626472 | 2906626824 | 158 |
| 507 | iso_pu_bacteria | 2906643746 | 2906649071 | 158 |
| 508 | iso_pu_bacteria | 2908775508 | 2908777402 | 158 |
| 509 | iso_pu_bacteria | 2919073203 | 2919077964 | 158 |
| 510 | iso_pu_bacteria | 2922368715 | 2922377169 | 158 |
| 511 | iso_pu_bacteria | 2922393267 | 2922398320 | 158 |
| 512 | iso_pu_bacteria | 2922425934 | 2922433125 | 158 |
| 513 | iso_pu_bacteria | 2929615660 | 2929623570 | 158 |
| 514 | iso_pu_bacteria | 2929624759 | 2929632728 | 158 |
| 515 | iso_pu_bacteria | 2932784394 | 2932791421 | 158 |
| 516 | iso_pu_bacteria | 2932809354 | 2932814717 | 158 |
| 517 | iso_pu_bacteria | 2932818245 | 2932823574 | 158 |
| 518 | iso_pu_bacteria | 2932828146 | 2932833011 | 158 |
| 519 | iso_pu_bacteria | 2933577622 | 2933585473 | 158 |
| 520 | iso_pu_bacteria | 2935608549 | 2935616353 | 158 |
| 521 | iso_pu_bacteria | 2935616580 | 2935623742 | 158 |
| 522 | iso_pu_bacteria | 2935638405 | 2935639513 | 158 |
| 523 | iso_pu_bacteria | 2935648319 | 2935650747 | 158 |
| 524 | iso_pu_bacteria | 2935656913 | 2935662127 | 158 |
| 525 | iso_pu_bacteria | 2935665750 | 2935670458 | 158 |
| 526 | iso_pu_bacteria | 2935675223 | 2935679887 | 158 |
| 527 | iso_pu_bacteria | 2935684952 | 2935687457 | 158 |
| 528 | iso_pu_bacteria | 2935694250 | 2935696571 | 158 |
| 529 | iso_pu_bacteria | 2935703347 | 2935705389 | 158 |
| 530 | iso_pu_bacteria | 2935713505 | 2935718916 | 158 |
| 531 | iso_pu_bacteria | 2935722832 | 2935728568 | 158 |
| 532 | iso_pu_bacteria | 2935732158 | 2935736835 | 158 |
| 533 | iso_pu_bacteria | 2935741537 | 2935746162 | 158 |
| 534 | iso_pu_bacteria | 2935750917 | 2935753423 | 158 |
| 535 | iso_pu_bacteria | 2935760218 | 2935766183 | 158 |
| 536 | iso_pu_bacteria | 2935769743 | 2935770406 | 158 |
| 537 | iso_pu_bacteria | 2935777560 | 2935777563 | 158 |
| 538 | iso_pu_bacteria | 2935785616 | 2935786541 | 158 |
| 539 | iso_pu_bacteria | 2935793552 | 2935794596 | 158 |
| 540 | iso_pu_bacteria | 2935801545 | 2935807131 | 158 |
| 541 | iso_pu_bacteria | 2935810662 | 2935813955 | 158 |
| 542 | iso_pu_bacteria | 2935819856 | 2935827150 | 158 |
| 543 | iso_pu_bacteria | 2935827899 | 2935828996 | 158 |
| 544 | iso_pu_bacteria | 2935837841 | 2935844168 | 158 |
| 545 | iso_pu_bacteria | 2935847175 | 2935854331 | 158 |
| 546 | iso_pu_bacteria | 2935855204 | 2935862033 | 158 |
| 547 | iso_pu_bacteria | 2935864058 | 2935871597 | 158 |
| 548 | iso_pu_bacteria | 2935873716 | 2935880292 | 158 |
| 549 | iso_pu_bacteria | 2935908558 | 2935913574 | 158 |
| 550 | iso_pu_bacteria | 2935916978 | 2935923472 | 158 |
| 551 | iso_pu_bacteria | 2935926038 | 2935931109 | 158 |
| 552 | iso_pu_bacteria | 2935934488 | 2935935391 | 158 |
| 553 | iso_pu_bacteria | 2935942939 | 2935946957 | 158 |
| 554 | iso_pu_bacteria | 2935951376 | 2935953948 | 158 |
| 555 | iso_pu_bacteria | 2935959822 | 2935961419 | 158 |
| 556 | iso_pu_bacteria | 2935967501 | 2935968974 | 158 |
| 557 | iso_pu_bacteria | 2935975950 | 2935982376 | 158 |
| 558 | iso_pu_bacteria | 2935984226 | 2935985833 | 158 |
| 559 | iso_pu_bacteria | 2935992306 | 2935996958 | 158 |
| 560 | iso_pu_bacteria | 2936002035 | 2936005993 | 158 |
| 561 | iso_pu_bacteria | 2936011229 | 2936016291 | 158 |
| 562 | iso_pu_bacteria | 2936019824 | 2936025061 | 158 |
| 563 | iso_pu_bacteria | 2936028420 | 2936033596 | 158 |
| 564 | iso_pu_bacteria | 2936037263 | 2936039511 | 158 |
| 565 | iso_pu_bacteria | 2936046547 | 2936050972 | 158 |
| 566 | iso_pu_bacteria | 2936055302 | 2936057721 | 158 |
| 567 | iso_pu_bacteria | 2940556831 | 2940559336 | 158 |
| 568 | iso_pu_bacteria | 2941538514 | 2941542031 | 158 |
| 569 | iso_pu_bacteria | 3005483717 | 3005491255 | 158 |
| 570 | iso_pu_bacteria | 3005506211 | 3005511096 | 158 |
| 571 | iso_pu_bacteria | 3005587118 | 3005591945 | 158 |
| 572 | iso_pu_bacteria | 3005594810 | 3005596075 | 158 |
| 573 | iso_pu_bacteria | 8006933436 | 8006935012 | 158 |
| 574 | iso_pu_bacteria | 8006973647 | 8006974980 | 158 |
| 575 | iso_pu_bacteria | 8016511872 | 8016517038 | 158 |
| 576 | iso_pu_bacteria | 8016522445 | 8016524585 | 158 |
| 577 | iso_pu_bacteria | 8016530956 | 8016538146 | 158 |
| 578 | iso_pu_bacteria | 8016539877 | 8016542427 | 158 |
| 579 | iso_pu_bacteria | 8016548790 | 8016550849 | 158 |
| 580 | iso_pu_bacteria | 8016557553 | 8016559261 | 158 |
| 581 | iso_pu_bacteria | 8016566248 | 8016567814 | 158 |
| 582 | iso_pu_bacteria | 8016575299 | 8016580503 | 158 |
| 583 | iso_pu_bacteria | 8016583857 | 8016588527 | 158 |
| 584 | iso_pu_bacteria | 8016595262 | 8016597211 | 158 |
| 585 | iso_pu_bacteria | 8016603502 | 8016605061 | 158 |
| 586 | iso_pu_bacteria | 8016613128 | 8016619958 | 158 |
| 587 | iso_pu_bacteria | 8016622563 | 8016624177 | 158 |
| 588 | iso_pu_bacteria | 8016630954 | 8016637569 | 158 |
| 589 | iso_pu_bacteria | 8017057580 | 8017059542 | 158 |
| 590 | iso_pu_bacteria | 8019530166 | 8019537818 | 158 |
| 591 | iso_pu_bacteria | 8019538911 | 8019539445 | 158 |
| 592 | iso_pu_bacteria | 8019547302 | 8019551198 | 158 |
| 593 | iso_pu_bacteria | 8019555841 | 8019563645 | 158 |
| 594 | iso_pu_bacteria | 8019565922 | 8019573715 | 158 |
| 595 | iso_pu_bacteria | 8019576017 | 8019579009 | 158 |
| 596 | iso_pu_bacteria | 8019597564 | 8019604632 | 158 |
| 597 | iso_pu_bacteria | 8019608314 | 8019613898 | 158 |
| 598 | iso_pu_bacteria | 8019619141 | 8019624474 | 158 |
| 599 | iso_pu_bacteria | 8019629233 | 8019637571 | 158 |
| 600 | iso_pu_bacteria | 8019638758 | 8019642045 | 158 |
| 601 | iso_pu_bacteria | 8019659431 | 8019665498 | 158 |
| 602 | iso_pu_bacteria | 8019678201 | 8019681053 | 158 |
| 603 | iso_pu_bacteria | 8019687851 | 8019694666 | 158 |
| 604 | iso_pu_bacteria | 8055742211 | 8055749730 | 158 |
| 605 | iso_pu_bacteria | 8056681323 | 8056681745 | 158 |
| 606 | iso_pu_bacteria | 8056967851 | 8056973943 | 158 |
| 607 | 3300005937 | Ga0081455_10053843 | Ga0081455_100538432 | 159 |
| 608 | 3300006871 | Ga0075434_101292010 | Ga0075434_1012920101 | 159 |
| 609 | 3300007788 | Ga0099795_10303414 | Ga0099795_103034141 | 159 |
| 610 | 3300009553 | Ga0105249_11562683 | Ga0105249_115626831 | 159 |
| 611 | 3300012483 | Ga0157337_1002162 | Ga0157337_10021621 | 159 |
| 612 | 3300017792 | Ga0163161_11122265 | Ga0163161_111222651 | 159 |
| 613 | 3300037471 | Ga0395905_0489194 | Ga0395905_0489194_373_861 | 159 |
| 614 | 3300038443 | Ga0395901_0190253 | Ga0395901_0190253_680_1168 | 159 |
| 615 | 3300039437 | Ga0436365_0823182 | Ga0436365_0823182_69_560 | 159 |
| 616 | 3300050512 | nmdc:mga0n895_1272174_c1 | nmdc:mga0n895_1272174_c1_173_661 | 159 |
| 617 | 3300059660 | Ga0587124_020525 | Ga0587124_020525_102_593 | 159 |
| 618 | 3300003911 | JGI25405J52794_10003478 | JGI25405J52794_100034782 | 160 |
| 619 | 3300005329 | Ga0070683_100358105 | Ga0070683_1003581051 | 160 |
| 620 | 3300005343 | Ga0070687_100178221 | Ga0070687_1001782211 | 160 |
| 621 | 3300005355 | Ga0070671_100038562 | Ga0070671_1000385625 | 160 |
| 622 | 3300005435 | Ga0070714_100015426 | Ga0070714_1000154263 | 160 |
| 623 | 3300005439 | Ga0070711_100520735 | Ga0070711_1005207352 | 160 |
| 624 | 3300005547 | Ga0070693_100178160 | Ga0070693_1001781602 | 160 |
| 625 | 3300005564 | Ga0070664_100126011 | Ga0070664_1001260112 | 160 |
| 626 | 3300005618 | Ga0068864_100491185 | Ga0068864_1004911852 | 160 |
| 627 | 3300005834 | Ga0068851_10417729 | Ga0068851_104177291 | 160 |
| 628 | 3300005841 | Ga0068863_100600051 | Ga0068863_1006000512 | 160 |
| 629 | 3300005937 | Ga0081455_10012018 | Ga0081455_100120184 | 160 |
| 630 | 3300005981 | Ga0081538_10030894 | Ga0081538_100308943 | 160 |
| 631 | 3300005983 | Ga0081540_1056247 | Ga0081540_10562472 | 160 |
| 632 | 3300006038 | Ga0075365_10013400 | Ga0075365_100134003 | 160 |
| 633 | 3300006051 | Ga0075364_10219000 | Ga0075364_102190002 | 160 |
| 634 | 3300006237 | Ga0097621_100892512 | Ga0097621_1008925121 | 160 |
| 635 | 3300006846 | Ga0075430_100184334 | Ga0075430_1001843342 | 160 |
| 636 | 3300006880 | Ga0075429_100153011 | Ga0075429_1001530112 | 160 |
| 637 | 3300009094 | Ga0111539_10768888 | Ga0111539_107688882 | 160 |
| 638 | 3300009551 | Ga0105238_10095850 | Ga0105238_100958504 | 160 |
| 639 | 3300010375 | Ga0105239_10032123 | Ga0105239_100321233 | 160 |
| 640 | 3300011119 | Ga0105246_10201239 | Ga0105246_102012392 | 160 |
| 641 | 3300013100 | Ga0157373_10189650 | Ga0157373_101896501 | 160 |
| 642 | 3300013296 | Ga0157374_10094363 | Ga0157374_100943632 | 160 |
| 643 | 3300013307 | Ga0157372_11715616 | Ga0157372_117156161 | 160 |
| 644 | 3300013308 | Ga0157375_10014388 | Ga0157375_100143884 | 160 |
| 645 | 3300014325 | Ga0163163_10109477 | Ga0163163_101094773 | 160 |
| 646 | 3300017792 | Ga0163161_10432229 | Ga0163161_104322292 | 160 |
| 647 | 3300025906 | Ga0207699_10340301 | Ga0207699_103403011 | 160 |
| 648 | 3300025915 | Ga0207693_10104955 | Ga0207693_101049553 | 160 |
| 649 | 3300025916 | Ga0207663_10048221 | Ga0207663_100482211 | 160 |
| 650 | 3300025918 | Ga0207662_10333127 | Ga0207662_103331271 | 160 |
| 651 | 3300025928 | Ga0207700_10286764 | Ga0207700_102867641 | 160 |
| 652 | 3300025928 | Ga0207700_10340516 | Ga0207700_103405162 | 160 |
| 653 | 3300025929 | Ga0207664_10011265 | Ga0207664_100112653 | 160 |
| 654 | 3300025944 | Ga0207661_10057962 | Ga0207661_100579623 | 160 |
| 655 | 3300025945 | Ga0207679_10095936 | Ga0207679_100959363 | 160 |
| 656 | 3300026023 | Ga0207677_10086019 | Ga0207677_100860193 | 160 |
| 657 | 3300026095 | Ga0207676_10092423 | Ga0207676_100924232 | 160 |
| 658 | 3300026142 | Ga0207698_10134117 | Ga0207698_101341172 | 160 |
| 659 | 3300030863 | Ga0265766_1009582 | Ga0265766_10095821 | 160 |
| 660 | 3300031595 | Ga0265313_10007792 | Ga0265313_100077923 | 160 |
| 661 | 3300031711 | Ga0265314_10247378 | Ga0265314_102473782 | 160 |
| 662 | 3300035084 | Ga0373928_0169218 | Ga0373928_0169218_96_587 | 160 |
| 663 | 3300035086 | Ga0373934_0115232 | Ga0373934_0115232_359_847 | 160 |
| 664 | 3300035111 | Ga0373923_0472518 | Ga0373923_0472518_25_513 | 160 |
| 665 | 3300035117 | Ga0373953_0030094 | Ga0373953_0030094_1201_1689 | 160 |
| 666 | 3300035118 | Ga0373954_0019062 | Ga0373954_0019062_375_863 | 160 |
| 667 | 3300035119 | Ga0373956_0015439 | Ga0373956_0015439_2477_2965 | 160 |
| 668 | 3300035120 | Ga0373957_0010840 | Ga0373957_0010840_1915_2403 | 160 |
| 669 | 3300035172 | Ga0373955_0039016 | Ga0373955_0039016_659_1147 | 160 |
| 670 | 3300035724 | Ga0373933_0048118 | Ga0373933_0048118_113_601 | 160 |
| 671 | 3300036401 | Ga0373937_0075352 | Ga0373937_0075352_511_999 | 160 |
| 672 | 3300046454 | Ga0495592_0051683 | Ga0495592_0051683_514_1002 | 160 |
| 673 | 3300046459 | Ga0495629_0116031 | Ga0495629_0116031_845_1333 | 160 |
| 674 | 3300046463 | Ga0495653_0025338 | Ga0495653_0025338_613_1101 | 160 |
| 675 | 3300046475 | Ga0495639_0212430 | Ga0495639_0212430_202_690 | 160 |
| 676 | 3300046511 | Ga0495608_0056748 | Ga0495608_0056748_588_1076 | 160 |
| 677 | 3300046514 | Ga0495618_0185562 | Ga0495618_0185562_586_1074 | 160 |
| 678 | 3300046517 | Ga0495630_0903802 | Ga0495630_0903802_75_563 | 160 |
| 679 | 3300046529 | Ga0495652_0028961 | Ga0495652_0028961_1485_1973 | 160 |
| 680 | 3300046533 | Ga0495640_0148669 | Ga0495640_0148669_666_1154 | 160 |
| 681 | 3300046559 | Ga0495667_0052392 | Ga0495667_0052392_523_1011 | 160 |
| 682 | 3300046642 | Ga0495634_0081282 | Ga0495634_0081282_430_918 | 160 |
| 683 | 3300046663 | Ga0495635_0018719 | Ga0495635_0018719_403_891 | 160 |
| 684 | 3300046675 | Ga0495657_0016378 | Ga0495657_0016378_4334_4822 | 160 |
| 685 | 3300046678 | Ga0495599_0166242 | Ga0495599_0166242_283_771 | 160 |
| 686 | 3300046683 | Ga0495658_0208075 | Ga0495658_0208075_532_1020 | 160 |
| 687 | 3300046689 | Ga0495613_0767128 | Ga0495613_0767128_45_533 | 160 |
| 688 | 3300046690 | Ga0495624_0411268 | Ga0495624_0411268_189_680 | 160 |
| 689 | 3300046809 | Ga0495600_0347429 | Ga0495600_0347429_52_540 | 160 |
| 690 | 3300047317 | Ga0495604_0117147 | Ga0495604_0117147_1393_1881 | 160 |
| 691 | 3300047319 | Ga0495674_0232372 | Ga0495674_0232372_538_1026 | 160 |
| 692 | 3300047322 | Ga0495680_0334977 | Ga0495680_0334977_72_560 | 160 |
| 693 | 3300047444 | Ga0495675_0012692 | Ga0495675_0012692_4232_4720 | 160 |
| 694 | 3300047444 | Ga0495675_0710794 | Ga0495675_0710794_53_544 | 160 |
| 695 | 3300048088 | Ga0495602_0050110 | Ga0495602_0050110_682_1170 | 160 |
| 696 | 3300048903 | Ga0496100_0045083 | Ga0496100_0045083_1526_2011 | 160 |
| 697 | 3300048904 | Ga0496101_0038367 | Ga0496101_0038367_344_829 | 160 |
| 698 | 3300048905 | Ga0496102_0003166 | Ga0496102_0003166_5491_5976 | 160 |
| 699 | 3300048907 | Ga0496104_0018749 | Ga0496104_0018749_5383_5868 | 160 |
| 700 | 3300048908 | Ga0496105_0058959 | Ga0496105_0058959_342_827 | 160 |
| 701 | 3300048909 | Ga0496106_0004829 | Ga0496106_0004829_7719_8204 | 160 |
| 702 | 3300048910 | Ga0496107_0008140 | Ga0496107_0008140_6534_7019 | 160 |
| 703 | 3300048911 | Ga0496108_0022903 | Ga0496108_0022903_341_826 | 160 |
| 704 | 3300048912 | Ga0496109_0010165 | Ga0496109_0010165_3145_3630 | 160 |
| 705 | 3300048913 | Ga0496110_0193956 | Ga0496110_0193956_967_1452 | 160 |
| 706 | 3300048915 | Ga0496112_0048391 | Ga0496112_0048391_2711_3196 | 160 |
| 707 | 3300048916 | Ga0496113_0015214 | Ga0496113_0015214_4498_4983 | 160 |
| 708 | 3300048918 | Ga0496115_0002383 | Ga0496115_0002383_5935_6420 | 160 |
| 709 | 3300049573 | Ga0501037_0716007 | Ga0501037_0716007_60_569 | 160 |
| 710 | 3300049575 | Ga0501039_0356563 | Ga0501039_0356563_190_678 | 160 |
| 711 | 3300049577 | Ga0501041_0423790 | Ga0501041_0423790_197_685 | 160 |
| 712 | 3300049579 | Ga0501043_0602857 | Ga0501043_0602857_163_651 | 160 |
| 713 | 3300049587 | Ga0501071_0109211 | Ga0501071_0109211_1300_1788 | 160 |
| 714 | 3300049588 | Ga0501072_0647005 | Ga0501072_0647005_34_522 | 160 |
| 715 | 3300049590 | Ga0501074_0264454 | Ga0501074_0264454_461_988 | 160 |
| 716 | 3300049591 | Ga0501075_0332019 | Ga0501075_0332019_422_949 | 160 |
| 717 | 3300049592 | Ga0501076_0032845 | Ga0501076_0032845_1552_2079 | 160 |
| 718 | 3300049593 | Ga0501077_0120879 | Ga0501077_0120879_524_1033 | 160 |
| 719 | 3300049742 | Ga0501080_0095483 | Ga0501080_0095483_79_567 | 160 |
