F496291

General Info

Members Datasets Scaffolds Average Seq Length
2033 848 1819 161

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0054880|Ga0530510_0054880_2205_2765
Length 167
Sequence MPSIARILSIASAALLVSACAANPKSAKGGTDVIDGAAVPTAPAETCALVRVAFAFDSAQLDEDAMRHLRENAECLKRRGATSLLVEGHCDERGTTEYNIALGARRAEAVKQYFLALGVGASIDSVSFGKEIPVATGSSDGAWAQNRRAELRLPGDKRSDGRLVAGR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355199
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
49 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
50 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
51 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
52 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
55 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
56 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
63 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
67 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
102 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
103 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
104 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
105 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
106 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
107 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
108 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
109 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
110 2922368715
111 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
112 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
113 2922425934
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
124 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
125 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
126 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
129 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
130 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
131 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
132 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
133 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
134 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
135 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
136 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
137 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
147 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
148 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
149 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
150 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
151 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
152 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
153 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
154 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
155 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
156 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
157 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
158 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
159 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
160 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
161 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
162 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
163 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
164 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
165 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
166 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
167 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
168 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
169 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
170 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
171 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
172 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
173 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
174 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
175 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
176 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
177 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
178 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
179 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
180 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
181 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
182 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
183 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
184 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
185 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
188 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
189 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
190 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
191 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
192 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
193 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
194 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
195 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
196 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
197 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
199 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
200 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
201 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
202 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
203 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
204 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
205 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
206 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
207 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
208 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
209 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
210 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
211 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
212 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
213 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
214 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
215 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
216 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
217 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
218 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
219 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
220 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
221 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
222 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
223 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
224 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
225 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
226 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
227 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
228 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
229 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
230 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
231 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
232 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
233 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
234 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
235 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
236 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
237 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
238 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
239 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
240 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
241 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
242 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
243 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
244 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
245 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
246 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
247 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
248 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
249 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
250 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
251 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
252 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
253 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
254 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
255 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
256 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
257 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
258 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
259 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
260 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
261 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
262 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
263 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
264 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
265 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
266 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
267 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
268 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
269 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
270 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
271 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
272 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
273 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
274 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
275 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
276 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
277 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
278 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
279 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
280 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
281 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
283 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
284 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
285 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
286 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
287 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
288 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
289 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
290 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
291 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
292 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
293 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
294 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
295 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
296 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
297 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
298 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
299 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
300 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
301 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
302 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
303 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
304 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
308 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
309 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
310 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
311 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
312 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
313 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
314 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
315 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
316 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
317 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
318 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
319 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
320 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
321 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
322 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
323 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
324 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
325 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
326 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
327 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
328 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
329 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
330 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
331 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
332 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
333 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
334 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
335 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
340 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
341 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
342 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
343 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
344 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
345 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
346 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
347 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
348 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
349 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
350 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
351 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
354 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
356 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
359 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
363 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
365 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
431 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
432 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
433 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
434 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
437 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
438 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
442 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
443 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
444 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
445 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
446 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
447 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
451 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
452 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
453 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
454 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
455 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
456 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
457 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
458 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
459 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
460 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
461 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
462 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
463 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
464 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
465 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
466 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
467 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
468 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
469 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
470 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
471 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
472 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
473 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
474 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
475 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
476 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
477 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
478 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
479 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
480 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
481 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
482 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
483 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
484 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
485 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
486 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
487 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
488 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
489 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
490 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
491 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
492 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
493 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
494 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
495 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
496 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
497 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
498 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
499 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
500 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
501 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
502 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
503 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
504 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
505 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
506 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
507 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
508 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
509 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
510 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
511 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
512 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
513 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
514 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
515 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
516 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
517 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
518 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
519 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
520 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
521 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
522 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
523 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
524 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
525 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
526 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
527 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
528 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
529 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
530 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
531 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
532 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
533 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
534 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
535 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
536 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
537 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
538 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
539 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
540 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
541 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
542 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
543 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
544 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
545 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
546 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
547 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
548 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
549 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
550 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
551 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
552 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
553 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
554 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
555 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
556 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
557 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
558 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
559 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
560 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
561 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
562 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
563 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
564 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
565 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
566 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
567 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
568 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
569 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
570 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
571 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
572 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
573 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
574 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
575 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
576 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
577 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
578 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
579 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
580 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
581 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
582 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
583 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
584 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
585 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
586 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
587 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
588 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
589 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
590 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
591 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
592 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
593 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
594 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
595 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
596 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
597 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
598 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
599 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
600 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
601 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
602 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
603 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
604 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
605 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
606 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
607 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
608 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
609 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
610 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
611 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
612 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
613 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
614 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
615 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
616 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
617 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
618 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
619 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
620 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
621 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
622 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
623 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
624 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
625 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
626 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
627 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
628 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
629 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
630 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
631 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
632 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
633 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
634 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
635 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
636 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
637 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
638 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
639 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
640 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
641 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
642 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
643 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
644 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
645 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
646 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
647 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
648 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
649 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
650 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
651 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
652 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
653 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
654 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
655 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
656 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
657 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
658 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
659 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
660 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
661 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
662 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
663 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
664 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
665 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
666 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
667 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
668 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
669 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
670 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
671 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
672 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
673 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
674 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
675 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
676 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
677 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
678 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
679 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
680 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
681 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
683 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
684 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
685 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
686 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
687 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
688 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
689 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
691 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
692 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
693 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
694 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
695 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
696 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
697 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
698 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
699 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
700 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
701 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
702 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
703 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
704 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
705 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
706 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
707 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
708 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
709 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