| 720 | 3300049743 | Ga0501081_0035611 | Ga0501081_0035611_2338_2829 | 160 |
| 721 | 3300049822 | Ga0501035_0336754 | Ga0501035_0336754_761_1249 | 160 |
| 722 | 3300049824 | Ga0501045_0257507 | Ga0501045_0257507_767_1258 | 160 |
| 723 | 3300049824 | Ga0501045_0500555 | Ga0501045_0500555_91_579 | 160 |
| 724 | 3300050492 | nmdc:mga0yw44_100616_c1 | nmdc:mga0yw44_100616_c1_623_1114 | 160 |
| 725 | 3300050509 | nmdc:mga0qj67_754949_c1 | nmdc:mga0qj67_754949_c1_246_737 | 160 |
| 726 | 3300050510 | nmdc:mga06r32_218511_c1 | nmdc:mga06r32_218511_c1_66_557 | 160 |
| 727 | 3300053078 | Ga0495612_0255806 | Ga0495612_0255806_96_584 | 160 |
| 728 | 3300053085 | Ga0495619_0378986 | Ga0495619_0378986_188_676 | 160 |
| 729 | 3300053730 | Ga0500645_048293 | Ga0500645_048293_451_939 | 160 |
| 730 | 3300054114 | Ga0501084_0334479 | Ga0501084_0334479_223_714 | 160 |
| 731 | 3300054114 | Ga0501084_0692783 | Ga0501084_0692783_142_630 | 160 |
| 732 | 3300060353 | Ga0501082_1188637 | Ga0501082_1188637_62_550 | 160 |
| 733 | 3300061734 | Ga0530510_0070488 | Ga0530510_0070488_84_611 | 160 |
| 734 | 3300002075 | JGI24738J21930_10138678 | JGI24738J21930_101386781 | 161 |
| 735 | 3300002077 | JGI24744J21845_10070339 | JGI24744J21845_100703391 | 161 |
| 736 | 3300003215 | JGI25153J46596_10002652 | JGI25153J46596_100026525 | 161 |
| 737 | 3300003659 | JGI25404J52841_10001685 | JGI25404J52841_100016851 | 161 |
| 738 | 3300003911 | JGI25405J52794_10042128 | JGI25405J52794_100421281 | 161 |
| 739 | 3300005295 | Ga0065707_10323728 | Ga0065707_103237282 | 161 |
| 740 | 3300005327 | Ga0070658_10250102 | Ga0070658_102501022 | 161 |
| 741 | 3300005328 | Ga0070676_10488034 | Ga0070676_104880341 | 161 |
| 742 | 3300005329 | Ga0070683_100229107 | Ga0070683_1002291072 | 161 |
| 743 | 3300005329 | Ga0070683_100879377 | Ga0070683_1008793772 | 161 |
| 744 | 3300005329 | Ga0070683_101800119 | Ga0070683_1018001191 | 161 |
| 745 | 3300005331 | Ga0070670_100197497 | Ga0070670_1001974971 | 161 |
| 746 | 3300005334 | Ga0068869_100027419 | Ga0068869_1000274193 | 161 |
| 747 | 3300005334 | Ga0068869_100575987 | Ga0068869_1005759872 | 161 |
| 748 | 3300005335 | Ga0070666_10046350 | Ga0070666_100463503 | 161 |
| 749 | 3300005336 | Ga0070680_100025590 | Ga0070680_1000255902 | 161 |
| 750 | 3300005337 | Ga0070682_100310424 | Ga0070682_1003104241 | 161 |
| 751 | 3300005337 | Ga0070682_101518708 | Ga0070682_1015187081 | 161 |
| 752 | 3300005338 | Ga0068868_100026005 | Ga0068868_1000260053 | 161 |
| 753 | 3300005338 | Ga0068868_100295349 | Ga0068868_1002953492 | 161 |
| 754 | 3300005339 | Ga0070660_100007638 | Ga0070660_1000076386 | 161 |
| 755 | 3300005339 | Ga0070660_100321361 | Ga0070660_1003213612 | 161 |
| 756 | 3300005339 | Ga0070660_100451376 | Ga0070660_1004513762 | 161 |
| 757 | 3300005340 | Ga0070689_100089135 | Ga0070689_1000891352 | 161 |
| 758 | 3300005341 | Ga0070691_10050182 | Ga0070691_100501821 | 161 |
| 759 | 3300005344 | Ga0070661_100094549 | Ga0070661_1000945492 | 161 |
| 760 | 3300005347 | Ga0070668_100028776 | Ga0070668_1000287764 | 161 |
| 761 | 3300005347 | Ga0070668_100481582 | Ga0070668_1004815822 | 161 |
| 762 | 3300005353 | Ga0070669_100414435 | Ga0070669_1004144351 | 161 |
| 763 | 3300005365 | Ga0070688_100377884 | Ga0070688_1003778841 | 161 |
| 764 | 3300005365 | Ga0070688_100519886 | Ga0070688_1005198862 | 161 |
| 765 | 3300005367 | Ga0070667_100035551 | Ga0070667_1000355513 | 161 |
| 766 | 3300005367 | Ga0070667_100530762 | Ga0070667_1005307621 | 161 |
| 767 | 3300005406 | Ga0070703_10065908 | Ga0070703_100659082 | 161 |
| 768 | 3300005434 | Ga0070709_10512808 | Ga0070709_105128081 | 161 |
| 769 | 3300005435 | Ga0070714_100064213 | Ga0070714_1000642133 | 161 |
| 770 | 3300005435 | Ga0070714_100286854 | Ga0070714_1002868542 | 161 |
| 771 | 3300005435 | Ga0070714_100336897 | Ga0070714_1003368971 | 161 |
| 772 | 3300005436 | Ga0070713_100012854 | Ga0070713_1000128544 | 161 |
| 773 | 3300005438 | Ga0070701_10211593 | Ga0070701_102115932 | 161 |
| 774 | 3300005439 | Ga0070711_100011060 | Ga0070711_1000110601 | 161 |
| 775 | 3300005439 | Ga0070711_100492219 | Ga0070711_1004922192 | 161 |
| 776 | 3300005445 | Ga0070708_100999514 | Ga0070708_1009995141 | 161 |
| 777 | 3300005455 | Ga0070663_100096273 | Ga0070663_1000962732 | 161 |
| 778 | 3300005455 | Ga0070663_100169739 | Ga0070663_1001697391 | 161 |
| 779 | 3300005456 | Ga0070678_100021041 | Ga0070678_1000210414 | 161 |
| 780 | 3300005457 | Ga0070662_100035970 | Ga0070662_1000359702 | 161 |
| 781 | 3300005459 | Ga0068867_100049036 | Ga0068867_1000490361 | 161 |
| 782 | 3300005459 | Ga0068867_100616004 | Ga0068867_1006160041 | 161 |
| 783 | 3300005530 | Ga0070679_100010119 | Ga0070679_1000101194 | 161 |
| 784 | 3300005530 | Ga0070679_100472346 | Ga0070679_1004723461 | 161 |
| 785 | 3300005535 | Ga0070684_100007774 | Ga0070684_1000077743 | 161 |
| 786 | 3300005535 | Ga0070684_100217994 | Ga0070684_1002179941 | 161 |
| 787 | 3300005536 | Ga0070697_100341878 | Ga0070697_1003418782 | 161 |
| 788 | 3300005539 | Ga0068853_101272831 | Ga0068853_1012728311 | 161 |
| 789 | 3300005543 | Ga0070672_100249900 | Ga0070672_1002499002 | 161 |
| 790 | 3300005545 | Ga0070695_100049535 | Ga0070695_1000495351 | 161 |
| 791 | 3300005546 | Ga0070696_100314910 | Ga0070696_1003149101 | 161 |
| 792 | 3300005548 | Ga0070665_100367872 | Ga0070665_1003678722 | 161 |
| 793 | 3300005548 | Ga0070665_100546511 | Ga0070665_1005465112 | 161 |
| 794 | 3300005548 | Ga0070665_100707365 | Ga0070665_1007073652 | 161 |
| 795 | 3300005548 | Ga0070665_101491396 | Ga0070665_1014913961 | 161 |
| 796 | 3300005548 | Ga0070665_101636392 | Ga0070665_1016363921 | 161 |
| 797 | 3300005549 | Ga0070704_100271835 | Ga0070704_1002718351 | 161 |
| 798 | 3300005563 | Ga0068855_100130222 | Ga0068855_1001302222 | 161 |
| 799 | 3300005563 | Ga0068855_100243740 | Ga0068855_1002437403 | 161 |
| 800 | 3300005563 | Ga0068855_101249750 | Ga0068855_1012497502 | 161 |
| 801 | 3300005563 | Ga0068855_101455680 | Ga0068855_1014556801 | 161 |
| 802 | 3300005578 | Ga0068854_100272890 | Ga0068854_1002728901 | 161 |
| 803 | 3300005614 | Ga0068856_100049006 | Ga0068856_1000490062 | 161 |
| 804 | 3300005614 | Ga0068856_100150564 | Ga0068856_1001505643 | 161 |
| 805 | 3300005614 | Ga0068856_101640490 | Ga0068856_1016404901 | 161 |
| 806 | 3300005615 | Ga0070702_100026334 | Ga0070702_1000263341 | 161 |
| 807 | 3300005616 | Ga0068852_100144875 | Ga0068852_1001448752 | 161 |
| 808 | 3300005616 | Ga0068852_100571491 | Ga0068852_1005714912 | 161 |
| 809 | 3300005616 | Ga0068852_100590158 | Ga0068852_1005901582 | 161 |
| 810 | 3300005617 | Ga0068859_100142154 | Ga0068859_1001421541 | 161 |
| 811 | 3300005618 | Ga0068864_100065929 | Ga0068864_1000659292 | 161 |
| 812 | 3300005719 | Ga0068861_100068901 | Ga0068861_1000689013 | 161 |
| 813 | 3300005719 | Ga0068861_100236282 | Ga0068861_1002362822 | 161 |
| 814 | 3300005719 | Ga0068861_100952270 | Ga0068861_1009522701 | 161 |
| 815 | 3300005719 | Ga0068861_100988474 | Ga0068861_1009884742 | 161 |
| 816 | 3300005840 | Ga0068870_10082280 | Ga0068870_100822802 | 161 |
| 817 | 3300005841 | Ga0068863_100104494 | Ga0068863_1001044943 | 161 |
| 818 | 3300005841 | Ga0068863_100334870 | Ga0068863_1003348702 | 161 |
| 819 | 3300005841 | Ga0068863_100437314 | Ga0068863_1004373141 | 161 |
| 820 | 3300005842 | Ga0068858_100052617 | Ga0068858_1000526173 | 161 |
| 821 | 3300005842 | Ga0068858_100104845 | Ga0068858_1001048452 | 161 |
| 822 | 3300005842 | Ga0068858_100219263 | Ga0068858_1002192631 | 161 |
| 823 | 3300005842 | Ga0068858_100222596 | Ga0068858_1002225962 | 161 |
| 824 | 3300005842 | Ga0068858_100226013 | Ga0068858_1002260132 | 161 |
| 825 | 3300005843 | Ga0068860_100000543 | Ga0068860_10000054341 | 161 |
| 826 | 3300005843 | Ga0068860_100148500 | Ga0068860_1001485004 | 161 |
| 827 | 3300005844 | Ga0068862_101215715 | Ga0068862_1012157151 | 161 |
| 828 | 3300005937 | Ga0081455_10005036 | Ga0081455_100050365 | 161 |
| 829 | 3300005981 | Ga0081538_10094308 | Ga0081538_100943082 | 161 |
| 830 | 3300005983 | Ga0081540_1003764 | Ga0081540_10037646 | 161 |
| 831 | 3300005983 | Ga0081540_1005838 | Ga0081540_10058384 | 161 |
| 832 | 3300005983 | Ga0081540_1005865 | Ga0081540_10058657 | 161 |
| 833 | 3300005983 | Ga0081540_1009326 | Ga0081540_10093264 | 161 |
| 834 | 3300005983 | Ga0081540_1035231 | Ga0081540_10352313 | 161 |
| 835 | 3300005985 | Ga0081539_10085162 | Ga0081539_100851623 | 161 |
| 836 | 3300006028 | Ga0070717_10028586 | Ga0070717_100285863 | 161 |
| 837 | 3300006028 | Ga0070717_10051868 | Ga0070717_100518682 | 161 |
| 838 | 3300006028 | Ga0070717_10202597 | Ga0070717_102025973 | 161 |
| 839 | 3300006028 | Ga0070717_11111106 | Ga0070717_111111061 | 161 |
| 840 | 3300006038 | Ga0075365_10028198 | Ga0075365_100281983 | 161 |
| 841 | 3300006038 | Ga0075365_10085140 | Ga0075365_100851403 | 161 |
| 842 | 3300006038 | Ga0075365_10189421 | Ga0075365_101894211 | 161 |
| 843 | 3300006042 | Ga0075368_10096087 | Ga0075368_100960872 | 161 |
| 844 | 3300006048 | Ga0075363_100214812 | Ga0075363_1002148121 | 161 |
| 845 | 3300006048 | Ga0075363_100445348 | Ga0075363_1004453482 | 161 |
| 846 | 3300006048 | Ga0075363_100473861 | Ga0075363_1004738611 | 161 |
| 847 | 3300006173 | Ga0070716_100506455 | Ga0070716_1005064551 | 161 |
| 848 | 3300006177 | Ga0075362_10116343 | Ga0075362_101163432 | 161 |
| 849 | 3300006178 | Ga0075367_10004639 | Ga0075367_100046394 | 161 |
| 850 | 3300006178 | Ga0075367_10352144 | Ga0075367_103521441 | 161 |
| 851 | 3300006195 | Ga0075366_10147749 | Ga0075366_101477492 | 161 |
| 852 | 3300006195 | Ga0075366_10227491 | Ga0075366_102274911 | 161 |
| 853 | 3300006195 | Ga0075366_10383386 | Ga0075366_103833861 | 161 |
| 854 | 3300006237 | Ga0097621_100515645 | Ga0097621_1005156452 | 161 |
| 855 | 3300006353 | Ga0075370_10018061 | Ga0075370_100180613 | 161 |
| 856 | 3300006358 | Ga0068871_100245345 | Ga0068871_1002453452 | 161 |
| 857 | 3300006358 | Ga0068871_100662671 | Ga0068871_1006626711 | 161 |
| 858 | 3300006844 | Ga0075428_100709422 | Ga0075428_1007094222 | 161 |
| 859 | 3300006871 | Ga0075434_100297723 | Ga0075434_1002977232 | 161 |
| 860 | 3300006881 | Ga0068865_100093045 | Ga0068865_1000930454 | 161 |
| 861 | 3300006914 | Ga0075436_100297621 | Ga0075436_1002976211 | 161 |
| 862 | 3300006914 | Ga0075436_100496251 | Ga0075436_1004962511 | 161 |
| 863 | 3300006931 | Ga0097620_100142152 | Ga0097620_1001421521 | 161 |
| 864 | 3300007076 | Ga0075435_100363348 | Ga0075435_1003633482 | 161 |
| 865 | 3300007076 | Ga0075435_100827196 | Ga0075435_1008271961 | 161 |
| 866 | 3300009011 | Ga0105251_10137145 | Ga0105251_101371451 | 161 |
| 867 | 3300009011 | Ga0105251_10329894 | Ga0105251_103298941 | 161 |
| 868 | 3300009092 | Ga0105250_10052188 | Ga0105250_100521881 | 161 |
| 869 | 3300009093 | Ga0105240_10022030 | Ga0105240_100220304 | 161 |
| 870 | 3300009093 | Ga0105240_10055436 | Ga0105240_100554364 | 161 |
| 871 | 3300009098 | Ga0105245_10082903 | Ga0105245_100829033 | 161 |
| 872 | 3300009101 | Ga0105247_10053876 | Ga0105247_100538763 | 161 |
| 873 | 3300009101 | Ga0105247_11283193 | Ga0105247_112831931 | 161 |
| 874 | 3300009147 | Ga0114129_11068240 | Ga0114129_110682402 | 161 |
| 875 | 3300009148 | Ga0105243_10321370 | Ga0105243_103213702 | 161 |
| 876 | 3300009176 | Ga0105242_10052705 | Ga0105242_100527053 | 161 |
| 877 | 3300009177 | Ga0105248_10076907 | Ga0105248_100769073 | 161 |
| 878 | 3300009545 | Ga0105237_10085961 | Ga0105237_100859613 | 161 |
| 879 | 3300009545 | Ga0105237_10148901 | Ga0105237_101489013 | 161 |
| 880 | 3300009545 | Ga0105237_10198097 | Ga0105237_101980972 | 161 |
| 881 | 3300009545 | Ga0105237_11563517 | Ga0105237_115635171 | 161 |
| 882 | 3300009551 | Ga0105238_10001743 | Ga0105238_1000174314 | 161 |
| 883 | 3300009551 | Ga0105238_10004073 | Ga0105238_1000407313 | 161 |
| 884 | 3300009553 | Ga0105249_10021525 | Ga0105249_100215252 | 161 |
| 885 | 3300010375 | Ga0105239_10014303 | Ga0105239_100143035 | 161 |
| 886 | 3300010375 | Ga0105239_10314536 | Ga0105239_103145362 | 161 |
| 887 | 3300010375 | Ga0105239_10549330 | Ga0105239_105493302 | 161 |
| 888 | 3300011119 | Ga0105246_10030767 | Ga0105246_100307673 | 161 |
| 889 | 3300011119 | Ga0105246_10064349 | Ga0105246_100643492 | 161 |
| 890 | 3300012477 | Ga0157336_1004394 | Ga0157336_10043941 | 161 |
| 891 | 3300012492 | Ga0157335_1008624 | Ga0157335_10086242 | 161 |
| 892 | 3300012506 | Ga0157324_1008745 | Ga0157324_10087452 | 161 |
| 893 | 3300013104 | Ga0157370_10012254 | Ga0157370_100122547 | 161 |
| 894 | 3300013104 | Ga0157370_10061921 | Ga0157370_100619214 | 161 |
| 895 | 3300013296 | Ga0157374_10113743 | Ga0157374_101137432 | 161 |
| 896 | 3300013296 | Ga0157374_10608527 | Ga0157374_106085271 | 161 |
| 897 | 3300013297 | Ga0157378_10002682 | Ga0157378_100026829 | 161 |
| 898 | 3300013297 | Ga0157378_10056434 | Ga0157378_100564343 | 161 |
| 899 | 3300013297 | Ga0157378_10451812 | Ga0157378_104518122 | 161 |
| 900 | 3300013306 | Ga0163162_10271475 | Ga0163162_102714752 | 161 |
| 901 | 3300013306 | Ga0163162_10396541 | Ga0163162_103965412 | 161 |
| 902 | 3300013306 | Ga0163162_10656178 | Ga0163162_106561782 | 161 |
| 903 | 3300013307 | Ga0157372_10557912 | Ga0157372_105579121 | 161 |
| 904 | 3300014325 | Ga0163163_10119609 | Ga0163163_101196093 | 161 |
| 905 | 3300014326 | Ga0157380_10793653 | Ga0157380_107936531 | 161 |
| 906 | 3300014326 | Ga0157380_11589697 | Ga0157380_115896971 | 161 |
| 907 | 3300014969 | Ga0157376_10291071 | Ga0157376_102910712 | 161 |
| 908 | 3300017792 | Ga0163161_10054336 | Ga0163161_100543362 | 161 |
| 909 | 3300017792 | Ga0163161_10346375 | Ga0163161_103463752 | 161 |
| 910 | 3300019166 | Ga0184595_129802 | Ga0184595_1298021 | 161 |
| 911 | 3300019183 | Ga0184601_116584 | Ga0184601_1165841 | 161 |
| 912 | 3300019183 | Ga0184601_135068 | Ga0184601_1350681 | 161 |
| 913 | 3300019188 | Ga0184599_119650 | Ga0184599_1196501 | 161 |
| 914 | 3300019190 | Ga0184600_141600 | Ga0184600_1416001 | 161 |
| 915 | 3300020070 | Ga0206356_10346957 | Ga0206356_103469571 | 161 |
| 916 | 3300023539 | Ga0247555_102493 | Ga0247555_1024931 | 161 |
| 917 | 3300023664 | Ga0247527_111926 | Ga0247527_1119261 | 161 |
| 918 | 3300025261 | Ga0209233_1012117 | Ga0209233_10121172 | 161 |
| 919 | 3300025271 | Ga0207666_1028629 | Ga0207666_10286291 | 161 |
| 920 | 3300025272 | Ga0209455_1013267 | Ga0209455_10132672 | 161 |
| 921 | 3300025297 | Ga0209758_1009586 | Ga0209758_10095865 | 161 |
| 922 | 3300025297 | Ga0209758_1018978 | Ga0209758_10189783 | 161 |
| 923 | 3300025321 | Ga0207656_10520900 | Ga0207656_105209001 | 161 |
| 924 | 3300025885 | Ga0207653_10037282 | Ga0207653_100372822 | 161 |
| 925 | 3300025898 | Ga0207692_10058429 | Ga0207692_100584291 | 161 |
| 926 | 3300025898 | Ga0207692_10531136 | Ga0207692_105311361 | 161 |
| 927 | 3300025899 | Ga0207642_10096607 | Ga0207642_100966072 | 161 |
| 928 | 3300025900 | Ga0207710_10015469 | Ga0207710_100154692 | 161 |
| 929 | 3300025901 | Ga0207688_10021039 | Ga0207688_100210393 | 161 |
| 930 | 3300025903 | Ga0207680_10553326 | Ga0207680_105533262 | 161 |
| 931 | 3300025904 | Ga0207647_10067001 | Ga0207647_100670012 | 161 |
| 932 | 3300025907 | Ga0207645_10104548 | Ga0207645_101045481 | 161 |
| 933 | 3300025908 | Ga0207643_10099208 | Ga0207643_100992082 | 161 |
| 934 | 3300025909 | Ga0207705_10431236 | Ga0207705_104312362 | 161 |
| 935 | 3300025910 | Ga0207684_10295307 | Ga0207684_102953072 | 161 |
| 936 | 3300025911 | Ga0207654_10077665 | Ga0207654_100776653 | 161 |
| 937 | 3300025912 | Ga0207707_10001016 | Ga0207707_1000101628 | 161 |
| 938 | 3300025912 | Ga0207707_10585625 | Ga0207707_105856251 | 161 |
| 939 | 3300025912 | Ga0207707_10921723 | Ga0207707_109217232 | 161 |
| 940 | 3300025914 | Ga0207671_10116065 | Ga0207671_101160652 | 161 |
| 941 | 3300025914 | Ga0207671_10248006 | Ga0207671_102480062 | 161 |
| 942 | 3300025914 | Ga0207671_10510307 | Ga0207671_105103071 | 161 |
| 943 | 3300025914 | Ga0207671_11062931 | Ga0207671_110629311 | 161 |
| 944 | 3300025916 | Ga0207663_10074325 | Ga0207663_100743252 | 161 |
| 945 | 3300025917 | Ga0207660_10000887 | Ga0207660_1000088716 | 161 |
| 946 | 3300025917 | Ga0207660_10020990 | Ga0207660_100209904 | 161 |
| 947 | 3300025918 | Ga0207662_10082475 | Ga0207662_100824752 | 161 |
| 948 | 3300025919 | Ga0207657_10001391 | Ga0207657_100013919 | 161 |
| 949 | 3300025919 | Ga0207657_10135259 | Ga0207657_101352592 | 161 |
| 950 | 3300025920 | Ga0207649_10093891 | Ga0207649_100938912 | 161 |
| 951 | 3300025921 | Ga0207652_10053035 | Ga0207652_100530353 | 161 |
| 952 | 3300025925 | Ga0207650_10325003 | Ga0207650_103250032 | 161 |
| 953 | 3300025927 | Ga0207687_10255587 | Ga0207687_102555872 | 161 |
| 954 | 3300025928 | Ga0207700_10026090 | Ga0207700_100260903 | 161 |
| 955 | 3300025929 | Ga0207664_10386272 | Ga0207664_103862721 | 161 |
| 956 | 3300025929 | Ga0207664_10548649 | Ga0207664_105486492 | 161 |
| 957 | 3300025929 | Ga0207664_10855239 | Ga0207664_108552391 | 161 |
| 958 | 3300025932 | Ga0207690_10131980 | Ga0207690_101319802 | 161 |
| 959 | 3300025934 | Ga0207686_10049076 | Ga0207686_100490763 | 161 |
| 960 | 3300025934 | Ga0207686_10187654 | Ga0207686_101876542 | 161 |
| 961 | 3300025936 | Ga0207670_10891513 | Ga0207670_108915131 | 161 |
| 962 | 3300025937 | Ga0207669_10051215 | Ga0207669_100512154 | 161 |
| 963 | 3300025938 | Ga0207704_10103541 | Ga0207704_101035411 | 161 |
| 964 | 3300025939 | Ga0207665_10071628 | Ga0207665_100716281 | 161 |
| 965 | 3300025940 | Ga0207691_10048268 | Ga0207691_100482682 | 161 |
| 966 | 3300025944 | Ga0207661_10349837 | Ga0207661_103498372 | 161 |
| 967 | 3300025949 | Ga0207667_10086340 | Ga0207667_100863403 | 161 |
| 968 | 3300025949 | Ga0207667_10114401 | Ga0207667_101144012 | 161 |
| 969 | 3300025949 | Ga0207667_10875507 | Ga0207667_108755071 | 161 |
| 970 | 3300025949 | Ga0207667_11218994 | Ga0207667_112189941 | 161 |
| 971 | 3300025961 | Ga0207712_10238503 | Ga0207712_102385032 | 161 |
| 972 | 3300025961 | Ga0207712_11695026 | Ga0207712_116950261 | 161 |
| 973 | 3300025972 | Ga0207668_10021619 | Ga0207668_100216193 | 161 |
| 974 | 3300025972 | Ga0207668_10736949 | Ga0207668_107369491 | 161 |
| 975 | 3300025972 | Ga0207668_10853781 | Ga0207668_108537811 | 161 |
| 976 | 3300025981 | Ga0207640_10157239 | Ga0207640_101572392 | 161 |
| 977 | 3300025986 | Ga0207658_11239127 | Ga0207658_112391272 | 161 |
| 978 | 3300026023 | Ga0207677_10042292 | Ga0207677_100422923 | 161 |
| 979 | 3300026035 | Ga0207703_10072541 | Ga0207703_100725412 | 161 |
| 980 | 3300026035 | Ga0207703_10586882 | Ga0207703_105868821 | 161 |
| 981 | 3300026035 | Ga0207703_10762167 | Ga0207703_107621671 | 161 |
| 982 | 3300026035 | Ga0207703_11128065 | Ga0207703_111280652 | 161 |
| 983 | 3300026041 | Ga0207639_10056384 | Ga0207639_100563843 | 161 |
| 984 | 3300026041 | Ga0207639_10107023 | Ga0207639_101070233 | 161 |
| 985 | 3300026067 | Ga0207678_10397020 | Ga0207678_103970202 | 161 |
| 986 | 3300026075 | Ga0207708_10055363 | Ga0207708_100553632 | 161 |
| 987 | 3300026088 | Ga0207641_11759583 | Ga0207641_117595831 | 161 |
| 988 | 3300026089 | Ga0207648_10014624 | Ga0207648_100146244 | 161 |
| 989 | 3300026095 | Ga0207676_10006429 | Ga0207676_100064293 | 161 |
| 990 | 3300026095 | Ga0207676_10571703 | Ga0207676_105717032 | 161 |
| 991 | 3300026116 | Ga0207674_10588818 | Ga0207674_105888181 | 161 |
| 992 | 3300026142 | Ga0207698_12042653 | Ga0207698_120426531 | 161 |
| 993 | 3300027866 | Ga0209813_10076709 | Ga0209813_100767091 | 161 |
| 994 | 3300027907 | Ga0207428_10618016 | Ga0207428_106180161 | 161 |
| 995 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113637 | 161 |
| 996 | 3300028379 | Ga0268266_10067714 | Ga0268266_100677142 | 161 |
| 997 | 3300028379 | Ga0268266_10109126 | Ga0268266_101091264 | 161 |
| 998 | 3300028379 | Ga0268266_10192392 | Ga0268266_101923923 | 161 |
| 999 | 3300028379 | Ga0268266_10330486 | Ga0268266_103304862 | 161 |
| 1000 | 3300028380 | Ga0268265_10076118 | Ga0268265_100761183 | 161 |
| 1001 | 3300028381 | Ga0268264_10000185 | Ga0268264_10000185104 | 161 |
| 1002 | 3300028381 | Ga0268264_12074603 | Ga0268264_120746031 | 161 |
| 1003 | 3300028573 | Ga0265334_10005906 | Ga0265334_100059064 | 161 |
| 1004 | 3300028800 | Ga0265338_11010540 | Ga0265338_110105401 | 161 |
| 1005 | 3300030521 | Ga0307511_10033050 | Ga0307511_100330504 | 161 |
| 1006 | 3300030521 | Ga0307511_10114077 | Ga0307511_101140772 | 161 |
| 1007 | 3300030522 | Ga0307512_10311289 | Ga0307512_103112891 | 161 |
| 1008 | 3300030878 | Ga0265770_1056325 | Ga0265770_10563251 | 161 |
| 1009 | 3300031090 | Ga0265760_10135028 | Ga0265760_101350281 | 161 |
| 1010 | 3300031242 | Ga0265329_10088338 | Ga0265329_100883381 | 161 |
| 1011 | 3300031249 | Ga0265339_10041054 | Ga0265339_100410543 | 161 |
| 1012 | 3300031250 | Ga0265331_10030929 | Ga0265331_100309292 | 161 |
| 1013 | 3300031456 | Ga0307513_10258126 | Ga0307513_102581262 | 161 |
| 1014 | 3300031456 | Ga0307513_10269695 | Ga0307513_102696952 | 161 |
| 1015 | 3300031507 | Ga0307509_10192424 | Ga0307509_101924241 | 161 |
| 1016 | 3300031507 | Ga0307509_10201925 | Ga0307509_102019253 | 161 |
| 1017 | 3300031507 | Ga0307509_10279568 | Ga0307509_102795681 | 161 |
| 1018 | 3300031507 | Ga0307509_10314853 | Ga0307509_103148531 | 161 |
| 1019 | 3300031548 | Ga0307408_101629302 | Ga0307408_1016293021 | 161 |
| 1020 | 3300031616 | Ga0307508_10054901 | Ga0307508_100549013 | 161 |
| 1021 | 3300031711 | Ga0265314_10034496 | Ga0265314_100344963 | 161 |
| 1022 | 3300031712 | Ga0265342_10003016 | Ga0265342_1000301613 | 161 |
| 1023 | 3300031730 | Ga0307516_10248542 | Ga0307516_102485422 | 161 |
| 1024 | 3300031731 | Ga0307405_11404721 | Ga0307405_114047211 | 161 |
| 1025 | 3300031810 | Ga0316044_116803 | Ga0316044_1168031 | 161 |
| 1026 | 3300031815 | Ga0316045_119733 | Ga0316045_1197331 | 161 |
| 1027 | 3300031824 | Ga0307413_10067220 | Ga0307413_100672203 | 161 |
| 1028 | 3300031852 | Ga0307410_10883114 | Ga0307410_108831142 | 161 |
| 1029 | 3300031903 | Ga0307407_10089969 | Ga0307407_100899692 | 161 |
| 1030 | 3300031911 | Ga0307412_10041561 | Ga0307412_100415611 | 161 |
| 1031 | 3300032002 | Ga0307416_100347484 | Ga0307416_1003474842 | 161 |
| 1032 | 3300032002 | Ga0307416_100808858 | Ga0307416_1008088581 | 161 |
| 1033 | 3300032004 | Ga0307414_10634989 | Ga0307414_106349891 | 161 |
| 1034 | 3300032005 | Ga0307411_10146037 | Ga0307411_101460372 | 161 |
| 1035 | 3300032005 | Ga0307411_10608888 | Ga0307411_106088881 | 161 |
| 1036 | 3300032120 | Ga0316053_111976 | Ga0316053_1119761 | 161 |
| 1037 | 3300032126 | Ga0307415_100048349 | Ga0307415_1000483491 | 161 |
| 1038 | 3300032126 | Ga0307415_100585758 | Ga0307415_1005857581 | 161 |
| 1039 | 3300033179 | Ga0307507_10014035 | Ga0307507_100140355 | 161 |
| 1040 | 3300033179 | Ga0307507_10362116 | Ga0307507_103621161 | 161 |
| 1041 | 3300033544 | Ga0316215_1001011 | Ga0316215_10010113 | 161 |
| 1042 | 3300034820 | Ga0373959_0098391 | Ga0373959_0098391_49_540 | 161 |
| 1043 | 3300035083 | Ga0373926_0068981 | Ga0373926_0068981_492_983 | 161 |
| 1044 | 3300035083 | Ga0373926_0198761 | Ga0373926_0198761_39_530 | 161 |
| 1045 | 3300035086 | Ga0373934_0009072 | Ga0373934_0009072_2562_3050 | 161 |
| 1046 | 3300035111 | Ga0373923_0011449 | Ga0373923_0011449_51_539 | 161 |
| 1047 | 3300035111 | Ga0373923_0092372 | Ga0373923_0092372_85_576 | 161 |
| 1048 | 3300035113 | Ga0373936_0000642 | Ga0373936_0000642_4504_4995 | 161 |
| 1049 | 3300035113 | Ga0373936_0361681 | Ga0373936_0361681_23_514 | 161 |
| 1050 | 3300035116 | Ga0373945_0197663 | Ga0373945_0197663_223_714 | 161 |
| 1051 | 3300035117 | Ga0373953_0000731 | Ga0373953_0000731_5373_5861 | 161 |
| 1052 | 3300035117 | Ga0373953_0040403 | Ga0373953_0040403_761_1252 | 161 |
| 1053 | 3300035118 | Ga0373954_0000496 | Ga0373954_0000496_10715_11206 | 161 |
| 1054 | 3300035118 | Ga0373954_0001719 | Ga0373954_0001719_5532_6020 | 161 |
| 1055 | 3300035119 | Ga0373956_0002420 | Ga0373956_0002420_3176_3664 | 161 |
| 1056 | 3300035119 | Ga0373956_0259385 | Ga0373956_0259385_321_812 | 161 |
| 1057 | 3300035120 | Ga0373957_0000218 | Ga0373957_0000218_7764_8252 | 161 |
| 1058 | 3300035120 | Ga0373957_0003907 | Ga0373957_0003907_3609_4100 | 161 |
| 1059 | 3300035170 | Ga0373943_0009912 | Ga0373943_0009912_1382_1873 | 161 |
| 1060 | 3300035171 | Ga0373946_0002589 | Ga0373946_0002589_5401_5892 | 161 |
| 1061 | 3300035172 | Ga0373955_0003024 | Ga0373955_0003024_3477_3965 | 161 |
| 1062 | 3300035172 | Ga0373955_0006844 | Ga0373955_0006844_360_851 | 161 |
| 1063 | 3300035410 | Ga0373924_0001915 | Ga0373924_0001915_2873_3364 | 161 |
| 1064 | 3300035410 | Ga0373924_0005387 | Ga0373924_0005387_443_931 | 161 |
| 1065 | 3300035692 | Ga0373935_0001176 | Ga0373935_0001176_5683_6174 | 161 |
| 1066 | 3300035692 | Ga0373935_0006965 | Ga0373935_0006965_1490_1978 | 161 |
| 1067 | 3300035695 | Ga0373927_0015261 | Ga0373927_0015261_4229_4720 | 161 |
| 1068 | 3300035695 | Ga0373927_0021714 | Ga0373927_0021714_372_860 | 161 |
| 1069 | 3300035695 | Ga0373927_0369592 | Ga0373927_0369592_368_859 | 161 |
| 1070 | 3300035724 | Ga0373933_0000026 | Ga0373933_0000026_79588_80076 | 161 |
| 1071 | 3300035724 | Ga0373933_0001354 | Ga0373933_0001354_34_525 | 161 |
| 1072 | 3300035724 | Ga0373933_0011360 | Ga0373933_0011360_3266_3754 | 161 |
| 1073 | 3300035725 | Ga0373947_0157312 | Ga0373947_0157312_848_1339 | 161 |
| 1074 | 3300035725 | Ga0373947_0227647 | Ga0373947_0227647_349_840 | 161 |
| 1075 | 3300036242 | Ga0310104_11267 | Ga0310104_11267_122_610 | 161 |
| 1076 | 3300036242 | Ga0310104_14568 | Ga0310104_14568_110_598 | 161 |
| 1077 | 3300036401 | Ga0373937_0000356 | Ga0373937_0000356_30683_31174 | 161 |
| 1078 | 3300036401 | Ga0373937_0023752 | Ga0373937_0023752_4004_4492 | 161 |
| 1079 | 3300036458 | Ga0310112_043340 | Ga0310112_043340_111_599 | 161 |
| 1080 | 3300037068 | Ga0373925_0000462 | Ga0373925_0000462_31602_32093 | 161 |
| 1081 | 3300037068 | Ga0373925_1104536 | Ga0373925_1104536_137_628 | 161 |
| 1082 | 3300037418 | Ga0395900_0453880 | Ga0395900_0453880_127_615 | 161 |
| 1083 | 3300037466 | Ga0395898_0113253 | Ga0395898_0113253_1537_2025 | 161 |
| 1084 | 3300039437 | Ga0436365_0266253 | Ga0436365_0266253_512_1000 | 161 |
| 1085 | 3300039437 | Ga0436365_0593482 | Ga0436365_0593482_220_708 | 161 |
| 1086 | 3300039437 | Ga0436365_1532080 | Ga0436365_1532080_395_886 | 161 |
| 1087 | 3300041459 | Ga0451800_0254077 | Ga0451800_0254077_341_832 | 161 |
| 1088 | 3300041460 | Ga0451802_1086364 | Ga0451802_1086364_982_1473 | 161 |
| 1089 | 3300041486 | Ga0451807_1734372 | Ga0451807_1734372_26_514 | 161 |
| 1090 | 3300041494 | Ga0451837_1625367 | Ga0451837_1625367_525_1016 | 161 |
| 1091 | 3300041498 | Ga0451841_0591288 | Ga0451841_0591288_112_603 | 161 |
| 1092 | 3300041507 | Ga0451851_0715062 | Ga0451851_0715062_177_665 | 161 |
| 1093 | 3300041509 | Ga0451843_0159796 | Ga0451843_0159796_11_502 | 161 |
| 1094 | 3300042005 | Ga0439448_0204978 | Ga0439448_0204978_113_604 | 161 |
| 1095 | 3300042012 | Ga0439455_0134205 | Ga0439455_0134205_177_668 | 161 |
| 1096 | 3300045976 | Ga0466967_0040143 | Ga0466967_0040143_2400_2888 | 161 |
| 1097 | 3300046453 | Ga0495627_067260 | Ga0495627_067260_365_856 | 161 |
| 1098 | 3300046454 | Ga0495592_0000090 | Ga0495592_0000090_8825_9316 | 161 |
| 1099 | 3300046454 | Ga0495592_0001238 | Ga0495592_0001238_3884_4372 | 161 |
| 1100 | 3300046454 | Ga0495592_0464700 | Ga0495592_0464700_258_746 | 161 |
| 1101 | 3300046455 | Ga0495603_0025337 | Ga0495603_0025337_260_751 | 161 |
| 1102 | 3300046455 | Ga0495603_0381656 | Ga0495603_0381656_220_711 | 161 |
| 1103 | 3300046455 | Ga0495603_0619393 | Ga0495603_0619393_102_593 | 161 |
| 1104 | 3300046458 | Ga0495591_049105 | Ga0495591_049105_520_1011 | 161 |
| 1105 | 3300046459 | Ga0495629_0000750 | Ga0495629_0000750_23028_23516 | 161 |
| 1106 | 3300046459 | Ga0495629_0017208 | Ga0495629_0017208_4048_4539 | 161 |
| 1107 | 3300046460 | Ga0495638_0020879 | Ga0495638_0020879_1940_2431 | 161 |
| 1108 | 3300046462 | Ga0495651_0000682 | Ga0495651_0000682_8837_9328 | 161 |
| 1109 | 3300046462 | Ga0495651_0014625 | Ga0495651_0014625_4546_5034 | 161 |
| 1110 | 3300046463 | Ga0495653_0000322 | Ga0495653_0000322_29631_30122 | 161 |
| 1111 | 3300046463 | Ga0495653_0007956 | Ga0495653_0007956_4685_5173 | 161 |
| 1112 | 3300046471 | Ga0495650_0072313 | Ga0495650_0072313_738_1229 | 161 |