710 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
711 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
712 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
713 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
714 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
715 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
716 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
717 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
718 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
719 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
720 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
721 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
722 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
723 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
724 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
725 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
726 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
727 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
728 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
729 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
730 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
731 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
732 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
733 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
734 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
735 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
736 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
737 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
738 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
739 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
740 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
741 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
742 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
743 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
744 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
745 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
746 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
747 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
748 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
749 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
750 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
751 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
752 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
753 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
754 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
755 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
756 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
757 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
758 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
759 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
760 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
761 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
762 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
763 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
764 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
765 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
766 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
767 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
768 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
769 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
770 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
771 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
772 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
773 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
774 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
775 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
776 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
777 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
778 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
779 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
780 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
781 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
782 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
783 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
784 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
785 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
786 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
787 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
788 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
789 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
808 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
809 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
810 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
811 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
812 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
813 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
814 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
815 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
816 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
817 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
818 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
819 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
820 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
821 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
822 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
823 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
824 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
825 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
826 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
827 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
828 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
829 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
830 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
831 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
832 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
833 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
834 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
835 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
836 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
837 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
838 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
839 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
840 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
841 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
842 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
843 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
844 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
845 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
846 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
847 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
848 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.19
Metatranscriptomes 2.46
Isolates 10.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 8.02
Rhizoplane 6.05
Rhizosphere 65.72
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1016355 3300001904 Bacteria 1182
2 JGI24752J21851_1027888 3300001976 Bacteria 742
3 JGI24740J21852_10051938 3300001979 Bacteria 1170
4 JGI24739J22299_10057219 3300001989 Bacteria 1241
5 JGI24737J22298_10041998 3300001990 Bacteria 1402
6 JGI24743J22301_10022260 3300001991 Bacteria 1214
7 JGI24735J21928_10062795 3300002067 Bacteria 1066
8 JGI24738J21930_10138678 3300002075 Bacteria 536
9 JGI24744J21845_10070339 3300002077 Bacteria 639
10 JGI24742J22300_10051161 3300002244 Bacteria 748
11 JGI25406J46586_10007497 3300003203 Bacteria 4977
12 JGI25406J46586_10038536 3300003203 Bacteria 1712
13 JGI25153J46596_10002652 3300003215 Bacteria 10226
14 JGI25153J46596_10012145 3300003215 Bacteria 3744
15 JGI25153J46596_10013197 3300003215 Bacteria 3510
16 JGI25153J46596_10047815 3300003215 Bacteria 1255
17 Ga0006777J48905_1033878 3300003308 Bacteria 545
18 JGI25160J50197_1000801 3300003354 Bacteria 16953
19 Ga0007410J51695_1046046 3300003574 Bacteria 629
20 JGI25404J52841_10001685 3300003659 Bacteria 3973
21 JGI25404J52841_10005572 3300003659 Bacteria 2602
22 JGI25404J52841_10007750 3300003659 Bacteria 2276
23 JGI25404J52841_10009204 3300003659 Bacteria 2110
24 Ga0055539_1010616 3300003752 Bacteria 1140
25 Ga0055526_1030287 3300003771 Bacteria 1583
26 Ga0055526_1070283 3300003771 Bacteria 712
27 Ga0055524_1019793 3300003775 Bacteria 2288
28 Ga0055531_10002406 3300003794 Bacteria 12566
29 JGI25405J52794_10003478 3300003911 Bacteria 2763
30 JGI25405J52794_10042128 3300003911 Bacteria 967
31 Ga0058860_12155477 3300004801 Bacteria 606
32 Ga0058862_10098549 3300004803 Bacteria 555
33 Ga0065165_1010861 3300005262 Bacteria 3877
34 Ga0065165_1084460 3300005262 Bacteria 818
35 Ga0065165_1124716 3300005262 Bacteria 621
36 Ga0065712_10342346 3300005290 Bacteria 799
37 Ga0065707_10323728 3300005295 Bacteria 960
38 Ga0070658_10058031 3300005327 Bacteria 3149
39 Ga0070658_10204382 3300005327 Bacteria 1667
40 Ga0070658_10250102 3300005327 Bacteria 1504
41 Ga0070676_10488034 3300005328 Bacteria 872
42 Ga0070683_100130474 3300005329 Bacteria 2378
43 Ga0070683_100229107 3300005329 Bacteria 1766
44 Ga0070683_100358105 3300005329 Bacteria 1390
45 Ga0070683_100879377 3300005329 Bacteria 859
46 Ga0070683_101800119 3300005329 Bacteria 589
47 Ga0070690_100228645 3300005330 Bacteria 1307
48 Ga0070670_100197497 3300005331 Bacteria 1748
49 Ga0070670_100202840 3300005331 Bacteria 1723
50 Ga0070670_101826782 3300005331 Bacteria 560
51 Ga0068869_100027419 3300005334 Bacteria 3971
52 Ga0068869_100455881 3300005334 Bacteria 1061
53 Ga0068869_100575987 3300005334 Bacteria 948
54 Ga0070666_10046350 3300005335 Bacteria 2915
55 Ga0070680_100025590 3300005336 Bacteria 4717
56 Ga0070680_100026931 3300005336 Bacteria 4601
57 Ga0070680_100098059 3300005336 Bacteria 2430
58 Ga0070682_100310424 3300005337 Bacteria 1161
59 Ga0070682_100563447 3300005337 Bacteria 893
60 Ga0070682_101518708 3300005337 Bacteria 576
61 Ga0068868_100026005 3300005338 Bacteria 4457
62 Ga0068868_100295349 3300005338 Bacteria 1375
63 Ga0070660_100007638 3300005339 Bacteria 7536
64 Ga0070660_100321361 3300005339 Bacteria 1271
65 Ga0070660_100451376 3300005339 Bacteria 1067
66 Ga0070660_101633481 3300005339 Bacteria 548
67 Ga0070689_100089135 3300005340 Bacteria 2429
68 Ga0070691_10050182 3300005341 Bacteria 1990
69 Ga0070687_100178221 3300005343 Bacteria 1271
70 Ga0070661_100075696 3300005344 Bacteria 2480
71 Ga0070661_100094549 3300005344 Bacteria 2215
72 Ga0070668_100024092 3300005347 Bacteria 4609
73 Ga0070668_100028776 3300005347 Bacteria 4216
74 Ga0070668_100408476 3300005347 Bacteria 1161
75 Ga0070668_100481582 3300005347 Bacteria 1072
76 Ga0070669_100414435 3300005353 Bacteria 1104
77 Ga0070675_100418602 3300005354 Bacteria 1198
78 Ga0070671_100011405 3300005355 Bacteria 7146
79 Ga0070671_100038562 3300005355 Bacteria 3965
80 Ga0070674_100440283 3300005356 Bacteria 1073
81 Ga0070674_100690527 3300005356 Bacteria 871
82 Ga0070688_100377884 3300005365 Bacteria 1044
83 Ga0070688_100519886 3300005365 Bacteria 900
84 Ga0070659_100025503 3300005366 Bacteria 4541
85 Ga0070659_100226056 3300005366 Bacteria 1546
86 Ga0070667_100032367 3300005367 Bacteria 4361
87 Ga0070667_100035551 3300005367 Bacteria 4174
88 Ga0070667_100530762 3300005367 Bacteria 1080
89 Ga0070703_10065908 3300005406 Bacteria 1197
90 Ga0070709_10001487 3300005434 Bacteria 12659
91 Ga0070709_10005197 3300005434 Bacteria 7039
92 Ga0070709_10512808 3300005434 Bacteria 912
93 Ga0070714_100008988 3300005435 Bacteria 7823
94 Ga0070714_100015426 3300005435 Bacteria 6149
95 Ga0070714_100064213 3300005435 Bacteria 3159
96 Ga0070714_100286854 3300005435 Bacteria 1531
97 Ga0070714_100336897 3300005435 Bacteria 1414
98 Ga0070714_101703807 3300005435 Bacteria 616
99 Ga0070713_100007532 3300005436 Bacteria 7649
100 Ga0070713_100012854 3300005436 Bacteria 6158
101 Ga0070713_100030133 3300005436 Bacteria 4305
102 Ga0070710_10001558 3300005437 Bacteria 10845
103 Ga0070710_10015094 3300005437 Bacteria 3901
104 Ga0070710_10089854 3300005437 Bacteria 1810
105 Ga0070701_10211593 3300005438 Bacteria 1151
106 Ga0070711_100003888 3300005439 Bacteria 8772
107 Ga0070711_100004290 3300005439 Bacteria 8392
108 Ga0070711_100011060 3300005439 Bacteria 5598
109 Ga0070711_100054430 3300005439 Bacteria 2761
110 Ga0070711_100492219 3300005439 Bacteria 1010
111 Ga0070711_100520735 3300005439 Bacteria 983
112 Ga0070708_100566755 3300005445 Bacteria 1071
113 Ga0070708_100999514 3300005445 Bacteria 784
114 Ga0070663_100023617 3300005455 Bacteria 4123
115 Ga0070663_100063772 3300005455 Bacteria 2662
116 Ga0070663_100096273 3300005455 Bacteria 2201
117 Ga0070663_100165493 3300005455 Bacteria 1705
118 Ga0070663_100169739 3300005455 Bacteria 1685
119 Ga0070663_100222670 3300005455 Bacteria 1482
120 Ga0070663_100283222 3300005455 Bacteria 1321
121 Ga0070678_100021041 3300005456 Bacteria 4292
122 Ga0070678_100153379 3300005456 Bacteria 1858
123 Ga0070678_100212714 3300005456 Bacteria 1603
124 Ga0070678_100687392 3300005456 Bacteria 921
125 Ga0070662_100035970 3300005457 Bacteria 3500
126 Ga0070662_100352249 3300005457 Bacteria 1206
127 Ga0070681_10066584 3300005458 Bacteria 3571
128 Ga0070681_10705787 3300005458 Bacteria 924
129 Ga0068867_100049036 3300005459 Bacteria 3108
130 Ga0068867_100416018 3300005459 Bacteria 1138
131 Ga0068867_100616004 3300005459 Bacteria 948
132 Ga0070685_10899823 3300005466 Bacteria 659
133 Ga0070679_100010119 3300005530 Bacteria 8939
134 Ga0070679_100032426 3300005530 Bacteria 5167
135 Ga0070679_100038144 3300005530 Bacteria 4776
136 Ga0070679_100341553 3300005530 Bacteria 1445
137 Ga0070679_100378215 3300005530 Bacteria 1363
138 Ga0070679_100472346 3300005530 Bacteria 1198
139 Ga0070684_100007774 3300005535 Bacteria 8357
140 Ga0070684_100217994 3300005535 Bacteria 1741
141 Ga0070684_100328492 3300005535 Bacteria 1405
142 Ga0070697_100341878 3300005536 Bacteria 1291
143 Ga0068853_100084746 3300005539 Bacteria 2777
144 Ga0068853_100262986 3300005539 Bacteria 1587
145 Ga0068853_100404833 3300005539 Bacteria 1278
146 Ga0068853_100784911 3300005539 Bacteria 911
147 Ga0068853_100814497 3300005539 Bacteria 894
148 Ga0068853_101272831 3300005539 Bacteria 711
149 Ga0070672_100249900 3300005543 Bacteria 1493
150 Ga0070695_100049535 3300005545 Bacteria 2690
151 Ga0070696_100314910 3300005546 Bacteria 1202
152 Ga0070693_100178160 3300005547 Bacteria 1367
153 Ga0070693_100211510 3300005547 Bacteria 1265
154 Ga0070693_100410130 3300005547 Bacteria 942
155 Ga0070693_100675471 3300005547 Bacteria 754
156 Ga0070665_100055417 3300005548 Bacteria 3976
157 Ga0070665_100212627 3300005548 Bacteria 1935
158 Ga0070665_100367872 3300005548 Bacteria 1444
159 Ga0070665_100546511 3300005548 Bacteria 1170
160 Ga0070665_100707365 3300005548 Bacteria 1021
161 Ga0070665_101491396 3300005548 Bacteria 685
162 Ga0070665_101636392 3300005548 Bacteria 651
163 Ga0070665_102400575 3300005548 Bacteria 530
164 Ga0070704_100271835 3300005549 Bacteria 1400
165 Ga0068855_100107261 3300005563 Bacteria 3209
166 Ga0068855_100130222 3300005563 Bacteria 2874
167 Ga0068855_100243740 3300005563 Bacteria 2007
168 Ga0068855_100250102 3300005563 Bacteria 1977
169 Ga0068855_100779407 3300005563 Bacteria 1018
170 Ga0068855_100855162 3300005563 Bacteria 964
171 Ga0068855_101249750 3300005563 Bacteria 770
172 Ga0068855_101455680 3300005563 Bacteria 704
173 Ga0070664_100126011 3300005564 Bacteria 2247
174 Ga0068857_100199140 3300005577 Bacteria 1825
175 Ga0068857_100233289 3300005577 Bacteria 1683
176 Ga0068857_100742562 3300005577 Bacteria 934
177 Ga0068854_100063189 3300005578 Bacteria 2687
178 Ga0068854_100064694 3300005578 Bacteria 2657
179 Ga0068854_100077690 3300005578 Bacteria 2443
180 Ga0068854_100126778 3300005578 Bacteria 1945
181 Ga0068854_100184482 3300005578 Bacteria 1631
182 Ga0068854_100272890 3300005578 Bacteria 1359
183 Ga0068856_100000055 3300005614 Bacteria 104152
184 Ga0068856_100002036 3300005614 Bacteria 20996
185 Ga0068856_100023673 3300005614 Bacteria 5971
186 Ga0068856_100049006 3300005614 Bacteria 4163
187 Ga0068856_100129943 3300005614 Bacteria 2523
188 Ga0068856_100150564 3300005614 Bacteria 2336
189 Ga0068856_100343214 3300005614 Bacteria 1512
190 Ga0068856_100852120 3300005614 Bacteria 930
191 Ga0068856_101640490 3300005614 Bacteria 656
192 Ga0070702_100026334 3300005615 Bacteria 3124
193 Ga0068852_100144875 3300005616 Bacteria 2202
194 Ga0068852_100571491 3300005616 Bacteria 1132
195 Ga0068852_100590158 3300005616 Bacteria 1114
196 Ga0068852_101391581 3300005616 Bacteria 723
197 Ga0068859_100142154 3300005617 Bacteria 2473
198 Ga0068859_100286671 3300005617 Bacteria 1740
199 Ga0068864_100065929 3300005618 Bacteria 3141
200 Ga0068864_100084851 3300005618 Bacteria 2783
201 Ga0068864_100389493 3300005618 Bacteria 1322
202 Ga0068864_100491185 3300005618 Bacteria 1180
203 Ga0068866_10679990 3300005718 Bacteria 704
204 Ga0068861_100068901 3300005719 Bacteria 2735
205 Ga0068861_100236282 3300005719 Bacteria 1552
206 Ga0068861_100952270 3300005719 Bacteria 816
207 Ga0068861_100988474 3300005719 Bacteria 802
208 Ga0068851_10006976 3300005834 Bacteria 5180
209 Ga0068851_10318005 3300005834 Bacteria 899
210 Ga0068851_10417729 3300005834 Bacteria 792
211 Ga0068870_10082280 3300005840 Bacteria 1782
212 Ga0068863_100104494 3300005841 Bacteria 2694
213 Ga0068863_100334870 3300005841 Bacteria 1472
214 Ga0068863_100437314 3300005841 Bacteria 1282
215 Ga0068863_100600051 3300005841 Bacteria 1090
216 Ga0068858_100052617 3300005842 Bacteria 3767
217 Ga0068858_100104845 3300005842 Bacteria 2638
218 Ga0068858_100142352 3300005842 Bacteria 2252
219 Ga0068858_100219263 3300005842 Bacteria 1801
220 Ga0068858_100222596 3300005842 Bacteria 1787
221 Ga0068858_100226013 3300005842 Bacteria 1773
222 Ga0068858_100240836 3300005842 Bacteria 1716
223 Ga0068858_100468892 3300005842 Bacteria 1214
224 Ga0068860_100000543 3300005843 Bacteria 45937
225 Ga0068860_100148500 3300005843 Bacteria 2256
226 Ga0068860_100154933 3300005843 Bacteria 2208
227 Ga0068862_101215715 3300005844 Bacteria 752
228 Ga0081455_10005036 3300005937 Bacteria 14601
229 Ga0081455_10006141 3300005937 Bacteria 12978
230 Ga0081455_10012018 3300005937 Bacteria 8664
231 Ga0081455_10032421 3300005937 Bacteria 4707
232 Ga0081455_10053843 3300005937 Bacteria 3435
233 Ga0081455_10067710 3300005937 Bacteria 2974
234 Ga0081538_10030894 3300005981 Bacteria 3626
235 Ga0081538_10094308 3300005981 Bacteria 1533
236 Ga0081540_1003764 3300005983 Bacteria 11882
237 Ga0081540_1004015 3300005983 Bacteria 11394
238 Ga0081540_1005838 3300005983 Bacteria 9103
239 Ga0081540_1005865 3300005983 Bacteria 9086
240 Ga0081540_1006857 3300005983 Bacteria 8222
241 Ga0081540_1009326 3300005983 Bacteria 6768
242 Ga0081540_1013901 3300005983 Bacteria 5199
243 Ga0081540_1015784 3300005983 Bacteria 4764
244 Ga0081540_1023846 3300005983 Bacteria 3566
245 Ga0081540_1024265 3300005983 Bacteria 3522
246 Ga0081540_1029953 3300005983 Bacteria 3022
247 Ga0081540_1035231 3300005983 Bacteria 2687
248 Ga0081540_1056247 3300005983 Bacteria 1911
249 Ga0081540_1094487 3300005983 Bacteria 1306
250 Ga0081540_1134583 3300005983 Bacteria 1003
251 Ga0081540_1183712 3300005983 Bacteria 779
252 Ga0081539_10000585 3300005985 Bacteria 74791
253 Ga0081539_10006073 3300005985 Bacteria 11812
254 Ga0081539_10085162 3300005985 Bacteria 1650
255 Ga0081539_10256092 3300005985 Bacteria 775
256 Ga0070717_10028586 3300006028 Bacteria 4464
257 Ga0070717_10051868 3300006028 Bacteria 3378
258 Ga0070717_10202597 3300006028 Bacteria 1739
259 Ga0070717_10947944 3300006028 Bacteria 784
260 Ga0070717_11097200 3300006028 Bacteria 725
261 Ga0070717_11111106 3300006028 Bacteria 720
262 Ga0075365_10013400 3300006038 Bacteria 4901
263 Ga0075365_10028198 3300006038 Bacteria 3579
264 Ga0075365_10059311 3300006038 Bacteria 2550
265 Ga0075365_10085140 3300006038 Bacteria 2147
266 Ga0075365_10104372 3300006038 Bacteria 1943
267 Ga0075365_10125516 3300006038 Bacteria 1773
268 Ga0075365_10182498 3300006038 Bacteria 1467
269 Ga0075365_10189421 3300006038 Bacteria 1439
270 Ga0075365_10265449 3300006038 Bacteria 1207
271 Ga0075365_10313193 3300006038 Bacteria 1105
272 Ga0075365_10484139 3300006038 Bacteria 874
273 Ga0075368_10005666 3300006042 Bacteria 4312
274 Ga0075368_10096087 3300006042 Bacteria 1214
275 Ga0075368_10101761 3300006042 Bacteria 1180
276 Ga0075368_10427174 3300006042 Bacteria 585
277 Ga0075363_100021660 3300006048 Bacteria 3241
278 Ga0075363_100214812 3300006048 Bacteria 1101
279 Ga0075363_100281853 3300006048 Bacteria 962
280 Ga0075363_100359413 3300006048 Bacteria 851
281 Ga0075363_100445348 3300006048 Bacteria 764
282 Ga0075363_100473861 3300006048 Bacteria 741
283 Ga0075364_10067065 3300006051 Bacteria 2358
284 Ga0075364_10120053 3300006051 Bacteria 1759
285 Ga0075364_10219000 3300006051 Bacteria 1291
286 Ga0075364_10282442 3300006051 Bacteria 1129
287 Ga0070715_10134483 3300006163 Bacteria 1194
288 Ga0070715_10149762 3300006163 Bacteria 1142
289 Ga0070716_100506455 3300006173 Bacteria 892
290 Ga0070712_100008298 3300006175 Bacteria 6527
291 Ga0070712_100025559 3300006175 Bacteria 3926
292 Ga0070712_100043262 3300006175 Bacteria 3100
293 Ga0070712_100663906 3300006175 Bacteria 887
294 Ga0070712_100888627 3300006175 Bacteria 768
295 Ga0075362_10045442 3300006177 Bacteria 1950
296 Ga0075362_10051962 3300006177 Bacteria 1835
297 Ga0075362_10116343 3300006177 Bacteria 1262
298 Ga0075367_10004639 3300006178 Bacteria 6733
299 Ga0075367_10026149 3300006178 Bacteria 3307
300 Ga0075367_10094648 3300006178 Bacteria 1821
301 Ga0075367_10180948 3300006178 Bacteria 1314
302 Ga0075367_10352144 3300006178 Bacteria 929
303 Ga0075369_10016546 3300006186 Bacteria 2978
304 Ga0075369_10031782 3300006186 Bacteria 2230
305 Ga0075369_10057521 3300006186 Bacteria 1691
306 Ga0075369_10125612 3300006186 Bacteria 1163
307 Ga0075366_10015283 3300006195 Bacteria 4396
308 Ga0075366_10147749 3300006195 Bacteria 1423
309 Ga0075366_10227491 3300006195 Bacteria 1136
310 Ga0075366_10249960 3300006195 Bacteria 1081
311 Ga0075366_10383386 3300006195 Bacteria 864
312 Ga0097621_100378693 3300006237 Bacteria 1263
313 Ga0097621_100515645 3300006237 Bacteria 1084
314 Ga0097621_100892512 3300006237 Bacteria 828
315 Ga0075370_10018061 3300006353 Bacteria 3821
316 Ga0075370_10107592 3300006353 Bacteria 1617
317 Ga0075370_10130719 3300006353 Bacteria 1465
318 Ga0075370_10383285 3300006353 Bacteria 842
319 Ga0075370_10400341 3300006353 Bacteria 823
320 Ga0068871_100245345 3300006358 Bacteria 1558
321 Ga0068871_100662671 3300006358 Bacteria 953
322 Ga0075428_100709422 3300006844 Bacteria 1071
323 Ga0075430_100184334 3300006846 Bacteria 1736
324 Ga0075434_100297723 3300006871 Bacteria 1633
325 Ga0075434_101292010 3300006871 Bacteria 741
326 Ga0075429_100153011 3300006880 Bacteria 2020
327 Ga0068865_100093045 3300006881 Bacteria 2191
328 Ga0075436_100297621 3300006914 Bacteria 1156
329 Ga0075436_100496251 3300006914 Bacteria 893
330 Ga0097620_100070150 3300006931 Bacteria 3540
331 Ga0097620_100142152 3300006931 Bacteria 2473
332 Ga0097620_100286663 3300006931 Bacteria 1740
333 Ga0075435_100363348 3300007076 Bacteria 1242
334 Ga0075435_100827196 3300007076 Bacteria 807
335 Ga0099794_10081198 3300007265 Bacteria 1600
336 Ga0099795_10299093 3300007788 Bacteria 707
337 Ga0099795_10303414 3300007788 Bacteria 703
338 Ga0105251_10137145 3300009011 Bacteria 1107
339 Ga0105251_10329894 3300009011 Bacteria 694
340 Ga0105244_10292586 3300009036 Bacteria 754
341 Ga0105250_10052188 3300009092 Bacteria 1641
342 Ga0105240_10004881 3300009093 Bacteria 20178
343 Ga0105240_10022030 3300009093 Bacteria 8460
344 Ga0105240_10055436 3300009093 Bacteria 4962
345 Ga0105240_10178270 3300009093 Bacteria 2510
346 Ga0105240_10196901 3300009093 Bacteria 2364
347 Ga0111539_10768888 3300009094 Bacteria 1121
348 Ga0105245_10082903 3300009098 Bacteria 2934
349 Ga0105247_10013326 3300009101 Bacteria 4935
350 Ga0105247_10053876 3300009101 Bacteria 2482
351 Ga0105247_10083743 3300009101 Bacteria 2015
352 Ga0105247_10173764 3300009101 Bacteria 1434
353 Ga0105247_10196167 3300009101 Bacteria 1354
354 Ga0105247_10206311 3300009101 Bacteria 1323
355 Ga0105247_11283193 3300009101 Bacteria 587
356 Ga0114129_11068240 3300009147 Bacteria 1012
357 Ga0105243_10313425 3300009148 Bacteria 1426
358 Ga0105243_10321370 3300009148 Bacteria 1410
359 Ga0105241_10001011 3300009174 Bacteria 21377
360 Ga0105241_10098771 3300009174 Bacteria 2317
361 Ga0105242_10052705 3300009176 Bacteria 3321
362 Ga0105242_10138449 3300009176 Bacteria 2109
363 Ga0105242_11419862 3300009176 Bacteria 722
364 Ga0105248_10050701 3300009177 Bacteria 4656
365 Ga0105248_10076907 3300009177 Bacteria 3751
366 Ga0105248_10284311 3300009177 Bacteria 1862
367 Ga0105248_10340817 3300009177 Bacteria 1688
368 Ga0105248_11565230 3300009177 Bacteria 747
369 Ga0105248_11840372 3300009177 Bacteria 687
370 Ga0105237_10030019 3300009545 Bacteria 5523
371 Ga0105237_10080441 3300009545 Bacteria 3249
372 Ga0105237_10085961 3300009545 Bacteria 3135
373 Ga0105237_10148901 3300009545 Bacteria 2336
374 Ga0105237_10175188 3300009545 Bacteria 2145
375 Ga0105237_10198097 3300009545 Bacteria 2008
376 Ga0105237_10250743 3300009545 Bacteria 1772
377 Ga0105237_10368248 3300009545 Bacteria 1442
378 Ga0105237_10408376 3300009545 Bacteria 1363
379 Ga0105237_11563517 3300009545 Bacteria 666
380 Ga0105238_10001743 3300009551 Bacteria 21842
381 Ga0105238_10004073 3300009551 Bacteria 14490
382 Ga0105238_10076517 3300009551 Bacteria 3338
383 Ga0105238_10095850 3300009551 Bacteria 2953
384 Ga0105238_10475945 3300009551 Bacteria 1248
385 Ga0105249_10021525 3300009553 Bacteria 5773
386 Ga0105249_10138873 3300009553 Bacteria 2328
387 Ga0105249_11562683 3300009553 Bacteria 732
388 Ga0099796_10050035 3300010159 Bacteria 1447
389 Ga0099796_10480559 3300010159 Bacteria 555
390 Ga0105239_10014303 3300010375 Bacteria 8805
391 Ga0105239_10025293 3300010375 Bacteria 6537
392 Ga0105239_10032123 3300010375 Bacteria 5770
393 Ga0105239_10149087 3300010375 Bacteria 2610
394 Ga0105239_10202613 3300010375 Bacteria 2223
395 Ga0105239_10300709 3300010375 Bacteria 1807
396 Ga0105239_10314536 3300010375 Bacteria 1765
397 Ga0105239_10549330 3300010375 Bacteria 1315
398 Ga0105239_11323901 3300010375 Bacteria 831
399 Ga0105246_10030767 3300011119 Bacteria 3548
400 Ga0105246_10064349 3300011119 Bacteria 2561
401 Ga0105246_10201239 3300011119 Bacteria 1548
402 Ga0105246_10439702 3300011119 Bacteria 1093
403 Ga0157336_1004394 3300012477 Bacteria 888
404 Ga0157337_1002162 3300012483 Bacteria 1089
405 Ga0157335_1008624 3300012492 Bacteria 786
406 Ga0157341_1012094 3300012494 Bacteria 755
407 Ga0157323_1006910 3300012495 Bacteria 805
408 Ga0157314_1048444 3300012500 Bacteria 536
409 Ga0157324_1008745 3300012506 Bacteria 822
410 Ga0157373_10098153 3300013100 Bacteria 2062
411 Ga0157373_10189650 3300013100 Bacteria 1449
412 Ga0157371_10021912 3300013102 Bacteria 4689
413 Ga0157370_10012254 3300013104 Bacteria 8903
414 Ga0157370_10061921 3300013104 Bacteria 3550
415 Ga0157370_10144710 3300013104 Bacteria 2214
416 Ga0157370_10146307 3300013104 Bacteria 2200
417 Ga0157369_10018060 3300013105 Bacteria 7911
418 Ga0157369_10356237 3300013105 Bacteria 1519
419 Ga0157369_10792865 3300013105 Bacteria 973
420 Ga0157374_10094363 3300013296 Bacteria 2859
421 Ga0157374_10113743 3300013296 Bacteria 2605
422 Ga0157374_10608527 3300013296 Bacteria 1103
423 Ga0157374_11022564 3300013296 Bacteria 846
424 Ga0157374_11683894 3300013296 Bacteria 659
425 Ga0157378_10002682 3300013297 Bacteria 15859
426 Ga0157378_10056434 3300013297 Bacteria 3500
427 Ga0157378_10451812 3300013297 Bacteria 1275
428 Ga0157378_10644094 3300013297 Bacteria 1075
429 Ga0163162_10187803 3300013306 Bacteria 2194
430 Ga0163162_10271475 3300013306 Bacteria 1828
431 Ga0163162_10396541 3300013306 Bacteria 1513
432 Ga0163162_10467696 3300013306 Bacteria 1392
433 Ga0163162_10656178 3300013306 Bacteria 1173
434 Ga0157372_10069722 3300013307 Bacteria 3954
435 Ga0157372_10278211 3300013307 Bacteria 1946
436 Ga0157372_10557912 3300013307 Bacteria 1335
437 Ga0157372_10559542 3300013307 Bacteria 1333
438 Ga0157372_11715616 3300013307 Bacteria 722
439 Ga0157375_10014388 3300013308 Bacteria 7056
440 Ga0157375_10044068 3300013308 Bacteria 4331
441 Ga0157375_12003884 3300013308 Bacteria 688
442 Ga0163163_10108554 3300014325 Bacteria 2802
443 Ga0163163_10109477 3300014325 Bacteria 2790
444 Ga0163163_10119609 3300014325 Bacteria 2667
445 Ga0163163_10370333 3300014325 Bacteria 1489
446 Ga0163163_11577188 3300014325 Bacteria 718
447 Ga0157380_10793653 3300014326 Bacteria 963
448 Ga0157380_11589697 3300014326 Bacteria 709
449 Ga0182008_10094769 3300014497 Bacteria 1473
450 Ga0157379_10157542 3300014968 Bacteria 2049
451 Ga0157379_10374052 3300014968 Bacteria 1307
452 Ga0157376_10291071 3300014969 Bacteria 1542
453 Ga0157376_12011778 3300014969 Bacteria 615
454 Ga0182005_1056718 3300015265 Bacteria 1068
455 Ga0163161_10054336 3300017792 Bacteria 2906
456 Ga0163161_10346375 3300017792 Bacteria 1180
457 Ga0163161_10432229 3300017792 Bacteria 1061
458 Ga0163161_11122265 3300017792 Bacteria 677
459 Ga0184595_129802 3300019166 Bacteria 624
460 Ga0184601_116584 3300019183 Bacteria 628
461 Ga0184601_135068 3300019183 Bacteria 553
462 Ga0184599_119650 3300019188 Bacteria 575