| 1113 | 3300046472 | Ga0495580_0424619 | Ga0495580_0424619_245_736 | 161 |
| 1114 | 3300046475 | Ga0495639_0061595 | Ga0495639_0061595_481_972 | 161 |
| 1115 | 3300046476 | Ga0495662_0059952 | Ga0495662_0059952_136_627 | 161 |
| 1116 | 3300046476 | Ga0495662_0087373 | Ga0495662_0087373_788_1279 | 161 |
| 1117 | 3300046476 | Ga0495662_0332578 | Ga0495662_0332578_51_539 | 161 |
| 1118 | 3300046477 | Ga0495664_0000078 | Ga0495664_0000078_35770_36261 | 161 |
| 1119 | 3300046477 | Ga0495664_0218356 | Ga0495664_0218356_458_946 | 161 |
| 1120 | 3300046491 | Ga0495584_0182774 | Ga0495584_0182774_37_528 | 161 |
| 1121 | 3300046492 | Ga0495585_0093083 | Ga0495585_0093083_207_698 | 161 |
| 1122 | 3300046499 | Ga0495594_0212459 | Ga0495594_0212459_433_924 | 161 |
| 1123 | 3300046511 | Ga0495608_0000022 | Ga0495608_0000022_153504_153995 | 161 |
| 1124 | 3300046511 | Ga0495608_0000738 | Ga0495608_0000738_12589_13077 | 161 |
| 1125 | 3300046512 | Ga0495610_0082229 | Ga0495610_0082229_416_907 | 161 |
| 1126 | 3300046513 | Ga0495616_0134315 | Ga0495616_0134315_20_511 | 161 |
| 1127 | 3300046514 | Ga0495618_0000229 | Ga0495618_0000229_31622_32113 | 161 |
| 1128 | 3300046515 | Ga0495620_0155379 | Ga0495620_0155379_188_679 | 161 |
| 1129 | 3300046515 | Ga0495620_0208563 | Ga0495620_0208563_22_513 | 161 |
| 1130 | 3300046516 | Ga0495628_0000035 | Ga0495628_0000035_101328_101819 | 161 |
| 1131 | 3300046516 | Ga0495628_0005837 | Ga0495628_0005837_6414_6902 | 161 |
| 1132 | 3300046517 | Ga0495630_0000377 | Ga0495630_0000377_422_913 | 161 |
| 1133 | 3300046519 | Ga0495632_0239056 | Ga0495632_0239056_140_631 | 161 |
| 1134 | 3300046523 | Ga0495644_0023135 | Ga0495644_0023135_186_677 | 161 |
| 1135 | 3300046523 | Ga0495644_0374016 | Ga0495644_0374016_10_501 | 161 |
| 1136 | 3300046524 | Ga0495648_0299264 | Ga0495648_0299264_203_694 | 161 |
| 1137 | 3300046529 | Ga0495652_0000062 | Ga0495652_0000062_101340_101831 | 161 |
| 1138 | 3300046529 | Ga0495652_0004125 | Ga0495652_0004125_10588_11076 | 161 |
| 1139 | 3300046533 | Ga0495640_0000021 | Ga0495640_0000021_11117_11608 | 161 |
| 1140 | 3300046533 | Ga0495640_0035969 | Ga0495640_0035969_2828_3316 | 161 |
| 1141 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_101340_101831 | 161 |
| 1142 | 3300046536 | Ga0495587_0006945 | Ga0495587_0006945_3950_4438 | 161 |
| 1143 | 3300046536 | Ga0495587_0333946 | Ga0495587_0333946_195_683 | 161 |
| 1144 | 3300046538 | Ga0495609_0019137 | Ga0495609_0019137_1690_2181 | 161 |
| 1145 | 3300046543 | Ga0495645_0000174 | Ga0495645_0000174_35493_35984 | 161 |
| 1146 | 3300046543 | Ga0495645_0046137 | Ga0495645_0046137_1655_2143 | 161 |
| 1147 | 3300046543 | Ga0495645_0053146 | Ga0495645_0053146_1234_1722 | 161 |
| 1148 | 3300046558 | Ga0495633_0085037 | Ga0495633_0085037_109_600 | 161 |
| 1149 | 3300046558 | Ga0495633_0373406 | Ga0495633_0373406_132_623 | 161 |
| 1150 | 3300046559 | Ga0495667_0000161 | Ga0495667_0000161_35549_36040 | 161 |
| 1151 | 3300046559 | Ga0495667_0014506 | Ga0495667_0014506_1358_1846 | 161 |
| 1152 | 3300046615 | Ga0495656_0014978 | Ga0495656_0014978_1233_1724 | 161 |
| 1153 | 3300046615 | Ga0495656_0098347 | Ga0495656_0098347_418_909 | 161 |
| 1154 | 3300046615 | Ga0495656_0115210 | Ga0495656_0115210_716_1207 | 161 |
| 1155 | 3300046616 | Ga0495668_0145889 | Ga0495668_0145889_473_964 | 161 |
| 1156 | 3300046642 | Ga0495634_0000350 | Ga0495634_0000350_8816_9307 | 161 |
| 1157 | 3300046642 | Ga0495634_0052709 | Ga0495634_0052709_24_512 | 161 |
| 1158 | 3300046663 | Ga0495635_0000018 | Ga0495635_0000018_184257_184748 | 161 |
| 1159 | 3300046663 | Ga0495635_0000166 | Ga0495635_0000166_9701_10189 | 161 |
| 1160 | 3300046665 | Ga0495661_0091627 | Ga0495661_0091627_163_654 | 161 |
| 1161 | 3300046674 | Ga0495588_0009190 | Ga0495588_0009190_2119_2610 | 161 |
| 1162 | 3300046674 | Ga0495588_0204504 | Ga0495588_0204504_47_538 | 161 |
| 1163 | 3300046675 | Ga0495657_0000245 | Ga0495657_0000245_40057_40548 | 161 |
| 1164 | 3300046675 | Ga0495657_0005822 | Ga0495657_0005822_5267_5755 | 161 |
| 1165 | 3300046678 | Ga0495599_0000032 | Ga0495599_0000032_98940_99431 | 161 |
| 1166 | 3300046678 | Ga0495599_0014529 | Ga0495599_0014529_2497_2985 | 161 |
| 1167 | 3300046678 | Ga0495599_0328783 | Ga0495599_0328783_348_836 | 161 |
| 1168 | 3300046679 | Ga0495623_0000004 | Ga0495623_0000004_25560_26051 | 161 |
| 1169 | 3300046679 | Ga0495623_0002267 | Ga0495623_0002267_2485_2973 | 161 |
| 1170 | 3300046680 | Ga0495646_0000083 | Ga0495646_0000083_9144_9635 | 161 |
| 1171 | 3300046680 | Ga0495646_0002103 | Ga0495646_0002103_9376_9864 | 161 |
| 1172 | 3300046683 | Ga0495658_0043206 | Ga0495658_0043206_1718_2209 | 161 |
| 1173 | 3300046689 | Ga0495613_0025336 | Ga0495613_0025336_11_499 | 161 |
| 1174 | 3300046689 | Ga0495613_0026055 | Ga0495613_0026055_262_753 | 161 |
| 1175 | 3300046690 | Ga0495624_0263353 | Ga0495624_0263353_56_547 | 161 |
| 1176 | 3300046691 | Ga0495670_0073621 | Ga0495670_0073621_56_547 | 161 |
| 1177 | 3300046692 | Ga0495671_0490135 | Ga0495671_0490135_31_522 | 161 |
| 1178 | 3300046794 | Ga0495589_0369885 | Ga0495589_0369885_122_613 | 161 |
| 1179 | 3300046794 | Ga0495589_0395888 | Ga0495589_0395888_13_504 | 161 |
| 1180 | 3300046809 | Ga0495600_0000022 | Ga0495600_0000022_83182_83673 | 161 |
| 1181 | 3300046809 | Ga0495600_0005583 | Ga0495600_0005583_3760_4248 | 161 |
| 1182 | 3300047317 | Ga0495604_0000011 | Ga0495604_0000011_8844_9335 | 161 |
| 1183 | 3300047317 | Ga0495604_0004924 | Ga0495604_0004924_2946_3434 | 161 |
| 1184 | 3300047319 | Ga0495674_0000034 | Ga0495674_0000034_101340_101831 | 161 |
| 1185 | 3300047319 | Ga0495674_0005019 | Ga0495674_0005019_9835_10323 | 161 |
| 1186 | 3300047319 | Ga0495674_0460149 | Ga0495674_0460149_380_868 | 161 |
| 1187 | 3300047320 | Ga0495672_0259049 | Ga0495672_0259049_301_792 | 161 |
| 1188 | 3300047321 | Ga0495676_0077799 | Ga0495676_0077799_1776_2267 | 161 |
| 1189 | 3300047322 | Ga0495680_0000290 | Ga0495680_0000290_8844_9335 | 161 |
| 1190 | 3300047322 | Ga0495680_0004903 | Ga0495680_0004903_3510_3998 | 161 |
| 1191 | 3300047323 | Ga0495683_0047102 | Ga0495683_0047102_1094_1585 | 161 |
| 1192 | 3300047444 | Ga0495675_0000352 | Ga0495675_0000352_20701_21192 | 161 |
| 1193 | 3300047444 | Ga0495675_0000770 | Ga0495675_0000770_1768_2256 | 161 |
| 1194 | 3300047447 | Ga0495685_081282 | Ga0495685_081282_163_654 | 161 |
| 1195 | 3300047469 | Ga0495673_0235178 | Ga0495673_0235178_20_511 | 161 |
| 1196 | 3300047471 | Ga0495684_0000012 | Ga0495684_0000012_175626_176117 | 161 |
| 1197 | 3300047471 | Ga0495684_0000501 | Ga0495684_0000501_23651_24139 | 161 |
| 1198 | 3300047472 | Ga0495686_0195326 | Ga0495686_0195326_83_574 | 161 |
| 1199 | 3300047673 | Ga0495593_0006360 | Ga0495593_0006360_2352_2840 | 161 |
| 1200 | 3300047673 | Ga0495593_0011797 | Ga0495593_0011797_3952_4443 | 161 |
| 1201 | 3300048088 | Ga0495602_0000064 | Ga0495602_0000064_8844_9335 | 161 |
| 1202 | 3300048088 | Ga0495602_0019776 | Ga0495602_0019776_4546_5034 | 161 |
| 1203 | 3300048088 | Ga0495602_0370624 | Ga0495602_0370624_416_904 | 161 |
| 1204 | 3300048903 | Ga0496100_0026252 | Ga0496100_0026252_460_951 | 161 |
| 1205 | 3300048903 | Ga0496100_0441582 | Ga0496100_0441582_42_533 | 161 |
| 1206 | 3300048903 | Ga0496100_0945233 | Ga0496100_0945233_131_622 | 161 |
| 1207 | 3300048904 | Ga0496101_0915158 | Ga0496101_0915158_45_536 | 161 |
| 1208 | 3300048904 | Ga0496101_1309443 | Ga0496101_1309443_66_554 | 161 |
| 1209 | 3300048905 | Ga0496102_0098200 | Ga0496102_0098200_1367_1858 | 161 |
| 1210 | 3300048905 | Ga0496102_0157479 | Ga0496102_0157479_55_546 | 161 |
| 1211 | 3300048905 | Ga0496102_0553494 | Ga0496102_0553494_23_514 | 161 |
| 1212 | 3300048905 | Ga0496102_1382650 | Ga0496102_1382650_70_558 | 161 |
| 1213 | 3300048906 | Ga0496103_0163899 | Ga0496103_0163899_807_1295 | 161 |
| 1214 | 3300048907 | Ga0496104_0137623 | Ga0496104_0137623_76_567 | 161 |
| 1215 | 3300048908 | Ga0496105_0243128 | Ga0496105_0243128_31_522 | 161 |
| 1216 | 3300048909 | Ga0496106_0002121 | Ga0496106_0002121_513_1001 | 161 |
| 1217 | 3300048909 | Ga0496106_0067637 | Ga0496106_0067637_1210_1701 | 161 |
| 1218 | 3300048909 | Ga0496106_0111063 | Ga0496106_0111063_1424_1915 | 161 |
| 1219 | 3300048909 | Ga0496106_0132597 | Ga0496106_0132597_300_791 | 161 |
| 1220 | 3300048909 | Ga0496106_0324648 | Ga0496106_0324648_648_1136 | 161 |
| 1221 | 3300048910 | Ga0496107_0120945 | Ga0496107_0120945_34_525 | 161 |
| 1222 | 3300048911 | Ga0496108_0115465 | Ga0496108_0115465_1260_1751 | 161 |
| 1223 | 3300048911 | Ga0496108_0308673 | Ga0496108_0308673_656_1147 | 161 |
| 1224 | 3300048912 | Ga0496109_0256482 | Ga0496109_0256482_612_1103 | 161 |
| 1225 | 3300048912 | Ga0496109_0787100 | Ga0496109_0787100_171_662 | 161 |
| 1226 | 3300048913 | Ga0496110_0051881 | Ga0496110_0051881_2336_2824 | 161 |
| 1227 | 3300048913 | Ga0496110_0663164 | Ga0496110_0663164_169_660 | 161 |
| 1228 | 3300048914 | Ga0496111_0092714 | Ga0496111_0092714_1025_1516 | 161 |
| 1229 | 3300048914 | Ga0496111_0138489 | Ga0496111_0138489_74_565 | 161 |
| 1230 | 3300048914 | Ga0496111_0180072 | Ga0496111_0180072_213_701 | 161 |
| 1231 | 3300048915 | Ga0496112_0020266 | Ga0496112_0020266_3959_4450 | 161 |
| 1232 | 3300048915 | Ga0496112_0040204 | Ga0496112_0040204_1139_1627 | 161 |
| 1233 | 3300048917 | Ga0496114_0193148 | Ga0496114_0193148_40_531 | 161 |
| 1234 | 3300048917 | Ga0496114_0334842 | Ga0496114_0334842_270_761 | 161 |
| 1235 | 3300048917 | Ga0496114_1248625 | Ga0496114_1248625_50_541 | 161 |
| 1236 | 3300048917 | Ga0496114_1424215 | Ga0496114_1424215_55_546 | 161 |
| 1237 | 3300048918 | Ga0496115_0114644 | Ga0496115_0114644_1328_1816 | 161 |
| 1238 | 3300048918 | Ga0496115_0139755 | Ga0496115_0139755_1281_1772 | 161 |
| 1239 | 3300048918 | Ga0496115_0819038 | Ga0496115_0819038_57_545 | 161 |
| 1240 | 3300048919 | Ga0496116_0322649 | Ga0496116_0322649_200_691 | 161 |
| 1241 | 3300048920 | Ga0496117_0013721 | Ga0496117_0013721_2123_2611 | 161 |
| 1242 | 3300048921 | Ga0496118_0002570 | Ga0496118_0002570_19427_19915 | 161 |
| 1243 | 3300048923 | Ga0496120_0164907 | Ga0496120_0164907_198_689 | 161 |
| 1244 | 3300048923 | Ga0496120_0181023 | Ga0496120_0181023_25_513 | 161 |
| 1245 | 3300048924 | Ga0496121_0001125 | Ga0496121_0001125_35303_35791 | 161 |
| 1246 | 3300048924 | Ga0496121_0073946 | Ga0496121_0073946_180_671 | 161 |
| 1247 | 3300048924 | Ga0496121_0083038 | Ga0496121_0083038_452_943 | 161 |
| 1248 | 3300048924 | Ga0496121_0453592 | Ga0496121_0453592_312_803 | 161 |
| 1249 | 3300048927 | Ga0496124_0022017 | Ga0496124_0022017_3734_4222 | 161 |
| 1250 | 3300048927 | Ga0496124_0293589 | Ga0496124_0293589_354_845 | 161 |
| 1251 | 3300048927 | Ga0496124_0700163 | Ga0496124_0700163_104_592 | 161 |
| 1252 | 3300048928 | Ga0496125_0561169 | Ga0496125_0561169_58_546 | 161 |
| 1253 | 3300048929 | Ga0496126_0011540 | Ga0496126_0011540_2152_2643 | 161 |
| 1254 | 3300048929 | Ga0496126_0051010 | Ga0496126_0051010_501_989 | 161 |
| 1255 | 3300049460 | Ga0495682_0222629 | Ga0495682_0222629_89_580 | 161 |
| 1256 | 3300049572 | Ga0501036_0628188 | Ga0501036_0628188_192_683 | 161 |
| 1257 | 3300049587 | Ga0501071_0658246 | Ga0501071_0658246_54_545 | 161 |
| 1258 | 3300049588 | Ga0501072_0700086 | Ga0501072_0700086_273_764 | 161 |
| 1259 | 3300049592 | Ga0501076_0848963 | Ga0501076_0848963_70_561 | 161 |
| 1260 | 3300049742 | Ga0501080_1308971 | Ga0501080_1308971_27_518 | 161 |
| 1261 | 3300049823 | Ga0501044_0817800 | Ga0501044_0817800_162_665 | 161 |
| 1262 | 3300049824 | Ga0501045_0605906 | Ga0501045_0605906_230_721 | 161 |
| 1263 | 3300050489 | nmdc:mga03683_170414_c1 | nmdc:mga03683_170414_c1_354_845 | 161 |
| 1264 | 3300050490 | nmdc:mga03n38_1311_c1 | nmdc:mga03n38_1311_c1_2892_3383 | 161 |
| 1265 | 3300050490 | nmdc:mga03n38_74157_c1 | nmdc:mga03n38_74157_c1_572_1063 | 161 |
| 1266 | 3300050491 | nmdc:mga00v17_336215_c1 | nmdc:mga00v17_336215_c1_417_908 | 161 |
| 1267 | 3300050491 | nmdc:mga00v17_741630_c1 | nmdc:mga00v17_741630_c1_26_517 | 161 |
| 1268 | 3300050491 | nmdc:mga00v17_90873_c1 | nmdc:mga00v17_90873_c1_27_518 | 161 |
| 1269 | 3300050492 | nmdc:mga0yw44_202540_c1 | nmdc:mga0yw44_202540_c1_645_1136 | 161 |
| 1270 | 3300050492 | nmdc:mga0yw44_48177_c1 | nmdc:mga0yw44_48177_c1_537_1028 | 161 |
| 1271 | 3300050493 | nmdc:mga0k408_126789_c1 | nmdc:mga0k408_126789_c1_887_1378 | 161 |
| 1272 | 3300050493 | nmdc:mga0k408_262781_c1 | nmdc:mga0k408_262781_c1_130_621 | 161 |
| 1273 | 3300050493 | nmdc:mga0k408_294138_c1 | nmdc:mga0k408_294138_c1_219_710 | 161 |
| 1274 | 3300050494 | nmdc:mga06z11_117592_c1 | nmdc:mga06z11_117592_c1_899_1390 | 161 |
| 1275 | 3300050496 | nmdc:mga07m45_3363_c1 | nmdc:mga07m45_3363_c1_6053_6544 | 161 |
| 1276 | 3300050496 | nmdc:mga07m45_430032_c1 | nmdc:mga07m45_430032_c1_199_690 | 161 |
| 1277 | 3300050511 | nmdc:mga08y16_356564_c1 | nmdc:mga08y16_356564_c1_346_837 | 161 |
| 1278 | 3300050511 | nmdc:mga08y16_449587_c1 | nmdc:mga08y16_449587_c1_26_523 | 161 |
| 1279 | 3300050512 | nmdc:mga0n895_1449844_c1 | nmdc:mga0n895_1449844_c1_145_642 | 161 |
| 1280 | 3300050512 | nmdc:mga0n895_228943_c1 | nmdc:mga0n895_228943_c1_596_1087 | 161 |
| 1281 | 3300050513 | nmdc:mga0rr50_202685_c1 | nmdc:mga0rr50_202685_c1_52_549 | 161 |
| 1282 | 3300050514 | nmdc:mga08x19_1052831_c1 | nmdc:mga08x19_1052831_c1_52_549 | 161 |
| 1283 | 3300050515 | nmdc:mga0a205_246805_c1 | nmdc:mga0a205_246805_c1_574_1065 | 161 |
| 1284 | 3300050516 | nmdc:mga0sz30_20156_c1 | nmdc:mga0sz30_20156_c1_958_1449 | 161 |
| 1285 | 3300053077 | Ga0495601_0000015 | Ga0495601_0000015_8844_9335 | 161 |
| 1286 | 3300053077 | Ga0495601_0014124 | Ga0495601_0014124_2884_3372 | 161 |
| 1287 | 3300053077 | Ga0495601_0100600 | Ga0495601_0100600_1030_1518 | 161 |
| 1288 | 3300053078 | Ga0495612_0000096 | Ga0495612_0000096_28683_29174 | 161 |
| 1289 | 3300053078 | Ga0495612_0170846 | Ga0495612_0170846_22_510 | 161 |
| 1290 | 3300053083 | Ga0495655_0127672 | Ga0495655_0127672_160_651 | 161 |
| 1291 | 3300053084 | Ga0495595_0000035 | Ga0495595_0000035_70545_71036 | 161 |
| 1292 | 3300053084 | Ga0495595_0000332 | Ga0495595_0000332_3433_3921 | 161 |
| 1293 | 3300053085 | Ga0495619_0000044 | Ga0495619_0000044_9144_9635 | 161 |
| 1294 | 3300053085 | Ga0495619_0000633 | Ga0495619_0000633_16747_17235 | 161 |
| 1295 | 3300053085 | Ga0495619_0887235 | Ga0495619_0887235_18_509 | 161 |
| 1296 | 3300053091 | Ga0500647_0164594 | Ga0500647_0164594_458_946 | 161 |
| 1297 | 3300053093 | Ga0500651_0050027 | Ga0500651_0050027_448_939 | 161 |
| 1298 | 3300053094 | Ga0500566_0037299 | Ga0500566_0037299_1549_2040 | 161 |
| 1299 | 3300053096 | Ga0500641_0001219 | Ga0500641_0001219_1094_1585 | 161 |
| 1300 | 3300053096 | Ga0500641_0011540 | Ga0500641_0011540_1643_2134 | 161 |
| 1301 | 3300053104 | Ga0500556_0224956 | Ga0500556_0224956_232_723 | 161 |
| 1302 | 3300053119 | Ga0500595_002179 | Ga0500595_002179_4026_4517 | 161 |
| 1303 | 3300053119 | Ga0500595_012929 | Ga0500595_012929_1449_1940 | 161 |
| 1304 | 3300053119 | Ga0500595_016261 | Ga0500595_016261_1882_2370 | 161 |
| 1305 | 3300053129 | Ga0500628_095836 | Ga0500628_095836_171_662 | 161 |
| 1306 | 3300053131 | Ga0500652_228319 | Ga0500652_228319_30_521 | 161 |
| 1307 | 3300053134 | Ga0500658_0410241 | Ga0500658_0410241_64_555 | 161 |
| 1308 | 3300053136 | Ga0500559_0043687 | Ga0500559_0043687_276_764 | 161 |
| 1309 | 3300053140 | Ga0500573_0080592 | Ga0500573_0080592_859_1347 | 161 |
| 1310 | 3300053142 | Ga0500577_0518601 | Ga0500577_0518601_19_510 | 161 |
| 1311 | 3300053147 | Ga0500589_024473 | Ga0500589_024473_1452_1943 | 161 |
| 1312 | 3300053148 | Ga0500590_212917 | Ga0500590_212917_176_667 | 161 |
| 1313 | 3300053148 | Ga0500590_342407 | Ga0500590_342407_28_519 | 161 |
| 1314 | 3300053151 | Ga0500604_0093832 | Ga0500604_0093832_53_544 | 161 |
| 1315 | 3300053156 | Ga0500622_0121696 | Ga0500622_0121696_235_726 | 161 |
| 1316 | 3300053177 | Ga0500636_0097505 | Ga0500636_0097505_384_872 | 161 |
| 1317 | 3300053177 | Ga0500636_0166334 | Ga0500636_0166334_309_797 | 161 |
| 1318 | 3300053177 | Ga0500636_0276343 | Ga0500636_0276343_98_589 | 161 |
| 1319 | 3300053730 | Ga0500645_010480 | Ga0500645_010480_120_611 | 161 |
| 1320 | 3300054114 | Ga0501084_1167141 | Ga0501084_1167141_81_572 | 161 |
| 1321 | 3300055283 | Ga0500661_018957 | Ga0500661_018957_618_1109 | 161 |
| 1322 | 3300059426 | Ga0590077_081133 | Ga0590077_081133_238_729 | 161 |
| 1323 | 3300059493 | Ga0587077_195595 | Ga0587077_195595_47_535 | 161 |
| 1324 | 3300059630 | Ga0587128_089277 | Ga0587128_089277_69_557 | 161 |
| 1325 | 3300059640 | Ga0587067_124011 | Ga0587067_124011_24_512 | 161 |
| 1326 | 3300059644 | Ga0587075_082314 | Ga0587075_082314_111_599 | 161 |
| 1327 | 3300059649 | Ga0587102_036813 | Ga0587102_036813_118_606 | 161 |
| 1328 | 3300060353 | Ga0501082_0792387 | Ga0501082_0792387_304_795 | 161 |
| 1329 | 3300001904 | JGI24736J21556_1016355 | JGI24736J21556_10163552 | 162 |
| 1330 | 3300001976 | JGI24752J21851_1027888 | JGI24752J21851_10278882 | 162 |
| 1331 | 3300001979 | JGI24740J21852_10051938 | JGI24740J21852_100519382 | 162 |
| 1332 | 3300001989 | JGI24739J22299_10057219 | JGI24739J22299_100572192 | 162 |
| 1333 | 3300001990 | JGI24737J22298_10041998 | JGI24737J22298_100419982 | 162 |
| 1334 | 3300001991 | JGI24743J22301_10022260 | JGI24743J22301_100222601 | 162 |
| 1335 | 3300002067 | JGI24735J21928_10062795 | JGI24735J21928_100627952 | 162 |
| 1336 | 3300002244 | JGI24742J22300_10051161 | JGI24742J22300_100511612 | 162 |
| 1337 | 3300003203 | JGI25406J46586_10007497 | JGI25406J46586_100074973 | 162 |
| 1338 | 3300003203 | JGI25406J46586_10038536 | JGI25406J46586_100385362 | 162 |
| 1339 | 3300003215 | JGI25153J46596_10012145 | JGI25153J46596_100121452 | 162 |
| 1340 | 3300003215 | JGI25153J46596_10013197 | JGI25153J46596_100131971 | 162 |
| 1341 | 3300003215 | JGI25153J46596_10047815 | JGI25153J46596_100478152 | 162 |
| 1342 | 3300003308 | Ga0006777J48905_1033878 | Ga0006777J48905_10338781 | 162 |
| 1343 | 3300003354 | JGI25160J50197_1000801 | JGI25160J50197_100080115 | 162 |
| 1344 | 3300003574 | Ga0007410J51695_1046046 | Ga0007410J51695_10460461 | 162 |
| 1345 | 3300003659 | JGI25404J52841_10005572 | JGI25404J52841_100055723 | 162 |
| 1346 | 3300003659 | JGI25404J52841_10007750 | JGI25404J52841_100077501 | 162 |
| 1347 | 3300003659 | JGI25404J52841_10009204 | JGI25404J52841_100092042 | 162 |
| 1348 | 3300003752 | Ga0055539_1010616 | Ga0055539_10106161 | 162 |
| 1349 | 3300003771 | Ga0055526_1030287 | Ga0055526_10302871 | 162 |
| 1350 | 3300003771 | Ga0055526_1070283 | Ga0055526_10702831 | 162 |
| 1351 | 3300003775 | Ga0055524_1019793 | Ga0055524_10197932 | 162 |
| 1352 | 3300003794 | Ga0055531_10002406 | Ga0055531_100024065 | 162 |
| 1353 | 3300004801 | Ga0058860_12155477 | Ga0058860_121554771 | 162 |
| 1354 | 3300004803 | Ga0058862_10098549 | Ga0058862_100985491 | 162 |
| 1355 | 3300005262 | Ga0065165_1010861 | Ga0065165_10108614 | 162 |
| 1356 | 3300005262 | Ga0065165_1084460 | Ga0065165_10844602 | 162 |
| 1357 | 3300005262 | Ga0065165_1124716 | Ga0065165_11247161 | 162 |
| 1358 | 3300005290 | Ga0065712_10342346 | Ga0065712_103423461 | 162 |
| 1359 | 3300005327 | Ga0070658_10058031 | Ga0070658_100580313 | 162 |
| 1360 | 3300005327 | Ga0070658_10204382 | Ga0070658_102043822 | 162 |
| 1361 | 3300005329 | Ga0070683_100130474 | Ga0070683_1001304741 | 162 |
| 1362 | 3300005330 | Ga0070690_100228645 | Ga0070690_1002286452 | 162 |
| 1363 | 3300005331 | Ga0070670_100202840 | Ga0070670_1002028402 | 162 |
| 1364 | 3300005331 | Ga0070670_101826782 | Ga0070670_1018267821 | 162 |
| 1365 | 3300005334 | Ga0068869_100455881 | Ga0068869_1004558812 | 162 |
| 1366 | 3300005336 | Ga0070680_100026931 | Ga0070680_1000269312 | 162 |
| 1367 | 3300005336 | Ga0070680_100098059 | Ga0070680_1000980592 | 162 |
| 1368 | 3300005337 | Ga0070682_100563447 | Ga0070682_1005634471 | 162 |
| 1369 | 3300005339 | Ga0070660_101633481 | Ga0070660_1016334811 | 162 |
| 1370 | 3300005344 | Ga0070661_100075696 | Ga0070661_1000756962 | 162 |
| 1371 | 3300005347 | Ga0070668_100024092 | Ga0070668_1000240923 | 162 |
| 1372 | 3300005347 | Ga0070668_100408476 | Ga0070668_1004084761 | 162 |
| 1373 | 3300005354 | Ga0070675_100418602 | Ga0070675_1004186021 | 162 |
| 1374 | 3300005355 | Ga0070671_100011405 | Ga0070671_1000114053 | 162 |
| 1375 | 3300005356 | Ga0070674_100440283 | Ga0070674_1004402831 | 162 |
| 1376 | 3300005356 | Ga0070674_100690527 | Ga0070674_1006905271 | 162 |
| 1377 | 3300005366 | Ga0070659_100025503 | Ga0070659_1000255033 | 162 |
| 1378 | 3300005366 | Ga0070659_100226056 | Ga0070659_1002260562 | 162 |
| 1379 | 3300005367 | Ga0070667_100032367 | Ga0070667_1000323673 | 162 |
| 1380 | 3300005434 | Ga0070709_10001487 | Ga0070709_100014873 | 162 |
| 1381 | 3300005434 | Ga0070709_10005197 | Ga0070709_100051975 | 162 |
| 1382 | 3300005435 | Ga0070714_100008988 | Ga0070714_1000089883 | 162 |
| 1383 | 3300005435 | Ga0070714_101703807 | Ga0070714_1017038071 | 162 |
| 1384 | 3300005436 | Ga0070713_100007532 | Ga0070713_1000075325 | 162 |
| 1385 | 3300005436 | Ga0070713_100030133 | Ga0070713_1000301332 | 162 |
| 1386 | 3300005437 | Ga0070710_10001558 | Ga0070710_100015586 | 162 |
| 1387 | 3300005437 | Ga0070710_10015094 | Ga0070710_100150943 | 162 |
| 1388 | 3300005437 | Ga0070710_10089854 | Ga0070710_100898541 | 162 |
| 1389 | 3300005439 | Ga0070711_100003888 | Ga0070711_1000038884 | 162 |
| 1390 | 3300005439 | Ga0070711_100004290 | Ga0070711_1000042905 | 162 |
| 1391 | 3300005439 | Ga0070711_100054430 | Ga0070711_1000544303 | 162 |
| 1392 | 3300005455 | Ga0070663_100023617 | Ga0070663_1000236173 | 162 |
| 1393 | 3300005455 | Ga0070663_100063772 | Ga0070663_1000637724 | 162 |
| 1394 | 3300005455 | Ga0070663_100165493 | Ga0070663_1001654932 | 162 |
| 1395 | 3300005455 | Ga0070663_100222670 | Ga0070663_1002226703 | 162 |
| 1396 | 3300005455 | Ga0070663_100283222 | Ga0070663_1002832222 | 162 |
| 1397 | 3300005456 | Ga0070678_100153379 | Ga0070678_1001533791 | 162 |
| 1398 | 3300005456 | Ga0070678_100212714 | Ga0070678_1002127142 | 162 |
| 1399 | 3300005456 | Ga0070678_100687392 | Ga0070678_1006873921 | 162 |
| 1400 | 3300005457 | Ga0070662_100352249 | Ga0070662_1003522491 | 162 |
| 1401 | 3300005458 | Ga0070681_10066584 | Ga0070681_100665843 | 162 |
| 1402 | 3300005458 | Ga0070681_10705787 | Ga0070681_107057873 | 162 |
| 1403 | 3300005459 | Ga0068867_100416018 | Ga0068867_1004160182 | 162 |
| 1404 | 3300005466 | Ga0070685_10899823 | Ga0070685_108998231 | 162 |
| 1405 | 3300005530 | Ga0070679_100032426 | Ga0070679_1000324262 | 162 |
| 1406 | 3300005530 | Ga0070679_100038144 | Ga0070679_1000381442 | 162 |
| 1407 | 3300005530 | Ga0070679_100341553 | Ga0070679_1003415532 | 162 |
| 1408 | 3300005530 | Ga0070679_100378215 | Ga0070679_1003782151 | 162 |
| 1409 | 3300005535 | Ga0070684_100328492 | Ga0070684_1003284922 | 162 |
| 1410 | 3300005539 | Ga0068853_100084746 | Ga0068853_1000847462 | 162 |
| 1411 | 3300005539 | Ga0068853_100262986 | Ga0068853_1002629861 | 162 |
| 1412 | 3300005539 | Ga0068853_100404833 | Ga0068853_1004048332 | 162 |
| 1413 | 3300005539 | Ga0068853_100784911 | Ga0068853_1007849111 | 162 |
| 1414 | 3300005539 | Ga0068853_100814497 | Ga0068853_1008144971 | 162 |
| 1415 | 3300005547 | Ga0070693_100211510 | Ga0070693_1002115101 | 162 |
| 1416 | 3300005547 | Ga0070693_100410130 | Ga0070693_1004101301 | 162 |
| 1417 | 3300005547 | Ga0070693_100675471 | Ga0070693_1006754712 | 162 |
| 1418 | 3300005548 | Ga0070665_100055417 | Ga0070665_1000554174 | 162 |
| 1419 | 3300005548 | Ga0070665_100212627 | Ga0070665_1002126272 | 162 |
| 1420 | 3300005548 | Ga0070665_102400575 | Ga0070665_1024005751 | 162 |
| 1421 | 3300005563 | Ga0068855_100107261 | Ga0068855_1001072614 | 162 |
| 1422 | 3300005563 | Ga0068855_100250102 | Ga0068855_1002501022 | 162 |
| 1423 | 3300005563 | Ga0068855_100779407 | Ga0068855_1007794072 | 162 |
| 1424 | 3300005563 | Ga0068855_100855162 | Ga0068855_1008551621 | 162 |
| 1425 | 3300005577 | Ga0068857_100199140 | Ga0068857_1001991401 | 162 |
| 1426 | 3300005577 | Ga0068857_100233289 | Ga0068857_1002332891 | 162 |
| 1427 | 3300005577 | Ga0068857_100742562 | Ga0068857_1007425622 | 162 |
| 1428 | 3300005578 | Ga0068854_100063189 | Ga0068854_1000631893 | 162 |
| 1429 | 3300005578 | Ga0068854_100064694 | Ga0068854_1000646941 | 162 |
| 1430 | 3300005578 | Ga0068854_100077690 | Ga0068854_1000776902 | 162 |
| 1431 | 3300005578 | Ga0068854_100126778 | Ga0068854_1001267782 | 162 |
| 1432 | 3300005578 | Ga0068854_100184482 | Ga0068854_1001844823 | 162 |
| 1433 | 3300005614 | Ga0068856_100000055 | Ga0068856_10000005552 | 162 |
| 1434 | 3300005614 | Ga0068856_100002036 | Ga0068856_10000203626 | 162 |
| 1435 | 3300005614 | Ga0068856_100023673 | Ga0068856_1000236733 | 162 |
| 1436 | 3300005614 | Ga0068856_100129943 | Ga0068856_1001299433 | 162 |
| 1437 | 3300005614 | Ga0068856_100343214 | Ga0068856_1003432142 | 162 |
| 1438 | 3300005614 | Ga0068856_100852120 | Ga0068856_1008521201 | 162 |
| 1439 | 3300005616 | Ga0068852_101391581 | Ga0068852_1013915811 | 162 |
| 1440 | 3300005617 | Ga0068859_100286671 | Ga0068859_1002866712 | 162 |
| 1441 | 3300005618 | Ga0068864_100084851 | Ga0068864_1000848512 | 162 |
| 1442 | 3300005618 | Ga0068864_100389493 | Ga0068864_1003894932 | 162 |
| 1443 | 3300005718 | Ga0068866_10679990 | Ga0068866_106799901 | 162 |
| 1444 | 3300005834 | Ga0068851_10006976 | Ga0068851_100069764 | 162 |
| 1445 | 3300005834 | Ga0068851_10318005 | Ga0068851_103180051 | 162 |
| 1446 | 3300005842 | Ga0068858_100142352 | Ga0068858_1001423521 | 162 |
| 1447 | 3300005842 | Ga0068858_100240836 | Ga0068858_1002408362 | 162 |
| 1448 | 3300005842 | Ga0068858_100468892 | Ga0068858_1004688923 | 162 |
| 1449 | 3300005843 | Ga0068860_100154933 | Ga0068860_1001549332 | 162 |
| 1450 | 3300005937 | Ga0081455_10006141 | Ga0081455_100061412 | 162 |
| 1451 | 3300005937 | Ga0081455_10032421 | Ga0081455_100324214 | 162 |
| 1452 | 3300005937 | Ga0081455_10067710 | Ga0081455_100677102 | 162 |
| 1453 | 3300005983 | Ga0081540_1004015 | Ga0081540_10040153 | 162 |
| 1454 | 3300005983 | Ga0081540_1006857 | Ga0081540_10068575 | 162 |
| 1455 | 3300005983 | Ga0081540_1013901 | Ga0081540_10139014 | 162 |
| 1456 | 3300005983 | Ga0081540_1015784 | Ga0081540_10157841 | 162 |
| 1457 | 3300005983 | Ga0081540_1023846 | Ga0081540_10238463 | 162 |
| 1458 | 3300005983 | Ga0081540_1024265 | Ga0081540_10242653 | 162 |
| 1459 | 3300005983 | Ga0081540_1029953 | Ga0081540_10299533 | 162 |
| 1460 | 3300005983 | Ga0081540_1094487 | Ga0081540_10944872 | 162 |
| 1461 | 3300005983 | Ga0081540_1183712 | Ga0081540_11837121 | 162 |
| 1462 | 3300005985 | Ga0081539_10000585 | Ga0081539_1000058548 | 162 |
| 1463 | 3300005985 | Ga0081539_10006073 | Ga0081539_100060738 | 162 |
| 1464 | 3300005985 | Ga0081539_10256092 | Ga0081539_102560922 | 162 |
| 1465 | 3300006028 | Ga0070717_10947944 | Ga0070717_109479441 | 162 |
| 1466 | 3300006038 | Ga0075365_10059311 | Ga0075365_100593112 | 162 |
| 1467 | 3300006038 | Ga0075365_10104372 | Ga0075365_101043722 | 162 |
| 1468 | 3300006038 | Ga0075365_10125516 | Ga0075365_101255161 | 162 |
| 1469 | 3300006038 | Ga0075365_10182498 | Ga0075365_101824981 | 162 |
| 1470 | 3300006038 | Ga0075365_10265449 | Ga0075365_102654491 | 162 |
| 1471 | 3300006038 | Ga0075365_10313193 | Ga0075365_103131932 | 162 |
| 1472 | 3300006038 | Ga0075365_10484139 | Ga0075365_104841391 | 162 |
| 1473 | 3300006042 | Ga0075368_10005666 | Ga0075368_100056662 | 162 |
| 1474 | 3300006042 | Ga0075368_10101761 | Ga0075368_101017612 | 162 |
| 1475 | 3300006042 | Ga0075368_10427174 | Ga0075368_104271741 | 162 |
| 1476 | 3300006048 | Ga0075363_100021660 | Ga0075363_1000216603 | 162 |
| 1477 | 3300006048 | Ga0075363_100281853 | Ga0075363_1002818532 | 162 |
| 1478 | 3300006048 | Ga0075363_100359413 | Ga0075363_1003594131 | 162 |
| 1479 | 3300006051 | Ga0075364_10067065 | Ga0075364_100670651 | 162 |
| 1480 | 3300006051 | Ga0075364_10120053 | Ga0075364_101200531 | 162 |
| 1481 | 3300006051 | Ga0075364_10282442 | Ga0075364_102824422 | 162 |
| 1482 | 3300006163 | Ga0070715_10134483 | Ga0070715_101344832 | 162 |
| 1483 | 3300006163 | Ga0070715_10149762 | Ga0070715_101497622 | 162 |
| 1484 | 3300006175 | Ga0070712_100008298 | Ga0070712_1000082983 | 162 |
| 1485 | 3300006175 | Ga0070712_100025559 | Ga0070712_1000255591 | 162 |