463 Ga0184600_141600 3300019190 Bacteria 709
464 Ga0197907_11339043 3300020069 Bacteria 613
465 Ga0206356_10346957 3300020070 Bacteria 830
466 Ga0206355_1436607 3300020076 Bacteria 775
467 Ga0206353_11312172 3300020082 Bacteria 633
468 Ga0214544_1000005 3300021320 Bacteria 387675
469 Ga0214542_1000004 3300021321 Bacteria 415597
470 Ga0214545_1000005 3300021324 Bacteria 415590
471 Ga0214543_1000111 3300021327 Bacteria 106517
472 Ga0213873_10179336 3300021358 Bacteria 649
473 Ga0213872_10079111 3300021361 Bacteria 1478
474 Ga0213876_10001491 3300021384 Bacteria 14550
475 Ga0213875_10046868 3300021388 Bacteria 2028
476 Ga0247555_102493 3300023539 Bacteria 615
477 Ga0247550_102757 3300023660 Bacteria 611
478 Ga0247527_111926 3300023664 Bacteria 600
479 Ga0209563_104277 3300025230 Bacteria 2759
480 Ga0207425_1023944 3300025245 Bacteria 1272
481 Ga0209677_110545 3300025253 Bacteria 1525
482 Ga0209148_1000672 3300025254 Bacteria 28919
483 Ga0209233_1010915 3300025261 Bacteria 2696
484 Ga0209233_1012117 3300025261 Bacteria 2512
485 Ga0209233_1013292 3300025261 Bacteria 2354
486 Ga0207666_1028629 3300025271 Bacteria 846
487 Ga0209455_1013267 3300025272 Bacteria 1922
488 Ga0209564_1000971 3300025295 Bacteria 36259
489 Ga0209564_1049345 3300025295 Bacteria 1042
490 Ga0209564_1050154 3300025295 Bacteria 1025
491 Ga0209758_1000102 3300025297 Bacteria 224851
492 Ga0209758_1007481 3300025297 Bacteria 7415
493 Ga0209758_1009586 3300025297 Bacteria 5982
494 Ga0209758_1009879 3300025297 Bacteria 5825
495 Ga0209758_1018978 3300025297 Bacteria 3341
496 Ga0209758_1031515 3300025297 Bacteria 2172
497 Ga0209758_1032221 3300025297 Bacteria 2132
498 Ga0209256_1005673 3300025299 Bacteria 7029
499 Ga0207426_1008961 3300025302 Bacteria 3991
500 Ga0209257_1005774 3300025304 Bacteria 8443
501 Ga0207697_10052681 3300025315 Bacteria 1684
502 Ga0207656_10129719 3300025321 Bacteria 1180
503 Ga0207656_10169680 3300025321 Bacteria 1042
504 Ga0207656_10520900 3300025321 Bacteria 604
505 Ga0207653_10037282 3300025885 Bacteria 1585
506 Ga0207682_10296969 3300025893 Bacteria 757
507 Ga0207692_10002983 3300025898 Bacteria 6554
508 Ga0207692_10016278 3300025898 Bacteria 3288
509 Ga0207692_10058429 3300025898 Bacteria 1987
510 Ga0207692_10181206 3300025898 Bacteria 1227
511 Ga0207692_10531136 3300025898 Bacteria 750
512 Ga0207692_10666405 3300025898 Bacteria 673
513 Ga0207642_10096607 3300025899 Bacteria 1473
514 Ga0207710_10015469 3300025900 Bacteria 3225
515 Ga0207688_10021039 3300025901 Bacteria 3563
516 Ga0207680_10533688 3300025903 Bacteria 837
517 Ga0207680_10553326 3300025903 Bacteria 821
518 Ga0207680_10777693 3300025903 Bacteria 686
519 Ga0207647_10022659 3300025904 Bacteria 4168
520 Ga0207647_10067001 3300025904 Bacteria 2176
521 Ga0207647_10285510 3300025904 Bacteria 941
522 Ga0207699_10001381 3300025906 Bacteria 11546
523 Ga0207699_10010672 3300025906 Bacteria 4619
524 Ga0207699_10340301 3300025906 Bacteria 1057
525 Ga0207645_10075858 3300025907 Bacteria 2152
526 Ga0207645_10104548 3300025907 Bacteria 1829
527 Ga0207643_10099208 3300025908 Bacteria 1707
528 Ga0207705_10327578 3300025909 Bacteria 1177
529 Ga0207705_10431236 3300025909 Bacteria 1021
530 Ga0207684_10295307 3300025910 Bacteria 1397
531 Ga0207654_10000468 3300025911 Bacteria 23099
532 Ga0207654_10033630 3300025911 Bacteria 2843
533 Ga0207654_10077665 3300025911 Bacteria 1991
534 Ga0207654_10125342 3300025911 Bacteria 1619
535 Ga0207707_10000386 3300025912 Bacteria 46013
536 Ga0207707_10001016 3300025912 Bacteria 26912
537 Ga0207707_10109693 3300025912 Bacteria 2412
538 Ga0207707_10585625 3300025912 Bacteria 945
539 Ga0207707_10921723 3300025912 Bacteria 721
540 Ga0207695_10001480 3300025913 Bacteria 39293
541 Ga0207695_10390884 3300025913 Bacteria 1276
542 Ga0207671_10101317 3300025914 Bacteria 2182
543 Ga0207671_10116065 3300025914 Bacteria 2042
544 Ga0207671_10163523 3300025914 Bacteria 1725
545 Ga0207671_10165850 3300025914 Bacteria 1713
546 Ga0207671_10248006 3300025914 Bacteria 1400
547 Ga0207671_10510307 3300025914 Bacteria 959
548 Ga0207671_10616271 3300025914 Bacteria 865
549 Ga0207671_11062931 3300025914 Bacteria 637
550 Ga0207693_10025202 3300025915 Bacteria 4716
551 Ga0207693_10030083 3300025915 Bacteria 4287
552 Ga0207693_10058734 3300025915 Bacteria 3013
553 Ga0207693_10104955 3300025915 Bacteria 2216
554 Ga0207663_10020005 3300025916 Bacteria 3784
555 Ga0207663_10026864 3300025916 Bacteria 3346
556 Ga0207663_10048221 3300025916 Bacteria 2635
557 Ga0207663_10074325 3300025916 Bacteria 2202
558 Ga0207663_10286215 3300025916 Bacteria 1226
559 Ga0207660_10000887 3300025917 Bacteria 19699
560 Ga0207660_10020990 3300025917 Bacteria 4389
561 Ga0207660_10065453 3300025917 Bacteria 2627
562 Ga0207660_10067863 3300025917 Bacteria 2585
563 Ga0207662_10082475 3300025918 Bacteria 1964
564 Ga0207662_10333127 3300025918 Bacteria 1016
565 Ga0207657_10001391 3300025919 Bacteria 25799
566 Ga0207657_10036976 3300025919 Bacteria 4366
567 Ga0207657_10065225 3300025919 Bacteria 3105
568 Ga0207657_10135259 3300025919 Bacteria 2017
569 Ga0207657_11231683 3300025919 Bacteria 568
570 Ga0207649_10093891 3300025920 Bacteria 1970
571 Ga0207649_10366562 3300025920 Bacteria 1070
572 Ga0207649_11316394 3300025920 Bacteria 571
573 Ga0207652_10053035 3300025921 Bacteria 3483
574 Ga0207652_10076797 3300025921 Bacteria 2913
575 Ga0207652_10432150 3300025921 Bacteria 1187
576 Ga0207652_10679409 3300025921 Bacteria 920
577 Ga0207652_11038235 3300025921 Bacteria 719
578 Ga0207681_10829963 3300025923 Bacteria 773
579 Ga0207681_11143768 3300025923 Bacteria 654
580 Ga0207694_10000136 3300025924 Bacteria 74908
581 Ga0207694_10683096 3300025924 Bacteria 866
582 Ga0207650_10325003 3300025925 Bacteria 1260
583 Ga0207650_10545986 3300025925 Bacteria 971
584 Ga0207687_10255587 3300025927 Bacteria 1395
585 Ga0207700_10026090 3300025928 Bacteria 4070
586 Ga0207700_10043132 3300025928 Bacteria 3312
587 Ga0207700_10084384 3300025928 Bacteria 2490
588 Ga0207700_10208204 3300025928 Bacteria 1652
589 Ga0207700_10286764 3300025928 Bacteria 1418
590 Ga0207700_10340516 3300025928 Bacteria 1304
591 Ga0207664_10011265 3300025929 Bacteria 6344
592 Ga0207664_10073307 3300025929 Bacteria 2763
593 Ga0207664_10214384 3300025929 Bacteria 1667
594 Ga0207664_10386272 3300025929 Bacteria 1243
595 Ga0207664_10548649 3300025929 Bacteria 1037
596 Ga0207664_10622360 3300025929 Bacteria 970
597 Ga0207664_10855239 3300025929 Bacteria 817
598 Ga0207644_10145803 3300025931 Bacteria 1827
599 Ga0207690_10069163 3300025932 Bacteria 2428
600 Ga0207690_10131980 3300025932 Bacteria 1829
601 Ga0207706_10258032 3300025933 Bacteria 1522
602 Ga0207686_10049076 3300025934 Bacteria 2618
603 Ga0207686_10187654 3300025934 Bacteria 1471
604 Ga0207686_10212848 3300025934 Bacteria 1390
605 Ga0207686_10448393 3300025934 Bacteria 992
606 Ga0207709_10250971 3300025935 Bacteria 1292
607 Ga0207670_10891513 3300025936 Bacteria 745
608 Ga0207669_10051215 3300025937 Bacteria 2472
609 Ga0207669_10266158 3300025937 Bacteria 1285
610 Ga0207669_10401877 3300025937 Bacteria 1073
611 Ga0207704_10103541 3300025938 Bacteria 1904
612 Ga0207665_10007889 3300025939 Bacteria 7031
613 Ga0207665_10071628 3300025939 Bacteria 2366
614 Ga0207665_10542820 3300025939 Bacteria 902
615 Ga0207691_10048268 3300025940 Bacteria 3904
616 Ga0207691_10342081 3300025940 Bacteria 1280
617 Ga0207691_11046933 3300025940 Bacteria 680
618 Ga0207711_10022786 3300025941 Bacteria 5240
619 Ga0207711_10066864 3300025941 Bacteria 3109
620 Ga0207711_10236216 3300025941 Bacteria 1675
621 Ga0207689_10218876 3300025942 Bacteria 1573
622 Ga0207661_10057962 3300025944 Bacteria 3116
623 Ga0207661_10349837 3300025944 Bacteria 1333
624 Ga0207661_11095126 3300025944 Bacteria 733
625 Ga0207679_10095936 3300025945 Bacteria 2306
626 Ga0207667_10067553 3300025949 Bacteria 3724
627 Ga0207667_10086340 3300025949 Bacteria 3247
628 Ga0207667_10114401 3300025949 Bacteria 2781
629 Ga0207667_10116984 3300025949 Bacteria 2747
630 Ga0207667_10121092 3300025949 Bacteria 2696
631 Ga0207667_10362445 3300025949 Bacteria 1478
632 Ga0207667_10708353 3300025949 Bacteria 1009
633 Ga0207667_10875507 3300025949 Bacteria 891
634 Ga0207667_10961465 3300025949 Bacteria 843
635 Ga0207667_11218994 3300025949 Bacteria 731
636 Ga0207651_10211442 3300025960 Bacteria 1562
637 Ga0207712_10238503 3300025961 Bacteria 1464
638 Ga0207712_10417571 3300025961 Bacteria 1131
639 Ga0207712_10895107 3300025961 Bacteria 784
640 Ga0207712_11695026 3300025961 Bacteria 567
641 Ga0207668_10021619 3300025972 Bacteria 4105
642 Ga0207668_10202012 3300025972 Bacteria 1583
643 Ga0207668_10736949 3300025972 Bacteria 868
644 Ga0207668_10853781 3300025972 Bacteria 808
645 Ga0207640_10038275 3300025981 Bacteria 3025
646 Ga0207640_10128290 3300025981 Bacteria 1829
647 Ga0207640_10157239 3300025981 Bacteria 1677
648 Ga0207640_10266409 3300025981 Bacteria 1338
649 Ga0207640_10700434 3300025981 Bacteria 868
650 Ga0207658_10026231 3300025986 Bacteria 4084
651 Ga0207658_10570791 3300025986 Bacteria 1014
652 Ga0207658_11113830 3300025986 Bacteria 721
653 Ga0207658_11239127 3300025986 Bacteria 682
654 Ga0207677_10042292 3300026023 Bacteria 3020
655 Ga0207677_10086019 3300026023 Bacteria 2271
656 Ga0207677_10123824 3300026023 Bacteria 1950
657 Ga0207677_10626293 3300026023 Bacteria 947
658 Ga0207703_10072541 3300026035 Bacteria 2846
659 Ga0207703_10073571 3300026035 Bacteria 2827
660 Ga0207703_10284721 3300026035 Bacteria 1502
661 Ga0207703_10294615 3300026035 Bacteria 1478
662 Ga0207703_10586882 3300026035 Bacteria 1053
663 Ga0207703_10762167 3300026035 Bacteria 922
664 Ga0207703_11128065 3300026035 Bacteria 753
665 Ga0207639_10056384 3300026041 Bacteria 3011
666 Ga0207639_10107023 3300026041 Bacteria 2271
667 Ga0207639_10184900 3300026041 Bacteria 1776
668 Ga0207639_10258006 3300026041 Bacteria 1523
669 Ga0207639_10486672 3300026041 Bacteria 1125
670 Ga0207639_10657954 3300026041 Bacteria 970
671 Ga0207678_10035839 3300026067 Bacteria 4319
672 Ga0207678_10121627 3300026067 Bacteria 2228
673 Ga0207678_10132853 3300026067 Bacteria 2123
674 Ga0207678_10397020 3300026067 Bacteria 1194
675 Ga0207678_10401691 3300026067 Bacteria 1186
676 Ga0207678_10761171 3300026067 Bacteria 854
677 Ga0207708_10055363 3300026075 Bacteria 3024
678 Ga0207702_10000006 3300026078 Bacteria 346370
679 Ga0207702_10000688 3300026078 Bacteria 36556
680 Ga0207702_10053029 3300026078 Bacteria 3433
681 Ga0207702_10880150 3300026078 Bacteria 887
682 Ga0207641_10181389 3300026088 Bacteria 1929
683 Ga0207641_11759583 3300026088 Bacteria 622
684 Ga0207648_10014624 3300026089 Bacteria 7245
685 Ga0207648_10105614 3300026089 Bacteria 2471
686 Ga0207676_10006429 3300026095 Bacteria 8303
687 Ga0207676_10092423 3300026095 Bacteria 2488
688 Ga0207676_10469317 3300026095 Bacteria 1190
689 Ga0207676_10571703 3300026095 Bacteria 1082
690 Ga0207674_10011177 3300026116 Bacteria 10096
691 Ga0207674_10119218 3300026116 Bacteria 2608
692 Ga0207674_10289970 3300026116 Bacteria 1585
693 Ga0207674_10552509 3300026116 Bacteria 1112
694 Ga0207674_10588818 3300026116 Bacteria 1074
695 Ga0207674_10697076 3300026116 Bacteria 980
696 Ga0207683_10015315 3300026121 Bacteria 6530
697 Ga0207683_10103193 3300026121 Bacteria 2547
698 Ga0207698_10042920 3300026142 Bacteria 3384
699 Ga0207698_10116835 3300026142 Bacteria 2249
700 Ga0207698_10134117 3300026142 Bacteria 2121
701 Ga0207698_10416383 3300026142 Bacteria 1288
702 Ga0207698_11168659 3300026142 Bacteria 783
703 Ga0207698_12042653 3300026142 Bacteria 587
704 Ga0209389_1000021 3300027296 Bacteria 169506
705 Ga0209389_1000120 3300027296 Bacteria 70535
706 Ga0209589_1000027 3300027357 Bacteria 155295
707 Ga0209489_100023 3300027361 Bacteria 198829
708 Ga0209489_100742 3300027361 Bacteria 64218
709 Ga0209700_100134 3300027363 Bacteria 112846
710 Ga0209179_1008998 3300027512 Bacteria 1699
711 Ga0209179_1038088 3300027512 Bacteria 1006
712 Ga0209588_1013577 3300027671 Bacteria 2485
713 Ga0209813_10022272 3300027866 Bacteria 1790
714 Ga0209813_10076709 3300027866 Bacteria 1097
715 Ga0207428_10618016 3300027907 Bacteria 780
716 Ga0268266_10001136 3300028379 Bacteria 33101
717 Ga0268266_10067714 3300028379 Bacteria 3090
718 Ga0268266_10109126 3300028379 Bacteria 2450
719 Ga0268266_10121335 3300028379 Bacteria 2326
720 Ga0268266_10192392 3300028379 Bacteria 1863
721 Ga0268266_10212435 3300028379 Bacteria 1775
722 Ga0268266_10290107 3300028379 Bacteria 1524
723 Ga0268266_10330486 3300028379 Bacteria 1428
724 Ga0268266_10437635 3300028379 Bacteria 1241
725 Ga0268266_11013333 3300028379 Bacteria 803
726 Ga0268266_11230077 3300028379 Bacteria 724
727 Ga0268265_10076118 3300028380 Bacteria 2631
728 Ga0268264_10000185 3300028381 Bacteria 131374
729 Ga0268264_10072563 3300028381 Bacteria 2919
730 Ga0268264_12074603 3300028381 Bacteria 577
731 Ga0265334_10005906 3300028573 Bacteria 5325
732 Ga0307517_10000098 3300028786 Bacteria 126044
733 Ga0307515_10016400 3300028794 Bacteria 13559
734 Ga0307515_10319246 3300028794 Bacteria 1221
735 Ga0265338_11010540 3300028800 Bacteria 563
736 Ga0307511_10033050 3300030521 Bacteria 4578
737 Ga0307511_10114077 3300030521 Bacteria 1705
738 Ga0307512_10311289 3300030522 Bacteria 724
739 Ga0265766_1009582 3300030863 Bacteria 680
740 Ga0265770_1056325 3300030878 Bacteria 722
741 Ga0265760_10135028 3300031090 Bacteria 800
742 Ga0265330_10025088 3300031235 Bacteria 2703
743 Ga0265330_10027675 3300031235 Bacteria 2560
744 Ga0265330_10046914 3300031235 Bacteria 1902
745 Ga0265330_10143046 3300031235 Bacteria 1017
746 Ga0265332_10020705 3300031238 Bacteria 2905
747 Ga0265328_10045647 3300031239 Bacteria 1611
748 Ga0265325_10073023 3300031241 Bacteria 1718
749 Ga0265329_10085283 3300031242 Bacteria 1001
750 Ga0265329_10088338 3300031242 Bacteria 983
751 Ga0265340_10003780 3300031247 Bacteria 8527
752 Ga0265339_10041054 3300031249 Bacteria 2570
753 Ga0265339_10149432 3300031249 Bacteria 1183
754 Ga0265331_10030929 3300031250 Bacteria 2663
755 Ga0265316_10120267 3300031344 Bacteria 1984
756 Ga0307513_10258126 3300031456 Bacteria 1534
757 Ga0307513_10269695 3300031456 Bacteria 1486
758 Ga0307509_10192424 3300031507 Bacteria 1889
759 Ga0307509_10201925 3300031507 Bacteria 1823
760 Ga0307509_10279568 3300031507 Bacteria 1431
761 Ga0307509_10314853 3300031507 Bacteria 1305
762 Ga0307509_10783763 3300031507 Bacteria 618
763 Ga0307408_101629302 3300031548 Bacteria 613
764 Ga0265313_10007792 3300031595 Bacteria 7234
765 Ga0265313_10102201 3300031595 Bacteria 1271
766 Ga0307508_10027398 3300031616 Bacteria 5158
767 Ga0307508_10054901 3300031616 Bacteria 3529
768 Ga0307508_10142818 3300031616 Bacteria 1997
769 Ga0307508_10179015 3300031616 Bacteria 1723
770 Ga0265314_10034496 3300031711 Bacteria 3699
771 Ga0265314_10231505 3300031711 Bacteria 1071
772 Ga0265314_10247378 3300031711 Bacteria 1025
773 Ga0265342_10003016 3300031712 Bacteria 14114
774 Ga0265342_10163286 3300031712 Bacteria 1230
775 Ga0307516_10018054 3300031730 Bacteria 7339
776 Ga0307516_10087197 3300031730 Bacteria 2956
777 Ga0307516_10181324 3300031730 Bacteria 1839
778 Ga0307516_10248542 3300031730 Bacteria 1474
779 Ga0307516_10285423 3300031730 Bacteria 1331
780 Ga0307405_11404721 3300031731 Bacteria 610
781 Ga0316044_116803 3300031810 Bacteria 795
782 Ga0316045_119733 3300031815 Bacteria 652
783 Ga0307413_10067220 3300031824 Bacteria 2240
784 Ga0307410_10883114 3300031852 Bacteria 765
785 Ga0307410_11234063 3300031852 Bacteria 652
786 Ga0307406_11865368 3300031901 Bacteria 535
787 Ga0307407_10089969 3300031903 Bacteria 1879
788 Ga0307412_10041561 3300031911 Bacteria 2981
789 Ga0307416_100347484 3300032002 Bacteria 1499
790 Ga0307416_100808858 3300032002 Bacteria 1033
791 Ga0307414_10291570 3300032004 Bacteria 1376
792 Ga0307414_10634989 3300032004 Bacteria 961
793 Ga0307411_10146037 3300032005 Bacteria 1751
794 Ga0307411_10608888 3300032005 Bacteria 940
795 Ga0316053_111976 3300032120 Bacteria 617
796 Ga0307415_100048349 3300032126 Bacteria 2870
797 Ga0307415_100520667 3300032126 Bacteria 1044
798 Ga0307415_100585758 3300032126 Bacteria 990
799 Ga0307507_10014035 3300033179 Bacteria 9619
800 Ga0307507_10361650 3300033179 Bacteria 847
801 Ga0307507_10362116 3300033179 Bacteria 846
802 Ga0307510_10047477 3300033180 Bacteria 4599
803 Ga0307510_10061680 3300033180 Bacteria 3840
804 Ga0307510_10325426 3300033180 Bacteria 993
805 Ga0315911_1000022 3300033442 Bacteria 118114
806 Ga0316215_1001011 3300033544 Bacteria 2731
807 Ga0373959_0098391 3300034820 Bacteria 694
808 Ga0373938_0011772 3300034957 Bacteria 1633
809 Ga0373926_0018331 3300035083 Bacteria 2406
810 Ga0373926_0068981 3300035083 Bacteria 1297
811 Ga0373926_0198761 3300035083 Bacteria 771
812 Ga0373926_0334613 3300035083 Bacteria 593
813 Ga0373928_0024614 3300035084 Bacteria 1292
814 Ga0373928_0169218 3300035084 Bacteria 615
815 Ga0373929_0052464 3300035085 Bacteria 935
816 Ga0373934_0009072 3300035086 Bacteria 3721
817 Ga0373934_0115232 3300035086 Bacteria 1092
818 Ga0373940_0023822 3300035088 Bacteria 1583
819 Ga0373944_0014978 3300035089 Bacteria 2171
820 Ga0373944_0299376 3300035089 Bacteria 603
821 Ga0373923_0011449 3300035111 Bacteria 3252
822 Ga0373923_0025959 3300035111 Bacteria 2327
823 Ga0373923_0055004 3300035111 Bacteria 1676
824 Ga0373923_0092372 3300035111 Bacteria 1325
825 Ga0373923_0472518 3300035111 Bacteria 609
826 Ga0373932_0126544 3300035112 Bacteria 857
827 Ga0373936_0000642 3300035113 Bacteria 12077
828 Ga0373936_0021327 3300035113 Bacteria 2519
829 Ga0373936_0361681 3300035113 Bacteria 662
830 Ga0373941_0018775 3300035115 Bacteria 1915
831 Ga0373945_0015097 3300035116 Bacteria 2596
832 Ga0373945_0197663 3300035116 Bacteria 834
833 Ga0373953_0000731 3300035117 Bacteria 9082
834 Ga0373953_0030094 3300035117 Bacteria 2103
835 Ga0373953_0040403 3300035117 Bacteria 1852
836 Ga0373953_0060668 3300035117 Bacteria 1546
837 Ga0373953_0227634 3300035117 Bacteria 808
838 Ga0373954_0000496 3300035118 Bacteria 14775
839 Ga0373954_0001719 3300035118 Bacteria 8964
840 Ga0373954_0019062 3300035118 Bacteria 3092
841 Ga0373954_0029859 3300035118 Bacteria 2513
842 Ga0373954_0275395 3300035118 Bacteria 829
843 Ga0373956_0002420 3300035119 Bacteria 7612
844 Ga0373956_0015439 3300035119 Bacteria 3198
845 Ga0373956_0066740 3300035119 Bacteria 1637
846 Ga0373956_0259385 3300035119 Bacteria 826
847 Ga0373957_0000218 3300035120 Bacteria 14250
848 Ga0373957_0003907 3300035120 Bacteria 4475
849 Ga0373957_0010840 3300035120 Bacteria 3025
850 Ga0373957_0201047 3300035120 Bacteria 830
851 Ga0373960_0063909 3300035121 Bacteria 1123
852 Ga0373943_0000806 3300035170 Bacteria 13730
853 Ga0373943_0009912 3300035170 Bacteria 4268
854 Ga0373943_0050860 3300035170 Bacteria 2038
855 Ga0373946_0002589 3300035171 Bacteria 6392
856 Ga0373946_0005160 3300035171 Bacteria 4708
857 Ga0373955_0003024 3300035172 Bacteria 7372
858 Ga0373955_0006844 3300035172 Bacteria 5211
859 Ga0373955_0039016 3300035172 Bacteria 2532
860 Ga0373955_0061584 3300035172 Bacteria 2073
861 Ga0373955_0124277 3300035172 Bacteria 1502
862 Ga0373955_0357048 3300035172 Bacteria 885
863 Ga0373961_0166916 3300035241 Bacteria 759
864 Ga0373924_0001915 3300035410 Bacteria 6921
865 Ga0373924_0005387 3300035410 Bacteria 4526
866 Ga0373924_0041117 3300035410 Bacteria 1894
867 Ga0373931_0000654 3300035691 Bacteria 14304
868 Ga0373931_0051450 3300035691 Bacteria 2194
869 Ga0373931_0219072 3300035691 Bacteria 1145
870 Ga0373931_0337003 3300035691 Bacteria 941
871 Ga0373935_0001176 3300035692 Bacteria 14365
872 Ga0373935_0006965 3300035692 Bacteria 6749
873 Ga0373935_0012134 3300035692 Bacteria 5182
874 Ga0373935_0361161 3300035692 Bacteria 1037
875 Ga0373935_1311443 3300035692 Bacteria 540
876 Ga0373927_0000046 3300035695 Bacteria 88401
877 Ga0373927_0015261 3300035695 Bacteria 5074
878 Ga0373927_0021714 3300035695 Bacteria 4207
879 Ga0373927_0027284 3300035695 Bacteria 3729
880 Ga0373927_0068952 3300035695 Bacteria 2288
881 Ga0373927_0283242 3300035695 Bacteria 1090
882 Ga0373927_0369592 3300035695 Bacteria 945
883 Ga0373927_0443969 3300035695 Bacteria 857
884 Ga0373933_0000026 3300035724 Bacteria 90309
885 Ga0373933_0001354 3300035724 Bacteria 14445
886 Ga0373933_0011360 3300035724 Bacteria 4905
887 Ga0373933_0038950 3300035724 Bacteria 2795
888 Ga0373933_0048118 3300035724 Bacteria 2538
889 Ga0373933_0049018 3300035724 Bacteria 2517
890 Ga0373933_0406371 3300035724 Bacteria 888
891 Ga0373947_0003991 3300035725 Bacteria 8665
892 Ga0373947_0007461 3300035725 Bacteria 6329
893 Ga0373947_0157312 3300035725 Bacteria 1467
894 Ga0373947_0227647 3300035725 Bacteria 1227
895 Ga0310104_11267 3300036242 Bacteria 719
896 Ga0310104_14568 3300036242 Bacteria 615
897 Ga0373937_0000356 3300036401 Bacteria 42503
898 Ga0373937_0011908 3300036401 Bacteria 7634
899 Ga0373937_0023752 3300036401 Bacteria 5525
900 Ga0373937_0039228 3300036401 Bacteria 4317
901 Ga0373937_0048069 3300036401 Bacteria 3904
902 Ga0373937_0051162 3300036401 Bacteria 3786
903 Ga0373937_0075352 3300036401 Bacteria 3114
904 Ga0373937_0192183 3300036401 Bacteria 1918
905 Ga0373937_0720775 3300036401 Bacteria 944
906 Ga0310112_041518 3300036458 Bacteria 625
907 Ga0310112_043340 3300036458 Bacteria 611
908 Ga0310109_025226 3300036534 Bacteria 797
909 Ga0373925_0000462 3300037068 Bacteria 40936
910 Ga0373925_0011487 3300037068 Bacteria 6408
911 Ga0373925_0033423 3300037068 Bacteria 3790
912 Ga0373925_0115773 3300037068 Bacteria 2076
913 Ga0373925_0255216 3300037068 Bacteria 1407
914 Ga0373925_0333023 3300037068 Bacteria 1230
915 Ga0373925_0380369 3300037068 Bacteria 1149
916 Ga0373925_0399786 3300037068 Bacteria 1120
917 Ga0373925_1104536 3300037068 Bacteria 652
918 Ga0395900_0009031 3300037418 Bacteria 10220
919 Ga0395900_0158767 3300037418 Bacteria 2308
920 Ga0395900_0453880 3300037418 Bacteria 1238
921 Ga0395898_0008119 3300037466 Bacteria 11113
922 Ga0395898_0113253 3300037466 Bacteria 2600
923 Ga0395898_0151868 3300037466 Bacteria 2216
924 Ga0395898_0348507 3300037466 Bacteria 1412
925 Ga0395905_0003811 3300037471 Bacteria 15942
926 Ga0395905_0024981 3300037471 Bacteria 5635
927 Ga0395905_0489194 3300037471 Bacteria 1130
928 Ga0436364_1112930 3300037853 Bacteria 3994
929 Ga0395901_0190253 3300038443 Bacteria 2152
930 Ga0395901_0430847 3300038443 Bacteria 1351
931 Ga0436365_0042070 3300039437 Bacteria 803
932 Ga0436365_0085392 3300039437 Bacteria 1248
933 Ga0436365_0245742 3300039437 Bacteria 809
934 Ga0436365_0266253 3300039437 Bacteria 1092
935 Ga0436365_0380670 3300039437 Bacteria 1669
936 Ga0436365_0405335 3300039437 Bacteria 642
937 Ga0436365_0593482 3300039437 Bacteria 857
938 Ga0436365_0594053 3300039437 Bacteria 722
939 Ga0436365_0823182 3300039437 Bacteria 721
940 Ga0436365_0921625 3300039437 Bacteria 24575
941 Ga0436365_1532080 3300039437 Bacteria 1280
942 Ga0436361_0999682 3300039447 Bacteria 526
943 Ga0436363_0033464 3300039450 Bacteria 793
944 Ga0436363_0726793 3300039450 Bacteria 1666
945 Ga0436363_0767229 3300039450 Bacteria 1464
946 Ga0436363_1660925 3300039450 Bacteria 2753
947 Ga0436362_0629335 3300039453 Bacteria 3750
948 Ga0436362_0985474 3300039453 Bacteria 776
949 Ga0436362_1147499 3300039453 Bacteria 563
950 Ga0439465_0125004 3300041413 Bacteria 904
951 Ga0451789_0003421 3300041443 Bacteria 911
952 Ga0451793_1933064 3300041452 Bacteria 2432
953 Ga0451800_0254077 3300041459 Bacteria 1015
954 Ga0451802_0631769 3300041460 Bacteria 650
955 Ga0451802_0679946 3300041460 Bacteria 1027
956 Ga0451802_1086364 3300041460 Bacteria 1630
957 Ga0451804_0307913 3300041463 Bacteria 1464
958 Ga0451807_0993385 3300041486 Bacteria 1044
959 Ga0451807_1734372 3300041486 Bacteria 704
960 Ga0451837_1625367 3300041494 Bacteria 1157
961 Ga0451839_0776644 3300041496 Bacteria 930
962 Ga0451841_0591288 3300041498 Bacteria 827
963 Ga0451849_0032440 3300041505 Bacteria 953
964 Ga0451851_0715062 3300041507 Bacteria 759
965 Ga0451843_0159796 3300041509 Bacteria 883
966 Ga0451853_2893679 3300041512 Bacteria 660
967 Ga0451853_3226891 3300041512 Bacteria 1480
968 Ga0439431_0255678 3300041997 Bacteria 520
969 Ga0439448_0204978 3300042005 Bacteria 692
970 Ga0439455_0134205 3300042012 Bacteria 699
971 Ga0451577_0062346 3300042876 Bacteria 3325
972 Ga0451577_0384233 3300042876 Bacteria 1274
973 Ga0451577_0398228 3300042876 Bacteria 1249
974 Ga0451577_0549311 3300042876 Bacteria 1049
975 Ga0451577_0693797 3300042876 Unclassified 922
976 Ga0451577_0715825 3300042876 Bacteria 906
977 Ga0451577_1008073 3300042876 Bacteria 747
978 Ga0466969_0158615 3300044656 Bacteria 1040
979 Ga0466969_0313346 3300044656 Bacteria 710
980 Ga0466972_0000274 3300044658 Bacteria 32491
981 Ga0466972_0168721 3300044658 Bacteria 1027
982 Ga0466965_0159700 3300044683 Bacteria 1181
983 Ga0466965_0400087 3300044683 Bacteria 759
984 Ga0466966_0366777 3300044684 Bacteria 865
985 Ga0466963_0020169 3300044694 Bacteria 4190
986 Ga0466964_0018182 3300044706 Bacteria 2695
987 Ga0466964_0065526 3300044706 Bacteria 1522
988 Ga0466964_0125688 3300044706 Bacteria 1161
989 Ga0466964_0242361 3300044706 Bacteria 885
990 Ga0453684_0001512 3300044712 Bacteria 65271
991 Ga0453684_0008350 3300044712 Bacteria 18605
992 Ga0453684_0171982 3300044712 Bacteria 2552
993 Ga0453684_0269919 3300044712 Bacteria 1944
994 Ga0466971_0108755 3300044719 Bacteria 1278
995 Ga0466968_0063903 3300044735 Bacteria 1591
996 Ga0466970_0056792 3300044765 Bacteria 2092
997 Ga0466970_0329598 3300044765 Bacteria 864
998 Ga0466957_0216315 3300044842 Bacteria 1264
999 Ga0466960_0027592 3300044901 Bacteria 2591
1000 Ga0466960_0601018 3300044901 Bacteria 653
1001 Ga0466959_0492938 3300045049 Bacteria 828
1002 Ga0451576_0066823 3300045051 Bacteria 3742
1003 Ga0451576_0249144 3300045051 Bacteria 1856
1004 Ga0451576_0271232 3300045051 Bacteria 1774
1005 Ga0466967_0024320 3300045976 Bacteria 4978
1006 Ga0466967_0040143 3300045976 Bacteria 4028
1007 Ga0495627_067260 3300046453 Bacteria 1051
1008 Ga0495592_0000090 3300046454 Bacteria 80171
1009 Ga0495592_0001238 3300046454 Bacteria 17695
1010 Ga0495592_0012178 3300046454 Bacteria 6527
1011 Ga0495592_0051683 3300046454 Bacteria 3052
1012 Ga0495592_0464700 3300046454 Bacteria 791
1013 Ga0495592_0520146 3300046454 Bacteria 736
1014 Ga0495603_0000051 3300046455 Bacteria 50402
1015 Ga0495603_0024048 3300046455 Bacteria 3685
1016 Ga0495603_0025337 3300046455 Bacteria 3587
1017 Ga0495603_0052399 3300046455 Bacteria 2423
1018 Ga0495603_0381656 3300046455 Bacteria 808
1019 Ga0495603_0458406 3300046455 Bacteria 730
1020 Ga0495603_0619393 3300046455 Bacteria 619
1021 Ga0495591_049105 3300046458 Bacteria 1161
1022 Ga0495629_0000182 3300046459 Bacteria 56655
1023 Ga0495629_0000750 3300046459 Bacteria 26239
1024 Ga0495629_0017208 3300046459 Bacteria 5185
1025 Ga0495629_0116031 3300046459 Bacteria 1866
1026 Ga0495629_0305515 3300046459 Bacteria 1089
1027 Ga0495638_0010821 3300046460 Bacteria 6308
1028 Ga0495638_0020879 3300046460 Bacteria 4324
1029 Ga0495638_0195596 3300046460 Bacteria 1145
1030 Ga0495638_0299920 3300046460 Bacteria 866
1031 Ga0495641_0006669 3300046461 Bacteria 7421
1032 Ga0495651_0000682 3300046462 Bacteria 26412
1033 Ga0495651_0013418 3300046462 Bacteria 6336
1034 Ga0495651_0014625 3300046462 Bacteria 6067
1035 Ga0495653_0000322 3300046463 Bacteria 38965
1036 Ga0495653_0007956 3300046463 Bacteria 8681
1037 Ga0495653_0025338 3300046463 Bacteria 4769
1038 Ga0495650_0072313 3300046471 Bacteria 1350
1039 Ga0495580_0017526 3300046472 Bacteria 5355
1040 Ga0495580_0082309 3300046472 Bacteria 2243
1041 Ga0495580_0424619 3300046472 Bacteria 894
1042 Ga0495582_0000025 3300046473 Bacteria 82063
1043 Ga0495582_0428192 3300046473 Bacteria 764
1044 Ga0495605_0046241 3300046474 Bacteria 2141
1045 Ga0495639_0007403 3300046475 Bacteria 4714
1046 Ga0495639_0047306 3300046475 Bacteria 1948
1047 Ga0495639_0061595 3300046475 Bacteria 1721
1048 Ga0495639_0077710 3300046475 Bacteria 1541
1049 Ga0495639_0212430 3300046475 Bacteria 949
1050 Ga0495639_0581458 3300046475 Bacteria 575
1051 Ga0495662_0000583 3300046476 Bacteria 16810
1052 Ga0495662_0059952 3300046476 Bacteria 1838
1053 Ga0495662_0087373 3300046476 Bacteria 1519
1054 Ga0495662_0332578 3300046476 Bacteria 747
1055 Ga0495664_0000078 3300046477 Bacteria 47377
1056 Ga0495664_0004145 3300046477 Bacteria 7913
1057 Ga0495664_0004921 3300046477 Bacteria 7309
1058 Ga0495664_0218356 3300046477 Bacteria 1154
1059 Ga0495664_0222054 3300046477 Bacteria 1144
1060 Ga0495584_0182774 3300046491 Bacteria 1065
1061 Ga0495584_0205217 3300046491 Bacteria 1002
1062 Ga0495585_0093083 3300046492 Bacteria 1621
1063 Ga0495585_0248900 3300046492 Bacteria 887
1064 Ga0495594_0002799 3300046499 Bacteria 9050
1065 Ga0495594_0149558 3300046499 Bacteria 1326
1066 Ga0495594_0212459 3300046499 Bacteria 1103
1067 Ga0495594_0249305 3300046499 Bacteria 1012
1068 Ga0495594_0348315 3300046499 Bacteria 843
1069 Ga0495596_0069274 3300046500 Bacteria 1371
1070 Ga0495607_0038824 3300046501 Bacteria 2849
1071 Ga0495583_0047989 3300046506 Bacteria 1961
1072 Ga0495606_0001505 3300046507 Bacteria 30975
1073 Ga0495606_0064386 3300046507 Bacteria 2333
1074 Ga0495606_0270265 3300046507 Bacteria 934
1075 Ga0495608_0000022 3300046511 Bacteria 165111
1076 Ga0495608_0000738 3300046511 Bacteria 22828
1077 Ga0495608_0056748 3300046511 Bacteria 2585
1078 Ga0495610_0067542 3300046512 Bacteria 1679
1079 Ga0495610_0082229 3300046512 Bacteria 1476
1080 Ga0495610_0127697 3300046512 Bacteria 1107
1081 Ga0495616_0054584 3300046513 Bacteria 1981
1082 Ga0495616_0065146 3300046513 Bacteria 1776