| 1486 | 3300006175 | Ga0070712_100043262 | Ga0070712_1000432622 | 162 |
| 1487 | 3300006175 | Ga0070712_100663906 | Ga0070712_1006639062 | 162 |
| 1488 | 3300006175 | Ga0070712_100888627 | Ga0070712_1008886272 | 162 |
| 1489 | 3300006177 | Ga0075362_10045442 | Ga0075362_100454421 | 162 |
| 1490 | 3300006177 | Ga0075362_10051962 | Ga0075362_100519622 | 162 |
| 1491 | 3300006178 | Ga0075367_10026149 | Ga0075367_100261494 | 162 |
| 1492 | 3300006178 | Ga0075367_10094648 | Ga0075367_100946482 | 162 |
| 1493 | 3300006178 | Ga0075367_10180948 | Ga0075367_101809482 | 162 |
| 1494 | 3300006186 | Ga0075369_10016546 | Ga0075369_100165463 | 162 |
| 1495 | 3300006186 | Ga0075369_10031782 | Ga0075369_100317823 | 162 |
| 1496 | 3300006186 | Ga0075369_10057521 | Ga0075369_100575212 | 162 |
| 1497 | 3300006186 | Ga0075369_10125612 | Ga0075369_101256121 | 162 |
| 1498 | 3300006195 | Ga0075366_10015283 | Ga0075366_100152833 | 162 |
| 1499 | 3300006195 | Ga0075366_10249960 | Ga0075366_102499602 | 162 |
| 1500 | 3300006237 | Ga0097621_100378693 | Ga0097621_1003786932 | 162 |
| 1501 | 3300006353 | Ga0075370_10107592 | Ga0075370_101075922 | 162 |
| 1502 | 3300006353 | Ga0075370_10130719 | Ga0075370_101307192 | 162 |
| 1503 | 3300006353 | Ga0075370_10383285 | Ga0075370_103832852 | 162 |
| 1504 | 3300006353 | Ga0075370_10400341 | Ga0075370_104003411 | 162 |
| 1505 | 3300006931 | Ga0097620_100070150 | Ga0097620_1000701504 | 162 |
| 1506 | 3300006931 | Ga0097620_100286663 | Ga0097620_1002866632 | 162 |
| 1507 | 3300007265 | Ga0099794_10081198 | Ga0099794_100811982 | 162 |
| 1508 | 3300007788 | Ga0099795_10299093 | Ga0099795_102990931 | 162 |
| 1509 | 3300009093 | Ga0105240_10004881 | Ga0105240_100048813 | 162 |
| 1510 | 3300009093 | Ga0105240_10178270 | Ga0105240_101782701 | 162 |
| 1511 | 3300009101 | Ga0105247_10013326 | Ga0105247_100133262 | 162 |
| 1512 | 3300009101 | Ga0105247_10173764 | Ga0105247_101737642 | 162 |
| 1513 | 3300009101 | Ga0105247_10206311 | Ga0105247_102063112 | 162 |
| 1514 | 3300009174 | Ga0105241_10001011 | Ga0105241_1000101113 | 162 |
| 1515 | 3300009176 | Ga0105242_11419862 | Ga0105242_114198621 | 162 |
| 1516 | 3300009177 | Ga0105248_10284311 | Ga0105248_102843113 | 162 |
| 1517 | 3300009177 | Ga0105248_10340817 | Ga0105248_103408172 | 162 |
| 1518 | 3300009177 | Ga0105248_11565230 | Ga0105248_115652301 | 162 |
| 1519 | 3300009177 | Ga0105248_11840372 | Ga0105248_118403721 | 162 |
| 1520 | 3300009545 | Ga0105237_10030019 | Ga0105237_100300195 | 162 |
| 1521 | 3300009545 | Ga0105237_10175188 | Ga0105237_101751881 | 162 |
| 1522 | 3300009545 | Ga0105237_10408376 | Ga0105237_104083761 | 162 |
| 1523 | 3300009551 | Ga0105238_10076517 | Ga0105238_100765173 | 162 |
| 1524 | 3300010159 | Ga0099796_10050035 | Ga0099796_100500352 | 162 |
| 1525 | 3300010159 | Ga0099796_10480559 | Ga0099796_104805591 | 162 |
| 1526 | 3300010375 | Ga0105239_10025293 | Ga0105239_100252935 | 162 |
| 1527 | 3300010375 | Ga0105239_11323901 | Ga0105239_113239012 | 162 |
| 1528 | 3300012494 | Ga0157341_1012094 | Ga0157341_10120941 | 162 |
| 1529 | 3300012495 | Ga0157323_1006910 | Ga0157323_10069101 | 162 |
| 1530 | 3300012500 | Ga0157314_1048444 | Ga0157314_10484441 | 162 |
| 1531 | 3300013102 | Ga0157371_10021912 | Ga0157371_100219122 | 162 |
| 1532 | 3300013104 | Ga0157370_10146307 | Ga0157370_101463072 | 162 |
| 1533 | 3300013105 | Ga0157369_10356237 | Ga0157369_103562372 | 162 |
| 1534 | 3300013307 | Ga0157372_10069722 | Ga0157372_100697224 | 162 |
| 1535 | 3300013307 | Ga0157372_10559542 | Ga0157372_105595422 | 162 |
| 1536 | 3300013308 | Ga0157375_10044068 | Ga0157375_100440681 | 162 |
| 1537 | 3300013308 | Ga0157375_12003884 | Ga0157375_120038841 | 162 |
| 1538 | 3300014325 | Ga0163163_11577188 | Ga0163163_115771881 | 162 |
| 1539 | 3300014497 | Ga0182008_10094769 | Ga0182008_100947692 | 162 |
| 1540 | 3300014968 | Ga0157379_10157542 | Ga0157379_101575422 | 162 |
| 1541 | 3300014969 | Ga0157376_12011778 | Ga0157376_120117781 | 162 |
| 1542 | 3300020076 | Ga0206355_1436607 | Ga0206355_14366072 | 162 |
| 1543 | 3300020082 | Ga0206353_11312172 | Ga0206353_113121721 | 162 |
| 1544 | 3300021320 | Ga0214544_1000005 | Ga0214544_100000558 | 162 |
| 1545 | 3300021321 | Ga0214542_1000004 | Ga0214542_100000462 | 162 |
| 1546 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005335 | 162 |
| 1547 | 3300021327 | Ga0214543_1000111 | Ga0214543_100011146 | 162 |
| 1548 | 3300021358 | Ga0213873_10179336 | Ga0213873_101793361 | 162 |
| 1549 | 3300021384 | Ga0213876_10001491 | Ga0213876_100014911 | 162 |
| 1550 | 3300021388 | Ga0213875_10046868 | Ga0213875_100468682 | 162 |
| 1551 | 3300025230 | Ga0209563_104277 | Ga0209563_1042773 | 162 |
| 1552 | 3300025245 | Ga0207425_1023944 | Ga0207425_10239442 | 162 |
| 1553 | 3300025253 | Ga0209677_110545 | Ga0209677_1105452 | 162 |
| 1554 | 3300025254 | Ga0209148_1000672 | Ga0209148_100067224 | 162 |
| 1555 | 3300025261 | Ga0209233_1010915 | Ga0209233_10109153 | 162 |
| 1556 | 3300025261 | Ga0209233_1013292 | Ga0209233_10132923 | 162 |
| 1557 | 3300025295 | Ga0209564_1000971 | Ga0209564_10009717 | 162 |
| 1558 | 3300025295 | Ga0209564_1049345 | Ga0209564_10493451 | 162 |
| 1559 | 3300025295 | Ga0209564_1050154 | Ga0209564_10501542 | 162 |
| 1560 | 3300025297 | Ga0209758_1000102 | Ga0209758_1000102157 | 162 |
| 1561 | 3300025297 | Ga0209758_1007481 | Ga0209758_10074813 | 162 |
| 1562 | 3300025297 | Ga0209758_1009879 | Ga0209758_10098793 | 162 |
| 1563 | 3300025297 | Ga0209758_1031515 | Ga0209758_10315151 | 162 |
| 1564 | 3300025297 | Ga0209758_1032221 | Ga0209758_10322211 | 162 |
| 1565 | 3300025299 | Ga0209256_1005673 | Ga0209256_10056734 | 162 |
| 1566 | 3300025302 | Ga0207426_1008961 | Ga0207426_10089611 | 162 |
| 1567 | 3300025304 | Ga0209257_1005774 | Ga0209257_10057742 | 162 |
| 1568 | 3300025315 | Ga0207697_10052681 | Ga0207697_100526811 | 162 |
| 1569 | 3300025321 | Ga0207656_10129719 | Ga0207656_101297191 | 162 |
| 1570 | 3300025321 | Ga0207656_10169680 | Ga0207656_101696801 | 162 |
| 1571 | 3300025893 | Ga0207682_10296969 | Ga0207682_102969691 | 162 |
| 1572 | 3300025898 | Ga0207692_10002983 | Ga0207692_100029833 | 162 |
| 1573 | 3300025898 | Ga0207692_10016278 | Ga0207692_100162782 | 162 |
| 1574 | 3300025898 | Ga0207692_10181206 | Ga0207692_101812062 | 162 |
| 1575 | 3300025898 | Ga0207692_10666405 | Ga0207692_106664051 | 162 |
| 1576 | 3300025903 | Ga0207680_10533688 | Ga0207680_105336881 | 162 |
| 1577 | 3300025903 | Ga0207680_10777693 | Ga0207680_107776931 | 162 |
| 1578 | 3300025904 | Ga0207647_10022659 | Ga0207647_100226592 | 162 |
| 1579 | 3300025904 | Ga0207647_10285510 | Ga0207647_102855101 | 162 |
| 1580 | 3300025906 | Ga0207699_10001381 | Ga0207699_100013816 | 162 |
| 1581 | 3300025906 | Ga0207699_10010672 | Ga0207699_100106722 | 162 |
| 1582 | 3300025907 | Ga0207645_10075858 | Ga0207645_100758582 | 162 |
| 1583 | 3300025909 | Ga0207705_10327578 | Ga0207705_103275782 | 162 |
| 1584 | 3300025911 | Ga0207654_10000468 | Ga0207654_100004683 | 162 |
| 1585 | 3300025911 | Ga0207654_10033630 | Ga0207654_100336304 | 162 |
| 1586 | 3300025911 | Ga0207654_10125342 | Ga0207654_101253421 | 162 |
| 1587 | 3300025912 | Ga0207707_10000386 | Ga0207707_100003865 | 162 |
| 1588 | 3300025912 | Ga0207707_10109693 | Ga0207707_101096933 | 162 |
| 1589 | 3300025913 | Ga0207695_10001480 | Ga0207695_1000148020 | 162 |
| 1590 | 3300025914 | Ga0207671_10101317 | Ga0207671_101013172 | 162 |
| 1591 | 3300025914 | Ga0207671_10163523 | Ga0207671_101635232 | 162 |
| 1592 | 3300025914 | Ga0207671_10165850 | Ga0207671_101658504 | 162 |
| 1593 | 3300025914 | Ga0207671_10616271 | Ga0207671_106162711 | 162 |
| 1594 | 3300025915 | Ga0207693_10025202 | Ga0207693_100252023 | 162 |
| 1595 | 3300025915 | Ga0207693_10030083 | Ga0207693_100300836 | 162 |
| 1596 | 3300025915 | Ga0207693_10058734 | Ga0207693_100587343 | 162 |
| 1597 | 3300025916 | Ga0207663_10020005 | Ga0207663_100200051 | 162 |
| 1598 | 3300025916 | Ga0207663_10026864 | Ga0207663_100268643 | 162 |
| 1599 | 3300025916 | Ga0207663_10286215 | Ga0207663_102862151 | 162 |
| 1600 | 3300025917 | Ga0207660_10065453 | Ga0207660_100654533 | 162 |
| 1601 | 3300025917 | Ga0207660_10067863 | Ga0207660_100678631 | 162 |
| 1602 | 3300025919 | Ga0207657_10036976 | Ga0207657_100369762 | 162 |
| 1603 | 3300025919 | Ga0207657_10065225 | Ga0207657_100652253 | 162 |
| 1604 | 3300025919 | Ga0207657_11231683 | Ga0207657_112316831 | 162 |
| 1605 | 3300025920 | Ga0207649_10366562 | Ga0207649_103665621 | 162 |
| 1606 | 3300025920 | Ga0207649_11316394 | Ga0207649_113163941 | 162 |
| 1607 | 3300025921 | Ga0207652_10076797 | Ga0207652_100767972 | 162 |
| 1608 | 3300025921 | Ga0207652_10432150 | Ga0207652_104321502 | 162 |
| 1609 | 3300025921 | Ga0207652_10679409 | Ga0207652_106794092 | 162 |
| 1610 | 3300025921 | Ga0207652_11038235 | Ga0207652_110382351 | 162 |
| 1611 | 3300025923 | Ga0207681_10829963 | Ga0207681_108299631 | 162 |
| 1612 | 3300025923 | Ga0207681_11143768 | Ga0207681_111437681 | 162 |
| 1613 | 3300025924 | Ga0207694_10000136 | Ga0207694_1000013673 | 162 |
| 1614 | 3300025924 | Ga0207694_10683096 | Ga0207694_106830961 | 162 |
| 1615 | 3300025925 | Ga0207650_10545986 | Ga0207650_105459861 | 162 |
| 1616 | 3300025928 | Ga0207700_10043132 | Ga0207700_100431324 | 162 |
| 1617 | 3300025928 | Ga0207700_10084384 | Ga0207700_100843841 | 162 |
| 1618 | 3300025928 | Ga0207700_10208204 | Ga0207700_102082042 | 162 |
| 1619 | 3300025929 | Ga0207664_10073307 | Ga0207664_100733071 | 162 |
| 1620 | 3300025929 | Ga0207664_10214384 | Ga0207664_102143841 | 162 |
| 1621 | 3300025929 | Ga0207664_10622360 | Ga0207664_106223601 | 162 |
| 1622 | 3300025931 | Ga0207644_10145803 | Ga0207644_101458031 | 162 |
| 1623 | 3300025932 | Ga0207690_10069163 | Ga0207690_100691633 | 162 |
| 1624 | 3300025933 | Ga0207706_10258032 | Ga0207706_102580321 | 162 |
| 1625 | 3300025934 | Ga0207686_10212848 | Ga0207686_102128481 | 162 |
| 1626 | 3300025934 | Ga0207686_10448393 | Ga0207686_104483932 | 162 |
| 1627 | 3300025935 | Ga0207709_10250971 | Ga0207709_102509711 | 162 |
| 1628 | 3300025937 | Ga0207669_10266158 | Ga0207669_102661581 | 162 |
| 1629 | 3300025937 | Ga0207669_10401877 | Ga0207669_104018771 | 162 |
| 1630 | 3300025939 | Ga0207665_10007889 | Ga0207665_100078893 | 162 |
| 1631 | 3300025939 | Ga0207665_10542820 | Ga0207665_105428201 | 162 |
| 1632 | 3300025940 | Ga0207691_10342081 | Ga0207691_103420811 | 162 |
| 1633 | 3300025940 | Ga0207691_11046933 | Ga0207691_110469332 | 162 |
| 1634 | 3300025941 | Ga0207711_10022786 | Ga0207711_100227862 | 162 |
| 1635 | 3300025941 | Ga0207711_10066864 | Ga0207711_100668642 | 162 |
| 1636 | 3300025941 | Ga0207711_10236216 | Ga0207711_102362162 | 162 |
| 1637 | 3300025942 | Ga0207689_10218876 | Ga0207689_102188761 | 162 |
| 1638 | 3300025944 | Ga0207661_11095126 | Ga0207661_110951261 | 162 |
| 1639 | 3300025949 | Ga0207667_10067553 | Ga0207667_100675533 | 162 |
| 1640 | 3300025949 | Ga0207667_10116984 | Ga0207667_101169841 | 162 |
| 1641 | 3300025949 | Ga0207667_10121092 | Ga0207667_101210922 | 162 |
| 1642 | 3300025949 | Ga0207667_10362445 | Ga0207667_103624452 | 162 |
| 1643 | 3300025949 | Ga0207667_10708353 | Ga0207667_107083531 | 162 |
| 1644 | 3300025949 | Ga0207667_10961465 | Ga0207667_109614651 | 162 |
| 1645 | 3300025960 | Ga0207651_10211442 | Ga0207651_102114421 | 162 |
| 1646 | 3300025961 | Ga0207712_10417571 | Ga0207712_104175712 | 162 |
| 1647 | 3300025961 | Ga0207712_10895107 | Ga0207712_108951071 | 162 |
| 1648 | 3300025972 | Ga0207668_10202012 | Ga0207668_102020122 | 162 |
| 1649 | 3300025981 | Ga0207640_10038275 | Ga0207640_100382753 | 162 |
| 1650 | 3300025981 | Ga0207640_10128290 | Ga0207640_101282902 | 162 |
| 1651 | 3300025981 | Ga0207640_10266409 | Ga0207640_102664091 | 162 |
| 1652 | 3300025981 | Ga0207640_10700434 | Ga0207640_107004342 | 162 |
| 1653 | 3300025986 | Ga0207658_10026231 | Ga0207658_100262312 | 162 |
| 1654 | 3300025986 | Ga0207658_10570791 | Ga0207658_105707911 | 162 |
| 1655 | 3300025986 | Ga0207658_11113830 | Ga0207658_111138301 | 162 |
| 1656 | 3300026023 | Ga0207677_10123824 | Ga0207677_101238242 | 162 |
| 1657 | 3300026023 | Ga0207677_10626293 | Ga0207677_106262931 | 162 |
| 1658 | 3300026035 | Ga0207703_10073571 | Ga0207703_100735712 | 162 |
| 1659 | 3300026035 | Ga0207703_10284721 | Ga0207703_102847211 | 162 |
| 1660 | 3300026035 | Ga0207703_10294615 | Ga0207703_102946152 | 162 |
| 1661 | 3300026041 | Ga0207639_10184900 | Ga0207639_101849002 | 162 |
| 1662 | 3300026041 | Ga0207639_10258006 | Ga0207639_102580062 | 162 |
| 1663 | 3300026041 | Ga0207639_10486672 | Ga0207639_104866721 | 162 |
| 1664 | 3300026041 | Ga0207639_10657954 | Ga0207639_106579541 | 162 |
| 1665 | 3300026067 | Ga0207678_10035839 | Ga0207678_100358394 | 162 |
| 1666 | 3300026067 | Ga0207678_10121627 | Ga0207678_101216272 | 162 |
| 1667 | 3300026067 | Ga0207678_10132853 | Ga0207678_101328532 | 162 |
| 1668 | 3300026067 | Ga0207678_10401691 | Ga0207678_104016912 | 162 |
| 1669 | 3300026067 | Ga0207678_10761171 | Ga0207678_107611711 | 162 |
| 1670 | 3300026078 | Ga0207702_10000006 | Ga0207702_10000006159 | 162 |
| 1671 | 3300026078 | Ga0207702_10000688 | Ga0207702_1000068829 | 162 |
| 1672 | 3300026078 | Ga0207702_10053029 | Ga0207702_100530292 | 162 |
| 1673 | 3300026078 | Ga0207702_10880150 | Ga0207702_108801501 | 162 |
| 1674 | 3300026088 | Ga0207641_10181389 | Ga0207641_101813892 | 162 |
| 1675 | 3300026089 | Ga0207648_10105614 | Ga0207648_101056141 | 162 |
| 1676 | 3300026095 | Ga0207676_10469317 | Ga0207676_104693171 | 162 |
| 1677 | 3300026116 | Ga0207674_10011177 | Ga0207674_100111777 | 162 |
| 1678 | 3300026116 | Ga0207674_10119218 | Ga0207674_101192183 | 162 |
| 1679 | 3300026116 | Ga0207674_10289970 | Ga0207674_102899702 | 162 |
| 1680 | 3300026116 | Ga0207674_10552509 | Ga0207674_105525091 | 162 |
| 1681 | 3300026116 | Ga0207674_10697076 | Ga0207674_106970762 | 162 |
| 1682 | 3300026121 | Ga0207683_10015315 | Ga0207683_100153154 | 162 |
| 1683 | 3300026121 | Ga0207683_10103193 | Ga0207683_101031932 | 162 |
| 1684 | 3300026142 | Ga0207698_10042920 | Ga0207698_100429203 | 162 |
| 1685 | 3300026142 | Ga0207698_10116835 | Ga0207698_101168352 | 162 |
| 1686 | 3300026142 | Ga0207698_10416383 | Ga0207698_104163832 | 162 |
| 1687 | 3300026142 | Ga0207698_11168659 | Ga0207698_111686592 | 162 |
| 1688 | 3300027296 | Ga0209389_1000021 | Ga0209389_1000021109 | 162 |
| 1689 | 3300027296 | Ga0209389_1000120 | Ga0209389_100012010 | 162 |
| 1690 | 3300027357 | Ga0209589_1000027 | Ga0209589_100002793 | 162 |
| 1691 | 3300027361 | Ga0209489_100023 | Ga0209489_1000239 | 162 |
| 1692 | 3300027361 | Ga0209489_100742 | Ga0209489_10074254 | 162 |
| 1693 | 3300027363 | Ga0209700_100134 | Ga0209700_100134107 | 162 |
| 1694 | 3300027512 | Ga0209179_1008998 | Ga0209179_10089981 | 162 |
| 1695 | 3300027512 | Ga0209179_1038088 | Ga0209179_10380881 | 162 |
| 1696 | 3300027671 | Ga0209588_1013577 | Ga0209588_10135772 | 162 |
| 1697 | 3300027866 | Ga0209813_10022272 | Ga0209813_100222722 | 162 |
| 1698 | 3300028379 | Ga0268266_10121335 | Ga0268266_101213353 | 162 |
| 1699 | 3300028379 | Ga0268266_10212435 | Ga0268266_102124351 | 162 |
| 1700 | 3300028379 | Ga0268266_10290107 | Ga0268266_102901072 | 162 |
| 1701 | 3300028379 | Ga0268266_10437635 | Ga0268266_104376351 | 162 |
| 1702 | 3300028379 | Ga0268266_11013333 | Ga0268266_110133331 | 162 |
| 1703 | 3300028379 | Ga0268266_11230077 | Ga0268266_112300771 | 162 |
| 1704 | 3300028381 | Ga0268264_10072563 | Ga0268264_100725633 | 162 |
| 1705 | 3300028786 | Ga0307517_10000098 | Ga0307517_1000009895 | 162 |
| 1706 | 3300028794 | Ga0307515_10016400 | Ga0307515_100164009 | 162 |
| 1707 | 3300028794 | Ga0307515_10319246 | Ga0307515_103192462 | 162 |
| 1708 | 3300031235 | Ga0265330_10025088 | Ga0265330_100250883 | 162 |
| 1709 | 3300031235 | Ga0265330_10027675 | Ga0265330_100276752 | 162 |
| 1710 | 3300031235 | Ga0265330_10046914 | Ga0265330_100469143 | 162 |
| 1711 | 3300031235 | Ga0265330_10143046 | Ga0265330_101430462 | 162 |
| 1712 | 3300031238 | Ga0265332_10020705 | Ga0265332_100207053 | 162 |
| 1713 | 3300031239 | Ga0265328_10045647 | Ga0265328_100456471 | 162 |
| 1714 | 3300031241 | Ga0265325_10073023 | Ga0265325_100730232 | 162 |
| 1715 | 3300031242 | Ga0265329_10085283 | Ga0265329_100852832 | 162 |
| 1716 | 3300031247 | Ga0265340_10003780 | Ga0265340_100037804 | 162 |
| 1717 | 3300031249 | Ga0265339_10149432 | Ga0265339_101494321 | 162 |
| 1718 | 3300031344 | Ga0265316_10120267 | Ga0265316_101202672 | 162 |
| 1719 | 3300031507 | Ga0307509_10783763 | Ga0307509_107837631 | 162 |
| 1720 | 3300031595 | Ga0265313_10102201 | Ga0265313_101022011 | 162 |
| 1721 | 3300031616 | Ga0307508_10027398 | Ga0307508_100273985 | 162 |
| 1722 | 3300031616 | Ga0307508_10142818 | Ga0307508_101428181 | 162 |
| 1723 | 3300031616 | Ga0307508_10179015 | Ga0307508_101790152 | 162 |
| 1724 | 3300031711 | Ga0265314_10231505 | Ga0265314_102315052 | 162 |
| 1725 | 3300031712 | Ga0265342_10163286 | Ga0265342_101632861 | 162 |
| 1726 | 3300031730 | Ga0307516_10018054 | Ga0307516_100180545 | 162 |
| 1727 | 3300031730 | Ga0307516_10087197 | Ga0307516_100871973 | 162 |
| 1728 | 3300031730 | Ga0307516_10181324 | Ga0307516_101813243 | 162 |
| 1729 | 3300031730 | Ga0307516_10285423 | Ga0307516_102854231 | 162 |
| 1730 | 3300031852 | Ga0307410_11234063 | Ga0307410_112340631 | 162 |
| 1731 | 3300031901 | Ga0307406_11865368 | Ga0307406_118653681 | 162 |
| 1732 | 3300032004 | Ga0307414_10291570 | Ga0307414_102915702 | 162 |
| 1733 | 3300032126 | Ga0307415_100520667 | Ga0307415_1005206672 | 162 |
| 1734 | 3300033179 | Ga0307507_10361650 | Ga0307507_103616502 | 162 |
| 1735 | 3300033180 | Ga0307510_10047477 | Ga0307510_100474774 | 162 |
| 1736 | 3300033180 | Ga0307510_10061680 | Ga0307510_100616802 | 162 |
| 1737 | 3300033180 | Ga0307510_10325426 | Ga0307510_103254262 | 162 |
| 1738 | 3300035083 | Ga0373926_0018331 | Ga0373926_0018331_1104_1595 | 162 |
| 1739 | 3300035089 | Ga0373944_0014978 | Ga0373944_0014978_502_993 | 162 |
| 1740 | 3300035111 | Ga0373923_0025959 | Ga0373923_0025959_822_1313 | 162 |
| 1741 | 3300035112 | Ga0373932_0126544 | Ga0373932_0126544_306_794 | 162 |
| 1742 | 3300035116 | Ga0373945_0015097 | Ga0373945_0015097_14_505 | 162 |
| 1743 | 3300035121 | Ga0373960_0063909 | Ga0373960_0063909_370_858 | 162 |
| 1744 | 3300035170 | Ga0373943_0000806 | Ga0373943_0000806_6735_7226 | 162 |
| 1745 | 3300035171 | Ga0373946_0005160 | Ga0373946_0005160_929_1420 | 162 |
| 1746 | 3300035172 | Ga0373955_0061584 | Ga0373955_0061584_1371_1862 | 162 |
| 1747 | 3300035410 | Ga0373924_0041117 | Ga0373924_0041117_184_675 | 162 |
| 1748 | 3300035691 | Ga0373931_0051450 | Ga0373931_0051450_1678_2166 | 162 |
| 1749 | 3300035691 | Ga0373931_0219072 | Ga0373931_0219072_291_782 | 162 |
| 1750 | 3300035691 | Ga0373931_0337003 | Ga0373931_0337003_236_724 | 162 |
| 1751 | 3300035692 | Ga0373935_0012134 | Ga0373935_0012134_4034_4525 | 162 |
| 1752 | 3300035692 | Ga0373935_0361161 | Ga0373935_0361161_22_513 | 162 |
| 1753 | 3300035695 | Ga0373927_0000046 | Ga0373927_0000046_63153_63644 | 162 |
| 1754 | 3300035695 | Ga0373927_0283242 | Ga0373927_0283242_93_584 | 162 |
| 1755 | 3300035695 | Ga0373927_0443969 | Ga0373927_0443969_87_578 | 162 |
| 1756 | 3300035725 | Ga0373947_0003991 | Ga0373947_0003991_2451_2942 | 162 |
| 1757 | 3300036401 | Ga0373937_0011908 | Ga0373937_0011908_1289_1780 | 162 |
| 1758 | 3300037068 | Ga0373925_0011487 | Ga0373925_0011487_2459_2950 | 162 |
| 1759 | 3300037466 | Ga0395898_0151868 | Ga0395898_0151868_893_1384 | 162 |
| 1760 | 3300039437 | Ga0436365_0245742 | Ga0436365_0245742_302_793 | 162 |
| 1761 | 3300039437 | Ga0436365_0405335 | Ga0436365_0405335_63_560 | 162 |
| 1762 | 3300039437 | Ga0436365_0594053 | Ga0436365_0594053_102_590 | 162 |
| 1763 | 3300039437 | Ga0436365_0921625 | Ga0436365_0921625_17317_17805 | 162 |
| 1764 | 3300039450 | Ga0436363_0033464 | Ga0436363_0033464_140_628 | 162 |
| 1765 | 3300039450 | Ga0436363_0726793 | Ga0436363_0726793_602_1090 | 162 |
| 1766 | 3300039450 | Ga0436363_0767229 | Ga0436363_0767229_503_991 | 162 |
| 1767 | 3300039453 | Ga0436362_0629335 | Ga0436362_0629335_546_1034 | 162 |
| 1768 | 3300039453 | Ga0436362_1147499 | Ga0436362_1147499_57_545 | 162 |
| 1769 | 3300046454 | Ga0495592_0012178 | Ga0495592_0012178_4120_4611 | 162 |
| 1770 | 3300046455 | Ga0495603_0000051 | Ga0495603_0000051_26314_26805 | 162 |
| 1771 | 3300046455 | Ga0495603_0024048 | Ga0495603_0024048_1494_1982 | 162 |
| 1772 | 3300046455 | Ga0495603_0458406 | Ga0495603_0458406_96_587 | 162 |
| 1773 | 3300046459 | Ga0495629_0000182 | Ga0495629_0000182_54206_54697 | 162 |
| 1774 | 3300046460 | Ga0495638_0195596 | Ga0495638_0195596_52_546 | 162 |
| 1775 | 3300046461 | Ga0495641_0006669 | Ga0495641_0006669_6580_7071 | 162 |
| 1776 | 3300046472 | Ga0495580_0017526 | Ga0495580_0017526_185_676 | 162 |
| 1777 | 3300046473 | Ga0495582_0000025 | Ga0495582_0000025_3568_4059 | 162 |
| 1778 | 3300046475 | Ga0495639_0007403 | Ga0495639_0007403_784_1275 | 162 |
| 1779 | 3300046475 | Ga0495639_0077710 | Ga0495639_0077710_778_1266 | 162 |
| 1780 | 3300046476 | Ga0495662_0000583 | Ga0495662_0000583_10679_11170 | 162 |
| 1781 | 3300046477 | Ga0495664_0004145 | Ga0495664_0004145_2642_3133 | 162 |
| 1782 | 3300046491 | Ga0495584_0205217 | Ga0495584_0205217_498_992 | 162 |
| 1783 | 3300046499 | Ga0495594_0002799 | Ga0495594_0002799_8199_8690 | 162 |
| 1784 | 3300046499 | Ga0495594_0249305 | Ga0495594_0249305_318_809 | 162 |
| 1785 | 3300046499 | Ga0495594_0348315 | Ga0495594_0348315_159_647 | 162 |
| 1786 | 3300046501 | Ga0495607_0038824 | Ga0495607_0038824_1192_1686 | 162 |
| 1787 | 3300046506 | Ga0495583_0047989 | Ga0495583_0047989_593_1087 | 162 |
| 1788 | 3300046507 | Ga0495606_0001505 | Ga0495606_0001505_6142_6633 | 162 |
| 1789 | 3300046512 | Ga0495610_0127697 | Ga0495610_0127697_230_724 | 162 |
| 1790 | 3300046513 | Ga0495616_0054584 | Ga0495616_0054584_479_973 | 162 |
| 1791 | 3300046515 | Ga0495620_0067580 | Ga0495620_0067580_130_624 | 162 |
| 1792 | 3300046516 | Ga0495628_0025875 | Ga0495628_0025875_3358_3849 | 162 |
| 1793 | 3300046516 | Ga0495628_0281424 | Ga0495628_0281424_147_674 | 162 |
| 1794 | 3300046517 | Ga0495630_0034359 | Ga0495630_0034359_2175_2666 | 162 |
| 1795 | 3300046518 | Ga0495631_0033956 | Ga0495631_0033956_982_1476 | 162 |
| 1796 | 3300046519 | Ga0495632_0195446 | Ga0495632_0195446_193_687 | 162 |
| 1797 | 3300046519 | Ga0495632_0212873 | Ga0495632_0212873_62_550 | 162 |
| 1798 | 3300046520 | Ga0495637_0179522 | Ga0495637_0179522_64_558 | 162 |
| 1799 | 3300046522 | Ga0495643_0171789 | Ga0495643_0171789_211_705 | 162 |
| 1800 | 3300046522 | Ga0495643_0413887 | Ga0495643_0413887_23_517 | 162 |
| 1801 | 3300046524 | Ga0495648_0052870 | Ga0495648_0052870_1737_2231 | 162 |
| 1802 | 3300046530 | Ga0495654_0016687 | Ga0495654_0016687_2390_2884 | 162 |
| 1803 | 3300046531 | Ga0495665_0000195 | Ga0495665_0000195_25273_25764 | 162 |
| 1804 | 3300046533 | Ga0495640_0023048 | Ga0495640_0023048_497_988 | 162 |
| 1805 | 3300046535 | Ga0495586_0737604 | Ga0495586_0737604_42_533 | 162 |
| 1806 | 3300046538 | Ga0495609_0279273 | Ga0495609_0279273_82_570 | 162 |
| 1807 | 3300046542 | Ga0495597_0211011 | Ga0495597_0211011_38_532 | 162 |
| 1808 | 3300046557 | Ga0495622_0001733 | Ga0495622_0001733_3063_3554 | 162 |
| 1809 | 3300046557 | Ga0495622_0031540 | Ga0495622_0031540_1967_2461 | 162 |
| 1810 | 3300046558 | Ga0495633_0156673 | Ga0495633_0156673_392_886 | 162 |
| 1811 | 3300046559 | Ga0495667_0004219 | Ga0495667_0004219_8228_8719 | 162 |
| 1812 | 3300046616 | Ga0495668_0161016 | Ga0495668_0161016_258_752 | 162 |
| 1813 | 3300046642 | Ga0495634_0005743 | Ga0495634_0005743_4773_5264 | 162 |
| 1814 | 3300046648 | Ga0495611_0269718 | Ga0495611_0269718_136_627 | 162 |
| 1815 | 3300046648 | Ga0495611_0297521 | Ga0495611_0297521_56_550 | 162 |
| 1816 | 3300046660 | Ga0495625_0101947 | Ga0495625_0101947_1061_1555 | 162 |
| 1817 | 3300046660 | Ga0495625_0221036 | Ga0495625_0221036_427_918 | 162 |
| 1818 | 3300046660 | Ga0495625_0300109 | Ga0495625_0300109_51_542 | 162 |
| 1819 | 3300046663 | Ga0495635_0004315 | Ga0495635_0004315_1385_1876 | 162 |
| 1820 | 3300046665 | Ga0495661_0091077 | Ga0495661_0091077_983_1477 | 162 |
| 1821 | 3300046674 | Ga0495588_0002009 | Ga0495588_0002009_4801_5292 | 162 |
| 1822 | 3300046675 | Ga0495657_0054952 | Ga0495657_0054952_1452_1943 | 162 |
| 1823 | 3300046681 | Ga0495647_0002805 | Ga0495647_0002805_2706_3197 | 162 |
| 1824 | 3300046683 | Ga0495658_0002361 | Ga0495658_0002361_6571_7062 | 162 |
| 1825 | 3300046684 | Ga0495669_0366981 | Ga0495669_0366981_111_605 | 162 |
| 1826 | 3300046689 | Ga0495613_0006158 | Ga0495613_0006158_2614_3105 | 162 |
| 1827 | 3300046690 | Ga0495624_0000898 | Ga0495624_0000898_22639_23130 | 162 |
| 1828 | 3300046690 | Ga0495624_0483252 | Ga0495624_0483252_13_501 | 162 |
| 1829 | 3300046691 | Ga0495670_0015791 | Ga0495670_0015791_2452_2946 | 162 |
| 1830 | 3300046692 | Ga0495671_0256829 | Ga0495671_0256829_320_808 | 162 |
| 1831 | 3300046692 | Ga0495671_0417277 | Ga0495671_0417277_13_504 | 162 |
| 1832 | 3300046694 | Ga0495649_0385658 | Ga0495649_0385658_174_665 | 162 |
| 1833 | 3300046794 | Ga0495589_0259198 | Ga0495589_0259198_94_588 | 162 |
| 1834 | 3300046810 | Ga0495660_0053737 | Ga0495660_0053737_1127_1621 | 162 |
| 1835 | 3300047315 | Ga0495581_0000187 | Ga0495581_0000187_24752_25243 | 162 |
| 1836 | 3300047315 | Ga0495581_0034768 | Ga0495581_0034768_57_548 | 162 |
| 1837 | 3300047317 | Ga0495604_0455490 | Ga0495604_0455490_256_750 | 162 |
| 1838 | 3300047319 | Ga0495674_0003575 | Ga0495674_0003575_6535_7026 | 162 |
| 1839 | 3300047319 | Ga0495674_0079738 | Ga0495674_0079738_1415_1906 | 162 |
| 1840 | 3300047320 | Ga0495672_0155002 | Ga0495672_0155002_21_515 | 162 |
| 1841 | 3300047320 | Ga0495672_0201003 | Ga0495672_0201003_192_692 | 162 |
| 1842 | 3300047321 | Ga0495676_0013511 | Ga0495676_0013511_5091_5582 | 162 |
| 1843 | 3300047322 | Ga0495680_0909340 | Ga0495680_0909340_31_522 | 162 |
| 1844 | 3300047446 | Ga0495679_143817 | Ga0495679_143817_66_557 | 162 |
| 1845 | 3300047447 | Ga0495685_195857 | Ga0495685_195857_11_505 | 162 |
| 1846 | 3300047470 | Ga0495681_0274420 | Ga0495681_0274420_83_577 | 162 |
| 1847 | 3300047472 | Ga0495686_0049725 | Ga0495686_0049725_1460_1954 | 162 |
| 1848 | 3300047472 | Ga0495686_0180773 | Ga0495686_0180773_514_1005 | 162 |
| 1849 | 3300047673 | Ga0495593_0000469 | Ga0495593_0000469_6506_6997 | 162 |
| 1850 | 3300048089 | Ga0495614_0092802 | Ga0495614_0092802_316_807 | 162 |
| 1851 | 3300048089 | Ga0495614_0206171 | Ga0495614_0206171_325_816 | 162 |
| 1852 | 3300048903 | Ga0496100_0536630 | Ga0496100_0536630_160_651 | 162 |
| 1853 | 3300048909 | Ga0496106_0166558 | Ga0496106_0166558_308_802 | 162 |
| 1854 | 3300048910 | Ga0496107_0110036 | Ga0496107_0110036_735_1226 | 162 |
| 1855 | 3300048910 | Ga0496107_0656418 | Ga0496107_0656418_263_757 | 162 |
| 1856 | 3300048911 | Ga0496108_1190035 | Ga0496108_1190035_46_540 | 162 |
| 1857 | 3300048913 | Ga0496110_0283861 | Ga0496110_0283861_428_919 | 162 |
| 1858 | 3300048914 | Ga0496111_0251012 | Ga0496111_0251012_689_1180 | 162 |
| 1859 | 3300048915 | Ga0496112_0000040 | Ga0496112_0000040_71566_72060 | 162 |
| 1860 | 3300048915 | Ga0496112_0202992 | Ga0496112_0202992_566_1057 | 162 |
| 1861 | 3300048915 | Ga0496112_0667664 | Ga0496112_0667664_64_555 | 162 |
| 1862 | 3300048916 | Ga0496113_0539310 | Ga0496113_0539310_367_861 | 162 |
| 1863 | 3300048916 | Ga0496113_1163731 | Ga0496113_1163731_91_582 | 162 |
| 1864 | 3300048917 | Ga0496114_1186606 | Ga0496114_1186606_120_611 | 162 |
| 1865 | 3300048917 | Ga0496114_1308302 | Ga0496114_1308302_18_509 | 162 |
| 1866 | 3300048918 | Ga0496115_0042374 | Ga0496115_0042374_10_501 | 162 |
| 1867 | 3300048919 | Ga0496116_0004777 | Ga0496116_0004777_8276_8770 | 162 |
| 1868 | 3300048920 | Ga0496117_0111358 | Ga0496117_0111358_1003_1497 | 162 |
| 1869 | 3300048920 | Ga0496117_0536984 | Ga0496117_0536984_35_529 | 162 |
| 1870 | 3300048921 | Ga0496118_0040696 | Ga0496118_0040696_1881_2375 | 162 |
| 1871 | 3300048921 | Ga0496118_0216079 | Ga0496118_0216079_42_536 | 162 |
| 1872 | 3300048922 | Ga0496119_0082079 | Ga0496119_0082079_502_996 | 162 |
| 1873 | 3300048922 | Ga0496119_0092898 | Ga0496119_0092898_575_1069 | 162 |