1083 Ga0495616_0134315 3300046513 Bacteria 1131
1084 Ga0495618_0000229 3300046514 Bacteria 40948
1085 Ga0495618_0185562 3300046514 Bacteria 1320
1086 Ga0495620_0067580 3300046515 Bacteria 1470
1087 Ga0495620_0155379 3300046515 Bacteria 890
1088 Ga0495620_0208563 3300046515 Bacteria 750
1089 Ga0495628_0000035 3300046516 Bacteria 111560
1090 Ga0495628_0005837 3300046516 Bacteria 10785
1091 Ga0495628_0025875 3300046516 Bacteria 4792
1092 Ga0495628_0042830 3300046516 Bacteria 3609
1093 Ga0495628_0281424 3300046516 Bacteria 1235
1094 Ga0495630_0000377 3300046517 Bacteria 35153
1095 Ga0495630_0034359 3300046517 Bacteria 3786
1096 Ga0495630_0222377 3300046517 Bacteria 1441
1097 Ga0495630_0903802 3300046517 Bacteria 672
1098 Ga0495631_0033956 3300046518 Bacteria 2288
1099 Ga0495632_0195446 3300046519 Bacteria 923
1100 Ga0495632_0212873 3300046519 Bacteria 876
1101 Ga0495632_0239056 3300046519 Bacteria 817
1102 Ga0495637_0179522 3300046520 Bacteria 785
1103 Ga0495637_0314914 3300046520 Bacteria 553
1104 Ga0495643_0047558 3300046522 Bacteria 2322
1105 Ga0495643_0171789 3300046522 Bacteria 1059
1106 Ga0495643_0239919 3300046522 Bacteria 851
1107 Ga0495643_0413887 3300046522 Bacteria 592
1108 Ga0495644_0023135 3300046523 Bacteria 2366
1109 Ga0495644_0341994 3300046523 Bacteria 588
1110 Ga0495644_0374016 3300046523 Bacteria 562
1111 Ga0495648_0052870 3300046524 Bacteria 2464
1112 Ga0495648_0067297 3300046524 Bacteria 2095
1113 Ga0495648_0190885 3300046524 Bacteria 1033
1114 Ga0495648_0214321 3300046524 Bacteria 954
1115 Ga0495648_0299264 3300046524 Bacteria 754
1116 Ga0495666_0033207 3300046526 Bacteria 2522
1117 Ga0495652_0000062 3300046529 Bacteria 111572
1118 Ga0495652_0004125 3300046529 Bacteria 14021
1119 Ga0495652_0028961 3300046529 Bacteria 4865
1120 Ga0495652_0807334 3300046529 Bacteria 624
1121 Ga0495654_0016687 3300046530 Bacteria 3873
1122 Ga0495665_0000195 3300046531 Bacteria 31231
1123 Ga0495665_0057443 3300046531 Bacteria 2054
1124 Ga0495640_0000021 3300046533 Bacteria 110511
1125 Ga0495640_0023048 3300046533 Bacteria 4545
1126 Ga0495640_0035969 3300046533 Bacteria 3502
1127 Ga0495640_0148669 3300046533 Bacteria 1506
1128 Ga0495586_0151857 3300046535 Bacteria 1303
1129 Ga0495586_0737604 3300046535 Bacteria 568
1130 Ga0495587_0000006 3300046536 Bacteria 310070
1131 Ga0495587_0006945 3300046536 Bacteria 7353
1132 Ga0495587_0304296 3300046536 Bacteria 891
1133 Ga0495587_0333946 3300046536 Bacteria 846
1134 Ga0495609_0019137 3300046538 Bacteria 3170
1135 Ga0495609_0279273 3300046538 Bacteria 683
1136 Ga0495597_0009354 3300046542 Bacteria 4847
1137 Ga0495597_0211011 3300046542 Bacteria 774
1138 Ga0495645_0000174 3300046543 Bacteria 44827
1139 Ga0495645_0046137 3300046543 Bacteria 3177
1140 Ga0495645_0053146 3300046543 Bacteria 2945
1141 Ga0495645_0102777 3300046543 Bacteria 2031
1142 Ga0495622_0001733 3300046557 Bacteria 10791
1143 Ga0495622_0031540 3300046557 Bacteria 2476
1144 Ga0495622_0186043 3300046557 Bacteria 930
1145 Ga0495633_0085037 3300046558 Bacteria 1471
1146 Ga0495633_0139098 3300046558 Bacteria 1123
1147 Ga0495633_0156673 3300046558 Bacteria 1051
1148 Ga0495633_0212747 3300046558 Bacteria 886
1149 Ga0495633_0373406 3300046558 Bacteria 645
1150 Ga0495667_0000161 3300046559 Bacteria 45781
1151 Ga0495667_0004219 3300046559 Bacteria 9686
1152 Ga0495667_0014506 3300046559 Bacteria 5322
1153 Ga0495667_0052392 3300046559 Bacteria 2688
1154 Ga0495667_0059306 3300046559 Bacteria 2512
1155 Ga0495667_0366042 3300046559 Bacteria 910
1156 Ga0495667_1019128 3300046559 Bacteria 504
1157 Ga0495656_0014978 3300046615 Bacteria 2917
1158 Ga0495656_0098347 3300046615 Bacteria 1349
1159 Ga0495656_0115210 3300046615 Bacteria 1262
1160 Ga0495668_0122222 3300046616 Bacteria 1424
1161 Ga0495668_0145889 3300046616 Bacteria 1295
1162 Ga0495668_0161016 3300046616 Bacteria 1229
1163 Ga0495634_0000350 3300046642 Bacteria 44772
1164 Ga0495634_0005743 3300046642 Bacteria 9475
1165 Ga0495634_0052709 3300046642 Bacteria 2727
1166 Ga0495634_0056209 3300046642 Bacteria 2630
1167 Ga0495634_0081282 3300046642 Bacteria 2119
1168 Ga0495611_0095356 3300046648 Bacteria 1377
1169 Ga0495611_0269718 3300046648 Bacteria 787
1170 Ga0495611_0297521 3300046648 Bacteria 744
1171 Ga0495611_0383120 3300046648 Bacteria 643
1172 Ga0495625_0101947 3300046660 Bacteria 1970
1173 Ga0495625_0221036 3300046660 Bacteria 1241
1174 Ga0495625_0300109 3300046660 Bacteria 1028
1175 Ga0495635_0000018 3300046663 Bacteria 193591
1176 Ga0495635_0000166 3300046663 Bacteria 40939
1177 Ga0495635_0004315 3300046663 Bacteria 9844
1178 Ga0495635_0018719 3300046663 Bacteria 4831
1179 Ga0495635_0102091 3300046663 Bacteria 1960
1180 Ga0495661_0091077 3300046665 Bacteria 1734
1181 Ga0495661_0091627 3300046665 Bacteria 1728
1182 Ga0495588_0002009 3300046674 Bacteria 8695
1183 Ga0495588_0009190 3300046674 Bacteria 4563
1184 Ga0495588_0016010 3300046674 Bacteria 3619
1185 Ga0495588_0204504 3300046674 Bacteria 1043
1186 Ga0495657_0000245 3300046675 Bacteria 49381
1187 Ga0495657_0005822 3300046675 Bacteria 9704
1188 Ga0495657_0016378 3300046675 Bacteria 5402
1189 Ga0495657_0054952 3300046675 Bacteria 2658
1190 Ga0495657_0527437 3300046675 Bacteria 687
1191 Ga0495599_0000032 3300046678 Bacteria 108178
1192 Ga0495599_0014529 3300046678 Bacteria 4875
1193 Ga0495599_0166242 3300046678 Bacteria 1362
1194 Ga0495599_0328783 3300046678 Bacteria 919
1195 Ga0495623_0000004 3300046679 Bacteria 142249
1196 Ga0495623_0002267 3300046679 Bacteria 12801
1197 Ga0495646_0000083 3300046680 Bacteria 45193
1198 Ga0495646_0002103 3300046680 Bacteria 12076
1199 Ga0495647_0002805 3300046681 Bacteria 5527
1200 Ga0495647_0281574 3300046681 Bacteria 746
1201 Ga0495658_0002361 3300046683 Bacteria 9539
1202 Ga0495658_0015804 3300046683 Bacteria 3877
1203 Ga0495658_0043206 3300046683 Bacteria 2520
1204 Ga0495658_0208075 3300046683 Bacteria 1221
1205 Ga0495669_0248088 3300046684 Bacteria 855
1206 Ga0495669_0292643 3300046684 Bacteria 784
1207 Ga0495669_0366981 3300046684 Bacteria 696
1208 Ga0495613_0006158 3300046689 Bacteria 8979
1209 Ga0495613_0025336 3300046689 Bacteria 4420
1210 Ga0495613_0026055 3300046689 Bacteria 4357
1211 Ga0495613_0767128 3300046689 Bacteria 631
1212 Ga0495624_0000898 3300046690 Bacteria 23624
1213 Ga0495624_0263353 3300046690 Bacteria 1042
1214 Ga0495624_0411268 3300046690 Bacteria 812
1215 Ga0495624_0483252 3300046690 Bacteria 741
1216 Ga0495670_0015791 3300046691 Bacteria 3711
1217 Ga0495670_0073621 3300046691 Bacteria 1731
1218 Ga0495671_0212948 3300046692 Bacteria 936
1219 Ga0495671_0256829 3300046692 Bacteria 843
1220 Ga0495671_0417277 3300046692 Bacteria 642
1221 Ga0495671_0490135 3300046692 Bacteria 586
1222 Ga0495649_0215041 3300046694 Bacteria 995
1223 Ga0495649_0385658 3300046694 Bacteria 705
1224 Ga0495649_0388659 3300046694 Bacteria 701
1225 Ga0495589_0219698 3300046794 Bacteria 893
1226 Ga0495589_0259198 3300046794 Bacteria 811
1227 Ga0495589_0265535 3300046794 Bacteria 800
1228 Ga0495589_0369885 3300046794 Bacteria 659
1229 Ga0495589_0395888 3300046794 Bacteria 634
1230 Ga0495600_0000022 3300046809 Bacteria 94789
1231 Ga0495600_0005583 3300046809 Bacteria 7596
1232 Ga0495600_0347429 3300046809 Bacteria 930
1233 Ga0495600_0790411 3300046809 Bacteria 566
1234 Ga0495660_0053737 3300046810 Bacteria 2185
1235 Ga0495581_0000187 3300047315 Bacteria 28682
1236 Ga0495581_0034768 3300047315 Bacteria 2916
1237 Ga0495581_0127338 3300047315 Bacteria 1483
1238 Ga0495581_0460226 3300047315 Bacteria 741
1239 Ga0495604_0000011 3300047317 Bacteria 292024
1240 Ga0495604_0004924 3300047317 Bacteria 10588
1241 Ga0495604_0117147 3300047317 Bacteria 1932
1242 Ga0495604_0378628 3300047317 Bacteria 935
1243 Ga0495604_0455490 3300047317 Bacteria 835
1244 Ga0495636_0238697 3300047318 Bacteria 838
1245 Ga0495674_0000034 3300047319 Bacteria 110674
1246 Ga0495674_0003575 3300047319 Bacteria 15109
1247 Ga0495674_0005019 3300047319 Bacteria 12726
1248 Ga0495674_0013003 3300047319 Bacteria 7835
1249 Ga0495674_0079738 3300047319 Bacteria 2811
1250 Ga0495674_0232372 3300047319 Bacteria 1521
1251 Ga0495674_0460149 3300047319 Bacteria 1021
1252 Ga0495672_0050924 3300047320 Bacteria 2441
1253 Ga0495672_0155002 3300047320 Bacteria 1184
1254 Ga0495672_0179053 3300047320 Bacteria 1075
1255 Ga0495672_0201003 3300047320 Bacteria 996
1256 Ga0495672_0259049 3300047320 Bacteria 840
1257 Ga0495672_0263491 3300047320 Bacteria 831
1258 Ga0495676_0013511 3300047321 Bacteria 7338
1259 Ga0495676_0060198 3300047321 Bacteria 2978
1260 Ga0495676_0077799 3300047321 Bacteria 2528
1261 Ga0495676_0417491 3300047321 Bacteria 888
1262 Ga0495680_0000290 3300047322 Bacteria 56506
1263 Ga0495680_0004903 3300047322 Bacteria 12674
1264 Ga0495680_0132741 3300047322 Bacteria 1828
1265 Ga0495680_0334977 3300047322 Bacteria 1056
1266 Ga0495680_0909340 3300047322 Bacteria 568
1267 Ga0495680_0937984 3300047322 Bacteria 557
1268 Ga0495683_0047102 3300047323 Bacteria 2163
1269 Ga0495683_0285280 3300047323 Bacteria 713
1270 Ga0495687_011239 3300047443 Bacteria 4828
1271 Ga0495675_0000352 3300047444 Bacteria 32304
1272 Ga0495675_0000770 3300047444 Bacteria 19951
1273 Ga0495675_0012692 3300047444 Bacteria 5302
1274 Ga0495675_0710794 3300047444 Bacteria 562
1275 Ga0495679_143817 3300047446 Bacteria 643
1276 Ga0495685_081282 3300047447 Bacteria 1079
1277 Ga0495685_195857 3300047447 Bacteria 648
1278 Ga0495673_0046688 3300047469 Bacteria 1918
1279 Ga0495673_0165924 3300047469 Bacteria 844
1280 Ga0495673_0235178 3300047469 Bacteria 673
1281 Ga0495673_0309667 3300047469 Bacteria 564
1282 Ga0495681_0274420 3300047470 Bacteria 659
1283 Ga0495684_0000012 3300047471 Bacteria 187118
1284 Ga0495684_0000501 3300047471 Bacteria 31747
1285 Ga0495684_0117831 3300047471 Bacteria 2001
1286 Ga0495684_0731871 3300047471 Bacteria 653
1287 Ga0495686_0049725 3300047472 Bacteria 2636
1288 Ga0495686_0139108 3300047472 Bacteria 1433
1289 Ga0495686_0180773 3300047472 Bacteria 1222
1290 Ga0495686_0195326 3300047472 Bacteria 1164
1291 Ga0495686_0453986 3300047472 Bacteria 680
1292 Ga0495593_0000469 3300047673 Bacteria 22695
1293 Ga0495593_0005905 3300047673 Bacteria 7211
1294 Ga0495593_0006360 3300047673 Bacteria 6928
1295 Ga0495593_0011797 3300047673 Bacteria 5011
1296 Ga0495602_0000064 3300048088 Bacteria 104858
1297 Ga0495602_0019776 3300048088 Bacteria 6673
1298 Ga0495602_0050110 3300048088 Bacteria 3734
1299 Ga0495602_0370624 3300048088 Bacteria 1028
1300 Ga0495602_0842467 3300048088 Bacteria 613
1301 Ga0495614_0092802 3300048089 Bacteria 1314
1302 Ga0495614_0206171 3300048089 Bacteria 891
1303 Ga0495615_0154977 3300048090 Bacteria 684
1304 Ga0495626_0123901 3300048091 Bacteria 1108
1305 Ga0496100_0026252 3300048903 Bacteria 3570
1306 Ga0496100_0045083 3300048903 Bacteria 2828
1307 Ga0496100_0239782 3300048903 Bacteria 1337
1308 Ga0496100_0441582 3300048903 Bacteria 996
1309 Ga0496100_0536630 3300048903 Bacteria 904
1310 Ga0496100_0670279 3300048903 Bacteria 808
1311 Ga0496100_0945233 3300048903 Bacteria 677
1312 Ga0496101_0001656 3300048904 Bacteria 13367
1313 Ga0496101_0038367 3300048904 Bacteria 3402
1314 Ga0496101_0040994 3300048904 Bacteria 3299
1315 Ga0496101_0090035 3300048904 Bacteria 2281
1316 Ga0496101_0160302 3300048904 Bacteria 1725
1317 Ga0496101_0662701 3300048904 Bacteria 824
1318 Ga0496101_0915158 3300048904 Bacteria 690
1319 Ga0496101_1309443 3300048904 Bacteria 566
1320 Ga0496102_0003166 3300048905 Bacteria 13960
1321 Ga0496102_0010759 3300048905 Bacteria 7880
1322 Ga0496102_0015959 3300048905 Bacteria 6553
1323 Ga0496102_0098200 3300048905 Bacteria 2717
1324 Ga0496102_0107507 3300048905 Bacteria 2597
1325 Ga0496102_0157479 3300048905 Bacteria 2135
1326 Ga0496102_0514920 3300048905 Bacteria 1119
1327 Ga0496102_0553494 3300048905 Bacteria 1073
1328 Ga0496102_1382650 3300048905 Bacteria 623
1329 Ga0496103_0004565 3300048906 Bacteria 8385
1330 Ga0496103_0016825 3300048906 Bacteria 4367
1331 Ga0496103_0026693 3300048906 Bacteria 3496
1332 Ga0496103_0163899 3300048906 Bacteria 1426
1333 Ga0496103_0675293 3300048906 Bacteria 655
1334 Ga0496104_0004595 3300048907 Bacteria 12035
1335 Ga0496104_0018749 3300048907 Bacteria 6318
1336 Ga0496104_0028670 3300048907 Bacteria 5160
1337 Ga0496104_0137623 3300048907 Bacteria 2346
1338 Ga0496105_0017472 3300048908 Bacteria 5753
1339 Ga0496105_0040208 3300048908 Bacteria 3854
1340 Ga0496105_0049487 3300048908 Bacteria 3470
1341 Ga0496105_0058959 3300048908 Bacteria 3167
1342 Ga0496105_0243128 3300048908 Bacteria 1460
1343 Ga0496106_0002121 3300048909 Bacteria 14838
1344 Ga0496106_0004829 3300048909 Bacteria 9973
1345 Ga0496106_0026288 3300048909 Bacteria 4333
1346 Ga0496106_0041586 3300048909 Bacteria 3444
1347 Ga0496106_0067637 3300048909 Bacteria 2724
1348 Ga0496106_0111063 3300048909 Bacteria 2134
1349 Ga0496106_0132597 3300048909 Bacteria 1954
1350 Ga0496106_0166558 3300048909 Bacteria 1745
1351 Ga0496106_0324648 3300048909 Bacteria 1236
1352 Ga0496107_0005918 3300048910 Bacteria 8380
1353 Ga0496107_0008140 3300048910 Bacteria 7252
1354 Ga0496107_0053637 3300048910 Bacteria 2908
1355 Ga0496107_0110036 3300048910 Bacteria 2024
1356 Ga0496107_0120945 3300048910 Bacteria 1929
1357 Ga0496107_0180421 3300048910 Bacteria 1568
1358 Ga0496107_0656418 3300048910 Bacteria 773
1359 Ga0496108_0022903 3300048911 Bacteria 5139
1360 Ga0496108_0115465 3300048911 Bacteria 2299
1361 Ga0496108_0159548 3300048911 Bacteria 1948
1362 Ga0496108_0236735 3300048911 Bacteria 1588
1363 Ga0496108_0308673 3300048911 Bacteria 1378
1364 Ga0496108_1190035 3300048911 Bacteria 645
1365 Ga0496109_0010165 3300048912 Bacteria 8032
1366 Ga0496109_0088490 3300048912 Bacteria 2862
1367 Ga0496109_0105241 3300048912 Bacteria 2620
1368 Ga0496109_0256482 3300048912 Bacteria 1647
1369 Ga0496109_0506568 3300048912 Bacteria 1139
1370 Ga0496109_0787100 3300048912 Bacteria 889
1371 Ga0496110_0020972 3300048913 Bacteria 5521
1372 Ga0496110_0028359 3300048913 Bacteria 4808
1373 Ga0496110_0051881 3300048913 Bacteria 3605
1374 Ga0496110_0193956 3300048913 Bacteria 1844
1375 Ga0496110_0197535 3300048913 Bacteria 1827
1376 Ga0496110_0283861 3300048913 Bacteria 1508
1377 Ga0496110_0321622 3300048913 Bacteria 1409
1378 Ga0496110_0663164 3300048913 Bacteria 943
1379 Ga0496111_0092714 3300048914 Bacteria 2214
1380 Ga0496111_0138489 3300048914 Bacteria 1803
1381 Ga0496111_0180072 3300048914 Bacteria 1571
1382 Ga0496111_0251012 3300048914 Bacteria 1313
1383 Ga0496111_0554542 3300048914 Bacteria 843
1384 Ga0496112_0000040 3300048915 Bacteria 89057
1385 Ga0496112_0002949 3300048915 Bacteria 13878
1386 Ga0496112_0020266 3300048915 Bacteria 6299
1387 Ga0496112_0040204 3300048915 Bacteria 4572
1388 Ga0496112_0048391 3300048915 Bacteria 4168
1389 Ga0496112_0068339 3300048915 Bacteria 3508
1390 Ga0496112_0183612 3300048915 Bacteria 2055
1391 Ga0496112_0202992 3300048915 Bacteria 1941
1392 Ga0496112_0667664 3300048915 Bacteria 968
1393 Ga0496113_0015214 3300048916 Bacteria 5279
1394 Ga0496113_0020040 3300048916 Bacteria 4693
1395 Ga0496113_0047223 3300048916 Bacteria 3199
1396 Ga0496113_0539310 3300048916 Bacteria 936
1397 Ga0496113_0820392 3300048916 Bacteria 738
1398 Ga0496113_1163731 3300048916 Bacteria 603
1399 Ga0496114_0008695 3300048917 Bacteria 8045
1400 Ga0496114_0193148 3300048917 Bacteria 1782
1401 Ga0496114_0334842 3300048917 Bacteria 1338
1402 Ga0496114_0386257 3300048917 Bacteria 1239
1403 Ga0496114_0640754 3300048917 Bacteria 935
1404 Ga0496114_1186606 3300048917 Bacteria 649
1405 Ga0496114_1248625 3300048917 Bacteria 629
1406 Ga0496114_1308302 3300048917 Bacteria 612
1407 Ga0496114_1424215 3300048917 Bacteria 580
1408 Ga0496115_0002383 3300048918 Bacteria 13482
1409 Ga0496115_0042374 3300048918 Bacteria 3626
1410 Ga0496115_0057832 3300048918 Bacteria 3119
1411 Ga0496115_0114644 3300048918 Bacteria 2215
1412 Ga0496115_0134764 3300048918 Bacteria 2036
1413 Ga0496115_0139755 3300048918 Bacteria 1998
1414 Ga0496115_0210492 3300048918 Bacteria 1606
1415 Ga0496115_0329545 3300048918 Bacteria 1247
1416 Ga0496115_0819038 3300048918 Bacteria 723
1417 Ga0496116_0004777 3300048919 Bacteria 12787
1418 Ga0496116_0091944 3300048919 Bacteria 1842
1419 Ga0496116_0322649 3300048919 Bacteria 722
1420 Ga0496117_0013721 3300048920 Bacteria 7040
1421 Ga0496117_0025524 3300048920 Bacteria 4645
1422 Ga0496117_0111358 3300048920 Bacteria 1704
1423 Ga0496117_0377298 3300048920 Bacteria 723
1424 Ga0496117_0536984 3300048920 Bacteria 559
1425 Ga0496118_0002570 3300048921 Bacteria 24239
1426 Ga0496118_0033149 3300048921 Bacteria 4244
1427 Ga0496118_0040696 3300048921 Bacteria 3692
1428 Ga0496118_0054679 3300048921 Bacteria 3021
1429 Ga0496118_0216079 3300048921 Bacteria 1120
1430 Ga0496118_0445083 3300048921 Bacteria 659
1431 Ga0496119_0046119 3300048922 Bacteria 2725
1432 Ga0496119_0082079 3300048922 Bacteria 1854
1433 Ga0496119_0092898 3300048922 Bacteria 1710
1434 Ga0496119_0222786 3300048922 Bacteria 964
1435 Ga0496120_0144788 3300048923 Bacteria 1202
1436 Ga0496120_0164907 3300048923 Bacteria 1101
1437 Ga0496120_0181023 3300048923 Bacteria 1035
1438 Ga0496120_0200703 3300048923 Bacteria 966
1439 Ga0496121_0000265 3300048924 Bacteria 109251
1440 Ga0496121_0001125 3300048924 Bacteria 47001
1441 Ga0496121_0002837 3300048924 Bacteria 25561
1442 Ga0496121_0003837 3300048924 Bacteria 20905
1443 Ga0496121_0009685 3300048924 Bacteria 11034
1444 Ga0496121_0016535 3300048924 Bacteria 7610
1445 Ga0496121_0017138 3300048924 Bacteria 7421
1446 Ga0496121_0020230 3300048924 Bacteria 6602
1447 Ga0496121_0073946 3300048924 Bacteria 2728
1448 Ga0496121_0083038 3300048924 Bacteria 2530
1449 Ga0496121_0141250 3300048924 Bacteria 1786
1450 Ga0496121_0155050 3300048924 Bacteria 1681
1451 Ga0496121_0331373 3300048924 Bacteria 1021
1452 Ga0496121_0453592 3300048924 Bacteria 825
1453 Ga0496121_0583948 3300048924 Bacteria 693
1454 Ga0496121_0644707 3300048924 Bacteria 646
1455 Ga0496122_0074814 3300048925 Bacteria 2393
1456 Ga0496122_0114191 3300048925 Bacteria 1762
1457 Ga0496122_0129062 3300048925 Bacteria 1611
1458 Ga0496122_0193780 3300048925 Bacteria 1196
1459 Ga0496124_0022017 3300048927 Bacteria 5857
1460 Ga0496124_0234874 3300048927 Bacteria 1368
1461 Ga0496124_0293589 3300048927 Bacteria 1178
1462 Ga0496124_0627200 3300048927 Bacteria 694
1463 Ga0496124_0700163 3300048927 Bacteria 642
1464 Ga0496125_0002054 3300048928 Bacteria 27194
1465 Ga0496125_0016454 3300048928 Bacteria 7099
1466 Ga0496125_0047446 3300048928 Bacteria 3591
1467 Ga0496125_0252537 3300048928 Bacteria 1111
1468 Ga0496125_0561169 3300048928 Bacteria 631
1469 Ga0496126_0005480 3300048929 Bacteria 14467
1470 Ga0496126_0011540 3300048929 Bacteria 9128
1471 Ga0496126_0031487 3300048929 Bacteria 5010
1472 Ga0496126_0051010 3300048929 Bacteria 3769
1473 Ga0496126_0082566 3300048929 Bacteria 2839
1474 Ga0496126_0173318 3300048929 Bacteria 1836
1475 Ga0496126_0212625 3300048929 Bacteria 1627
1476 Ga0496126_0323879 3300048929 Bacteria 1266
1477 Ga0496126_0326786 3300048929 Bacteria 1259
1478 Ga0496126_0350187 3300048929 Bacteria 1208
1479 Ga0496126_0354501 3300048929 Bacteria 1199
1480 Ga0496126_0419105 3300048929 Bacteria 1083
1481 Ga0496126_0639311 3300048929 Bacteria 834
1482 Ga0496126_1064547 3300048929 Bacteria 603
1483 Ga0495678_086058 3300049459 Bacteria 1118
1484 Ga0495682_0222629 3300049460 Bacteria 668
1485 Ga0495682_0223451 3300049460 Bacteria 667
1486 Ga0501031_0005620 3300049568 Bacteria 8169
1487 Ga0501031_0037214 3300049568 Bacteria 3174
1488 Ga0501031_0130145 3300049568 Bacteria 1644
1489 Ga0501032_0001270 3300049569 Bacteria 20219
1490 Ga0501032_0004513 3300049569 Bacteria 10476
1491 Ga0501032_0056453 3300049569 Bacteria 2639
1492 Ga0501032_0600840 3300049569 Bacteria 700
1493 Ga0501033_0000175 3300049570 Bacteria 60845
1494 Ga0501033_0015137 3300049570 Bacteria 5852
1495 Ga0501034_0000202 3300049571 Bacteria 112985
1496 Ga0501034_0047397 3300049571 Bacteria 4339
1497 Ga0501034_0114578 3300049571 Bacteria 2684
1498 Ga0501036_0000042 3300049572 Bacteria 79876
1499 Ga0501036_0022055 3300049572 Bacteria 5355
1500 Ga0501036_0122464 3300049572 Bacteria 2196
1501 Ga0501036_0363694 3300049572 Bacteria 1208
1502 Ga0501036_0628188 3300049572 Bacteria 890
1503 Ga0501037_0000100 3300049573 Bacteria 81013
1504 Ga0501037_0034827 3300049573 Bacteria 3714
1505 Ga0501037_0117071 3300049573 Bacteria 1917
1506 Ga0501037_0716007 3300049573 Bacteria 665
1507 Ga0501038_0000157 3300049574 Bacteria 58169
1508 Ga0501038_0004335 3300049574 Bacteria 13194
1509 Ga0501038_0093604 3300049574 Bacteria 2513
1510 Ga0501039_0000216 3300049575 Bacteria 42349
1511 Ga0501039_0069527 3300049575 Bacteria 2734
1512 Ga0501039_0070882 3300049575 Bacteria 2707
1513 Ga0501039_0356563 3300049575 Bacteria 1149
1514 Ga0501040_0009591 3300049576 Bacteria 6314
1515 Ga0501040_0198285 3300049576 Bacteria 1425
1516 Ga0501040_0362394 3300049576 Bacteria 1039
1517 Ga0501040_0549875 3300049576 Bacteria 833
1518 Ga0501041_0383483 3300049577 Bacteria 889
1519 Ga0501041_0423790 3300049577 Bacteria 844
1520 Ga0501041_0757479 3300049577 Bacteria 622
1521 Ga0501041_0932845 3300049577 Bacteria 558
1522 Ga0501042_0008128 3300049578 Bacteria 6911
1523 Ga0501042_0019198 3300049578 Bacteria 4743
1524 Ga0501043_0004658 3300049579 Bacteria 11117
1525 Ga0501043_0073021 3300049579 Bacteria 2694
1526 Ga0501043_0149557 3300049579 Bacteria 1827
1527 Ga0501043_0602857 3300049579 Bacteria 811
1528 Ga0501046_0011426 3300049580 Bacteria 7589
1529 Ga0501046_0022043 3300049580 Bacteria 5250
1530 Ga0501046_0072850 3300049580 Bacteria 2666
1531 Ga0501047_0000159 3300049581 Bacteria 82106
1532 Ga0501047_0006707 3300049581 Bacteria 10824
1533 Ga0501047_0092163 3300049581 Bacteria 2908
1534 Ga0501047_0767039 3300049581 Bacteria 780
1535 Ga0501048_0005267 3300049582 Bacteria 9849
1536 Ga0501048_0010436 3300049582 Bacteria 6936
1537 Ga0501048_0102291 3300049582 Bacteria 2021
1538 Ga0501048_0238023 3300049582 Bacteria 1292
1539 Ga0501067_0002974 3300049583 Bacteria 9351
1540 Ga0501067_0017732 3300049583 Bacteria 3942
1541 Ga0501067_0035174 3300049583 Bacteria 2781
1542 Ga0501067_0082621 3300049583 Bacteria 1781
1543 Ga0501068_0000168 3300049584 Bacteria 30562
1544 Ga0501068_0010825 3300049584 Bacteria 5132
1545 Ga0501068_0028519 3300049584 Bacteria 3302
1546 Ga0501069_0011906 3300049585 Bacteria 4615
1547 Ga0501069_0039165 3300049585 Bacteria 2618
1548 Ga0501069_0088588 3300049585 Bacteria 1749
1549 Ga0501070_0016415 3300049586 Bacteria 6221
1550 Ga0501070_0089095 3300049586 Bacteria 2553
1551 Ga0501070_0209207 3300049586 Bacteria 1601
1552 Ga0501070_0319337 3300049586 Bacteria 1263
1553 Ga0501071_0039988 3300049587 Bacteria 3356
1554 Ga0501071_0052969 3300049587 Bacteria 2926
1555 Ga0501071_0109211 3300049587 Bacteria 2044
1556 Ga0501071_0155255 3300049587 Bacteria 1709
1557 Ga0501071_0335709 3300049587 Bacteria 1149
1558 Ga0501071_0658246 3300049587 Bacteria 806
1559 Ga0501072_0000475 3300049588 Bacteria 28798
1560 Ga0501072_0025195 3300049588 Bacteria 4632
1561 Ga0501072_0174662 3300049588 Bacteria 1714
1562 Ga0501072_0647005 3300049588 Bacteria 832
1563 Ga0501072_0700086 3300049588 Bacteria 796
1564 Ga0501073_0000678 3300049589 Bacteria 23931
1565 Ga0501073_0029036 3300049589 Bacteria 3951
1566 Ga0501073_0206051 3300049589 Bacteria 1359
1567 Ga0501074_0000117 3300049590 Bacteria 40113
1568 Ga0501074_0001904 3300049590 Bacteria 14331
1569 Ga0501074_0064795 3300049590 Bacteria 2631
1570 Ga0501074_0264454 3300049590 Bacteria 1223
1571 Ga0501075_0169216 3300049591 Bacteria 1667
1572 Ga0501075_0332019 3300049591 Bacteria 1159
1573 Ga0501076_0016262 3300049592 Bacteria 5638
1574 Ga0501076_0030457 3300049592 Bacteria 4203
1575 Ga0501076_0032845 3300049592 Bacteria 4053
1576 Ga0501076_0126661 3300049592 Bacteria 2070
1577 Ga0501076_0848963 3300049592 Bacteria 753
1578 Ga0501077_0100262 3300049593 Bacteria 1835
1579 Ga0501077_0120879 3300049593 Bacteria 1660
1580 Ga0501079_0009895 3300049741 Bacteria 7234
1581 Ga0501079_0077852 3300049741 Bacteria 2565
1582 Ga0501079_0141351 3300049741 Bacteria 1875
1583 Ga0501079_0205176 3300049741 Bacteria 1539
1584 Ga0501080_0004449 3300049742 Bacteria 12471
1585 Ga0501080_0015418 3300049742 Bacteria 7044
1586 Ga0501080_0086703 3300049742 Bacteria 2909
1587 Ga0501080_0095483 3300049742 Bacteria 2761
1588 Ga0501080_1308971 3300049742 Bacteria 620
1589 Ga0501081_0035611 3300049743 Bacteria 3389
1590 Ga0501081_0156336 3300049743 Bacteria 1641
1591 Ga0501083_0004228 3300049744 Bacteria 10110
1592 Ga0501083_0049179 3300049744 Bacteria 2843
1593 Ga0501083_0134404 3300049744 Bacteria 1621
1594 Ga0501035_0000172 3300049822 Bacteria 79203
1595 Ga0501035_0320325 3300049822 Bacteria 1303
1596 Ga0501035_0336754 3300049822 Bacteria 1265
1597 Ga0501035_0397773 3300049822 Bacteria 1146
1598 Ga0501035_0562782 3300049822 Bacteria 932
1599 Ga0501035_0945897 3300049822 Bacteria 680
1600 Ga0501044_0000282 3300049823 Bacteria 64640
1601 Ga0501044_0359332 3300049823 Bacteria 1374
1602 Ga0501044_0465141 3300049823 Bacteria 1169
1603 Ga0501044_0817800 3300049823 Bacteria 810
1604 Ga0501045_0030903 3300049824 Bacteria 3877
1605 Ga0501045_0099371 3300049824 Bacteria 2153
1606 Ga0501045_0257507 3300049824 Bacteria 1299
1607 Ga0501045_0275163 3300049824 Bacteria 1253
1608 Ga0501045_0500555 3300049824 Bacteria 902
1609 Ga0501045_0544144 3300049824 Bacteria 861
1610 Ga0501045_0605906 3300049824 Bacteria 811
1611 nmdc:mga03683_170414_c1 3300050489 Bacteria 989
1612 nmdc:mga03683_87890_c1 3300050489 Bacteria 1351
1613 nmdc:mga03n38_1311_c1 3300050490 Bacteria 7027
1614 nmdc:mga03n38_197867_c1 3300050490 Bacteria 1039
1615 nmdc:mga03n38_357684_c1 3300050490 Bacteria 796
1616 nmdc:mga03n38_74157_c1 3300050490 Bacteria 1582
1617 nmdc:mga00v17_105861_c1 3300050491 Bacteria 1780
1618 nmdc:mga00v17_20915_c1 3300050491 Bacteria 2847
1619 nmdc:mga00v17_260639_c1 3300050491 Bacteria 1125
1620 nmdc:mga00v17_336215_c1 3300050491 Bacteria 982
1621 nmdc:mga00v17_741630_c1 3300050491 Bacteria 628
1622 nmdc:mga00v17_90873_c1 3300050491 Bacteria 1917
1623 nmdc:mga0yw44_100616_c1 3300050492 Bacteria 1841
1624 nmdc:mga0yw44_175931_c1 3300050492 Bacteria 1407
1625 nmdc:mga0yw44_202540_c1 3300050492 Bacteria 1311
1626 nmdc:mga0yw44_24529_c1 3300050492 Bacteria 2317
1627 nmdc:mga0yw44_31673_c1 3300050492 Bacteria 3077
1628 nmdc:mga0yw44_48177_c1 3300050492 Bacteria 2569
1629 nmdc:mga0yw44_628579_c1 3300050492 Bacteria 730
1630 nmdc:mga0yw44_62959_c1 3300050492 Bacteria 2280
1631 nmdc:mga0yw44_841546_c1 3300050492 Bacteria 623
1632 nmdc:mga0yw44_967079_c1 3300050492 Bacteria 577
1633 nmdc:mga0k408_11902_c1 3300050493 Bacteria 3393
1634 nmdc:mga0k408_126789_c1 3300050493 Bacteria 1514
1635 nmdc:mga0k408_262781_c1 3300050493 Bacteria 1031
1636 nmdc:mga0k408_294138_c1 3300050493 Bacteria 969
1637 nmdc:mga0k408_715058_c1 3300050493 Bacteria 586
1638 nmdc:mga06z11_117592_c1 3300050494 Bacteria 1480
1639 nmdc:mga06z11_18937_c1 3300050494 Bacteria 3155
1640 nmdc:mga04h51_19459_c1 3300050495 Bacteria 1790
1641 nmdc:mga04h51_195161_c1 3300050495 Bacteria 793
1642 nmdc:mga04h51_91122_c1 3300050495 Bacteria 1097
1643 nmdc:mga07m45_18987_c1 3300050496 Bacteria 3720
1644 nmdc:mga07m45_30607_c1 3300050496 Bacteria 2982
1645 nmdc:mga07m45_3363_c1 3300050496 Bacteria 7708
1646 nmdc:mga07m45_430032_c1 3300050496 Bacteria 766
1647 nmdc:mga07m45_683442_c1 3300050496 Bacteria 591
1648 nmdc:mga05p37_214291_c1 3300050507 Bacteria 2326
1649 nmdc:mga0qj67_754949_c1 3300050509 Bacteria 772
1650 nmdc:mga06r32_218511_c1 3300050510 Bacteria 1894
1651 nmdc:mga08y16_356564_c1 3300050511 Bacteria 1502
1652 nmdc:mga08y16_449587_c1 3300050511 Bacteria 1314
1653 nmdc:mga0n895_113627_c1 3300050512 Bacteria 2725
1654 nmdc:mga0n895_1272174_c1 3300050512 Bacteria 707
1655 nmdc:mga0n895_1449844_c1 3300050512 Bacteria 654
1656 nmdc:mga0n895_228943_c1 3300050512 Bacteria 1887
1657 nmdc:mga0n895_728338_c1 3300050512 Bacteria 986
1658 nmdc:mga0rr50_202685_c1 3300050513 Bacteria 1631
1659 nmdc:mga08x19_1052831_c1 3300050514 Bacteria 578
1660 nmdc:mga08x19_5246_c1 3300050514 Bacteria 7669
1661 nmdc:mga0a205_246805_c1 3300050515 Bacteria 1665
1662 nmdc:mga0sz30_11871_c1 3300050516 Bacteria 3378
1663 nmdc:mga0sz30_159126_c1 3300050516 Bacteria 1000
1664 nmdc:mga0sz30_1763_c1 3300050516 Bacteria 7683
1665 nmdc:mga0sz30_20156_c1 3300050516 Bacteria 2688
1666 nmdc:mga0sz30_34913_c1 3300050516 Bacteria 2096
1667 Ga0495601_0000015 3300053077 Bacteria 213851
1668 Ga0495601_0014124 3300053077 Bacteria 4811
1669 Ga0495601_0100600 3300053077 Bacteria 1867
1670 Ga0495612_0000096 3300053078 Bacteria 38017
1671 Ga0495612_0081702 3300053078 Bacteria 1358
1672 Ga0495612_0170846 3300053078 Bacteria 952
1673 Ga0495612_0255806 3300053078 Bacteria 779
1674 Ga0500610_0119506 3300053079 Bacteria 1349
1675 Ga0500635_0024895 3300053080 Bacteria 1882
1676 Ga0495655_0040535 3300053083 Bacteria 1186
1677 Ga0495655_0054133 3300053083 Bacteria 1073
1678 Ga0495655_0127672 3300053083 Bacteria 780
1679 Ga0495595_0000035 3300053084 Bacteria 79822
1680 Ga0495595_0000332 3300053084 Bacteria 18218
1681 Ga0495595_0173013 3300053084 Bacteria 1069
1682 Ga0495595_0389504 3300053084 Bacteria 706
1683 Ga0495619_0000044 3300053085 Bacteria 108581
1684 Ga0495619_0000633 3300053085 Bacteria 23194
1685 Ga0495619_0305695 3300053085 Bacteria 1101
1686 Ga0495619_0378986 3300053085 Bacteria 977
1687 Ga0495619_0445476 3300053085 Bacteria 893
1688 Ga0495619_0887235 3300053085 Bacteria 600
1689 Ga0500578_0428989 3300053086 Bacteria 756
1690 Ga0500578_0622617 3300053086 Bacteria 590
1691 Ga0500643_000016 3300053087 Bacteria 309502
1692 Ga0500643_039291 3300053087 Bacteria 1398
1693 Ga0500644_0011683 3300053088 Bacteria 2407
1694 Ga0500644_0374348 3300053088 Bacteria 618
1695 Ga0500646_0084705 3300053090 Bacteria 972
1696 Ga0500647_0164594 3300053091 Bacteria 1027
1697 Ga0500651_0001377 3300053093 Bacteria 12178
1698 Ga0500651_0050027 3300053093 Bacteria 2624
1699 Ga0500566_0002104 3300053094 Bacteria 11745
1700 Ga0500566_0037299 3300053094 Bacteria 2817
1701 Ga0500641_0001219 3300053096 Bacteria 9151
1702 Ga0500641_0011540 3300053096 Bacteria 3207
1703 Ga0500641_0021459 3300053096 Bacteria 2462
1704 Ga0500641_0038330 3300053096 Bacteria 1925
1705 Ga0500650_0016352 3300053098 Bacteria 3180
1706 Ga0500553_229283 3300053101 Bacteria 594
1707 Ga0500556_0000195 3300053104 Bacteria 49800
1708 Ga0500556_0007068 3300053104 Bacteria 3204
1709 Ga0500556_0224956 3300053104 Bacteria 740
1710 Ga0500557_000011 3300053105 Bacteria 117471
1711 Ga0500557_031893 3300053105 Bacteria 1602
1712 Ga0500562_010064 3300053108 Bacteria 2393
1713 Ga0500562_095183 3300053108 Bacteria 809
1714 Ga0500569_153803 3300053109 Bacteria 776
1715 Ga0500592_000692 3300053116 Bacteria 5549
1716 Ga0500593_193951 3300053117 Bacteria 740
1717 Ga0500594_0027401 3300053118 Bacteria 1475
1718 Ga0500594_0053663 3300053118 Bacteria 1142
1719 Ga0500595_002179 3300053119 Bacteria 9946
1720 Ga0500595_003662 3300053119 Bacteria 7111
1721 Ga0500595_005876 3300053119 Bacteria 5286
1722 Ga0500595_012929 3300053119 Bacteria 3211
1723 Ga0500595_016261 3300053119 Bacteria 2775
1724 Ga0500597_071190 3300053120 Bacteria 1504
1725 Ga0500607_139392 3300053121 Bacteria 1143
1726 Ga0500608_251870 3300053122 Bacteria 688
1727 Ga0500608_350386 3300053122 Bacteria 523
1728 Ga0500618_008174 3300053125 Bacteria 2939
1729 Ga0500618_046364 3300053125 Bacteria 990
1730 Ga0500621_038365 3300053126 Bacteria 1928
1731 Ga0500628_095836 3300053129 Bacteria 779
1732 Ga0500642_0000012 3300053130 Bacteria 206424
1733 Ga0500642_0000090 3300053130 Bacteria 46849
1734 Ga0500642_0004650 3300053130 Bacteria 4326
1735 Ga0500652_000146 3300053131 Bacteria 26947
1736 Ga0500652_228319 3300053131 Bacteria 746
1737 Ga0500658_0410241 3300053134 Bacteria 619
1738 Ga0500559_0005374 3300053136 Bacteria 5895
1739 Ga0500559_0043687 3300053136 Bacteria 1958
1740 Ga0500559_0475973 3300053136 Bacteria 575
1741 Ga0500564_127084 3300053138 Bacteria 1106
1742 Ga0500568_0002038 3300053139 Bacteria 12288
1743 Ga0500568_0008058 3300053139 Bacteria 5114
1744 Ga0500573_0080592 3300053140 Bacteria 1849
1745 Ga0500577_0001485 3300053142 Bacteria 5986
1746 Ga0500577_0040634 3300053142 Bacteria 1693
1747 Ga0500577_0268383 3300053142 Bacteria 743
1748 Ga0500577_0518601 3300053142 Bacteria 520
1749 Ga0500586_004216 3300053145 Bacteria 3490
1750 Ga0500589_024473 3300053147 Bacteria 2788
1751 Ga0500590_064864 3300053148 Bacteria 1828
1752 Ga0500590_212917 3300053148 Bacteria 805
1753 Ga0500590_342407 3300053148 Bacteria 539
1754 Ga0500603_004752 3300053150 Bacteria 2907
1755 Ga0500604_0043149 3300053151 Bacteria 1369
1756 Ga0500604_0093832 3300053151 Bacteria 983
1757 Ga0500616_0000046 3300053153 Bacteria 333409
1758 Ga0500616_0001093 3300053153 Bacteria 28182
1759 Ga0500616_0018046 3300053153 Bacteria 3993
1760 Ga0500622_0003795 3300053156 Bacteria 9840
1761 Ga0500622_0121696 3300053156 Bacteria 1265
1762 Ga0500622_0137669 3300053156 Bacteria 1168
1763 Ga0500633_0015028 3300053160 Bacteria 2212
1764 Ga0500633_0022339 3300053160 Bacteria 1937
1765 Ga0500636_0014194 3300053177 Bacteria 4683
1766 Ga0500636_0019749 3300053177 Bacteria 3984
1767 Ga0500636_0097505 3300053177 Bacteria 1675
1768 Ga0500636_0166334 3300053177 Bacteria 1197
1769 Ga0500636_0276343 3300053177 Bacteria 841
1770 Ga0500637_0029315 3300053178 Bacteria 3052
1771 Ga0500611_007308 3300053727 Bacteria 1654
1772 Ga0500611_079236 3300053727 Bacteria 816
1773 Ga0500657_119015 3300053728 Bacteria 1050
1774 Ga0500625_062174 3300053729 Bacteria 1690
1775 Ga0500645_010480 3300053730 Bacteria 3063
1776 Ga0500645_025797 3300053730 Bacteria 1791
1777 Ga0500645_031444 3300053730 Bacteria 1595
1778 Ga0500645_033030 3300053730 Bacteria 1549
1779 Ga0500645_048293 3300053730 Bacteria 1247
1780 Ga0500656_034772 3300053732 Bacteria 685
1781 Ga0500599_001833 3300053736 Bacteria 2498
1782 Ga0500601_034627 3300053737 Bacteria 605
1783 Ga0501084_0002863 3300054114 Bacteria 13951
1784 Ga0501084_0032538 3300054114 Bacteria 4362
1785 Ga0501084_0334479 3300054114 Bacteria 1279
1786 Ga0501084_0692783 3300054114 Bacteria 859
1787 Ga0501084_1167141 3300054114 Bacteria 646
1788 Ga0500661_018957 3300055283 Bacteria 1225
1789 Ga0590077_081133 3300059426 Bacteria 747
1790 Ga0587070_114810 3300059491 Bacteria 636
1791 Ga0587073_0192516 3300059492 Bacteria 606
1792 Ga0587077_134966 3300059493 Bacteria 630
1793 Ga0587077_142152 3300059493 Bacteria 619
1794 Ga0587077_195595 3300059493 Bacteria 556
1795 Ga0587080_047642 3300059503 Bacteria 800
1796 Ga0587083_0077395 3300059505 Bacteria 785
1797 Ga0587085_092389 3300059506 Bacteria 627
1798 Ga0587085_096377 3300059506 Bacteria 618
1799 Ga0587088_103635 3300059508 Bacteria 638
1800 Ga0587088_110329 3300059508 Bacteria 625
1801 Ga0587088_165574 3300059508 Bacteria 545
1802 Ga0587128_089277 3300059630 Bacteria 630
1803 Ga0587062_042191 3300059639 Bacteria 744
1804 Ga0587067_124011 3300059640 Bacteria 623
1805 Ga0587068_088907 3300059641 Bacteria 634
1806 Ga0587069_066389 3300059642 Bacteria 676
1807 Ga0587075_082314 3300059644 Bacteria 616
1808 Ga0587102_036813 3300059649 Bacteria 618
1809 Ga0587107_051245 3300059652 Bacteria 701
1810 Ga0587124_020525 3300059660 Bacteria 672
1811 Ga0587071_072381 3300060344 Bacteria 753
1812 Ga0587111_0093287 3300060346 Bacteria 738
1813 Ga0501082_0024686 3300060353 Bacteria 5181
1814 Ga0501082_0178335 3300060353 Bacteria 1848
1815 Ga0501082_0792387 3300060353 Bacteria 829
1816 Ga0501082_1188637 3300060353 Bacteria 666
1817 Ga0530510_0017394 3300061734 Bacteria 5096
1818 Ga0530510_0054880 3300061734 Bacteria 2879
1819 Ga0530510_0070488 3300061734 Bacteria 2537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0693797 Ga0451577_0693797_157_756 118
2 3300044712 Ga0453684_0001512 Ga0453684_0001512_55108_55707 120
3 3300045051 Ga0451576_0271232 Ga0451576_0271232_312_908 130
4 3300042876 Ga0451577_0715825 Ga0451577_0715825_111_713 131
5 3300041997 Ga0439431_0255678 Ga0439431_0255678_70_501 139
6 3300045051 Ga0451576_0066823 Ga0451576_0066823_2423_3013 140
7 3300005445 Ga0070708_100566755 Ga0070708_1005667552 141
8 3300042876 Ga0451577_0384233 Ga0451577_0384233_269_859 141
9 3300042876 Ga0451577_0398228 Ga0451577_0398228_478_1071 143
10 3300044712 Ga0453684_0008350 Ga0453684_0008350_4879_5475 143
11 3300045051 Ga0451576_0249144 Ga0451576_0249144_1166_1759 143
12 3300042876 Ga0451577_0062346 Ga0451577_0062346_1767_2366 144
13 3300042876 Ga0451577_1008073 Ga0451577_1008073_135_734 144
14 3300044712 Ga0453684_0171982 Ga0453684_0171982_1100_1699 144
15 3300046558 Ga0495633_0212747 Ga0495633_0212747_11_487 144
16 3300049576 Ga0501040_0549875 Ga0501040_0549875_334_774 144
17 3300044712 Ga0453684_0269919 Ga0453684_0269919_651_1238 145
18 3300046559 Ga0495667_1019128 Ga0495667_1019128_36_488 145
19 3300046473 Ga0495582_0428192 Ga0495582_0428192_304_750 146
20 3300047469 Ga0495673_0309667 Ga0495673_0309667_25_471 146
21 3300049744 Ga0501083_0134404 Ga0501083_0134404_875_1378 146
22 3300050492 nmdc:mga0yw44_967079_c1 nmdc:mga0yw44_967079_c1_102_548 146
23 3300050507 nmdc:mga05p37_214291_c1 nmdc:mga05p37_214291_c1_1870_2316 146
24 iso_pu_bacteria 8019586578 8019597051 146
25 3300046492 Ga0495585_0248900 Ga0495585_0248900_164_658 147
26 3300046520 Ga0495637_0314914 Ga0495637_0314914_38_532 147
27 3300046523 Ga0495644_0341994 Ga0495644_0341994_43_537 147
28 3300046558 Ga0495633_0139098 Ga0495633_0139098_246_740 147
29 3300046684 Ga0495669_0248088 Ga0495669_0248088_285_779 147
30 3300047318 Ga0495636_0238697 Ga0495636_0238697_52_546 147
31 3300050496 nmdc:mga07m45_683442_c1 nmdc:mga07m45_683442_c1_11_460 147
32 3300053122 Ga0500608_350386 Ga0500608_350386_40_489 147
33 3300061734 Ga0530510_0054880 Ga0530510_0054880_2205_2765 147
34 3300037068 Ga0373925_0333023 Ga0373925_0333023_112_570 149
35 3300042876 Ga0451577_0549311 Ga0451577_0549311_128_694 149
36 3300020069 Ga0197907_11339043 Ga0197907_113390431 150
37 3300048906 Ga0496103_0675293 Ga0496103_0675293_170_625 150
38 3300049581 Ga0501047_0767039 Ga0501047_0767039_11_469 150
39 3300047322 Ga0495680_0937984 Ga0495680_0937984_83_541 151
40 3300005983 Ga0081540_1134583 Ga0081540_11345831 152
41 3300039447 Ga0436361_0999682 Ga0436361_0999682_57_515 152
42 3300046460 Ga0495638_0299920 Ga0495638_0299920_396_854 152
43 3300046475 Ga0495639_0581458 Ga0495639_0581458_98_559 152
44 3300046809 Ga0495600_0790411 Ga0495600_0790411_14_475 152
45 3300048910 Ga0496107_0180421 Ga0496107_0180421_1090_1554 152
46 3300048924 Ga0496121_0644707 Ga0496121_0644707_12_476 152
47 3300049572 Ga0501036_0363694 Ga0501036_0363694_706_1179 152
48 3300049576 Ga0501040_0198285 Ga0501040_0198285_385_858 152
49 3300049577 Ga0501041_0932845 Ga0501041_0932845_66_524 152
50 3300049582 Ga0501048_0238023 Ga0501048_0238023_138_611 152
51 3300049586 Ga0501070_0319337 Ga0501070_0319337_634_1098 152
52 3300049591 Ga0501075_0169216 Ga0501075_0169216_184_657 152
53 3300049592 Ga0501076_0016262 Ga0501076_0016262_2785_3258 152
54 3300049741 Ga0501079_0141351 Ga0501079_0141351_875_1348 152
55 3300049822 Ga0501035_0945897 Ga0501035_0945897_159_632 152
56 3300061734 Ga0530510_0017394 Ga0530510_0017394_4576_5049 152
57 3300050514 nmdc:mga08x19_5246_c1 nmdc:mga08x19_5246_c1_2114_2581 153
58 3300053096 Ga0500641_0021459 Ga0500641_0021459_1541_2044 153
59 3300059508 Ga0587088_165574 Ga0587088_165574_31_525 153
60 3300006028 Ga0070717_11097200 Ga0070717_110972002 154
61 3300021361 Ga0213872_10079111 Ga0213872_100791112 154
62 3300039450 Ga0436363_1660925 Ga0436363_1660925_2004_2513 154
63 3300039453 Ga0436362_0985474 Ga0436362_0985474_102_611 154
64 3300046794 Ga0495589_0265535 Ga0495589_0265535_85_576 154
65 iso_pu_bacteria 2513237096 2513659120 154
66 iso_pu_bacteria 2513237137 2513859158 154
67 iso_pu_bacteria 2513237145 2513920552 154
68 iso_pu_bacteria 2517572143 2517887421 154
69 iso_pu_bacteria 2667528175 2671120840 154
70 iso_pu_bacteria 2824732956 2824736412 154
71 iso_pu_bacteria 2885374607 2885382908 154
72 iso_pu_bacteria 2903748898 2903754098 154
73 iso_pu_bacteria 2904690495 2904691714 154
74 iso_pu_bacteria 2906635258 2906637421 154
75 iso_pu_bacteria 2906660503 2906663650 154
76 iso_pu_bacteria 2908739725 2908745863 154
77 iso_pu_bacteria 2908756301 2908763770 154
78 iso_pu_bacteria 3005474847 3005482750 154
79 iso_pu_bacteria 8056689827 8056696095 154
80 3300013307 Ga0157372_10278211 Ga0157372_102782112 156
81 3300035118 Ga0373954_0029859 Ga0373954_0029859_835_1311 156
82 3300035118 Ga0373954_0275395 Ga0373954_0275395_57_557 156
83 3300035120 Ga0373957_0201047 Ga0373957_0201047_258_734 156
84 3300035172 Ga0373955_0124277 Ga0373955_0124277_820_1296 156
85 3300035724 Ga0373933_0049018 Ga0373933_0049018_89_565 156
86 3300035724 Ga0373933_0406371 Ga0373933_0406371_277_777 156
87 3300036401 Ga0373937_0051162 Ga0373937_0051162_3171_3671 156
88 3300036401 Ga0373937_0192183 Ga0373937_0192183_1396_1872 156
89 3300037068 Ga0373925_0115773 Ga0373925_0115773_1134_1634 156
90 3300048088 Ga0495602_0842467 Ga0495602_0842467_77_553 156
91 3300048921 Ga0496118_0445083 Ga0496118_0445083_41_559 156
92 3300048924 Ga0496121_0331373 Ga0496121_0331373_414_932 156
93 3300053084 Ga0495595_0173013 Ga0495595_0173013_24_524 156
94 3300009545 Ga0105237_10080441 Ga0105237_100804413 157
95 3300013297 Ga0157378_10644094 Ga0157378_106440941 157
96 3300035117 Ga0373953_0060668 Ga0373953_0060668_870_1346 157
97 3300036401 Ga0373937_0039228 Ga0373937_0039228_1250_1726 157
98 3300036401 Ga0373937_0720775 Ga0373937_0720775_312_788 157
99 3300036458 Ga0310112_041518 Ga0310112_041518_131_607 157
100 3300036534 Ga0310109_025226 Ga0310109_025226_232_708 157
101 3300037068 Ga0373925_0033423 Ga0373925_0033423_2437_2913 157
102 3300039437 Ga0436365_0042070 Ga0436365_0042070_56_532 157
103 3300041413 Ga0439465_0125004 Ga0439465_0125004_359_838 157
104 3300044656 Ga0466969_0158615 Ga0466969_0158615_113_589 157
105 3300044656 Ga0466969_0313346 Ga0466969_0313346_24_497 157
106 3300044684 Ga0466966_0366777 Ga0466966_0366777_97_570 157
107 3300044706 Ga0466964_0242361 Ga0466964_0242361_85_558 157
108 3300046462 Ga0495651_0013418 Ga0495651_0013418_3942_4418 157
109 3300046477 Ga0495664_0222054 Ga0495664_0222054_465_941 157
110 3300046536 Ga0495587_0304296 Ga0495587_0304296_192_668 157
111 3300046559 Ga0495667_0366042 Ga0495667_0366042_346_822 157
112 3300046675 Ga0495657_0527437 Ga0495657_0527437_14_490 157
113 3300047322 Ga0495680_0132741 Ga0495680_0132741_37_513 157
114 3300047471 Ga0495684_0731871 Ga0495684_0731871_47_523 157
115 3300048090 Ga0495615_0154977 Ga0495615_0154977_10_489 157
116 3300048904 Ga0496101_0160302 Ga0496101_0160302_1189_1665 157
117 3300048904 Ga0496101_0662701 Ga0496101_0662701_134_610 157
118 3300048912 Ga0496109_0088490 Ga0496109_0088490_2013_2489 157
119 3300048914 Ga0496111_0554542 Ga0496111_0554542_131_607 157
120 3300048917 Ga0496114_0640754 Ga0496114_0640754_204_680 157
121 3300048918 Ga0496115_0329545 Ga0496115_0329545_323_799 157
122 3300048929 Ga0496126_0031487 Ga0496126_0031487_268_747 157
123 3300048929 Ga0496126_0173318 Ga0496126_0173318_59_535 157
124 3300048929 Ga0496126_0212625 Ga0496126_0212625_239_715 157
125 3300050490 nmdc:mga03n38_357684_c1 nmdc:mga03n38_357684_c1_76_555 157
126 3300050492 nmdc:mga0yw44_628579_c1 nmdc:mga0yw44_628579_c1_201_680 157
127 3300050493 nmdc:mga0k408_715058_c1 nmdc:mga0k408_715058_c1_14_493 157
128 3300050494 nmdc:mga06z11_18937_c1 nmdc:mga06z11_18937_c1_482_961 157
129 3300050495 nmdc:mga04h51_91122_c1 nmdc:mga04h51_91122_c1_519_998 157
130 3300053083 Ga0495655_0054133 Ga0495655_0054133_78_557 157
131 3300053728 Ga0500657_119015 Ga0500657_119015_469_945 157
132 iso_pu_bacteria 2513237101 2513698561 157
133 iso_pu_bacteria 2721755755 2723848821 157
134 iso_pu_bacteria 2791355199 2793078823 157
135 iso_pu_bacteria 2874604998 2874606048 157
136 iso_pu_bacteria 2876808645 2876817839 157
137 iso_pu_bacteria 2879110137 2879116788 157
138 iso_pu_bacteria 2889033259 2889034443 157
139 iso_pu_bacteria 2922361189 2922363436 157
140 iso_pu_bacteria 2922386360 2922389553 157
141 iso_pu_bacteria 8006964411 8006970037 157
142 iso_pu_bacteria 8006984368 8006986245 157
143 iso_pu_bacteria 8006994254 8006998926 157
144 iso_pu_bacteria 8056673599 8056675388 157
145 3300009036 Ga0105244_10292586 Ga0105244_102925861 158
146 3300009093 Ga0105240_10196901 Ga0105240_101969012 158
147 3300009101 Ga0105247_10083743 Ga0105247_100837433 158
148 3300009101 Ga0105247_10196167 Ga0105247_101961672 158
149 3300009148 Ga0105243_10313425 Ga0105243_103134252 158
150 3300009174 Ga0105241_10098771 Ga0105241_100987712 158
151 3300009176 Ga0105242_10138449 Ga0105242_101384491 158
152 3300009177 Ga0105248_10050701 Ga0105248_100507014 158
153 3300009545 Ga0105237_10250743 Ga0105237_102507432 158
154 3300009545 Ga0105237_10368248 Ga0105237_103682482 158
155 3300009551 Ga0105238_10475945 Ga0105238_104759452 158
156 3300009553 Ga0105249_10138873 Ga0105249_101388732 158
157 3300010375 Ga0105239_10149087 Ga0105239_101490872 158
158 3300010375 Ga0105239_10202613 Ga0105239_102026132 158
159 3300010375 Ga0105239_10300709 Ga0105239_103007091 158
160 3300011119 Ga0105246_10439702 Ga0105246_104397022 158
161 3300013100 Ga0157373_10098153 Ga0157373_100981532 158
162 3300013104 Ga0157370_10144710 Ga0157370_101447103 158
163 3300013105 Ga0157369_10018060 Ga0157369_100180606 158
164 3300013105 Ga0157369_10792865 Ga0157369_107928652 158
165 3300013296 Ga0157374_11022564 Ga0157374_110225642 158
166 3300013296 Ga0157374_11683894 Ga0157374_116838942 158
167 3300013306 Ga0163162_10187803 Ga0163162_101878032 158
168 3300013306 Ga0163162_10467696 Ga0163162_104676962 158
169 3300014325 Ga0163163_10108554 Ga0163163_101085543 158
170 3300014325 Ga0163163_10370333 Ga0163163_103703332 158
171 3300014968 Ga0157379_10374052 Ga0157379_103740522 158
172 3300015265 Ga0182005_1056718 Ga0182005_10567181 158
173 3300023660 Ga0247550_102757 Ga0247550_1027571 158
174 3300025913 Ga0207695_10390884 Ga0207695_103908841 158
175 3300033442 Ga0315911_1000022 Ga0315911_1000022117 158
176 3300034957 Ga0373938_0011772 Ga0373938_0011772_319_798 158
177 3300035083 Ga0373926_0334613 Ga0373926_0334613_101_577 158
178 3300035084 Ga0373928_0024614 Ga0373928_0024614_567_1046 158
179 3300035085 Ga0373929_0052464 Ga0373929_0052464_275_754 158
180 3300035088 Ga0373940_0023822 Ga0373940_0023822_742_1221 158
181 3300035089 Ga0373944_0299376 Ga0373944_0299376_100_576 158
182 3300035111 Ga0373923_0055004 Ga0373923_0055004_204_680 158
183 3300035113 Ga0373936_0021327 Ga0373936_0021327_135_611 158
184 3300035115 Ga0373941_0018775 Ga0373941_0018775_279_758 158
185 3300035117 Ga0373953_0227634 Ga0373953_0227634_170_646 158
186 3300035119 Ga0373956_0066740 Ga0373956_0066740_224_700 158
187 3300035170 Ga0373943_0050860 Ga0373943_0050860_363_839 158
188 3300035172 Ga0373955_0357048 Ga0373955_0357048_57_533 158
189 3300035241 Ga0373961_0166916 Ga0373961_0166916_186_665 158
190 3300035691 Ga0373931_0000654 Ga0373931_0000654_7633_8112 158
191 3300035692 Ga0373935_1311443 Ga0373935_1311443_23_499 158
192 3300035695 Ga0373927_0027284 Ga0373927_0027284_1397_1876 158
193 3300035695 Ga0373927_0068952 Ga0373927_0068952_465_941 158
194 3300035724 Ga0373933_0038950 Ga0373933_0038950_280_756 158
195 3300035725 Ga0373947_0007461 Ga0373947_0007461_1368_1844 158
196 3300036401 Ga0373937_0048069 Ga0373937_0048069_708_1184 158
197 3300037068 Ga0373925_0255216 Ga0373925_0255216_401_880 158
198 3300037068 Ga0373925_0380369 Ga0373925_0380369_517_993 158
199 3300037068 Ga0373925_0399786 Ga0373925_0399786_271_747 158
200 3300037418 Ga0395900_0009031 Ga0395900_0009031_8714_9190 158
201 3300037418 Ga0395900_0158767 Ga0395900_0158767_552_1028 158
202 3300037466 Ga0395898_0008119 Ga0395898_0008119_3361_3837 158
203 3300037466 Ga0395898_0348507 Ga0395898_0348507_885_1361 158
204 3300037471 Ga0395905_0003811 Ga0395905_0003811_11625_12101 158
205 3300037471 Ga0395905_0024981 Ga0395905_0024981_4254_4730 158
206 3300037853 Ga0436364_1112930 Ga0436364_1112930_1942_2418 158
207 3300038443 Ga0395901_0430847 Ga0395901_0430847_186_662 158
208 3300039437 Ga0436365_0085392 Ga0436365_0085392_167_649 158
209 3300039437 Ga0436365_0380670 Ga0436365_0380670_460_936 158
210 3300041443 Ga0451789_0003421 Ga0451789_0003421_97_573 158
211 3300041452 Ga0451793_1933064 Ga0451793_1933064_230_706 158
212 3300041460 Ga0451802_0631769 Ga0451802_0631769_116_601 158
213 3300041460 Ga0451802_0679946 Ga0451802_0679946_375_851 158
214 3300041463 Ga0451804_0307913 Ga0451804_0307913_99_575 158
215 3300041486 Ga0451807_0993385 Ga0451807_0993385_210_689 158
216 3300041496 Ga0451839_0776644 Ga0451839_0776644_416_904 158
217 3300041505 Ga0451849_0032440 Ga0451849_0032440_132_614 158
218 3300041512 Ga0451853_2893679 Ga0451853_2893679_12_491 158
219 3300041512 Ga0451853_3226891 Ga0451853_3226891_455_931 158
220 3300044658 Ga0466972_0000274 Ga0466972_0000274_6032_6508 158
221 3300044658 Ga0466972_0168721 Ga0466972_0168721_15_491 158
222 3300044683 Ga0466965_0159700 Ga0466965_0159700_579_1055 158
223 3300044683 Ga0466965_0400087 Ga0466965_0400087_272_748 158
224 3300044694 Ga0466963_0020169 Ga0466963_0020169_2404_2880 158
225 3300044706 Ga0466964_0018182 Ga0466964_0018182_1451_1927 158
226 3300044706 Ga0466964_0065526 Ga0466964_0065526_318_794 158
227 3300044706 Ga0466964_0125688 Ga0466964_0125688_647_1123 158
228 3300044719 Ga0466971_0108755 Ga0466971_0108755_152_628 158
229 3300044735 Ga0466968_0063903 Ga0466968_0063903_953_1429 158
230 3300044765 Ga0466970_0056792 Ga0466970_0056792_1091_1567 158
231 3300044765 Ga0466970_0329598 Ga0466970_0329598_178_654 158
232 3300044842 Ga0466957_0216315 Ga0466957_0216315_156_638 158
233 3300044901 Ga0466960_0027592 Ga0466960_0027592_1734_2210 158
234 3300044901 Ga0466960_0601018 Ga0466960_0601018_10_486 158
235 3300045049 Ga0466959_0492938 Ga0466959_0492938_163_639 158
236 3300045976 Ga0466967_0024320 Ga0466967_0024320_3255_3731 158
237 3300046454 Ga0495592_0520146 Ga0495592_0520146_95_574 158
238 3300046455 Ga0495603_0052399 Ga0495603_0052399_382_858 158
239 3300046459 Ga0495629_0305515 Ga0495629_0305515_64_540 158
240 3300046460 Ga0495638_0010821 Ga0495638_0010821_1474_1950 158
241 3300046472 Ga0495580_0082309 Ga0495580_0082309_1508_1984 158
242 3300046474 Ga0495605_0046241 Ga0495605_0046241_980_1456 158
243 3300046475 Ga0495639_0047306 Ga0495639_0047306_385_861 158
244 3300046477 Ga0495664_0004921 Ga0495664_0004921_4933_5409 158
245 3300046499 Ga0495594_0149558 Ga0495594_0149558_46_522 158
246 3300046500 Ga0495596_0069274 Ga0495596_0069274_585_1061 158
247 3300046507 Ga0495606_0064386 Ga0495606_0064386_279_755 158
248 3300046507 Ga0495606_0270265 Ga0495606_0270265_375_851 158
249 3300046512 Ga0495610_0067542 Ga0495610_0067542_209_685 158
250 3300046513 Ga0495616_0065146 Ga0495616_0065146_1141_1617 158
251 3300046516 Ga0495628_0042830 Ga0495628_0042830_208_684 158
252 3300046517 Ga0495630_0222377 Ga0495630_0222377_691_1167 158
253 3300046522 Ga0495643_0047558 Ga0495643_0047558_1036_1512 158
254 3300046522 Ga0495643_0239919 Ga0495643_0239919_36_512 158
255 3300046524 Ga0495648_0067297 Ga0495648_0067297_1498_1974 158
256 3300046524 Ga0495648_0190885 Ga0495648_0190885_94_570 158
257 3300046524 Ga0495648_0214321 Ga0495648_0214321_369_845 158
258 3300046526 Ga0495666_0033207 Ga0495666_0033207_1782_2258 158
259 3300046529 Ga0495652_0807334 Ga0495652_0807334_99_575 158
260 3300046531 Ga0495665_0057443 Ga0495665_0057443_758_1234 158
261 3300046535 Ga0495586_0151857 Ga0495586_0151857_442_918 158
262 3300046542 Ga0495597_0009354 Ga0495597_0009354_3337_3813 158
263 3300046543 Ga0495645_0102777 Ga0495645_0102777_65_541 158
264 3300046557 Ga0495622_0186043 Ga0495622_0186043_273_749 158
265 3300046559 Ga0495667_0059306 Ga0495667_0059306_1199_1675 158
266 3300046616 Ga0495668_0122222 Ga0495668_0122222_450_926 158
267 3300046642 Ga0495634_0056209 Ga0495634_0056209_1876_2352 158
268 3300046648 Ga0495611_0095356 Ga0495611_0095356_583_1059 158
269 3300046648 Ga0495611_0383120 Ga0495611_0383120_103_579 158
270 3300046663 Ga0495635_0102091 Ga0495635_0102091_852_1328 158
271 3300046674 Ga0495588_0016010 Ga0495588_0016010_2916_3392 158
272 3300046681 Ga0495647_0281574 Ga0495647_0281574_175_651 158
273 3300046683 Ga0495658_0015804 Ga0495658_0015804_2026_2502 158
274 3300046684 Ga0495669_0292643 Ga0495669_0292643_200_676 158
275 3300046692 Ga0495671_0212948 Ga0495671_0212948_144_620 158
276 3300046694 Ga0495649_0215041 Ga0495649_0215041_364_840 158
277 3300046694 Ga0495649_0388659 Ga0495649_0388659_47_523 158
278 3300046794 Ga0495589_0219698 Ga0495589_0219698_18_494 158
279 3300047315 Ga0495581_0127338 Ga0495581_0127338_414_890 158
280 3300047315 Ga0495581_0460226 Ga0495581_0460226_106_582 158
281 3300047317 Ga0495604_0378628 Ga0495604_0378628_79_555 158
282 3300047319 Ga0495674_0013003 Ga0495674_0013003_5786_6262 158
283 3300047320 Ga0495672_0050924 Ga0495672_0050924_449_928 158
284 3300047320 Ga0495672_0179053 Ga0495672_0179053_476_952 158
285 3300047320 Ga0495672_0263491 Ga0495672_0263491_132_608 158
286 3300047321 Ga0495676_0060198 Ga0495676_0060198_934_1410 158
287 3300047321 Ga0495676_0417491 Ga0495676_0417491_131_607 158
288 3300047323 Ga0495683_0285280 Ga0495683_0285280_14_490 158
289 3300047443 Ga0495687_011239 Ga0495687_011239_898_1374 158
290 3300047469 Ga0495673_0046688 Ga0495673_0046688_896_1372 158
291 3300047469 Ga0495673_0165924 Ga0495673_0165924_207_683 158
292 3300047471 Ga0495684_0117831 Ga0495684_0117831_1391_1867 158
293 3300047472 Ga0495686_0139108 Ga0495686_0139108_195_671 158
294 3300047472 Ga0495686_0453986 Ga0495686_0453986_167_643 158
295 3300047673 Ga0495593_0005905 Ga0495593_0005905_478_954 158
296 3300048091 Ga0495626_0123901 Ga0495626_0123901_605_1081 158
297 3300048903 Ga0496100_0239782 Ga0496100_0239782_434_910 158
298 3300048903 Ga0496100_0670279 Ga0496100_0670279_134_613 158
299 3300048904 Ga0496101_0001656 Ga0496101_0001656_6400_6879 158
300 3300048904 Ga0496101_0040994 Ga0496101_0040994_1806_2282 158
301 3300048904 Ga0496101_0090035 Ga0496101_0090035_1285_1761 158
302 3300048905 Ga0496102_0010759 Ga0496102_0010759_190_669 158
303 3300048905 Ga0496102_0015959 Ga0496102_0015959_3316_3792 158
304 3300048905 Ga0496102_0107507 Ga0496102_0107507_2110_2586 158
305 3300048905 Ga0496102_0514920 Ga0496102_0514920_215_691 158
306 3300048906 Ga0496103_0004565 Ga0496103_0004565_3458_3934 158
307 3300048906 Ga0496103_0016825 Ga0496103_0016825_3753_4232 158
308 3300048906 Ga0496103_0026693 Ga0496103_0026693_1838_2314 158
309 3300048907 Ga0496104_0004595 Ga0496104_0004595_4451_4930 158
310 3300048907 Ga0496104_0028670 Ga0496104_0028670_3463_3939 158
311 3300048908 Ga0496105_0017472 Ga0496105_0017472_5004_5480 158
312 3300048908 Ga0496105_0040208 Ga0496105_0040208_499_978 158
313 3300048908 Ga0496105_0049487 Ga0496105_0049487_1227_1703 158
314 3300048909 Ga0496106_0026288 Ga0496106_0026288_2111_2590 158
315 3300048909 Ga0496106_0041586 Ga0496106_0041586_1314_1790 158
316 3300048910 Ga0496107_0005918 Ga0496107_0005918_4007_4486 158
317 3300048910 Ga0496107_0053637 Ga0496107_0053637_203_679 158
318 3300048911 Ga0496108_0159548 Ga0496108_0159548_401_880 158
319 3300048911 Ga0496108_0236735 Ga0496108_0236735_880_1356 158
320 3300048912 Ga0496109_0105241 Ga0496109_0105241_938_1414 158
321 3300048912 Ga0496109_0506568 Ga0496109_0506568_291_770 158
322 3300048913 Ga0496110_0020972 Ga0496110_0020972_4212_4691 158
323 3300048913 Ga0496110_0028359 Ga0496110_0028359_722_1198 158
324 3300048913 Ga0496110_0197535 Ga0496110_0197535_568_1044 158
325 3300048913 Ga0496110_0321622 Ga0496110_0321622_600_1076 158
326 3300048915 Ga0496112_0002949 Ga0496112_0002949_7207_7686 158
327 3300048915 Ga0496112_0068339 Ga0496112_0068339_1931_2407 158
328 3300048915 Ga0496112_0183612 Ga0496112_0183612_662_1138 158
329 3300048916 Ga0496113_0020040 Ga0496113_0020040_2057_2536 158
330 3300048916 Ga0496113_0047223 Ga0496113_0047223_1512_1988 158
331 3300048916 Ga0496113_0820392 Ga0496113_0820392_170_646 158
332 3300048917 Ga0496114_0008695 Ga0496114_0008695_4751_5230 158
333 3300048917 Ga0496114_0386257 Ga0496114_0386257_576_1052 158
334 3300048918 Ga0496115_0057832 Ga0496115_0057832_2508_2987 158
335 3300048918 Ga0496115_0134764 Ga0496115_0134764_628_1104 158
336 3300048918 Ga0496115_0210492 Ga0496115_0210492_1057_1533 158
337 3300048919 Ga0496116_0091944 Ga0496116_0091944_918_1394 158
338 3300048920 Ga0496117_0025524 Ga0496117_0025524_3187_3663 158
339 3300048920 Ga0496117_0377298 Ga0496117_0377298_181_657 158
340 3300048921 Ga0496118_0033149 Ga0496118_0033149_1802_2278 158
341 3300048921 Ga0496118_0054679 Ga0496118_0054679_1242_1718 158
342 3300048922 Ga0496119_0046119 Ga0496119_0046119_358_834 158
343 3300048923 Ga0496120_0144788 Ga0496120_0144788_39_518 158
344 3300048924 Ga0496121_0009685 Ga0496121_0009685_1063_1539 158
345 3300048924 Ga0496121_0017138 Ga0496121_0017138_2248_2733 158
346 3300048924 Ga0496121_0020230 Ga0496121_0020230_5455_5931 158
347 3300048925 Ga0496122_0129062 Ga0496122_0129062_760_1236 158
348 3300048927 Ga0496124_0234874 Ga0496124_0234874_44_520 158
349 3300048928 Ga0496125_0016454 Ga0496125_0016454_4091_4567 158
350 3300048928 Ga0496125_0252537 Ga0496125_0252537_74_550 158
351 3300048929 Ga0496126_0082566 Ga0496126_0082566_37_513 158
352 3300048929 Ga0496126_0323879 Ga0496126_0323879_206_682 158
353 3300048929 Ga0496126_0639311 Ga0496126_0639311_259_741 158
354 3300049460 Ga0495682_0223451 Ga0495682_0223451_99_575 158
355 3300049568 Ga0501031_0130145 Ga0501031_0130145_483_965 158
356 3300049569 Ga0501032_0056453 Ga0501032_0056453_1460_1942 158
357 3300049571 Ga0501034_0114578 Ga0501034_0114578_1997_2479 158
358 3300049572 Ga0501036_0122464 Ga0501036_0122464_829_1311 158
359 3300049573 Ga0501037_0117071 Ga0501037_0117071_829_1311 158
360 3300049574 Ga0501038_0093604 Ga0501038_0093604_1048_1530 158
361 3300049575 Ga0501039_0070882 Ga0501039_0070882_1384_1866 158
362 3300049576 Ga0501040_0362394 Ga0501040_0362394_90_572 158
363 3300049577 Ga0501041_0757479 Ga0501041_0757479_40_522 158
364 3300049579 Ga0501043_0149557 Ga0501043_0149557_491_973 158
365 3300049580 Ga0501046_0072850 Ga0501046_0072850_1419_1901 158
366 3300049581 Ga0501047_0092163 Ga0501047_0092163_1559_2041 158
367 3300049582 Ga0501048_0102291 Ga0501048_0102291_1096_1578 158
368 3300049583 Ga0501067_0082621 Ga0501067_0082621_482_964 158
369 3300049584 Ga0501068_0028519 Ga0501068_0028519_1288_1770 158
370 3300049585 Ga0501069_0088588 Ga0501069_0088588_1081_1563 158
371 3300049586 Ga0501070_0209207 Ga0501070_0209207_1081_1563 158
372 3300049587 Ga0501071_0155255 Ga0501071_0155255_1039_1521 158
373 3300049588 Ga0501072_0174662 Ga0501072_0174662_843_1325 158
374 3300049589 Ga0501073_0206051 Ga0501073_0206051_613_1095 158
375 3300049590 Ga0501074_0064795 Ga0501074_0064795_463_945 158
376 3300049741 Ga0501079_0077852 Ga0501079_0077852_863_1345 158
377 3300049742 Ga0501080_0086703 Ga0501080_0086703_1763_2245 158
378 3300049822 Ga0501035_0562782 Ga0501035_0562782_246_728 158
379 3300049823 Ga0501044_0465141 Ga0501044_0465141_32_514 158
380 3300049824 Ga0501045_0099371 Ga0501045_0099371_257_739 158
381 3300050489 nmdc:mga03683_87890_c1 nmdc:mga03683_87890_c1_61_537 158
382 3300050490 nmdc:mga03n38_197867_c1 nmdc:mga03n38_197867_c1_110_586 158
383 3300050491 nmdc:mga00v17_20915_c1 nmdc:mga00v17_20915_c1_2071_2547 158
384 3300050491 nmdc:mga00v17_260639_c1 nmdc:mga00v17_260639_c1_574_1050 158
385 3300050492 nmdc:mga0yw44_31673_c1 nmdc:mga0yw44_31673_c1_1056_1532 158
386 3300050492 nmdc:mga0yw44_62959_c1 nmdc:mga0yw44_62959_c1_769_1245 158
387 3300050492 nmdc:mga0yw44_841546_c1 nmdc:mga0yw44_841546_c1_44_520 158
388 3300050493 nmdc:mga0k408_11902_c1 nmdc:mga0k408_11902_c1_1591_2067 158
389 3300050495 nmdc:mga04h51_19459_c1 nmdc:mga04h51_19459_c1_858_1334 158
390 3300050495 nmdc:mga04h51_195161_c1 nmdc:mga04h51_195161_c1_46_522 158
391 3300050496 nmdc:mga07m45_18987_c1 nmdc:mga07m45_18987_c1_948_1424 158
392 3300050496 nmdc:mga07m45_30607_c1 nmdc:mga07m45_30607_c1_1378_1854 158
393 3300050516 nmdc:mga0sz30_11871_c1 nmdc:mga0sz30_11871_c1_2627_3103 158
394 3300050516 nmdc:mga0sz30_34913_c1 nmdc:mga0sz30_34913_c1_396_872 158
395 3300053078 Ga0495612_0081702 Ga0495612_0081702_511_987 158
396 3300053079 Ga0500610_0119506 Ga0500610_0119506_521_997 158
397 3300053083 Ga0495655_0040535 Ga0495655_0040535_347_823 158
398 3300053085 Ga0495619_0445476 Ga0495619_0445476_134_610 158
399 3300053086 Ga0500578_0428989 Ga0500578_0428989_212_688 158
400 3300053086 Ga0500578_0622617 Ga0500578_0622617_16_492 158
401 3300053087 Ga0500643_000016 Ga0500643_000016_63588_64064 158
402 3300053101 Ga0500553_229283 Ga0500553_229283_12_488 158
403 3300053104 Ga0500556_0007068 Ga0500556_0007068_2102_2578 158
404 3300053105 Ga0500557_000011 Ga0500557_000011_30083_30559 158
405 3300053108 Ga0500562_010064 Ga0500562_010064_1432_1908 158
406 3300053120 Ga0500597_071190 Ga0500597_071190_783_1259 158
407 3300053122 Ga0500608_251870 Ga0500608_251870_109_585 158
408 3300053126 Ga0500621_038365 Ga0500621_038365_1037_1513 158
409 3300053130 Ga0500642_0000090 Ga0500642_0000090_21631_22107 158
410 3300053142 Ga0500577_0268383 Ga0500577_0268383_11_493 158
411 3300053153 Ga0500616_0018046 Ga0500616_0018046_639_1115 158
412 3300053156 Ga0500622_0003795 Ga0500622_0003795_8873_9349 158
413 3300053160 Ga0500633_0015028 Ga0500633_0015028_144_620 158
414 3300053177 Ga0500636_0014194 Ga0500636_0014194_2384_2866 158
415 3300053727 Ga0500611_007308 Ga0500611_007308_429_905 158
416 3300053729 Ga0500625_062174 Ga0500625_062174_23_499 158
417 3300053730 Ga0500645_025797 Ga0500645_025797_1304_1780 158
418 3300053732 Ga0500656_034772 Ga0500656_034772_158_634 158
419 3300053736 Ga0500599_001833 Ga0500599_001833_1530_2006 158
420 3300053737 Ga0500601_034627 Ga0500601_034627_18_494 158
421 3300060353 Ga0501082_0178335 Ga0501082_0178335_1303_1785 158
422 iso_pu_bacteria 2507262055 2507511457 158
423 iso_pu_bacteria 2508501009 2508545264 158
424 iso_pu_bacteria 2508501042 2508694096 158
425 iso_pu_bacteria 2511231028 2511397238 158
426 iso_pu_bacteria 2513237092 2513624051 158
427 iso_pu_bacteria 2513237095 2513648431 158
428 iso_pu_bacteria 2513237098 2513673282 158
429 iso_pu_bacteria 2513237102 2513703651 158
430 iso_pu_bacteria 2513237104 2513716386 158
431 iso_pu_bacteria 2513237139 2513875059 158
432 iso_pu_bacteria 2513237161 2514013869 158
433 iso_pu_bacteria 2515154112 2515624969 158
434 iso_pu_bacteria 2517093001 2517101217 158
435 iso_pu_bacteria 2524023205 2524439851 158
436 iso_pu_bacteria 2524023210 2524465850 158
437 iso_pu_bacteria 2524023228 2524539237 158
438 iso_pu_bacteria 2528768022 2528855436 158
439 iso_pu_bacteria 2602042107 2603857458 158
440 iso_pu_bacteria 2617270735 2617348376 158
441 iso_pu_bacteria 2617270741 2617374917 158
442 iso_pu_bacteria 2744054633 2745075872 158
443 iso_pu_bacteria 2791355196 2793061352 158
444 iso_pu_bacteria 2802429603 2805916351 158
445 iso_pu_bacteria 2816332527 2818240013 158
446 iso_pu_bacteria 2824600985 2824607034 158
447 iso_pu_bacteria 2824609381 2824614295 158
448 iso_pu_bacteria 2824617872 2824622295 158
449 iso_pu_bacteria 2824626560 2824631492 158
450 iso_pu_bacteria 2824635225 2824638012 158
451 iso_pu_bacteria 2824644064 2824651115 158
452 iso_pu_bacteria 2824653114 2824660642 158
453 iso_pu_bacteria 2824661429 2824664126 158
454 iso_pu_bacteria 2824671348 2824674554 158
455 iso_pu_bacteria 2824679649 2824681581 158
456 iso_pu_bacteria 2824687955 2824690517 158
457 iso_pu_bacteria 2824696289 2824697901 158
458 iso_pu_bacteria 2824704595 2824711250 158
459 iso_pu_bacteria 2824714736 2824721088 158
460 iso_pu_bacteria 2824723954 2824726694 158
461 iso_pu_bacteria 2824746037 2824752049 158
462 iso_pu_bacteria 2824753945 2824762908 158
463 iso_pu_bacteria 2824763712 2824770279 158
464 iso_pu_bacteria 2824773399 2824776220 158
465 iso_pu_bacteria 2838122688 2838129984 158
466 iso_pu_bacteria 2841941048 2841947023 158
467 iso_pu_bacteria 2841949485 2841955046 158
468 iso_pu_bacteria 2841957949 2841964937 158
469 iso_pu_bacteria 2841966195 2841970003 158
470 iso_pu_bacteria 2841974524 2841977355 158
471 iso_pu_bacteria 2841983080 2841990231 158
472 iso_pu_bacteria 2842038055 2842042232 158
473 iso_pu_bacteria 2842045827 2842050275 158
474 iso_pu_bacteria 2844315083 2844316450 158
475 iso_pu_bacteria 2847930680 2847939250 158
476 iso_pu_bacteria 2847939898 2847943789 158
477 iso_pu_bacteria 2849076700 2849081979 158
478 iso_pu_bacteria 2857509624 2857513542 158
479 iso_pu_bacteria 2857524615 2857526839 158
480 iso_pu_bacteria 2874590934 2874594672 158
481 iso_pu_bacteria 2874612657 2874615265 158
482 iso_pu_bacteria 2874620515 2874622674 158
483 iso_pu_bacteria 2874645413 2874647248 158
484 iso_pu_bacteria 2876761206 2876765437 158
485 iso_pu_bacteria 2876771140 2876773804 158
486 iso_pu_bacteria 2876818435 2876819958 158
487 iso_pu_bacteria 2879074833 2879075163 158
488 iso_pu_bacteria 2879083081 2879086922 158
489 iso_pu_bacteria 2879099564 2879103047 158
490 iso_pu_bacteria 2879127579 2879129317 158
491 iso_pu_bacteria 2879142872 2879142918 158
492 iso_pu_bacteria 2881364244 2881369405 158
493 iso_pu_bacteria 2881665667 2881668257 158
494 iso_pu_bacteria 2885366525 2885373666 158
495 iso_pu_bacteria 2885409591 2885411082 158
496 iso_pu_bacteria 2888378607 2888387035 158
497 iso_pu_bacteria 2888388044 2888389718 158
498 iso_pu_bacteria 2888419890 2888421370 158
499 iso_pu_bacteria 2893066018 2893070002 158
500 iso_pu_bacteria 2903727486 2903732331 158
501 iso_pu_bacteria 2903768456 2903777305 158
502 iso_pu_bacteria 2904666416 2904671319 158
503 iso_pu_bacteria 2904699407 2904707225 158
504 iso_pu_bacteria 2904711408 2904719618 158
505 iso_pu_bacteria 2906602504 2906606356 158
506 iso_pu_bacteria 2906626472 2906626824 158
507 iso_pu_bacteria 2906643746 2906649071 158
508 iso_pu_bacteria 2908775508 2908777402 158
509 iso_pu_bacteria 2919073203 2919077964 158
510 iso_pu_bacteria 2922368715 2922377169 158
511 iso_pu_bacteria 2922393267 2922398320 158
512 iso_pu_bacteria 2922425934 2922433125 158
513 iso_pu_bacteria 2929615660 2929623570 158
514 iso_pu_bacteria 2929624759 2929632728 158
515 iso_pu_bacteria 2932784394 2932791421 158
516 iso_pu_bacteria 2932809354 2932814717 158
517 iso_pu_bacteria 2932818245 2932823574 158
518 iso_pu_bacteria 2932828146 2932833011 158
519 iso_pu_bacteria 2933577622 2933585473 158
520 iso_pu_bacteria 2935608549 2935616353 158
521 iso_pu_bacteria 2935616580 2935623742 158
522 iso_pu_bacteria 2935638405 2935639513 158
523 iso_pu_bacteria 2935648319 2935650747 158
524 iso_pu_bacteria 2935656913 2935662127 158
525 iso_pu_bacteria 2935665750 2935670458 158
526 iso_pu_bacteria 2935675223 2935679887 158
527 iso_pu_bacteria 2935684952 2935687457 158
528 iso_pu_bacteria 2935694250 2935696571 158
529 iso_pu_bacteria 2935703347 2935705389 158
530 iso_pu_bacteria 2935713505 2935718916 158
531 iso_pu_bacteria 2935722832 2935728568 158
532 iso_pu_bacteria 2935732158 2935736835 158
533 iso_pu_bacteria 2935741537 2935746162 158
534 iso_pu_bacteria 2935750917 2935753423 158
535 iso_pu_bacteria 2935760218 2935766183 158
536 iso_pu_bacteria 2935769743 2935770406 158
537 iso_pu_bacteria 2935777560 2935777563 158
538 iso_pu_bacteria 2935785616 2935786541 158
539 iso_pu_bacteria 2935793552 2935794596 158
540 iso_pu_bacteria 2935801545 2935807131 158
541 iso_pu_bacteria 2935810662 2935813955 158
542 iso_pu_bacteria 2935819856 2935827150 158
543 iso_pu_bacteria 2935827899 2935828996 158
544 iso_pu_bacteria 2935837841 2935844168 158
545 iso_pu_bacteria 2935847175 2935854331 158
546 iso_pu_bacteria 2935855204 2935862033 158
547 iso_pu_bacteria 2935864058 2935871597 158
548 iso_pu_bacteria 2935873716 2935880292 158
549 iso_pu_bacteria 2935908558 2935913574 158
550 iso_pu_bacteria 2935916978 2935923472 158
551 iso_pu_bacteria 2935926038 2935931109 158
552 iso_pu_bacteria 2935934488 2935935391 158
553 iso_pu_bacteria 2935942939 2935946957 158
554 iso_pu_bacteria 2935951376 2935953948 158
555 iso_pu_bacteria 2935959822 2935961419 158
556 iso_pu_bacteria 2935967501 2935968974 158
557 iso_pu_bacteria 2935975950 2935982376 158
558 iso_pu_bacteria 2935984226 2935985833 158
559 iso_pu_bacteria 2935992306 2935996958 158
560 iso_pu_bacteria 2936002035 2936005993 158
561 iso_pu_bacteria 2936011229 2936016291 158
562 iso_pu_bacteria 2936019824 2936025061 158
563 iso_pu_bacteria 2936028420 2936033596 158
564 iso_pu_bacteria 2936037263 2936039511 158
565 iso_pu_bacteria 2936046547 2936050972 158
566 iso_pu_bacteria 2936055302 2936057721 158
567 iso_pu_bacteria 2940556831 2940559336 158
568 iso_pu_bacteria 2941538514 2941542031 158
569 iso_pu_bacteria 3005483717 3005491255 158
570 iso_pu_bacteria 3005506211 3005511096 158
571 iso_pu_bacteria 3005587118 3005591945 158
572 iso_pu_bacteria 3005594810 3005596075 158
573 iso_pu_bacteria 8006933436 8006935012 158
574 iso_pu_bacteria 8006973647 8006974980 158
575 iso_pu_bacteria 8016511872 8016517038 158
576 iso_pu_bacteria 8016522445 8016524585 158
577 iso_pu_bacteria 8016530956 8016538146 158
578 iso_pu_bacteria 8016539877 8016542427 158
579 iso_pu_bacteria 8016548790 8016550849 158
580 iso_pu_bacteria 8016557553 8016559261 158
581 iso_pu_bacteria 8016566248 8016567814 158
582 iso_pu_bacteria 8016575299 8016580503 158
583 iso_pu_bacteria 8016583857 8016588527 158
584 iso_pu_bacteria 8016595262 8016597211 158
585 iso_pu_bacteria 8016603502 8016605061 158
586 iso_pu_bacteria 8016613128 8016619958 158
587 iso_pu_bacteria 8016622563 8016624177 158
588 iso_pu_bacteria 8016630954 8016637569 158
589 iso_pu_bacteria 8017057580 8017059542 158
590 iso_pu_bacteria 8019530166 8019537818 158
591 iso_pu_bacteria 8019538911 8019539445 158
592 iso_pu_bacteria 8019547302 8019551198 158
593 iso_pu_bacteria 8019555841 8019563645 158
594 iso_pu_bacteria 8019565922 8019573715 158
595 iso_pu_bacteria 8019576017 8019579009 158
596 iso_pu_bacteria 8019597564 8019604632 158
597 iso_pu_bacteria 8019608314 8019613898 158
598 iso_pu_bacteria 8019619141 8019624474 158
599 iso_pu_bacteria 8019629233 8019637571 158
600 iso_pu_bacteria 8019638758 8019642045 158
601 iso_pu_bacteria 8019659431 8019665498 158
602 iso_pu_bacteria 8019678201 8019681053 158
603 iso_pu_bacteria 8019687851 8019694666 158
604 iso_pu_bacteria 8055742211 8055749730 158
605 iso_pu_bacteria 8056681323 8056681745 158
606 iso_pu_bacteria 8056967851 8056973943 158
607 3300005937 Ga0081455_10053843 Ga0081455_100538432 159
608 3300006871 Ga0075434_101292010 Ga0075434_1012920101 159
609 3300007788 Ga0099795_10303414 Ga0099795_103034141 159
610 3300009553 Ga0105249_11562683 Ga0105249_115626831 159
611 3300012483 Ga0157337_1002162 Ga0157337_10021621 159
612 3300017792 Ga0163161_11122265 Ga0163161_111222651 159
613 3300037471 Ga0395905_0489194 Ga0395905_0489194_373_861 159
614 3300038443 Ga0395901_0190253 Ga0395901_0190253_680_1168 159
615 3300039437 Ga0436365_0823182 Ga0436365_0823182_69_560 159
616 3300050512 nmdc:mga0n895_1272174_c1 nmdc:mga0n895_1272174_c1_173_661 159
617 3300059660 Ga0587124_020525 Ga0587124_020525_102_593 159
618 3300003911 JGI25405J52794_10003478 JGI25405J52794_100034782 160
619 3300005329 Ga0070683_100358105 Ga0070683_1003581051 160
620 3300005343 Ga0070687_100178221 Ga0070687_1001782211 160
621 3300005355 Ga0070671_100038562 Ga0070671_1000385625 160
622 3300005435 Ga0070714_100015426 Ga0070714_1000154263 160
623 3300005439 Ga0070711_100520735 Ga0070711_1005207352 160
624 3300005547 Ga0070693_100178160 Ga0070693_1001781602 160
625 3300005564 Ga0070664_100126011 Ga0070664_1001260112 160
626 3300005618 Ga0068864_100491185 Ga0068864_1004911852 160
627 3300005834 Ga0068851_10417729 Ga0068851_104177291 160
628 3300005841 Ga0068863_100600051 Ga0068863_1006000512 160
629 3300005937 Ga0081455_10012018 Ga0081455_100120184 160
630 3300005981 Ga0081538_10030894 Ga0081538_100308943 160
631 3300005983 Ga0081540_1056247 Ga0081540_10562472 160
632 3300006038 Ga0075365_10013400 Ga0075365_100134003 160
633 3300006051 Ga0075364_10219000 Ga0075364_102190002 160
634 3300006237 Ga0097621_100892512 Ga0097621_1008925121 160
635 3300006846 Ga0075430_100184334 Ga0075430_1001843342 160
636 3300006880 Ga0075429_100153011 Ga0075429_1001530112 160
637 3300009094 Ga0111539_10768888 Ga0111539_107688882 160
638 3300009551 Ga0105238_10095850 Ga0105238_100958504 160
639 3300010375 Ga0105239_10032123 Ga0105239_100321233 160
640 3300011119 Ga0105246_10201239 Ga0105246_102012392 160
641 3300013100 Ga0157373_10189650 Ga0157373_101896501 160
642 3300013296 Ga0157374_10094363 Ga0157374_100943632 160
643 3300013307 Ga0157372_11715616 Ga0157372_117156161 160
644 3300013308 Ga0157375_10014388 Ga0157375_100143884 160
645 3300014325 Ga0163163_10109477 Ga0163163_101094773 160
646 3300017792 Ga0163161_10432229 Ga0163161_104322292 160
647 3300025906 Ga0207699_10340301 Ga0207699_103403011 160
648 3300025915 Ga0207693_10104955 Ga0207693_101049553 160
649 3300025916 Ga0207663_10048221 Ga0207663_100482211 160
650 3300025918 Ga0207662_10333127 Ga0207662_103331271 160
651 3300025928 Ga0207700_10286764 Ga0207700_102867641 160
652 3300025928 Ga0207700_10340516 Ga0207700_103405162 160
653 3300025929 Ga0207664_10011265 Ga0207664_100112653 160
654 3300025944 Ga0207661_10057962 Ga0207661_100579623 160
655 3300025945 Ga0207679_10095936 Ga0207679_100959363 160
656 3300026023 Ga0207677_10086019 Ga0207677_100860193 160
657 3300026095 Ga0207676_10092423 Ga0207676_100924232 160
658 3300026142 Ga0207698_10134117 Ga0207698_101341172 160
659 3300030863 Ga0265766_1009582 Ga0265766_10095821 160
660 3300031595 Ga0265313_10007792 Ga0265313_100077923 160
661 3300031711 Ga0265314_10247378 Ga0265314_102473782 160
662 3300035084 Ga0373928_0169218 Ga0373928_0169218_96_587 160
663 3300035086 Ga0373934_0115232 Ga0373934_0115232_359_847 160
664 3300035111 Ga0373923_0472518 Ga0373923_0472518_25_513 160
665 3300035117 Ga0373953_0030094 Ga0373953_0030094_1201_1689 160
666 3300035118 Ga0373954_0019062 Ga0373954_0019062_375_863 160
667 3300035119 Ga0373956_0015439 Ga0373956_0015439_2477_2965 160
668 3300035120 Ga0373957_0010840 Ga0373957_0010840_1915_2403 160
669 3300035172 Ga0373955_0039016 Ga0373955_0039016_659_1147 160
670 3300035724 Ga0373933_0048118 Ga0373933_0048118_113_601 160
671 3300036401 Ga0373937_0075352 Ga0373937_0075352_511_999 160
672 3300046454 Ga0495592_0051683 Ga0495592_0051683_514_1002 160
673 3300046459 Ga0495629_0116031 Ga0495629_0116031_845_1333 160
674 3300046463 Ga0495653_0025338 Ga0495653_0025338_613_1101 160
675 3300046475 Ga0495639_0212430 Ga0495639_0212430_202_690 160
676 3300046511 Ga0495608_0056748 Ga0495608_0056748_588_1076 160
677 3300046514 Ga0495618_0185562 Ga0495618_0185562_586_1074 160
678 3300046517 Ga0495630_0903802 Ga0495630_0903802_75_563 160
679 3300046529 Ga0495652_0028961 Ga0495652_0028961_1485_1973 160
680 3300046533 Ga0495640_0148669 Ga0495640_0148669_666_1154 160
681 3300046559 Ga0495667_0052392 Ga0495667_0052392_523_1011 160
682 3300046642 Ga0495634_0081282 Ga0495634_0081282_430_918 160
683 3300046663 Ga0495635_0018719 Ga0495635_0018719_403_891 160
684 3300046675 Ga0495657_0016378 Ga0495657_0016378_4334_4822 160
685 3300046678 Ga0495599_0166242 Ga0495599_0166242_283_771 160
686 3300046683 Ga0495658_0208075 Ga0495658_0208075_532_1020 160
687 3300046689 Ga0495613_0767128 Ga0495613_0767128_45_533 160
688 3300046690 Ga0495624_0411268 Ga0495624_0411268_189_680 160
689 3300046809 Ga0495600_0347429 Ga0495600_0347429_52_540 160
690 3300047317 Ga0495604_0117147 Ga0495604_0117147_1393_1881 160
691 3300047319 Ga0495674_0232372 Ga0495674_0232372_538_1026 160
692 3300047322 Ga0495680_0334977 Ga0495680_0334977_72_560 160
693 3300047444 Ga0495675_0012692 Ga0495675_0012692_4232_4720 160
694 3300047444 Ga0495675_0710794 Ga0495675_0710794_53_544 160
695 3300048088 Ga0495602_0050110 Ga0495602_0050110_682_1170 160
696 3300048903 Ga0496100_0045083 Ga0496100_0045083_1526_2011 160
697 3300048904 Ga0496101_0038367 Ga0496101_0038367_344_829 160
698 3300048905 Ga0496102_0003166 Ga0496102_0003166_5491_5976 160
699 3300048907 Ga0496104_0018749 Ga0496104_0018749_5383_5868 160
700 3300048908 Ga0496105_0058959 Ga0496105_0058959_342_827 160
701 3300048909 Ga0496106_0004829 Ga0496106_0004829_7719_8204 160
702 3300048910 Ga0496107_0008140 Ga0496107_0008140_6534_7019 160
703 3300048911 Ga0496108_0022903 Ga0496108_0022903_341_826 160
704 3300048912 Ga0496109_0010165 Ga0496109_0010165_3145_3630 160
705 3300048913 Ga0496110_0193956 Ga0496110_0193956_967_1452 160
706 3300048915 Ga0496112_0048391 Ga0496112_0048391_2711_3196 160
707 3300048916 Ga0496113_0015214 Ga0496113_0015214_4498_4983 160
708 3300048918 Ga0496115_0002383 Ga0496115_0002383_5935_6420 160
709 3300049573 Ga0501037_0716007 Ga0501037_0716007_60_569 160
710 3300049575 Ga0501039_0356563 Ga0501039_0356563_190_678 160
711 3300049577 Ga0501041_0423790 Ga0501041_0423790_197_685 160
712 3300049579 Ga0501043_0602857 Ga0501043_0602857_163_651 160
713 3300049587 Ga0501071_0109211 Ga0501071_0109211_1300_1788 160
714 3300049588 Ga0501072_0647005 Ga0501072_0647005_34_522 160
715 3300049590 Ga0501074_0264454 Ga0501074_0264454_461_988 160
716 3300049591 Ga0501075_0332019 Ga0501075_0332019_422_949 160
717 3300049592 Ga0501076_0032845 Ga0501076_0032845_1552_2079 160
718 3300049593 Ga0501077_0120879 Ga0501077_0120879_524_1033 160
719 3300049742 Ga0501080_0095483 Ga0501080_0095483_79_567 160
720 3300049743 Ga0501081_0035611 Ga0501081_0035611_2338_2829 160
721 3300049822 Ga0501035_0336754 Ga0501035_0336754_761_1249 160
722 3300049824 Ga0501045_0257507 Ga0501045_0257507_767_1258 160
723 3300049824 Ga0501045_0500555 Ga0501045_0500555_91_579 160
724 3300050492 nmdc:mga0yw44_100616_c1 nmdc:mga0yw44_100616_c1_623_1114 160
725 3300050509 nmdc:mga0qj67_754949_c1 nmdc:mga0qj67_754949_c1_246_737 160
726 3300050510 nmdc:mga06r32_218511_c1 nmdc:mga06r32_218511_c1_66_557 160
727 3300053078 Ga0495612_0255806 Ga0495612_0255806_96_584 160
728 3300053085 Ga0495619_0378986 Ga0495619_0378986_188_676 160
729 3300053730 Ga0500645_048293 Ga0500645_048293_451_939 160
730 3300054114 Ga0501084_0334479 Ga0501084_0334479_223_714 160
731 3300054114 Ga0501084_0692783 Ga0501084_0692783_142_630 160
732 3300060353 Ga0501082_1188637 Ga0501082_1188637_62_550 160
733 3300061734 Ga0530510_0070488 Ga0530510_0070488_84_611 160
734 3300002075 JGI24738J21930_10138678 JGI24738J21930_101386781 161
735 3300002077 JGI24744J21845_10070339 JGI24744J21845_100703391 161
736 3300003215 JGI25153J46596_10002652 JGI25153J46596_100026525 161
737 3300003659 JGI25404J52841_10001685 JGI25404J52841_100016851 161
738 3300003911 JGI25405J52794_10042128 JGI25405J52794_100421281 161
739 3300005295 Ga0065707_10323728 Ga0065707_103237282 161
740 3300005327 Ga0070658_10250102 Ga0070658_102501022 161
741 3300005328 Ga0070676_10488034 Ga0070676_104880341 161
742 3300005329 Ga0070683_100229107 Ga0070683_1002291072 161
743 3300005329 Ga0070683_100879377 Ga0070683_1008793772 161
744 3300005329 Ga0070683_101800119 Ga0070683_1018001191 161
745 3300005331 Ga0070670_100197497 Ga0070670_1001974971 161
746 3300005334 Ga0068869_100027419 Ga0068869_1000274193 161
747 3300005334 Ga0068869_100575987 Ga0068869_1005759872 161
748 3300005335 Ga0070666_10046350 Ga0070666_100463503 161
749 3300005336 Ga0070680_100025590 Ga0070680_1000255902 161
750 3300005337 Ga0070682_100310424 Ga0070682_1003104241 161
751 3300005337 Ga0070682_101518708 Ga0070682_1015187081 161
752 3300005338 Ga0068868_100026005 Ga0068868_1000260053 161
753 3300005338 Ga0068868_100295349 Ga0068868_1002953492 161
754 3300005339 Ga0070660_100007638 Ga0070660_1000076386 161
755 3300005339 Ga0070660_100321361 Ga0070660_1003213612 161
756 3300005339 Ga0070660_100451376 Ga0070660_1004513762 161
757 3300005340 Ga0070689_100089135 Ga0070689_1000891352 161
758 3300005341 Ga0070691_10050182 Ga0070691_100501821 161
759 3300005344 Ga0070661_100094549 Ga0070661_1000945492 161
760 3300005347 Ga0070668_100028776 Ga0070668_1000287764 161
761 3300005347 Ga0070668_100481582 Ga0070668_1004815822 161
762 3300005353 Ga0070669_100414435 Ga0070669_1004144351 161
763 3300005365 Ga0070688_100377884 Ga0070688_1003778841 161
764 3300005365 Ga0070688_100519886 Ga0070688_1005198862 161
765 3300005367 Ga0070667_100035551 Ga0070667_1000355513 161
766 3300005367 Ga0070667_100530762 Ga0070667_1005307621 161
767 3300005406 Ga0070703_10065908 Ga0070703_100659082 161
768 3300005434 Ga0070709_10512808 Ga0070709_105128081 161
769 3300005435 Ga0070714_100064213 Ga0070714_1000642133 161
770 3300005435 Ga0070714_100286854 Ga0070714_1002868542 161
771 3300005435 Ga0070714_100336897 Ga0070714_1003368971 161
772 3300005436 Ga0070713_100012854 Ga0070713_1000128544 161
773 3300005438 Ga0070701_10211593 Ga0070701_102115932 161
774 3300005439 Ga0070711_100011060 Ga0070711_1000110601 161
775 3300005439 Ga0070711_100492219 Ga0070711_1004922192 161
776 3300005445 Ga0070708_100999514 Ga0070708_1009995141 161
777 3300005455 Ga0070663_100096273 Ga0070663_1000962732 161
778 3300005455 Ga0070663_100169739 Ga0070663_1001697391 161
779 3300005456 Ga0070678_100021041 Ga0070678_1000210414 161
780 3300005457 Ga0070662_100035970 Ga0070662_1000359702 161
781 3300005459 Ga0068867_100049036 Ga0068867_1000490361 161
782 3300005459 Ga0068867_100616004 Ga0068867_1006160041 161
783 3300005530 Ga0070679_100010119 Ga0070679_1000101194 161
784 3300005530 Ga0070679_100472346 Ga0070679_1004723461 161
785 3300005535 Ga0070684_100007774 Ga0070684_1000077743 161
786 3300005535 Ga0070684_100217994 Ga0070684_1002179941 161
787 3300005536 Ga0070697_100341878 Ga0070697_1003418782 161
788 3300005539 Ga0068853_101272831 Ga0068853_1012728311 161
789 3300005543 Ga0070672_100249900 Ga0070672_1002499002 161
790 3300005545 Ga0070695_100049535 Ga0070695_1000495351 161
791 3300005546 Ga0070696_100314910 Ga0070696_1003149101 161
792 3300005548 Ga0070665_100367872 Ga0070665_1003678722 161
793 3300005548 Ga0070665_100546511 Ga0070665_1005465112 161
794 3300005548 Ga0070665_100707365 Ga0070665_1007073652 161
795 3300005548 Ga0070665_101491396 Ga0070665_1014913961 161
796 3300005548 Ga0070665_101636392 Ga0070665_1016363921 161
797 3300005549 Ga0070704_100271835 Ga0070704_1002718351 161
798 3300005563 Ga0068855_100130222 Ga0068855_1001302222 161
799 3300005563 Ga0068855_100243740 Ga0068855_1002437403 161
800 3300005563 Ga0068855_101249750 Ga0068855_1012497502 161
801 3300005563 Ga0068855_101455680 Ga0068855_1014556801 161
802 3300005578 Ga0068854_100272890 Ga0068854_1002728901 161
803 3300005614 Ga0068856_100049006 Ga0068856_1000490062 161
804 3300005614 Ga0068856_100150564 Ga0068856_1001505643 161
805 3300005614 Ga0068856_101640490 Ga0068856_1016404901 161
806 3300005615 Ga0070702_100026334 Ga0070702_1000263341 161
807 3300005616 Ga0068852_100144875 Ga0068852_1001448752 161
808 3300005616 Ga0068852_100571491 Ga0068852_1005714912 161
809 3300005616 Ga0068852_100590158 Ga0068852_1005901582 161
810 3300005617 Ga0068859_100142154 Ga0068859_1001421541 161
811 3300005618 Ga0068864_100065929 Ga0068864_1000659292 161
812 3300005719 Ga0068861_100068901 Ga0068861_1000689013 161
813 3300005719 Ga0068861_100236282 Ga0068861_1002362822 161
814 3300005719 Ga0068861_100952270 Ga0068861_1009522701 161
815 3300005719 Ga0068861_100988474 Ga0068861_1009884742 161
816 3300005840 Ga0068870_10082280 Ga0068870_100822802 161
817 3300005841 Ga0068863_100104494 Ga0068863_1001044943 161
818 3300005841 Ga0068863_100334870 Ga0068863_1003348702 161
819 3300005841 Ga0068863_100437314 Ga0068863_1004373141 161
820 3300005842 Ga0068858_100052617 Ga0068858_1000526173 161
821 3300005842 Ga0068858_100104845 Ga0068858_1001048452 161
822 3300005842 Ga0068858_100219263 Ga0068858_1002192631 161
823 3300005842 Ga0068858_100222596 Ga0068858_1002225962 161
824 3300005842 Ga0068858_100226013 Ga0068858_1002260132 161
825 3300005843 Ga0068860_100000543 Ga0068860_10000054341 161
826 3300005843 Ga0068860_100148500 Ga0068860_1001485004 161
827 3300005844 Ga0068862_101215715 Ga0068862_1012157151 161
828 3300005937 Ga0081455_10005036 Ga0081455_100050365 161
829 3300005981 Ga0081538_10094308 Ga0081538_100943082 161
830 3300005983 Ga0081540_1003764 Ga0081540_10037646 161
831 3300005983 Ga0081540_1005838 Ga0081540_10058384 161
832 3300005983 Ga0081540_1005865 Ga0081540_10058657 161
833 3300005983 Ga0081540_1009326 Ga0081540_10093264 161
834 3300005983 Ga0081540_1035231 Ga0081540_10352313 161
835 3300005985 Ga0081539_10085162 Ga0081539_100851623 161
836 3300006028 Ga0070717_10028586 Ga0070717_100285863 161
837 3300006028 Ga0070717_10051868 Ga0070717_100518682 161
838 3300006028 Ga0070717_10202597 Ga0070717_102025973 161
839 3300006028 Ga0070717_11111106 Ga0070717_111111061 161
840 3300006038 Ga0075365_10028198 Ga0075365_100281983 161
841 3300006038 Ga0075365_10085140 Ga0075365_100851403 161
842 3300006038 Ga0075365_10189421 Ga0075365_101894211 161
843 3300006042 Ga0075368_10096087 Ga0075368_100960872 161
844 3300006048 Ga0075363_100214812 Ga0075363_1002148121 161
845 3300006048 Ga0075363_100445348 Ga0075363_1004453482 161
846 3300006048 Ga0075363_100473861 Ga0075363_1004738611 161
847 3300006173 Ga0070716_100506455 Ga0070716_1005064551 161
848 3300006177 Ga0075362_10116343 Ga0075362_101163432 161
849 3300006178 Ga0075367_10004639 Ga0075367_100046394 161
850 3300006178 Ga0075367_10352144 Ga0075367_103521441 161
851 3300006195 Ga0075366_10147749 Ga0075366_101477492 161
852 3300006195 Ga0075366_10227491 Ga0075366_102274911 161
853 3300006195 Ga0075366_10383386 Ga0075366_103833861 161
854 3300006237 Ga0097621_100515645 Ga0097621_1005156452 161
855 3300006353 Ga0075370_10018061 Ga0075370_100180613 161
856 3300006358 Ga0068871_100245345 Ga0068871_1002453452 161
857 3300006358 Ga0068871_100662671 Ga0068871_1006626711 161
858 3300006844 Ga0075428_100709422 Ga0075428_1007094222 161
859 3300006871 Ga0075434_100297723 Ga0075434_1002977232 161
860 3300006881 Ga0068865_100093045 Ga0068865_1000930454 161
861 3300006914 Ga0075436_100297621 Ga0075436_1002976211 161
862 3300006914 Ga0075436_100496251 Ga0075436_1004962511 161
863 3300006931 Ga0097620_100142152 Ga0097620_1001421521 161
864 3300007076 Ga0075435_100363348 Ga0075435_1003633482 161
865 3300007076 Ga0075435_100827196 Ga0075435_1008271961 161
866 3300009011 Ga0105251_10137145 Ga0105251_101371451 161
867 3300009011 Ga0105251_10329894 Ga0105251_103298941 161
868 3300009092 Ga0105250_10052188 Ga0105250_100521881 161
869 3300009093 Ga0105240_10022030 Ga0105240_100220304 161
870 3300009093 Ga0105240_10055436 Ga0105240_100554364 161
871 3300009098 Ga0105245_10082903 Ga0105245_100829033 161
872 3300009101 Ga0105247_10053876 Ga0105247_100538763 161
873 3300009101 Ga0105247_11283193 Ga0105247_112831931 161
874 3300009147 Ga0114129_11068240 Ga0114129_110682402 161
875 3300009148 Ga0105243_10321370 Ga0105243_103213702 161
876 3300009176 Ga0105242_10052705 Ga0105242_100527053 161
877 3300009177 Ga0105248_10076907 Ga0105248_100769073 161
878 3300009545 Ga0105237_10085961 Ga0105237_100859613 161
879 3300009545 Ga0105237_10148901 Ga0105237_101489013 161
880 3300009545 Ga0105237_10198097 Ga0105237_101980972 161
881 3300009545 Ga0105237_11563517 Ga0105237_115635171 161
882 3300009551 Ga0105238_10001743 Ga0105238_1000174314 161
883 3300009551 Ga0105238_10004073 Ga0105238_1000407313 161
884 3300009553 Ga0105249_10021525 Ga0105249_100215252 161
885 3300010375 Ga0105239_10014303 Ga0105239_100143035 161
886 3300010375 Ga0105239_10314536 Ga0105239_103145362 161
887 3300010375 Ga0105239_10549330 Ga0105239_105493302 161
888 3300011119 Ga0105246_10030767 Ga0105246_100307673 161
889 3300011119 Ga0105246_10064349 Ga0105246_100643492 161
890 3300012477 Ga0157336_1004394 Ga0157336_10043941 161
891 3300012492 Ga0157335_1008624 Ga0157335_10086242 161
892 3300012506 Ga0157324_1008745 Ga0157324_10087452 161
893 3300013104 Ga0157370_10012254 Ga0157370_100122547 161
894 3300013104 Ga0157370_10061921 Ga0157370_100619214 161
895 3300013296 Ga0157374_10113743 Ga0157374_101137432 161
896 3300013296 Ga0157374_10608527 Ga0157374_106085271 161
897 3300013297 Ga0157378_10002682 Ga0157378_100026829 161
898 3300013297 Ga0157378_10056434 Ga0157378_100564343 161
899 3300013297 Ga0157378_10451812 Ga0157378_104518122 161
900 3300013306 Ga0163162_10271475 Ga0163162_102714752 161
901 3300013306 Ga0163162_10396541 Ga0163162_103965412 161
902 3300013306 Ga0163162_10656178 Ga0163162_106561782 161
903 3300013307 Ga0157372_10557912 Ga0157372_105579121 161
904 3300014325 Ga0163163_10119609 Ga0163163_101196093 161
905 3300014326 Ga0157380_10793653 Ga0157380_107936531 161
906 3300014326 Ga0157380_11589697 Ga0157380_115896971 161
907 3300014969 Ga0157376_10291071 Ga0157376_102910712 161
908 3300017792 Ga0163161_10054336 Ga0163161_100543362 161
909 3300017792 Ga0163161_10346375 Ga0163161_103463752 161
910 3300019166 Ga0184595_129802 Ga0184595_1298021 161
911 3300019183 Ga0184601_116584 Ga0184601_1165841 161
912 3300019183 Ga0184601_135068 Ga0184601_1350681 161
913 3300019188 Ga0184599_119650 Ga0184599_1196501 161
914 3300019190 Ga0184600_141600 Ga0184600_1416001 161
915 3300020070 Ga0206356_10346957 Ga0206356_103469571 161
916 3300023539 Ga0247555_102493 Ga0247555_1024931 161
917 3300023664 Ga0247527_111926 Ga0247527_1119261 161
918 3300025261 Ga0209233_1012117 Ga0209233_10121172 161
919 3300025271 Ga0207666_1028629 Ga0207666_10286291 161
920 3300025272 Ga0209455_1013267 Ga0209455_10132672 161
921 3300025297 Ga0209758_1009586 Ga0209758_10095865 161
922 3300025297 Ga0209758_1018978 Ga0209758_10189783 161
923 3300025321 Ga0207656_10520900 Ga0207656_105209001 161
924 3300025885 Ga0207653_10037282 Ga0207653_100372822 161
925 3300025898 Ga0207692_10058429 Ga0207692_100584291 161
926 3300025898 Ga0207692_10531136 Ga0207692_105311361 161
927 3300025899 Ga0207642_10096607 Ga0207642_100966072 161
928 3300025900 Ga0207710_10015469 Ga0207710_100154692 161
929 3300025901 Ga0207688_10021039 Ga0207688_100210393 161
930 3300025903 Ga0207680_10553326 Ga0207680_105533262 161
931 3300025904 Ga0207647_10067001 Ga0207647_100670012 161
932 3300025907 Ga0207645_10104548 Ga0207645_101045481 161
933 3300025908 Ga0207643_10099208 Ga0207643_100992082 161
934 3300025909 Ga0207705_10431236 Ga0207705_104312362 161
935 3300025910 Ga0207684_10295307 Ga0207684_102953072 161
936 3300025911 Ga0207654_10077665 Ga0207654_100776653 161
937 3300025912 Ga0207707_10001016 Ga0207707_1000101628 161
938 3300025912 Ga0207707_10585625 Ga0207707_105856251 161
939 3300025912 Ga0207707_10921723 Ga0207707_109217232 161
940 3300025914 Ga0207671_10116065 Ga0207671_101160652 161
941 3300025914 Ga0207671_10248006 Ga0207671_102480062 161
942 3300025914 Ga0207671_10510307 Ga0207671_105103071 161
943 3300025914 Ga0207671_11062931 Ga0207671_110629311 161
944 3300025916 Ga0207663_10074325 Ga0207663_100743252 161
945 3300025917 Ga0207660_10000887 Ga0207660_1000088716 161
946 3300025917 Ga0207660_10020990 Ga0207660_100209904 161
947 3300025918 Ga0207662_10082475 Ga0207662_100824752 161
948 3300025919 Ga0207657_10001391 Ga0207657_100013919 161
949 3300025919 Ga0207657_10135259 Ga0207657_101352592 161
950 3300025920 Ga0207649_10093891 Ga0207649_100938912 161
951 3300025921 Ga0207652_10053035 Ga0207652_100530353 161
952 3300025925 Ga0207650_10325003 Ga0207650_103250032 161
953 3300025927 Ga0207687_10255587 Ga0207687_102555872 161
954 3300025928 Ga0207700_10026090 Ga0207700_100260903 161
955 3300025929 Ga0207664_10386272 Ga0207664_103862721 161
956 3300025929 Ga0207664_10548649 Ga0207664_105486492 161
957 3300025929 Ga0207664_10855239 Ga0207664_108552391 161
958 3300025932 Ga0207690_10131980 Ga0207690_101319802 161
959 3300025934 Ga0207686_10049076 Ga0207686_100490763 161
960 3300025934 Ga0207686_10187654 Ga0207686_101876542 161
961 3300025936 Ga0207670_10891513 Ga0207670_108915131 161
962 3300025937 Ga0207669_10051215 Ga0207669_100512154 161
963 3300025938 Ga0207704_10103541 Ga0207704_101035411 161
964 3300025939 Ga0207665_10071628 Ga0207665_100716281 161
965 3300025940 Ga0207691_10048268 Ga0207691_100482682 161
966 3300025944 Ga0207661_10349837 Ga0207661_103498372 161
967 3300025949 Ga0207667_10086340 Ga0207667_100863403 161
968 3300025949 Ga0207667_10114401 Ga0207667_101144012 161
969 3300025949 Ga0207667_10875507 Ga0207667_108755071 161
970 3300025949 Ga0207667_11218994 Ga0207667_112189941 161
971 3300025961 Ga0207712_10238503 Ga0207712_102385032 161
972 3300025961 Ga0207712_11695026 Ga0207712_116950261 161
973 3300025972 Ga0207668_10021619 Ga0207668_100216193 161
974 3300025972 Ga0207668_10736949 Ga0207668_107369491 161
975 3300025972 Ga0207668_10853781 Ga0207668_108537811 161
976 3300025981 Ga0207640_10157239 Ga0207640_101572392 161
977 3300025986 Ga0207658_11239127 Ga0207658_112391272 161
978 3300026023 Ga0207677_10042292 Ga0207677_100422923 161
979 3300026035 Ga0207703_10072541 Ga0207703_100725412 161
980 3300026035 Ga0207703_10586882 Ga0207703_105868821 161
981 3300026035 Ga0207703_10762167 Ga0207703_107621671 161
982 3300026035 Ga0207703_11128065 Ga0207703_111280652 161
983 3300026041 Ga0207639_10056384 Ga0207639_100563843 161
984 3300026041 Ga0207639_10107023 Ga0207639_101070233 161
985 3300026067 Ga0207678_10397020 Ga0207678_103970202 161
986 3300026075 Ga0207708_10055363 Ga0207708_100553632 161
987 3300026088 Ga0207641_11759583 Ga0207641_117595831 161
988 3300026089 Ga0207648_10014624 Ga0207648_100146244 161
989 3300026095 Ga0207676_10006429 Ga0207676_100064293 161
990 3300026095 Ga0207676_10571703 Ga0207676_105717032 161
991 3300026116 Ga0207674_10588818 Ga0207674_105888181 161
992 3300026142 Ga0207698_12042653 Ga0207698_120426531 161
993 3300027866 Ga0209813_10076709 Ga0209813_100767091 161
994 3300027907 Ga0207428_10618016 Ga0207428_106180161 161
995 3300028379 Ga0268266_10001136 Ga0268266_1000113637 161
996 3300028379 Ga0268266_10067714 Ga0268266_100677142 161
997 3300028379 Ga0268266_10109126 Ga0268266_101091264 161
998 3300028379 Ga0268266_10192392 Ga0268266_101923923 161
999 3300028379 Ga0268266_10330486 Ga0268266_103304862 161
1000 3300028380 Ga0268265_10076118 Ga0268265_100761183 161
1001 3300028381 Ga0268264_10000185 Ga0268264_10000185104 161
1002 3300028381 Ga0268264_12074603 Ga0268264_120746031 161
1003 3300028573 Ga0265334_10005906 Ga0265334_100059064 161
1004 3300028800 Ga0265338_11010540 Ga0265338_110105401 161
1005 3300030521 Ga0307511_10033050 Ga0307511_100330504 161
1006 3300030521 Ga0307511_10114077 Ga0307511_101140772 161
1007 3300030522 Ga0307512_10311289 Ga0307512_103112891 161
1008 3300030878 Ga0265770_1056325 Ga0265770_10563251 161
1009 3300031090 Ga0265760_10135028 Ga0265760_101350281 161
1010 3300031242 Ga0265329_10088338 Ga0265329_100883381 161
1011 3300031249 Ga0265339_10041054 Ga0265339_100410543 161
1012 3300031250 Ga0265331_10030929 Ga0265331_100309292 161
1013 3300031456 Ga0307513_10258126 Ga0307513_102581262 161
1014 3300031456 Ga0307513_10269695 Ga0307513_102696952 161
1015 3300031507 Ga0307509_10192424 Ga0307509_101924241 161
1016 3300031507 Ga0307509_10201925 Ga0307509_102019253 161
1017 3300031507 Ga0307509_10279568 Ga0307509_102795681 161
1018 3300031507 Ga0307509_10314853 Ga0307509_103148531 161
1019 3300031548 Ga0307408_101629302 Ga0307408_1016293021 161
1020 3300031616 Ga0307508_10054901 Ga0307508_100549013 161
1021 3300031711 Ga0265314_10034496 Ga0265314_100344963 161
1022 3300031712 Ga0265342_10003016 Ga0265342_1000301613 161
1023 3300031730 Ga0307516_10248542 Ga0307516_102485422 161
1024 3300031731 Ga0307405_11404721 Ga0307405_114047211 161
1025 3300031810 Ga0316044_116803 Ga0316044_1168031 161
1026 3300031815 Ga0316045_119733 Ga0316045_1197331 161
1027 3300031824 Ga0307413_10067220 Ga0307413_100672203 161
1028 3300031852 Ga0307410_10883114 Ga0307410_108831142 161
1029 3300031903 Ga0307407_10089969 Ga0307407_100899692 161
1030 3300031911 Ga0307412_10041561 Ga0307412_100415611 161
1031 3300032002 Ga0307416_100347484 Ga0307416_1003474842 161
1032 3300032002 Ga0307416_100808858 Ga0307416_1008088581 161
1033 3300032004 Ga0307414_10634989 Ga0307414_106349891 161
1034 3300032005 Ga0307411_10146037 Ga0307411_101460372 161
1035 3300032005 Ga0307411_10608888 Ga0307411_106088881 161
1036 3300032120 Ga0316053_111976 Ga0316053_1119761 161
1037 3300032126 Ga0307415_100048349 Ga0307415_1000483491 161
1038 3300032126 Ga0307415_100585758 Ga0307415_1005857581 161
1039 3300033179 Ga0307507_10014035 Ga0307507_100140355 161
1040 3300033179 Ga0307507_10362116 Ga0307507_103621161 161
1041 3300033544 Ga0316215_1001011 Ga0316215_10010113 161
1042 3300034820 Ga0373959_0098391 Ga0373959_0098391_49_540 161
1043 3300035083 Ga0373926_0068981 Ga0373926_0068981_492_983 161
1044 3300035083 Ga0373926_0198761 Ga0373926_0198761_39_530 161
1045 3300035086 Ga0373934_0009072 Ga0373934_0009072_2562_3050 161
1046 3300035111 Ga0373923_0011449 Ga0373923_0011449_51_539 161
1047 3300035111 Ga0373923_0092372 Ga0373923_0092372_85_576 161
1048 3300035113 Ga0373936_0000642 Ga0373936_0000642_4504_4995 161
1049 3300035113 Ga0373936_0361681 Ga0373936_0361681_23_514 161
1050 3300035116 Ga0373945_0197663 Ga0373945_0197663_223_714 161
1051 3300035117 Ga0373953_0000731 Ga0373953_0000731_5373_5861 161
1052 3300035117 Ga0373953_0040403 Ga0373953_0040403_761_1252 161
1053 3300035118 Ga0373954_0000496 Ga0373954_0000496_10715_11206 161
1054 3300035118 Ga0373954_0001719 Ga0373954_0001719_5532_6020 161
1055 3300035119 Ga0373956_0002420 Ga0373956_0002420_3176_3664 161
1056 3300035119 Ga0373956_0259385 Ga0373956_0259385_321_812 161
1057 3300035120 Ga0373957_0000218 Ga0373957_0000218_7764_8252 161
1058 3300035120 Ga0373957_0003907 Ga0373957_0003907_3609_4100 161
1059 3300035170 Ga0373943_0009912 Ga0373943_0009912_1382_1873 161
1060 3300035171 Ga0373946_0002589 Ga0373946_0002589_5401_5892 161
1061 3300035172 Ga0373955_0003024 Ga0373955_0003024_3477_3965 161
1062 3300035172 Ga0373955_0006844 Ga0373955_0006844_360_851 161
1063 3300035410 Ga0373924_0001915 Ga0373924_0001915_2873_3364 161
1064 3300035410 Ga0373924_0005387 Ga0373924_0005387_443_931 161
1065 3300035692 Ga0373935_0001176 Ga0373935_0001176_5683_6174 161
1066 3300035692 Ga0373935_0006965 Ga0373935_0006965_1490_1978 161
1067 3300035695 Ga0373927_0015261 Ga0373927_0015261_4229_4720 161
1068 3300035695 Ga0373927_0021714 Ga0373927_0021714_372_860 161
1069 3300035695 Ga0373927_0369592 Ga0373927_0369592_368_859 161
1070 3300035724 Ga0373933_0000026 Ga0373933_0000026_79588_80076 161
1071 3300035724 Ga0373933_0001354 Ga0373933_0001354_34_525 161
1072 3300035724 Ga0373933_0011360 Ga0373933_0011360_3266_3754 161
1073 3300035725 Ga0373947_0157312 Ga0373947_0157312_848_1339 161
1074 3300035725 Ga0373947_0227647 Ga0373947_0227647_349_840 161
1075 3300036242 Ga0310104_11267 Ga0310104_11267_122_610 161
1076 3300036242 Ga0310104_14568 Ga0310104_14568_110_598 161
1077 3300036401 Ga0373937_0000356 Ga0373937_0000356_30683_31174 161
1078 3300036401 Ga0373937_0023752 Ga0373937_0023752_4004_4492 161
1079 3300036458 Ga0310112_043340 Ga0310112_043340_111_599 161
1080 3300037068 Ga0373925_0000462 Ga0373925_0000462_31602_32093 161
1081 3300037068 Ga0373925_1104536 Ga0373925_1104536_137_628 161
1082 3300037418 Ga0395900_0453880 Ga0395900_0453880_127_615 161
1083 3300037466 Ga0395898_0113253 Ga0395898_0113253_1537_2025 161
1084 3300039437 Ga0436365_0266253 Ga0436365_0266253_512_1000 161
1085 3300039437 Ga0436365_0593482 Ga0436365_0593482_220_708 161
1086 3300039437 Ga0436365_1532080 Ga0436365_1532080_395_886 161
1087 3300041459 Ga0451800_0254077 Ga0451800_0254077_341_832 161
1088 3300041460 Ga0451802_1086364 Ga0451802_1086364_982_1473 161
1089 3300041486 Ga0451807_1734372 Ga0451807_1734372_26_514 161
1090 3300041494 Ga0451837_1625367 Ga0451837_1625367_525_1016 161
1091 3300041498 Ga0451841_0591288 Ga0451841_0591288_112_603 161
1092 3300041507 Ga0451851_0715062 Ga0451851_0715062_177_665 161
1093 3300041509 Ga0451843_0159796 Ga0451843_0159796_11_502 161
1094 3300042005 Ga0439448_0204978 Ga0439448_0204978_113_604 161
1095 3300042012 Ga0439455_0134205 Ga0439455_0134205_177_668 161
1096 3300045976 Ga0466967_0040143 Ga0466967_0040143_2400_2888 161
1097 3300046453 Ga0495627_067260 Ga0495627_067260_365_856 161
1098 3300046454 Ga0495592_0000090 Ga0495592_0000090_8825_9316 161
1099 3300046454 Ga0495592_0001238 Ga0495592_0001238_3884_4372 161
1100 3300046454 Ga0495592_0464700 Ga0495592_0464700_258_746 161
1101 3300046455 Ga0495603_0025337 Ga0495603_0025337_260_751 161
1102 3300046455 Ga0495603_0381656 Ga0495603_0381656_220_711 161
1103 3300046455 Ga0495603_0619393 Ga0495603_0619393_102_593 161
1104 3300046458 Ga0495591_049105 Ga0495591_049105_520_1011 161
1105 3300046459 Ga0495629_0000750 Ga0495629_0000750_23028_23516 161
1106 3300046459 Ga0495629_0017208 Ga0495629_0017208_4048_4539 161
1107 3300046460 Ga0495638_0020879 Ga0495638_0020879_1940_2431 161
1108 3300046462 Ga0495651_0000682 Ga0495651_0000682_8837_9328 161
1109 3300046462 Ga0495651_0014625 Ga0495651_0014625_4546_5034 161
1110 3300046463 Ga0495653_0000322 Ga0495653_0000322_29631_30122 161
1111 3300046463 Ga0495653_0007956 Ga0495653_0007956_4685_5173 161
1112 3300046471 Ga0495650_0072313 Ga0495650_0072313_738_1229 161
1113 3300046472 Ga0495580_0424619 Ga0495580_0424619_245_736 161
1114 3300046475 Ga0495639_0061595 Ga0495639_0061595_481_972 161
1115 3300046476 Ga0495662_0059952 Ga0495662_0059952_136_627 161
1116 3300046476 Ga0495662_0087373 Ga0495662_0087373_788_1279 161
1117 3300046476 Ga0495662_0332578 Ga0495662_0332578_51_539 161
1118 3300046477 Ga0495664_0000078 Ga0495664_0000078_35770_36261 161
1119 3300046477 Ga0495664_0218356 Ga0495664_0218356_458_946 161
1120 3300046491 Ga0495584_0182774 Ga0495584_0182774_37_528 161
1121 3300046492 Ga0495585_0093083 Ga0495585_0093083_207_698 161
1122 3300046499 Ga0495594_0212459 Ga0495594_0212459_433_924 161
1123 3300046511 Ga0495608_0000022 Ga0495608_0000022_153504_153995 161
1124 3300046511 Ga0495608_0000738 Ga0495608_0000738_12589_13077 161
1125 3300046512 Ga0495610_0082229 Ga0495610_0082229_416_907 161
1126 3300046513 Ga0495616_0134315 Ga0495616_0134315_20_511 161
1127 3300046514 Ga0495618_0000229 Ga0495618_0000229_31622_32113 161
1128 3300046515 Ga0495620_0155379 Ga0495620_0155379_188_679 161
1129 3300046515 Ga0495620_0208563 Ga0495620_0208563_22_513 161
1130 3300046516 Ga0495628_0000035 Ga0495628_0000035_101328_101819 161
1131 3300046516 Ga0495628_0005837 Ga0495628_0005837_6414_6902 161
1132 3300046517 Ga0495630_0000377 Ga0495630_0000377_422_913 161
1133 3300046519 Ga0495632_0239056 Ga0495632_0239056_140_631 161
1134 3300046523 Ga0495644_0023135 Ga0495644_0023135_186_677 161
1135 3300046523 Ga0495644_0374016 Ga0495644_0374016_10_501 161
1136 3300046524 Ga0495648_0299264 Ga0495648_0299264_203_694 161
1137 3300046529 Ga0495652_0000062 Ga0495652_0000062_101340_101831 161
1138 3300046529 Ga0495652_0004125 Ga0495652_0004125_10588_11076 161
1139 3300046533 Ga0495640_0000021 Ga0495640_0000021_11117_11608 161
1140 3300046533 Ga0495640_0035969 Ga0495640_0035969_2828_3316 161
1141 3300046536 Ga0495587_0000006 Ga0495587_0000006_101340_101831 161
1142 3300046536 Ga0495587_0006945 Ga0495587_0006945_3950_4438 161
1143 3300046536 Ga0495587_0333946 Ga0495587_0333946_195_683 161
1144 3300046538 Ga0495609_0019137 Ga0495609_0019137_1690_2181 161
1145 3300046543 Ga0495645_0000174 Ga0495645_0000174_35493_35984 161
1146 3300046543 Ga0495645_0046137 Ga0495645_0046137_1655_2143 161
1147 3300046543 Ga0495645_0053146 Ga0495645_0053146_1234_1722 161
1148 3300046558 Ga0495633_0085037 Ga0495633_0085037_109_600 161
1149 3300046558 Ga0495633_0373406 Ga0495633_0373406_132_623 161
1150 3300046559 Ga0495667_0000161 Ga0495667_0000161_35549_36040 161
1151 3300046559 Ga0495667_0014506 Ga0495667_0014506_1358_1846 161
1152 3300046615 Ga0495656_0014978 Ga0495656_0014978_1233_1724 161
1153 3300046615 Ga0495656_0098347 Ga0495656_0098347_418_909 161
1154 3300046615 Ga0495656_0115210 Ga0495656_0115210_716_1207 161
1155 3300046616 Ga0495668_0145889 Ga0495668_0145889_473_964 161
1156 3300046642 Ga0495634_0000350 Ga0495634_0000350_8816_9307 161
1157 3300046642 Ga0495634_0052709 Ga0495634_0052709_24_512 161
1158 3300046663 Ga0495635_0000018 Ga0495635_0000018_184257_184748 161
1159 3300046663 Ga0495635_0000166 Ga0495635_0000166_9701_10189 161
1160 3300046665 Ga0495661_0091627 Ga0495661_0091627_163_654 161
1161 3300046674 Ga0495588_0009190 Ga0495588_0009190_2119_2610 161
1162 3300046674 Ga0495588_0204504 Ga0495588_0204504_47_538 161
1163 3300046675 Ga0495657_0000245 Ga0495657_0000245_40057_40548 161
1164 3300046675 Ga0495657_0005822 Ga0495657_0005822_5267_5755 161
1165 3300046678 Ga0495599_0000032 Ga0495599_0000032_98940_99431 161
1166 3300046678 Ga0495599_0014529 Ga0495599_0014529_2497_2985 161
1167 3300046678 Ga0495599_0328783 Ga0495599_0328783_348_836 161
1168 3300046679 Ga0495623_0000004 Ga0495623_0000004_25560_26051 161
1169 3300046679 Ga0495623_0002267 Ga0495623_0002267_2485_2973 161
1170 3300046680 Ga0495646_0000083 Ga0495646_0000083_9144_9635 161
1171 3300046680 Ga0495646_0002103 Ga0495646_0002103_9376_9864 161
1172 3300046683 Ga0495658_0043206 Ga0495658_0043206_1718_2209 161
1173 3300046689 Ga0495613_0025336 Ga0495613_0025336_11_499 161
1174 3300046689 Ga0495613_0026055 Ga0495613_0026055_262_753 161
1175 3300046690 Ga0495624_0263353 Ga0495624_0263353_56_547 161
1176 3300046691 Ga0495670_0073621 Ga0495670_0073621_56_547 161
1177 3300046692 Ga0495671_0490135 Ga0495671_0490135_31_522 161
1178 3300046794 Ga0495589_0369885 Ga0495589_0369885_122_613 161
1179 3300046794 Ga0495589_0395888 Ga0495589_0395888_13_504 161
1180 3300046809 Ga0495600_0000022 Ga0495600_0000022_83182_83673 161
1181 3300046809 Ga0495600_0005583 Ga0495600_0005583_3760_4248 161
1182 3300047317 Ga0495604_0000011 Ga0495604_0000011_8844_9335 161
1183 3300047317 Ga0495604_0004924 Ga0495604_0004924_2946_3434 161
1184 3300047319 Ga0495674_0000034 Ga0495674_0000034_101340_101831 161
1185 3300047319 Ga0495674_0005019 Ga0495674_0005019_9835_10323 161
1186 3300047319 Ga0495674_0460149 Ga0495674_0460149_380_868 161
1187 3300047320 Ga0495672_0259049 Ga0495672_0259049_301_792 161
1188 3300047321 Ga0495676_0077799 Ga0495676_0077799_1776_2267 161
1189 3300047322 Ga0495680_0000290 Ga0495680_0000290_8844_9335 161
1190 3300047322 Ga0495680_0004903 Ga0495680_0004903_3510_3998 161
1191 3300047323 Ga0495683_0047102 Ga0495683_0047102_1094_1585 161
1192 3300047444 Ga0495675_0000352 Ga0495675_0000352_20701_21192 161
1193 3300047444 Ga0495675_0000770 Ga0495675_0000770_1768_2256 161
1194 3300047447 Ga0495685_081282 Ga0495685_081282_163_654 161
1195 3300047469 Ga0495673_0235178 Ga0495673_0235178_20_511 161
1196 3300047471 Ga0495684_0000012 Ga0495684_0000012_175626_176117 161
1197 3300047471 Ga0495684_0000501 Ga0495684_0000501_23651_24139 161
1198 3300047472 Ga0495686_0195326 Ga0495686_0195326_83_574 161
1199 3300047673 Ga0495593_0006360 Ga0495593_0006360_2352_2840 161
1200 3300047673 Ga0495593_0011797 Ga0495593_0011797_3952_4443 161
1201 3300048088 Ga0495602_0000064 Ga0495602_0000064_8844_9335 161
1202 3300048088 Ga0495602_0019776 Ga0495602_0019776_4546_5034 161
1203 3300048088 Ga0495602_0370624 Ga0495602_0370624_416_904 161
1204 3300048903 Ga0496100_0026252 Ga0496100_0026252_460_951 161
1205 3300048903 Ga0496100_0441582 Ga0496100_0441582_42_533 161
1206 3300048903 Ga0496100_0945233 Ga0496100_0945233_131_622 161
1207 3300048904 Ga0496101_0915158 Ga0496101_0915158_45_536 161
1208 3300048904 Ga0496101_1309443 Ga0496101_1309443_66_554 161
1209 3300048905 Ga0496102_0098200 Ga0496102_0098200_1367_1858 161
1210 3300048905 Ga0496102_0157479 Ga0496102_0157479_55_546 161
1211 3300048905 Ga0496102_0553494 Ga0496102_0553494_23_514 161
1212 3300048905 Ga0496102_1382650 Ga0496102_1382650_70_558 161
1213 3300048906 Ga0496103_0163899 Ga0496103_0163899_807_1295 161
1214 3300048907 Ga0496104_0137623 Ga0496104_0137623_76_567 161
1215 3300048908 Ga0496105_0243128 Ga0496105_0243128_31_522 161
1216 3300048909 Ga0496106_0002121 Ga0496106_0002121_513_1001 161
1217 3300048909 Ga0496106_0067637 Ga0496106_0067637_1210_1701 161
1218 3300048909 Ga0496106_0111063 Ga0496106_0111063_1424_1915 161
1219 3300048909 Ga0496106_0132597 Ga0496106_0132597_300_791 161
1220 3300048909 Ga0496106_0324648 Ga0496106_0324648_648_1136 161
1221 3300048910 Ga0496107_0120945 Ga0496107_0120945_34_525 161
1222 3300048911 Ga0496108_0115465 Ga0496108_0115465_1260_1751 161
1223 3300048911 Ga0496108_0308673 Ga0496108_0308673_656_1147 161
1224 3300048912 Ga0496109_0256482 Ga0496109_0256482_612_1103 161
1225 3300048912 Ga0496109_0787100 Ga0496109_0787100_171_662 161
1226 3300048913 Ga0496110_0051881 Ga0496110_0051881_2336_2824 161
1227 3300048913 Ga0496110_0663164 Ga0496110_0663164_169_660 161
1228 3300048914 Ga0496111_0092714 Ga0496111_0092714_1025_1516 161
1229 3300048914 Ga0496111_0138489 Ga0496111_0138489_74_565 161
1230 3300048914 Ga0496111_0180072 Ga0496111_0180072_213_701 161
1231 3300048915 Ga0496112_0020266 Ga0496112_0020266_3959_4450 161
1232 3300048915 Ga0496112_0040204 Ga0496112_0040204_1139_1627 161
1233 3300048917 Ga0496114_0193148 Ga0496114_0193148_40_531 161
1234 3300048917 Ga0496114_0334842 Ga0496114_0334842_270_761 161
1235 3300048917 Ga0496114_1248625 Ga0496114_1248625_50_541 161
1236 3300048917 Ga0496114_1424215 Ga0496114_1424215_55_546 161
1237 3300048918 Ga0496115_0114644 Ga0496115_0114644_1328_1816 161
1238 3300048918 Ga0496115_0139755 Ga0496115_0139755_1281_1772 161
1239 3300048918 Ga0496115_0819038 Ga0496115_0819038_57_545 161
1240 3300048919 Ga0496116_0322649 Ga0496116_0322649_200_691 161
1241 3300048920 Ga0496117_0013721 Ga0496117_0013721_2123_2611 161
1242 3300048921 Ga0496118_0002570 Ga0496118_0002570_19427_19915 161
1243 3300048923 Ga0496120_0164907 Ga0496120_0164907_198_689 161
1244 3300048923 Ga0496120_0181023 Ga0496120_0181023_25_513 161
1245 3300048924 Ga0496121_0001125 Ga0496121_0001125_35303_35791 161
1246 3300048924 Ga0496121_0073946 Ga0496121_0073946_180_671 161
1247 3300048924 Ga0496121_0083038 Ga0496121_0083038_452_943 161
1248 3300048924 Ga0496121_0453592 Ga0496121_0453592_312_803 161
1249 3300048927 Ga0496124_0022017 Ga0496124_0022017_3734_4222 161
1250 3300048927 Ga0496124_0293589 Ga0496124_0293589_354_845 161
1251 3300048927 Ga0496124_0700163 Ga0496124_0700163_104_592 161
1252 3300048928 Ga0496125_0561169 Ga0496125_0561169_58_546 161
1253 3300048929 Ga0496126_0011540 Ga0496126_0011540_2152_2643 161
1254 3300048929 Ga0496126_0051010 Ga0496126_0051010_501_989 161
1255 3300049460 Ga0495682_0222629 Ga0495682_0222629_89_580 161
1256 3300049572 Ga0501036_0628188 Ga0501036_0628188_192_683 161
1257 3300049587 Ga0501071_0658246 Ga0501071_0658246_54_545 161
1258 3300049588 Ga0501072_0700086 Ga0501072_0700086_273_764 161
1259 3300049592 Ga0501076_0848963 Ga0501076_0848963_70_561 161
1260 3300049742 Ga0501080_1308971 Ga0501080_1308971_27_518 161
1261 3300049823 Ga0501044_0817800 Ga0501044_0817800_162_665 161
1262 3300049824 Ga0501045_0605906 Ga0501045_0605906_230_721 161
1263 3300050489 nmdc:mga03683_170414_c1 nmdc:mga03683_170414_c1_354_845 161
1264 3300050490 nmdc:mga03n38_1311_c1 nmdc:mga03n38_1311_c1_2892_3383 161
1265 3300050490 nmdc:mga03n38_74157_c1 nmdc:mga03n38_74157_c1_572_1063 161
1266 3300050491 nmdc:mga00v17_336215_c1 nmdc:mga00v17_336215_c1_417_908 161
1267 3300050491 nmdc:mga00v17_741630_c1 nmdc:mga00v17_741630_c1_26_517 161
1268 3300050491 nmdc:mga00v17_90873_c1 nmdc:mga00v17_90873_c1_27_518 161
1269 3300050492 nmdc:mga0yw44_202540_c1 nmdc:mga0yw44_202540_c1_645_1136 161
1270 3300050492 nmdc:mga0yw44_48177_c1 nmdc:mga0yw44_48177_c1_537_1028 161
1271 3300050493 nmdc:mga0k408_126789_c1 nmdc:mga0k408_126789_c1_887_1378 161
1272 3300050493 nmdc:mga0k408_262781_c1 nmdc:mga0k408_262781_c1_130_621 161
1273 3300050493 nmdc:mga0k408_294138_c1 nmdc:mga0k408_294138_c1_219_710 161
1274 3300050494 nmdc:mga06z11_117592_c1 nmdc:mga06z11_117592_c1_899_1390 161
1275 3300050496 nmdc:mga07m45_3363_c1 nmdc:mga07m45_3363_c1_6053_6544 161
1276 3300050496 nmdc:mga07m45_430032_c1 nmdc:mga07m45_430032_c1_199_690 161
1277 3300050511 nmdc:mga08y16_356564_c1 nmdc:mga08y16_356564_c1_346_837 161
1278 3300050511 nmdc:mga08y16_449587_c1 nmdc:mga08y16_449587_c1_26_523 161
1279 3300050512 nmdc:mga0n895_1449844_c1 nmdc:mga0n895_1449844_c1_145_642 161
1280 3300050512 nmdc:mga0n895_228943_c1 nmdc:mga0n895_228943_c1_596_1087 161
1281 3300050513 nmdc:mga0rr50_202685_c1 nmdc:mga0rr50_202685_c1_52_549 161
1282 3300050514 nmdc:mga08x19_1052831_c1 nmdc:mga08x19_1052831_c1_52_549 161
1283 3300050515 nmdc:mga0a205_246805_c1 nmdc:mga0a205_246805_c1_574_1065 161
1284 3300050516 nmdc:mga0sz30_20156_c1 nmdc:mga0sz30_20156_c1_958_1449 161
1285 3300053077 Ga0495601_0000015 Ga0495601_0000015_8844_9335 161
1286 3300053077 Ga0495601_0014124 Ga0495601_0014124_2884_3372 161
1287 3300053077 Ga0495601_0100600 Ga0495601_0100600_1030_1518 161
1288 3300053078 Ga0495612_0000096 Ga0495612_0000096_28683_29174 161
1289 3300053078 Ga0495612_0170846 Ga0495612_0170846_22_510 161
1290 3300053083 Ga0495655_0127672 Ga0495655_0127672_160_651 161
1291 3300053084 Ga0495595_0000035 Ga0495595_0000035_70545_71036 161
1292 3300053084 Ga0495595_0000332 Ga0495595_0000332_3433_3921 161
1293 3300053085 Ga0495619_0000044 Ga0495619_0000044_9144_9635 161
1294 3300053085 Ga0495619_0000633 Ga0495619_0000633_16747_17235 161
1295 3300053085 Ga0495619_0887235 Ga0495619_0887235_18_509 161
1296 3300053091 Ga0500647_0164594 Ga0500647_0164594_458_946 161
1297 3300053093 Ga0500651_0050027 Ga0500651_0050027_448_939 161
1298 3300053094 Ga0500566_0037299 Ga0500566_0037299_1549_2040 161
1299 3300053096 Ga0500641_0001219 Ga0500641_0001219_1094_1585 161
1300 3300053096 Ga0500641_0011540 Ga0500641_0011540_1643_2134 161
1301 3300053104 Ga0500556_0224956 Ga0500556_0224956_232_723 161
1302 3300053119 Ga0500595_002179 Ga0500595_002179_4026_4517 161
1303 3300053119 Ga0500595_012929 Ga0500595_012929_1449_1940 161
1304 3300053119 Ga0500595_016261 Ga0500595_016261_1882_2370 161
1305 3300053129 Ga0500628_095836 Ga0500628_095836_171_662 161
1306 3300053131 Ga0500652_228319 Ga0500652_228319_30_521 161
1307 3300053134 Ga0500658_0410241 Ga0500658_0410241_64_555 161
1308 3300053136 Ga0500559_0043687 Ga0500559_0043687_276_764 161
1309 3300053140 Ga0500573_0080592 Ga0500573_0080592_859_1347 161
1310 3300053142 Ga0500577_0518601 Ga0500577_0518601_19_510 161
1311 3300053147 Ga0500589_024473 Ga0500589_024473_1452_1943 161
1312 3300053148 Ga0500590_212917 Ga0500590_212917_176_667 161
1313 3300053148 Ga0500590_342407 Ga0500590_342407_28_519 161
1314 3300053151 Ga0500604_0093832 Ga0500604_0093832_53_544 161
1315 3300053156 Ga0500622_0121696 Ga0500622_0121696_235_726 161
1316 3300053177 Ga0500636_0097505 Ga0500636_0097505_384_872 161
1317 3300053177 Ga0500636_0166334 Ga0500636_0166334_309_797 161
1318 3300053177 Ga0500636_0276343 Ga0500636_0276343_98_589 161
1319 3300053730 Ga0500645_010480 Ga0500645_010480_120_611 161
1320 3300054114 Ga0501084_1167141 Ga0501084_1167141_81_572 161
1321 3300055283 Ga0500661_018957 Ga0500661_018957_618_1109 161
1322 3300059426 Ga0590077_081133 Ga0590077_081133_238_729 161
1323 3300059493 Ga0587077_195595 Ga0587077_195595_47_535 161
1324 3300059630 Ga0587128_089277 Ga0587128_089277_69_557 161
1325 3300059640 Ga0587067_124011 Ga0587067_124011_24_512 161
1326 3300059644 Ga0587075_082314 Ga0587075_082314_111_599 161
1327 3300059649 Ga0587102_036813 Ga0587102_036813_118_606 161
1328 3300060353 Ga0501082_0792387 Ga0501082_0792387_304_795 161
1329 3300001904 JGI24736J21556_1016355 JGI24736J21556_10163552 162
1330 3300001976 JGI24752J21851_1027888 JGI24752J21851_10278882 162
1331 3300001979 JGI24740J21852_10051938 JGI24740J21852_100519382 162
1332 3300001989 JGI24739J22299_10057219 JGI24739J22299_100572192 162
1333 3300001990 JGI24737J22298_10041998 JGI24737J22298_100419982 162
1334 3300001991 JGI24743J22301_10022260 JGI24743J22301_100222601 162
1335 3300002067 JGI24735J21928_10062795 JGI24735J21928_100627952 162
1336 3300002244 JGI24742J22300_10051161 JGI24742J22300_100511612 162
1337 3300003203 JGI25406J46586_10007497 JGI25406J46586_100074973 162
1338 3300003203 JGI25406J46586_10038536 JGI25406J46586_100385362 162
1339 3300003215 JGI25153J46596_10012145 JGI25153J46596_100121452 162
1340 3300003215 JGI25153J46596_10013197 JGI25153J46596_100131971 162
1341 3300003215 JGI25153J46596_10047815 JGI25153J46596_100478152 162
1342 3300003308 Ga0006777J48905_1033878 Ga0006777J48905_10338781 162
1343 3300003354 JGI25160J50197_1000801 JGI25160J50197_100080115 162
1344 3300003574 Ga0007410J51695_1046046 Ga0007410J51695_10460461 162
1345 3300003659 JGI25404J52841_10005572 JGI25404J52841_100055723 162
1346 3300003659 JGI25404J52841_10007750 JGI25404J52841_100077501 162
1347 3300003659 JGI25404J52841_10009204 JGI25404J52841_100092042 162
1348 3300003752 Ga0055539_1010616 Ga0055539_10106161 162
1349 3300003771 Ga0055526_1030287 Ga0055526_10302871 162
1350 3300003771 Ga0055526_1070283 Ga0055526_10702831 162
1351 3300003775 Ga0055524_1019793 Ga0055524_10197932 162
1352 3300003794 Ga0055531_10002406 Ga0055531_100024065 162
1353 3300004801 Ga0058860_12155477 Ga0058860_121554771 162
1354 3300004803 Ga0058862_10098549 Ga0058862_100985491 162
1355 3300005262 Ga0065165_1010861 Ga0065165_10108614 162
1356 3300005262 Ga0065165_1084460 Ga0065165_10844602 162
1357 3300005262 Ga0065165_1124716 Ga0065165_11247161 162
1358 3300005290 Ga0065712_10342346 Ga0065712_103423461 162
1359 3300005327 Ga0070658_10058031 Ga0070658_100580313 162
1360 3300005327 Ga0070658_10204382 Ga0070658_102043822 162
1361 3300005329 Ga0070683_100130474 Ga0070683_1001304741 162
1362 3300005330 Ga0070690_100228645 Ga0070690_1002286452 162
1363 3300005331 Ga0070670_100202840 Ga0070670_1002028402 162
1364 3300005331 Ga0070670_101826782 Ga0070670_1018267821 162
1365 3300005334 Ga0068869_100455881 Ga0068869_1004558812 162
1366 3300005336 Ga0070680_100026931 Ga0070680_1000269312 162
1367 3300005336 Ga0070680_100098059 Ga0070680_1000980592 162
1368 3300005337 Ga0070682_100563447 Ga0070682_1005634471 162
1369 3300005339 Ga0070660_101633481 Ga0070660_1016334811 162
1370 3300005344 Ga0070661_100075696 Ga0070661_1000756962 162
1371 3300005347 Ga0070668_100024092 Ga0070668_1000240923 162
1372 3300005347 Ga0070668_100408476 Ga0070668_1004084761 162
1373 3300005354 Ga0070675_100418602 Ga0070675_1004186021 162
1374 3300005355 Ga0070671_100011405 Ga0070671_1000114053 162
1375 3300005356 Ga0070674_100440283 Ga0070674_1004402831 162
1376 3300005356 Ga0070674_100690527 Ga0070674_1006905271 162
1377 3300005366 Ga0070659_100025503 Ga0070659_1000255033 162
1378 3300005366 Ga0070659_100226056 Ga0070659_1002260562 162
1379 3300005367 Ga0070667_100032367 Ga0070667_1000323673 162
1380 3300005434 Ga0070709_10001487 Ga0070709_100014873 162
1381 3300005434 Ga0070709_10005197 Ga0070709_100051975 162
1382 3300005435 Ga0070714_100008988 Ga0070714_1000089883 162
1383 3300005435 Ga0070714_101703807 Ga0070714_1017038071 162
1384 3300005436 Ga0070713_100007532 Ga0070713_1000075325 162
1385 3300005436 Ga0070713_100030133 Ga0070713_1000301332 162
1386 3300005437 Ga0070710_10001558 Ga0070710_100015586 162
1387 3300005437 Ga0070710_10015094 Ga0070710_100150943 162
1388 3300005437 Ga0070710_10089854 Ga0070710_100898541 162
1389 3300005439 Ga0070711_100003888 Ga0070711_1000038884 162
1390 3300005439 Ga0070711_100004290 Ga0070711_1000042905 162
1391 3300005439 Ga0070711_100054430 Ga0070711_1000544303 162
1392 3300005455 Ga0070663_100023617 Ga0070663_1000236173 162
1393 3300005455 Ga0070663_100063772 Ga0070663_1000637724 162
1394 3300005455 Ga0070663_100165493 Ga0070663_1001654932 162
1395 3300005455 Ga0070663_100222670 Ga0070663_1002226703 162
1396 3300005455 Ga0070663_100283222 Ga0070663_1002832222 162
1397 3300005456 Ga0070678_100153379 Ga0070678_1001533791 162
1398 3300005456 Ga0070678_100212714 Ga0070678_1002127142 162
1399 3300005456 Ga0070678_100687392 Ga0070678_1006873921 162
1400 3300005457 Ga0070662_100352249 Ga0070662_1003522491 162
1401 3300005458 Ga0070681_10066584 Ga0070681_100665843 162
1402 3300005458 Ga0070681_10705787 Ga0070681_107057873 162
1403 3300005459 Ga0068867_100416018 Ga0068867_1004160182 162
1404 3300005466 Ga0070685_10899823 Ga0070685_108998231 162
1405 3300005530 Ga0070679_100032426 Ga0070679_1000324262 162
1406 3300005530 Ga0070679_100038144 Ga0070679_1000381442 162
1407 3300005530 Ga0070679_100341553 Ga0070679_1003415532 162
1408 3300005530 Ga0070679_100378215 Ga0070679_1003782151 162
1409 3300005535 Ga0070684_100328492 Ga0070684_1003284922 162
1410 3300005539 Ga0068853_100084746 Ga0068853_1000847462 162
1411 3300005539 Ga0068853_100262986 Ga0068853_1002629861 162
1412 3300005539 Ga0068853_100404833 Ga0068853_1004048332 162
1413 3300005539 Ga0068853_100784911 Ga0068853_1007849111 162
1414 3300005539 Ga0068853_100814497 Ga0068853_1008144971 162
1415 3300005547 Ga0070693_100211510 Ga0070693_1002115101 162
1416 3300005547 Ga0070693_100410130 Ga0070693_1004101301 162
1417 3300005547 Ga0070693_100675471 Ga0070693_1006754712 162
1418 3300005548 Ga0070665_100055417 Ga0070665_1000554174 162
1419 3300005548 Ga0070665_100212627 Ga0070665_1002126272 162
1420 3300005548 Ga0070665_102400575 Ga0070665_1024005751 162
1421 3300005563 Ga0068855_100107261 Ga0068855_1001072614 162
1422 3300005563 Ga0068855_100250102 Ga0068855_1002501022 162
1423 3300005563 Ga0068855_100779407 Ga0068855_1007794072 162
1424 3300005563 Ga0068855_100855162 Ga0068855_1008551621 162
1425 3300005577 Ga0068857_100199140 Ga0068857_1001991401 162
1426 3300005577 Ga0068857_100233289 Ga0068857_1002332891 162
1427 3300005577 Ga0068857_100742562 Ga0068857_1007425622 162
1428 3300005578 Ga0068854_100063189 Ga0068854_1000631893 162
1429 3300005578 Ga0068854_100064694 Ga0068854_1000646941 162
1430 3300005578 Ga0068854_100077690 Ga0068854_1000776902 162
1431 3300005578 Ga0068854_100126778 Ga0068854_1001267782 162
1432 3300005578 Ga0068854_100184482 Ga0068854_1001844823 162
1433 3300005614 Ga0068856_100000055 Ga0068856_10000005552 162
1434 3300005614 Ga0068856_100002036 Ga0068856_10000203626 162
1435 3300005614 Ga0068856_100023673 Ga0068856_1000236733 162
1436 3300005614 Ga0068856_100129943 Ga0068856_1001299433 162
1437 3300005614 Ga0068856_100343214 Ga0068856_1003432142 162
1438 3300005614 Ga0068856_100852120 Ga0068856_1008521201 162
1439 3300005616 Ga0068852_101391581 Ga0068852_1013915811 162
1440 3300005617 Ga0068859_100286671 Ga0068859_1002866712 162
1441 3300005618 Ga0068864_100084851 Ga0068864_1000848512 162
1442 3300005618 Ga0068864_100389493 Ga0068864_1003894932 162
1443 3300005718 Ga0068866_10679990 Ga0068866_106799901 162
1444 3300005834 Ga0068851_10006976 Ga0068851_100069764 162
1445 3300005834 Ga0068851_10318005 Ga0068851_103180051 162
1446 3300005842 Ga0068858_100142352 Ga0068858_1001423521 162
1447 3300005842 Ga0068858_100240836 Ga0068858_1002408362 162
1448 3300005842 Ga0068858_100468892 Ga0068858_1004688923 162
1449 3300005843 Ga0068860_100154933 Ga0068860_1001549332 162
1450 3300005937 Ga0081455_10006141 Ga0081455_100061412 162
1451 3300005937 Ga0081455_10032421 Ga0081455_100324214 162
1452 3300005937 Ga0081455_10067710 Ga0081455_100677102 162
1453 3300005983 Ga0081540_1004015 Ga0081540_10040153 162
1454 3300005983 Ga0081540_1006857 Ga0081540_10068575 162
1455 3300005983 Ga0081540_1013901 Ga0081540_10139014 162
1456 3300005983 Ga0081540_1015784 Ga0081540_10157841 162
1457 3300005983 Ga0081540_1023846 Ga0081540_10238463 162
1458 3300005983 Ga0081540_1024265 Ga0081540_10242653 162
1459 3300005983 Ga0081540_1029953 Ga0081540_10299533 162
1460 3300005983 Ga0081540_1094487 Ga0081540_10944872 162
1461 3300005983 Ga0081540_1183712 Ga0081540_11837121 162
1462 3300005985 Ga0081539_10000585 Ga0081539_1000058548 162
1463 3300005985 Ga0081539_10006073 Ga0081539_100060738 162
1464 3300005985 Ga0081539_10256092 Ga0081539_102560922 162
1465 3300006028 Ga0070717_10947944 Ga0070717_109479441 162
1466 3300006038 Ga0075365_10059311 Ga0075365_100593112 162
1467 3300006038 Ga0075365_10104372 Ga0075365_101043722 162
1468 3300006038 Ga0075365_10125516 Ga0075365_101255161 162
1469 3300006038 Ga0075365_10182498 Ga0075365_101824981 162
1470 3300006038 Ga0075365_10265449 Ga0075365_102654491 162
1471 3300006038 Ga0075365_10313193 Ga0075365_103131932 162
1472 3300006038 Ga0075365_10484139 Ga0075365_104841391 162
1473 3300006042 Ga0075368_10005666 Ga0075368_100056662 162
1474 3300006042 Ga0075368_10101761 Ga0075368_101017612 162
1475 3300006042 Ga0075368_10427174 Ga0075368_104271741 162
1476 3300006048 Ga0075363_100021660 Ga0075363_1000216603 162
1477 3300006048 Ga0075363_100281853 Ga0075363_1002818532 162
1478 3300006048 Ga0075363_100359413 Ga0075363_1003594131 162
1479 3300006051 Ga0075364_10067065 Ga0075364_100670651 162
1480 3300006051 Ga0075364_10120053 Ga0075364_101200531 162
1481 3300006051 Ga0075364_10282442 Ga0075364_102824422 162
1482 3300006163 Ga0070715_10134483 Ga0070715_101344832 162
1483 3300006163 Ga0070715_10149762 Ga0070715_101497622 162
1484 3300006175 Ga0070712_100008298 Ga0070712_1000082983 162
1485 3300006175 Ga0070712_100025559 Ga0070712_1000255591 162
1486 3300006175 Ga0070712_100043262 Ga0070712_1000432622 162
1487 3300006175 Ga0070712_100663906 Ga0070712_1006639062 162
1488 3300006175 Ga0070712_100888627 Ga0070712_1008886272 162
1489 3300006177 Ga0075362_10045442 Ga0075362_100454421 162
1490 3300006177 Ga0075362_10051962 Ga0075362_100519622 162
1491 3300006178 Ga0075367_10026149 Ga0075367_100261494 162
1492 3300006178 Ga0075367_10094648 Ga0075367_100946482 162
1493 3300006178 Ga0075367_10180948 Ga0075367_101809482 162
1494 3300006186 Ga0075369_10016546 Ga0075369_100165463 162
1495 3300006186 Ga0075369_10031782 Ga0075369_100317823 162
1496 3300006186 Ga0075369_10057521 Ga0075369_100575212 162
1497 3300006186 Ga0075369_10125612 Ga0075369_101256121 162
1498 3300006195 Ga0075366_10015283 Ga0075366_100152833 162
1499 3300006195 Ga0075366_10249960 Ga0075366_102499602 162
1500 3300006237 Ga0097621_100378693 Ga0097621_1003786932 162
1501 3300006353 Ga0075370_10107592 Ga0075370_101075922 162
1502 3300006353 Ga0075370_10130719 Ga0075370_101307192 162
1503 3300006353 Ga0075370_10383285 Ga0075370_103832852 162
1504 3300006353 Ga0075370_10400341 Ga0075370_104003411 162
1505 3300006931 Ga0097620_100070150 Ga0097620_1000701504 162
1506 3300006931 Ga0097620_100286663 Ga0097620_1002866632 162
1507 3300007265 Ga0099794_10081198 Ga0099794_100811982 162
1508 3300007788 Ga0099795_10299093 Ga0099795_102990931 162
1509 3300009093 Ga0105240_10004881 Ga0105240_100048813 162
1510 3300009093 Ga0105240_10178270 Ga0105240_101782701 162
1511 3300009101 Ga0105247_10013326 Ga0105247_100133262 162
1512 3300009101 Ga0105247_10173764 Ga0105247_101737642 162
1513 3300009101 Ga0105247_10206311 Ga0105247_102063112 162
1514 3300009174 Ga0105241_10001011 Ga0105241_1000101113 162
1515 3300009176 Ga0105242_11419862 Ga0105242_114198621 162
1516 3300009177 Ga0105248_10284311 Ga0105248_102843113 162
1517 3300009177 Ga0105248_10340817 Ga0105248_103408172 162
1518 3300009177 Ga0105248_11565230 Ga0105248_115652301 162
1519 3300009177 Ga0105248_11840372 Ga0105248_118403721 162
1520 3300009545 Ga0105237_10030019 Ga0105237_100300195 162
1521 3300009545 Ga0105237_10175188 Ga0105237_101751881 162
1522 3300009545 Ga0105237_10408376 Ga0105237_104083761 162
1523 3300009551 Ga0105238_10076517 Ga0105238_100765173 162
1524 3300010159 Ga0099796_10050035 Ga0099796_100500352 162
1525 3300010159 Ga0099796_10480559 Ga0099796_104805591 162
1526 3300010375 Ga0105239_10025293 Ga0105239_100252935 162
1527 3300010375 Ga0105239_11323901 Ga0105239_113239012 162
1528 3300012494 Ga0157341_1012094 Ga0157341_10120941 162
1529 3300012495 Ga0157323_1006910 Ga0157323_10069101 162
1530 3300012500 Ga0157314_1048444 Ga0157314_10484441 162
1531 3300013102 Ga0157371_10021912 Ga0157371_100219122 162
1532 3300013104 Ga0157370_10146307 Ga0157370_101463072 162
1533 3300013105 Ga0157369_10356237 Ga0157369_103562372 162
1534 3300013307 Ga0157372_10069722 Ga0157372_100697224 162
1535 3300013307 Ga0157372_10559542 Ga0157372_105595422 162
1536 3300013308 Ga0157375_10044068 Ga0157375_100440681 162
1537 3300013308 Ga0157375_12003884 Ga0157375_120038841 162
1538 3300014325 Ga0163163_11577188 Ga0163163_115771881 162
1539 3300014497 Ga0182008_10094769 Ga0182008_100947692 162
1540 3300014968 Ga0157379_10157542 Ga0157379_101575422 162
1541 3300014969 Ga0157376_12011778 Ga0157376_120117781 162
1542 3300020076 Ga0206355_1436607 Ga0206355_14366072 162
1543 3300020082 Ga0206353_11312172 Ga0206353_113121721 162
1544 3300021320 Ga0214544_1000005 Ga0214544_100000558 162
1545 3300021321 Ga0214542_1000004 Ga0214542_100000462 162
1546 3300021324 Ga0214545_1000005 Ga0214545_1000005335 162
1547 3300021327 Ga0214543_1000111 Ga0214543_100011146 162
1548 3300021358 Ga0213873_10179336 Ga0213873_101793361 162
1549 3300021384 Ga0213876_10001491 Ga0213876_100014911 162
1550 3300021388 Ga0213875_10046868 Ga0213875_100468682 162
1551 3300025230 Ga0209563_104277 Ga0209563_1042773 162
1552 3300025245 Ga0207425_1023944 Ga0207425_10239442 162
1553 3300025253 Ga0209677_110545 Ga0209677_1105452 162
1554 3300025254 Ga0209148_1000672 Ga0209148_100067224 162
1555 3300025261 Ga0209233_1010915 Ga0209233_10109153 162
1556 3300025261 Ga0209233_1013292 Ga0209233_10132923 162
1557 3300025295 Ga0209564_1000971 Ga0209564_10009717 162
1558 3300025295 Ga0209564_1049345 Ga0209564_10493451 162
1559 3300025295 Ga0209564_1050154 Ga0209564_10501542 162
1560 3300025297 Ga0209758_1000102 Ga0209758_1000102157 162
1561 3300025297 Ga0209758_1007481 Ga0209758_10074813 162
1562 3300025297 Ga0209758_1009879 Ga0209758_10098793 162
1563 3300025297 Ga0209758_1031515 Ga0209758_10315151 162
1564 3300025297 Ga0209758_1032221 Ga0209758_10322211 162
1565 3300025299 Ga0209256_1005673 Ga0209256_10056734 162
1566 3300025302 Ga0207426_1008961 Ga0207426_10089611 162
1567 3300025304 Ga0209257_1005774 Ga0209257_10057742 162
1568 3300025315 Ga0207697_10052681 Ga0207697_100526811 162
1569 3300025321 Ga0207656_10129719 Ga0207656_101297191 162
1570 3300025321 Ga0207656_10169680 Ga0207656_101696801 162
1571 3300025893 Ga0207682_10296969 Ga0207682_102969691 162
1572 3300025898 Ga0207692_10002983 Ga0207692_100029833 162
1573 3300025898 Ga0207692_10016278 Ga0207692_100162782 162
1574 3300025898 Ga0207692_10181206 Ga0207692_101812062 162
1575 3300025898 Ga0207692_10666405 Ga0207692_106664051 162
1576 3300025903 Ga0207680_10533688 Ga0207680_105336881 162
1577 3300025903 Ga0207680_10777693 Ga0207680_107776931 162
1578 3300025904 Ga0207647_10022659 Ga0207647_100226592 162
1579 3300025904 Ga0207647_10285510 Ga0207647_102855101 162
1580 3300025906 Ga0207699_10001381 Ga0207699_100013816 162
1581 3300025906 Ga0207699_10010672 Ga0207699_100106722 162
1582 3300025907 Ga0207645_10075858 Ga0207645_100758582 162
1583 3300025909 Ga0207705_10327578 Ga0207705_103275782 162
1584 3300025911 Ga0207654_10000468 Ga0207654_100004683 162
1585 3300025911 Ga0207654_10033630 Ga0207654_100336304 162
1586 3300025911 Ga0207654_10125342 Ga0207654_101253421 162
1587 3300025912 Ga0207707_10000386 Ga0207707_100003865 162
1588 3300025912 Ga0207707_10109693 Ga0207707_101096933 162
1589 3300025913 Ga0207695_10001480 Ga0207695_1000148020 162
1590 3300025914 Ga0207671_10101317 Ga0207671_101013172 162
1591 3300025914 Ga0207671_10163523 Ga0207671_101635232 162
1592 3300025914 Ga0207671_10165850 Ga0207671_101658504 162
1593 3300025914 Ga0207671_10616271 Ga0207671_106162711 162
1594 3300025915 Ga0207693_10025202 Ga0207693_100252023 162
1595 3300025915 Ga0207693_10030083 Ga0207693_100300836 162
1596 3300025915 Ga0207693_10058734 Ga0207693_100587343 162
1597 3300025916 Ga0207663_10020005 Ga0207663_100200051 162
1598 3300025916 Ga0207663_10026864 Ga0207663_100268643 162
1599 3300025916 Ga0207663_10286215 Ga0207663_102862151 162
1600 3300025917 Ga0207660_10065453 Ga0207660_100654533 162
1601 3300025917 Ga0207660_10067863 Ga0207660_100678631 162
1602 3300025919 Ga0207657_10036976 Ga0207657_100369762 162
1603 3300025919 Ga0207657_10065225 Ga0207657_100652253 162
1604 3300025919 Ga0207657_11231683 Ga0207657_112316831 162
1605 3300025920 Ga0207649_10366562 Ga0207649_103665621 162
1606 3300025920 Ga0207649_11316394 Ga0207649_113163941 162
1607 3300025921 Ga0207652_10076797 Ga0207652_100767972 162
1608 3300025921 Ga0207652_10432150 Ga0207652_104321502 162
1609 3300025921 Ga0207652_10679409 Ga0207652_106794092 162
1610 3300025921 Ga0207652_11038235 Ga0207652_110382351 162
1611 3300025923 Ga0207681_10829963 Ga0207681_108299631 162
1612 3300025923 Ga0207681_11143768 Ga0207681_111437681 162
1613 3300025924 Ga0207694_10000136 Ga0207694_1000013673 162
1614 3300025924 Ga0207694_10683096 Ga0207694_106830961 162
1615 3300025925 Ga0207650_10545986 Ga0207650_105459861 162
1616 3300025928 Ga0207700_10043132 Ga0207700_100431324 162
1617 3300025928 Ga0207700_10084384 Ga0207700_100843841 162
1618 3300025928 Ga0207700_10208204 Ga0207700_102082042 162
1619 3300025929 Ga0207664_10073307 Ga0207664_100733071 162
1620 3300025929 Ga0207664_10214384 Ga0207664_102143841 162
1621 3300025929 Ga0207664_10622360 Ga0207664_106223601 162
1622 3300025931 Ga0207644_10145803 Ga0207644_101458031 162
1623 3300025932 Ga0207690_10069163 Ga0207690_100691633 162
1624 3300025933 Ga0207706_10258032 Ga0207706_102580321 162
1625 3300025934 Ga0207686_10212848 Ga0207686_102128481 162
1626 3300025934 Ga0207686_10448393 Ga0207686_104483932 162
1627 3300025935 Ga0207709_10250971 Ga0207709_102509711 162
1628 3300025937 Ga0207669_10266158 Ga0207669_102661581 162
1629 3300025937 Ga0207669_10401877 Ga0207669_104018771 162
1630 3300025939 Ga0207665_10007889 Ga0207665_100078893 162
1631 3300025939 Ga0207665_10542820 Ga0207665_105428201 162
1632 3300025940 Ga0207691_10342081 Ga0207691_103420811 162
1633 3300025940 Ga0207691_11046933 Ga0207691_110469332 162
1634 3300025941 Ga0207711_10022786 Ga0207711_100227862 162
1635 3300025941 Ga0207711_10066864 Ga0207711_100668642 162
1636 3300025941 Ga0207711_10236216 Ga0207711_102362162 162
1637 3300025942 Ga0207689_10218876 Ga0207689_102188761 162
1638 3300025944 Ga0207661_11095126 Ga0207661_110951261 162
1639 3300025949 Ga0207667_10067553 Ga0207667_100675533 162
1640 3300025949 Ga0207667_10116984 Ga0207667_101169841 162
1641 3300025949 Ga0207667_10121092 Ga0207667_101210922 162
1642 3300025949 Ga0207667_10362445 Ga0207667_103624452 162
1643 3300025949 Ga0207667_10708353 Ga0207667_107083531 162
1644 3300025949 Ga0207667_10961465 Ga0207667_109614651 162
1645 3300025960 Ga0207651_10211442 Ga0207651_102114421 162
1646 3300025961 Ga0207712_10417571 Ga0207712_104175712 162
1647 3300025961 Ga0207712_10895107 Ga0207712_108951071 162
1648 3300025972 Ga0207668_10202012 Ga0207668_102020122 162
1649 3300025981 Ga0207640_10038275 Ga0207640_100382753 162
1650 3300025981 Ga0207640_10128290 Ga0207640_101282902 162
1651 3300025981 Ga0207640_10266409 Ga0207640_102664091 162
1652 3300025981 Ga0207640_10700434 Ga0207640_107004342 162
1653 3300025986 Ga0207658_10026231 Ga0207658_100262312 162
1654 3300025986 Ga0207658_10570791 Ga0207658_105707911 162
1655 3300025986 Ga0207658_11113830 Ga0207658_111138301 162
1656 3300026023 Ga0207677_10123824 Ga0207677_101238242 162
1657 3300026023 Ga0207677_10626293 Ga0207677_106262931 162
1658 3300026035 Ga0207703_10073571 Ga0207703_100735712 162
1659 3300026035 Ga0207703_10284721 Ga0207703_102847211 162
1660 3300026035 Ga0207703_10294615 Ga0207703_102946152 162
1661 3300026041 Ga0207639_10184900 Ga0207639_101849002 162
1662 3300026041 Ga0207639_10258006 Ga0207639_102580062 162
1663 3300026041 Ga0207639_10486672 Ga0207639_104866721 162
1664 3300026041 Ga0207639_10657954 Ga0207639_106579541 162
1665 3300026067 Ga0207678_10035839 Ga0207678_100358394 162
1666 3300026067 Ga0207678_10121627 Ga0207678_101216272 162
1667 3300026067 Ga0207678_10132853 Ga0207678_101328532 162
1668 3300026067 Ga0207678_10401691 Ga0207678_104016912 162
1669 3300026067 Ga0207678_10761171 Ga0207678_107611711 162
1670 3300026078 Ga0207702_10000006 Ga0207702_10000006159 162
1671 3300026078 Ga0207702_10000688 Ga0207702_1000068829 162
1672 3300026078 Ga0207702_10053029 Ga0207702_100530292 162
1673 3300026078 Ga0207702_10880150 Ga0207702_108801501 162
1674 3300026088 Ga0207641_10181389 Ga0207641_101813892 162
1675 3300026089 Ga0207648_10105614 Ga0207648_101056141 162
1676 3300026095 Ga0207676_10469317 Ga0207676_104693171 162
1677 3300026116 Ga0207674_10011177 Ga0207674_100111777 162
1678 3300026116 Ga0207674_10119218 Ga0207674_101192183 162
1679 3300026116 Ga0207674_10289970 Ga0207674_102899702 162
1680 3300026116 Ga0207674_10552509 Ga0207674_105525091 162
1681 3300026116 Ga0207674_10697076 Ga0207674_106970762 162
1682 3300026121 Ga0207683_10015315 Ga0207683_100153154 162
1683 3300026121 Ga0207683_10103193 Ga0207683_101031932 162
1684 3300026142 Ga0207698_10042920 Ga0207698_100429203 162
1685 3300026142 Ga0207698_10116835 Ga0207698_101168352 162
1686 3300026142 Ga0207698_10416383 Ga0207698_104163832 162
1687 3300026142 Ga0207698_11168659 Ga0207698_111686592 162
1688 3300027296 Ga0209389_1000021 Ga0209389_1000021109 162
1689 3300027296 Ga0209389_1000120 Ga0209389_100012010 162
1690 3300027357 Ga0209589_1000027 Ga0209589_100002793 162
1691 3300027361 Ga0209489_100023 Ga0209489_1000239 162
1692 3300027361 Ga0209489_100742 Ga0209489_10074254 162
1693 3300027363 Ga0209700_100134 Ga0209700_100134107 162
1694 3300027512 Ga0209179_1008998 Ga0209179_10089981 162
1695 3300027512 Ga0209179_1038088 Ga0209179_10380881 162
1696 3300027671 Ga0209588_1013577 Ga0209588_10135772 162
1697 3300027866 Ga0209813_10022272 Ga0209813_100222722 162
1698 3300028379 Ga0268266_10121335 Ga0268266_101213353 162
1699 3300028379 Ga0268266_10212435 Ga0268266_102124351 162
1700 3300028379 Ga0268266_10290107 Ga0268266_102901072 162
1701 3300028379 Ga0268266_10437635 Ga0268266_104376351 162
1702 3300028379 Ga0268266_11013333 Ga0268266_110133331 162
1703 3300028379 Ga0268266_11230077 Ga0268266_112300771 162
1704 3300028381 Ga0268264_10072563 Ga0268264_100725633 162
1705 3300028786 Ga0307517_10000098 Ga0307517_1000009895 162
1706 3300028794 Ga0307515_10016400 Ga0307515_100164009 162
1707 3300028794 Ga0307515_10319246 Ga0307515_103192462 162
1708 3300031235 Ga0265330_10025088 Ga0265330_100250883 162
1709 3300031235 Ga0265330_10027675 Ga0265330_100276752 162
1710 3300031235 Ga0265330_10046914 Ga0265330_100469143 162
1711 3300031235 Ga0265330_10143046 Ga0265330_101430462 162
1712 3300031238 Ga0265332_10020705 Ga0265332_100207053 162
1713 3300031239 Ga0265328_10045647 Ga0265328_100456471 162
1714 3300031241 Ga0265325_10073023 Ga0265325_100730232 162
1715 3300031242 Ga0265329_10085283 Ga0265329_100852832 162
1716 3300031247 Ga0265340_10003780 Ga0265340_100037804 162
1717 3300031249 Ga0265339_10149432 Ga0265339_101494321 162
1718 3300031344 Ga0265316_10120267 Ga0265316_101202672 162
1719 3300031507 Ga0307509_10783763 Ga0307509_107837631 162
1720 3300031595 Ga0265313_10102201 Ga0265313_101022011 162
1721 3300031616 Ga0307508_10027398 Ga0307508_100273985 162
1722 3300031616 Ga0307508_10142818 Ga0307508_101428181 162
1723 3300031616 Ga0307508_10179015 Ga0307508_101790152 162
1724 3300031711 Ga0265314_10231505 Ga0265314_102315052 162
1725 3300031712 Ga0265342_10163286 Ga0265342_101632861 162
1726 3300031730 Ga0307516_10018054 Ga0307516_100180545 162
1727 3300031730 Ga0307516_10087197 Ga0307516_100871973 162
1728 3300031730 Ga0307516_10181324 Ga0307516_101813243 162
1729 3300031730 Ga0307516_10285423 Ga0307516_102854231 162
1730 3300031852 Ga0307410_11234063 Ga0307410_112340631 162
1731 3300031901 Ga0307406_11865368 Ga0307406_118653681 162
1732 3300032004 Ga0307414_10291570 Ga0307414_102915702 162
1733 3300032126 Ga0307415_100520667 Ga0307415_1005206672 162
1734 3300033179 Ga0307507_10361650 Ga0307507_103616502 162
1735 3300033180 Ga0307510_10047477 Ga0307510_100474774 162
1736 3300033180 Ga0307510_10061680 Ga0307510_100616802 162
1737 3300033180 Ga0307510_10325426 Ga0307510_103254262 162
1738 3300035083 Ga0373926_0018331 Ga0373926_0018331_1104_1595 162
1739 3300035089 Ga0373944_0014978 Ga0373944_0014978_502_993 162
1740 3300035111 Ga0373923_0025959 Ga0373923_0025959_822_1313 162
1741 3300035112 Ga0373932_0126544 Ga0373932_0126544_306_794 162
1742 3300035116 Ga0373945_0015097 Ga0373945_0015097_14_505 162
1743 3300035121 Ga0373960_0063909 Ga0373960_0063909_370_858 162
1744 3300035170 Ga0373943_0000806 Ga0373943_0000806_6735_7226 162
1745 3300035171 Ga0373946_0005160 Ga0373946_0005160_929_1420 162
1746 3300035172 Ga0373955_0061584 Ga0373955_0061584_1371_1862 162
1747 3300035410 Ga0373924_0041117 Ga0373924_0041117_184_675 162
1748 3300035691 Ga0373931_0051450 Ga0373931_0051450_1678_2166 162
1749 3300035691 Ga0373931_0219072 Ga0373931_0219072_291_782 162
1750 3300035691 Ga0373931_0337003 Ga0373931_0337003_236_724 162
1751 3300035692 Ga0373935_0012134 Ga0373935_0012134_4034_4525 162
1752 3300035692 Ga0373935_0361161 Ga0373935_0361161_22_513 162
1753 3300035695 Ga0373927_0000046 Ga0373927_0000046_63153_63644 162
1754 3300035695 Ga0373927_0283242 Ga0373927_0283242_93_584 162
1755 3300035695 Ga0373927_0443969 Ga0373927_0443969_87_578 162
1756 3300035725 Ga0373947_0003991 Ga0373947_0003991_2451_2942 162
1757 3300036401 Ga0373937_0011908 Ga0373937_0011908_1289_1780 162
1758 3300037068 Ga0373925_0011487 Ga0373925_0011487_2459_2950 162
1759 3300037466 Ga0395898_0151868 Ga0395898_0151868_893_1384 162
1760 3300039437 Ga0436365_0245742 Ga0436365_0245742_302_793 162
1761 3300039437 Ga0436365_0405335 Ga0436365_0405335_63_560 162
1762 3300039437 Ga0436365_0594053 Ga0436365_0594053_102_590 162
1763 3300039437 Ga0436365_0921625 Ga0436365_0921625_17317_17805 162
1764 3300039450 Ga0436363_0033464 Ga0436363_0033464_140_628 162
1765 3300039450 Ga0436363_0726793 Ga0436363_0726793_602_1090 162
1766 3300039450 Ga0436363_0767229 Ga0436363_0767229_503_991 162
1767 3300039453 Ga0436362_0629335 Ga0436362_0629335_546_1034 162
1768 3300039453 Ga0436362_1147499 Ga0436362_1147499_57_545 162
1769 3300046454 Ga0495592_0012178 Ga0495592_0012178_4120_4611 162
1770 3300046455 Ga0495603_0000051 Ga0495603_0000051_26314_26805 162
1771 3300046455 Ga0495603_0024048 Ga0495603_0024048_1494_1982 162
1772 3300046455 Ga0495603_0458406 Ga0495603_0458406_96_587 162
1773 3300046459 Ga0495629_0000182 Ga0495629_0000182_54206_54697 162
1774 3300046460 Ga0495638_0195596 Ga0495638_0195596_52_546 162
1775 3300046461 Ga0495641_0006669 Ga0495641_0006669_6580_7071 162
1776 3300046472 Ga0495580_0017526 Ga0495580_0017526_185_676 162
1777 3300046473 Ga0495582_0000025 Ga0495582_0000025_3568_4059 162
1778 3300046475 Ga0495639_0007403 Ga0495639_0007403_784_1275 162
1779 3300046475 Ga0495639_0077710 Ga0495639_0077710_778_1266 162
1780 3300046476 Ga0495662_0000583 Ga0495662_0000583_10679_11170 162
1781 3300046477 Ga0495664_0004145 Ga0495664_0004145_2642_3133 162
1782 3300046491 Ga0495584_0205217 Ga0495584_0205217_498_992 162
1783 3300046499 Ga0495594_0002799 Ga0495594_0002799_8199_8690 162
1784 3300046499 Ga0495594_0249305 Ga0495594_0249305_318_809 162
1785 3300046499 Ga0495594_0348315 Ga0495594_0348315_159_647 162
1786 3300046501 Ga0495607_0038824 Ga0495607_0038824_1192_1686 162
1787 3300046506 Ga0495583_0047989 Ga0495583_0047989_593_1087 162
1788 3300046507 Ga0495606_0001505 Ga0495606_0001505_6142_6633 162
1789 3300046512 Ga0495610_0127697 Ga0495610_0127697_230_724 162
1790 3300046513 Ga0495616_0054584 Ga0495616_0054584_479_973 162
1791 3300046515 Ga0495620_0067580 Ga0495620_0067580_130_624 162
1792 3300046516 Ga0495628_0025875 Ga0495628_0025875_3358_3849 162
1793 3300046516 Ga0495628_0281424 Ga0495628_0281424_147_674 162
1794 3300046517 Ga0495630_0034359 Ga0495630_0034359_2175_2666 162
1795 3300046518 Ga0495631_0033956 Ga0495631_0033956_982_1476 162
1796 3300046519 Ga0495632_0195446 Ga0495632_0195446_193_687 162
1797 3300046519 Ga0495632_0212873 Ga0495632_0212873_62_550 162
1798 3300046520 Ga0495637_0179522 Ga0495637_0179522_64_558 162
1799 3300046522 Ga0495643_0171789 Ga0495643_0171789_211_705 162
1800 3300046522 Ga0495643_0413887 Ga0495643_0413887_23_517 162
1801 3300046524 Ga0495648_0052870 Ga0495648_0052870_1737_2231 162
1802 3300046530 Ga0495654_0016687 Ga0495654_0016687_2390_2884 162
1803 3300046531 Ga0495665_0000195 Ga0495665_0000195_25273_25764 162
1804 3300046533 Ga0495640_0023048 Ga0495640_0023048_497_988 162
1805 3300046535 Ga0495586_0737604 Ga0495586_0737604_42_533 162
1806 3300046538 Ga0495609_0279273 Ga0495609_0279273_82_570 162
1807 3300046542 Ga0495597_0211011 Ga0495597_0211011_38_532 162
1808 3300046557 Ga0495622_0001733 Ga0495622_0001733_3063_3554 162
1809 3300046557 Ga0495622_0031540 Ga0495622_0031540_1967_2461 162
1810 3300046558 Ga0495633_0156673 Ga0495633_0156673_392_886 162
1811 3300046559 Ga0495667_0004219 Ga0495667_0004219_8228_8719 162
1812 3300046616 Ga0495668_0161016 Ga0495668_0161016_258_752 162
1813 3300046642 Ga0495634_0005743 Ga0495634_0005743_4773_5264 162
1814 3300046648 Ga0495611_0269718 Ga0495611_0269718_136_627 162
1815 3300046648 Ga0495611_0297521 Ga0495611_0297521_56_550 162
1816 3300046660 Ga0495625_0101947 Ga0495625_0101947_1061_1555 162
1817 3300046660 Ga0495625_0221036 Ga0495625_0221036_427_918 162
1818 3300046660 Ga0495625_0300109 Ga0495625_0300109_51_542 162
1819 3300046663 Ga0495635_0004315 Ga0495635_0004315_1385_1876 162
1820 3300046665 Ga0495661_0091077 Ga0495661_0091077_983_1477 162
1821 3300046674 Ga0495588_0002009 Ga0495588_0002009_4801_5292 162
1822 3300046675 Ga0495657_0054952 Ga0495657_0054952_1452_1943 162
1823 3300046681 Ga0495647_0002805 Ga0495647_0002805_2706_3197 162
1824 3300046683 Ga0495658_0002361 Ga0495658_0002361_6571_7062 162
1825 3300046684 Ga0495669_0366981 Ga0495669_0366981_111_605 162
1826 3300046689 Ga0495613_0006158 Ga0495613_0006158_2614_3105 162
1827 3300046690 Ga0495624_0000898 Ga0495624_0000898_22639_23130 162
1828 3300046690 Ga0495624_0483252 Ga0495624_0483252_13_501 162
1829 3300046691 Ga0495670_0015791 Ga0495670_0015791_2452_2946 162
1830 3300046692 Ga0495671_0256829 Ga0495671_0256829_320_808 162
1831 3300046692 Ga0495671_0417277 Ga0495671_0417277_13_504 162
1832 3300046694 Ga0495649_0385658 Ga0495649_0385658_174_665 162
1833 3300046794 Ga0495589_0259198 Ga0495589_0259198_94_588 162
1834 3300046810 Ga0495660_0053737 Ga0495660_0053737_1127_1621 162
1835 3300047315 Ga0495581_0000187 Ga0495581_0000187_24752_25243 162
1836 3300047315 Ga0495581_0034768 Ga0495581_0034768_57_548 162
1837 3300047317 Ga0495604_0455490 Ga0495604_0455490_256_750 162
1838 3300047319 Ga0495674_0003575 Ga0495674_0003575_6535_7026 162
1839 3300047319 Ga0495674_0079738 Ga0495674_0079738_1415_1906 162
1840 3300047320 Ga0495672_0155002 Ga0495672_0155002_21_515 162
1841 3300047320 Ga0495672_0201003 Ga0495672_0201003_192_692 162
1842 3300047321 Ga0495676_0013511 Ga0495676_0013511_5091_5582 162
1843 3300047322 Ga0495680_0909340 Ga0495680_0909340_31_522 162
1844 3300047446 Ga0495679_143817 Ga0495679_143817_66_557 162
1845 3300047447 Ga0495685_195857 Ga0495685_195857_11_505 162
1846 3300047470 Ga0495681_0274420 Ga0495681_0274420_83_577 162
1847 3300047472 Ga0495686_0049725 Ga0495686_0049725_1460_1954 162
1848 3300047472 Ga0495686_0180773 Ga0495686_0180773_514_1005 162
1849 3300047673 Ga0495593_0000469 Ga0495593_0000469_6506_6997 162
1850 3300048089 Ga0495614_0092802 Ga0495614_0092802_316_807 162
1851 3300048089 Ga0495614_0206171 Ga0495614_0206171_325_816 162
1852 3300048903 Ga0496100_0536630 Ga0496100_0536630_160_651 162
1853 3300048909 Ga0496106_0166558 Ga0496106_0166558_308_802 162
1854 3300048910 Ga0496107_0110036 Ga0496107_0110036_735_1226 162
1855 3300048910 Ga0496107_0656418 Ga0496107_0656418_263_757 162
1856 3300048911 Ga0496108_1190035 Ga0496108_1190035_46_540 162
1857 3300048913 Ga0496110_0283861 Ga0496110_0283861_428_919 162
1858