| 1874 | 3300048922 | Ga0496119_0222786 | Ga0496119_0222786_279_773 | 162 |
| 1875 | 3300048923 | Ga0496120_0200703 | Ga0496120_0200703_415_909 | 162 |
| 1876 | 3300048924 | Ga0496121_0000265 | Ga0496121_0000265_63370_63861 | 162 |
| 1877 | 3300048924 | Ga0496121_0002837 | Ga0496121_0002837_23163_23657 | 162 |
| 1878 | 3300048924 | Ga0496121_0003837 | Ga0496121_0003837_11161_11652 | 162 |
| 1879 | 3300048924 | Ga0496121_0016535 | Ga0496121_0016535_4325_4819 | 162 |
| 1880 | 3300048924 | Ga0496121_0141250 | Ga0496121_0141250_55_552 | 162 |
| 1881 | 3300048924 | Ga0496121_0155050 | Ga0496121_0155050_1100_1597 | 162 |
| 1882 | 3300048924 | Ga0496121_0583948 | Ga0496121_0583948_65_556 | 162 |
| 1883 | 3300048925 | Ga0496122_0074814 | Ga0496122_0074814_1577_2074 | 162 |
| 1884 | 3300048925 | Ga0496122_0114191 | Ga0496122_0114191_806_1300 | 162 |
| 1885 | 3300048925 | Ga0496122_0193780 | Ga0496122_0193780_513_1004 | 162 |
| 1886 | 3300048927 | Ga0496124_0627200 | Ga0496124_0627200_178_672 | 162 |
| 1887 | 3300048928 | Ga0496125_0002054 | Ga0496125_0002054_19294_19788 | 162 |
| 1888 | 3300048928 | Ga0496125_0047446 | Ga0496125_0047446_191_685 | 162 |
| 1889 | 3300048929 | Ga0496126_0005480 | Ga0496126_0005480_6027_6518 | 162 |
| 1890 | 3300048929 | Ga0496126_0326786 | Ga0496126_0326786_629_1123 | 162 |
| 1891 | 3300048929 | Ga0496126_0350187 | Ga0496126_0350187_11_544 | 162 |
| 1892 | 3300048929 | Ga0496126_0354501 | Ga0496126_0354501_381_875 | 162 |
| 1893 | 3300048929 | Ga0496126_0419105 | Ga0496126_0419105_484_981 | 162 |
| 1894 | 3300048929 | Ga0496126_1064547 | Ga0496126_1064547_27_518 | 162 |
| 1895 | 3300049459 | Ga0495678_086058 | Ga0495678_086058_166_660 | 162 |
| 1896 | 3300049568 | Ga0501031_0005620 | Ga0501031_0005620_3213_3704 | 162 |
| 1897 | 3300049568 | Ga0501031_0037214 | Ga0501031_0037214_1908_2405 | 162 |
| 1898 | 3300049569 | Ga0501032_0001270 | Ga0501032_0001270_12829_13320 | 162 |
| 1899 | 3300049569 | Ga0501032_0004513 | Ga0501032_0004513_7381_7878 | 162 |
| 1900 | 3300049569 | Ga0501032_0600840 | Ga0501032_0600840_121_618 | 162 |
| 1901 | 3300049570 | Ga0501033_0000175 | Ga0501033_0000175_55020_55511 | 162 |
| 1902 | 3300049570 | Ga0501033_0015137 | Ga0501033_0015137_5187_5684 | 162 |
| 1903 | 3300049571 | Ga0501034_0000202 | Ga0501034_0000202_93308_93799 | 162 |
| 1904 | 3300049571 | Ga0501034_0047397 | Ga0501034_0047397_3044_3541 | 162 |
| 1905 | 3300049572 | Ga0501036_0000042 | Ga0501036_0000042_60224_60715 | 162 |
| 1906 | 3300049572 | Ga0501036_0022055 | Ga0501036_0022055_501_998 | 162 |
| 1907 | 3300049573 | Ga0501037_0000100 | Ga0501037_0000100_57060_57551 | 162 |
| 1908 | 3300049573 | Ga0501037_0034827 | Ga0501037_0034827_3093_3590 | 162 |
| 1909 | 3300049574 | Ga0501038_0000157 | Ga0501038_0000157_55005_55496 | 162 |
| 1910 | 3300049574 | Ga0501038_0004335 | Ga0501038_0004335_10409_10906 | 162 |
| 1911 | 3300049575 | Ga0501039_0000216 | Ga0501039_0000216_13074_13565 | 162 |
| 1912 | 3300049575 | Ga0501039_0069527 | Ga0501039_0069527_2113_2610 | 162 |
| 1913 | 3300049576 | Ga0501040_0009591 | Ga0501040_0009591_3808_4305 | 162 |
| 1914 | 3300049577 | Ga0501041_0383483 | Ga0501041_0383483_210_707 | 162 |
| 1915 | 3300049578 | Ga0501042_0008128 | Ga0501042_0008128_3637_4128 | 162 |
| 1916 | 3300049578 | Ga0501042_0019198 | Ga0501042_0019198_2339_2836 | 162 |
| 1917 | 3300049579 | Ga0501043_0004658 | Ga0501043_0004658_2674_3165 | 162 |
| 1918 | 3300049579 | Ga0501043_0073021 | Ga0501043_0073021_770_1267 | 162 |
| 1919 | 3300049580 | Ga0501046_0011426 | Ga0501046_0011426_3490_3987 | 162 |
| 1920 | 3300049580 | Ga0501046_0022043 | Ga0501046_0022043_2340_2831 | 162 |
| 1921 | 3300049581 | Ga0501047_0000159 | Ga0501047_0000159_21113_21604 | 162 |
| 1922 | 3300049581 | Ga0501047_0006707 | Ga0501047_0006707_373_870 | 162 |
| 1923 | 3300049582 | Ga0501048_0005267 | Ga0501048_0005267_842_1339 | 162 |
| 1924 | 3300049582 | Ga0501048_0010436 | Ga0501048_0010436_2523_3014 | 162 |
| 1925 | 3300049583 | Ga0501067_0002974 | Ga0501067_0002974_3700_4191 | 162 |
| 1926 | 3300049583 | Ga0501067_0017732 | Ga0501067_0017732_3411_3899 | 162 |
| 1927 | 3300049583 | Ga0501067_0035174 | Ga0501067_0035174_2077_2574 | 162 |
| 1928 | 3300049584 | Ga0501068_0000168 | Ga0501068_0000168_4206_4697 | 162 |
| 1929 | 3300049584 | Ga0501068_0010825 | Ga0501068_0010825_4620_5117 | 162 |
| 1930 | 3300049585 | Ga0501069_0011906 | Ga0501069_0011906_4012_4503 | 162 |
| 1931 | 3300049585 | Ga0501069_0039165 | Ga0501069_0039165_803_1300 | 162 |
| 1932 | 3300049586 | Ga0501070_0016415 | Ga0501070_0016415_2944_3435 | 162 |
| 1933 | 3300049586 | Ga0501070_0089095 | Ga0501070_0089095_1840_2337 | 162 |
| 1934 | 3300049587 | Ga0501071_0039988 | Ga0501071_0039988_754_1251 | 162 |
| 1935 | 3300049587 | Ga0501071_0052969 | Ga0501071_0052969_2229_2720 | 162 |
| 1936 | 3300049587 | Ga0501071_0335709 | Ga0501071_0335709_461_949 | 162 |
| 1937 | 3300049588 | Ga0501072_0000475 | Ga0501072_0000475_14090_14581 | 162 |
| 1938 | 3300049588 | Ga0501072_0025195 | Ga0501072_0025195_649_1146 | 162 |
| 1939 | 3300049589 | Ga0501073_0000678 | Ga0501073_0000678_4263_4754 | 162 |
| 1940 | 3300049589 | Ga0501073_0029036 | Ga0501073_0029036_89_586 | 162 |
| 1941 | 3300049590 | Ga0501074_0000117 | Ga0501074_0000117_4884_5375 | 162 |
| 1942 | 3300049590 | Ga0501074_0001904 | Ga0501074_0001904_12068_12565 | 162 |
| 1943 | 3300049592 | Ga0501076_0030457 | Ga0501076_0030457_58_555 | 162 |
| 1944 | 3300049592 | Ga0501076_0126661 | Ga0501076_0126661_641_1132 | 162 |
| 1945 | 3300049593 | Ga0501077_0100262 | Ga0501077_0100262_549_1046 | 162 |
| 1946 | 3300049741 | Ga0501079_0009895 | Ga0501079_0009895_2533_3024 | 162 |
| 1947 | 3300049741 | Ga0501079_0205176 | Ga0501079_0205176_912_1409 | 162 |
| 1948 | 3300049742 | Ga0501080_0004449 | Ga0501080_0004449_10288_10779 | 162 |
| 1949 | 3300049742 | Ga0501080_0015418 | Ga0501080_0015418_1955_2452 | 162 |
| 1950 | 3300049743 | Ga0501081_0156336 | Ga0501081_0156336_1024_1521 | 162 |
| 1951 | 3300049744 | Ga0501083_0004228 | Ga0501083_0004228_9497_9988 | 162 |
| 1952 | 3300049744 | Ga0501083_0049179 | Ga0501083_0049179_1846_2343 | 162 |
| 1953 | 3300049822 | Ga0501035_0000172 | Ga0501035_0000172_23536_24027 | 162 |
| 1954 | 3300049822 | Ga0501035_0320325 | Ga0501035_0320325_697_1194 | 162 |
| 1955 | 3300049822 | Ga0501035_0397773 | Ga0501035_0397773_277_774 | 162 |
| 1956 | 3300049823 | Ga0501044_0000282 | Ga0501044_0000282_46431_46922 | 162 |
| 1957 | 3300049823 | Ga0501044_0359332 | Ga0501044_0359332_550_1047 | 162 |
| 1958 | 3300049824 | Ga0501045_0030903 | Ga0501045_0030903_1909_2406 | 162 |
| 1959 | 3300049824 | Ga0501045_0275163 | Ga0501045_0275163_453_944 | 162 |
| 1960 | 3300049824 | Ga0501045_0544144 | Ga0501045_0544144_317_805 | 162 |
| 1961 | 3300050491 | nmdc:mga00v17_105861_c1 | nmdc:mga00v17_105861_c1_351_845 | 162 |
| 1962 | 3300050492 | nmdc:mga0yw44_175931_c1 | nmdc:mga0yw44_175931_c1_696_1187 | 162 |
| 1963 | 3300050492 | nmdc:mga0yw44_24529_c1 | nmdc:mga0yw44_24529_c1_875_1369 | 162 |
| 1964 | 3300050512 | nmdc:mga0n895_113627_c1 | nmdc:mga0n895_113627_c1_1787_2275 | 162 |
| 1965 | 3300050512 | nmdc:mga0n895_728338_c1 | nmdc:mga0n895_728338_c1_169_660 | 162 |
| 1966 | 3300050516 | nmdc:mga0sz30_159126_c1 | nmdc:mga0sz30_159126_c1_11_505 | 162 |
| 1967 | 3300050516 | nmdc:mga0sz30_1763_c1 | nmdc:mga0sz30_1763_c1_5523_6017 | 162 |
| 1968 | 3300053080 | Ga0500635_0024895 | Ga0500635_0024895_93_584 | 162 |
| 1969 | 3300053084 | Ga0495595_0389504 | Ga0495595_0389504_121_612 | 162 |
| 1970 | 3300053085 | Ga0495619_0305695 | Ga0495619_0305695_249_740 | 162 |
| 1971 | 3300053087 | Ga0500643_039291 | Ga0500643_039291_458_952 | 162 |
| 1972 | 3300053088 | Ga0500644_0011683 | Ga0500644_0011683_389_883 | 162 |
| 1973 | 3300053088 | Ga0500644_0374348 | Ga0500644_0374348_79_570 | 162 |
| 1974 | 3300053090 | Ga0500646_0084705 | Ga0500646_0084705_156_650 | 162 |
| 1975 | 3300053093 | Ga0500651_0001377 | Ga0500651_0001377_1523_2017 | 162 |
| 1976 | 3300053094 | Ga0500566_0002104 | Ga0500566_0002104_3902_4396 | 162 |
| 1977 | 3300053096 | Ga0500641_0038330 | Ga0500641_0038330_974_1468 | 162 |
| 1978 | 3300053098 | Ga0500650_0016352 | Ga0500650_0016352_1325_1819 | 162 |
| 1979 | 3300053104 | Ga0500556_0000195 | Ga0500556_0000195_22768_23262 | 162 |
| 1980 | 3300053105 | Ga0500557_031893 | Ga0500557_031893_458_952 | 162 |
| 1981 | 3300053108 | Ga0500562_095183 | Ga0500562_095183_180_674 | 162 |
| 1982 | 3300053109 | Ga0500569_153803 | Ga0500569_153803_212_706 | 162 |
| 1983 | 3300053116 | Ga0500592_000692 | Ga0500592_000692_4088_4582 | 162 |
| 1984 | 3300053117 | Ga0500593_193951 | Ga0500593_193951_48_542 | 162 |
| 1985 | 3300053118 | Ga0500594_0027401 | Ga0500594_0027401_527_1021 | 162 |
| 1986 | 3300053118 | Ga0500594_0053663 | Ga0500594_0053663_417_911 | 162 |
| 1987 | 3300053119 | Ga0500595_003662 | Ga0500595_003662_519_1013 | 162 |
| 1988 | 3300053119 | Ga0500595_005876 | Ga0500595_005876_2351_2842 | 162 |
| 1989 | 3300053121 | Ga0500607_139392 | Ga0500607_139392_472_966 | 162 |
| 1990 | 3300053125 | Ga0500618_008174 | Ga0500618_008174_2126_2620 | 162 |
| 1991 | 3300053125 | Ga0500618_046364 | Ga0500618_046364_421_918 | 162 |
| 1992 | 3300053130 | Ga0500642_0000012 | Ga0500642_0000012_22795_23289 | 162 |
| 1993 | 3300053130 | Ga0500642_0004650 | Ga0500642_0004650_3756_4250 | 162 |
| 1994 | 3300053131 | Ga0500652_000146 | Ga0500652_000146_23165_23659 | 162 |
| 1995 | 3300053136 | Ga0500559_0005374 | Ga0500559_0005374_5252_5746 | 162 |
| 1996 | 3300053136 | Ga0500559_0475973 | Ga0500559_0475973_51_548 | 162 |
| 1997 | 3300053138 | Ga0500564_127084 | Ga0500564_127084_209_703 | 162 |
| 1998 | 3300053139 | Ga0500568_0002038 | Ga0500568_0002038_8418_8912 | 162 |
| 1999 | 3300053139 | Ga0500568_0008058 | Ga0500568_0008058_274_768 | 162 |
| 2000 | 3300053142 | Ga0500577_0001485 | Ga0500577_0001485_3672_4172 | 162 |
| 2001 | 3300053142 | Ga0500577_0040634 | Ga0500577_0040634_235_729 | 162 |
| 2002 | 3300053145 | Ga0500586_004216 | Ga0500586_004216_482_976 | 162 |
| 2003 | 3300053148 | Ga0500590_064864 | Ga0500590_064864_901_1395 | 162 |
| 2004 | 3300053150 | Ga0500603_004752 | Ga0500603_004752_648_1139 | 162 |
| 2005 | 3300053151 | Ga0500604_0043149 | Ga0500604_0043149_857_1351 | 162 |
| 2006 | 3300053153 | Ga0500616_0000046 | Ga0500616_0000046_296888_297379 | 162 |
| 2007 | 3300053153 | Ga0500616_0001093 | Ga0500616_0001093_10975_11469 | 162 |
| 2008 | 3300053156 | Ga0500622_0137669 | Ga0500622_0137669_269_763 | 162 |
| 2009 | 3300053160 | Ga0500633_0022339 | Ga0500633_0022339_443_937 | 162 |
| 2010 | 3300053177 | Ga0500636_0019749 | Ga0500636_0019749_199_693 | 162 |
| 2011 | 3300053178 | Ga0500637_0029315 | Ga0500637_0029315_22_516 | 162 |
| 2012 | 3300053727 | Ga0500611_079236 | Ga0500611_079236_222_716 | 162 |
| 2013 | 3300053730 | Ga0500645_031444 | Ga0500645_031444_752_1246 | 162 |
| 2014 | 3300053730 | Ga0500645_033030 | Ga0500645_033030_539_1033 | 162 |
| 2015 | 3300054114 | Ga0501084_0002863 | Ga0501084_0002863_8242_8733 | 162 |
| 2016 | 3300054114 | Ga0501084_0032538 | Ga0501084_0032538_1959_2456 | 162 |
| 2017 | 3300059491 | Ga0587070_114810 | Ga0587070_114810_48_536 | 162 |
| 2018 | 3300059492 | Ga0587073_0192516 | Ga0587073_0192516_17_508 | 162 |
| 2019 | 3300059493 | Ga0587077_134966 | Ga0587077_134966_39_530 | 162 |
| 2020 | 3300059493 | Ga0587077_142152 | Ga0587077_142152_110_598 | 162 |
| 2021 | 3300059503 | Ga0587080_047642 | Ga0587080_047642_18_506 | 162 |
| 2022 | 3300059505 | Ga0587083_0077395 | Ga0587083_0077395_102_590 | 162 |
| 2023 | 3300059506 | Ga0587085_092389 | Ga0587085_092389_111_599 | 162 |
| 2024 | 3300059506 | Ga0587085_096377 | Ga0587085_096377_108_596 | 162 |
| 2025 | 3300059508 | Ga0587088_103635 | Ga0587088_103635_118_606 | 162 |
| 2026 | 3300059508 | Ga0587088_110329 | Ga0587088_110329_23_511 | 162 |
| 2027 | 3300059639 | Ga0587062_042191 | Ga0587062_042191_238_726 | 162 |
| 2028 | 3300059641 | Ga0587068_088907 | Ga0587068_088907_17_505 | 162 |
| 2029 | 3300059642 | Ga0587069_066389 | Ga0587069_066389_17_508 | 162 |
| 2030 | 3300059652 | Ga0587107_051245 | Ga0587107_051245_18_506 | 162 |
| 2031 | 3300060344 | Ga0587071_072381 | Ga0587071_072381_100_588 | 162 |
| 2032 | 3300060346 | Ga0587111_0093287 | Ga0587111_0093287_119_607 | 162 |
| 2033 | 3300060353 | Ga0501082_0024686 | Ga0501082_0024686_1126_1623 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u1h-assembly3.cif.gz_C | crystal structure of the c-terminal peptidoglycan binding domain of oprf (pa1777) from pseudomonas aeruginosa | 0.8917 | 56 | 140 |
| 6u83-assembly1.cif.gz_A | ompa-like domain of fopa1 from francisella tularensis subsp. tularensis schu s4 | 0.8715 | 56 | 140 |
| 4g88-assembly4.cif.gz_G | crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii | 0.864 | 56 | 140 |
| 5wtp-assembly2.cif.gz_B | crystal structure of the c-terminal domain of outer membrane protein a (ompa) from capnocytophaga gingivalis | 0.8511 | 56 | 140 |
| 5wtl-assembly4.cif.gz_D | crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis | 0.8507 | 56 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u1hB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.9047 | 56 | 140 | 3.30.1330.60 |
| 3td4B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8685 | 56 | 140 | 3.30.1330.60 |
| 3oonA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8612 | 56 | 136 | 3.30.1330.60 |
| 5wtpB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8511 | 56 | 140 | 3.30.1330.60 |
| af_P0A910_199_343_3.30.1330.60 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8501 | 56 | 139 | 3.30.1330.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7P2D3-F1-model_v4 | deleted | 0.9845 | 40 | 120 |
|
| AF-A0A4Q3YQX1-F1-model_v4 | OmpA family protein | 0.983 | 41 | 124 |
GO:0009279
|
| AF-A0A350YPD8-F1-model_v4 | OmpA-like domain-containing protein | 0.9694 | 56 | 136 |
GO:0009279
|
| AF-A0A848XK22-F1-model_v4 | OmpA family protein | 0.9686 | 56 | 131 |
GO:0009279
|
| AF-A0A6L9YMP8-F1-model_v4 | OmpA family protein | 0.9684 | 56 | 133 |
GO:0009279
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar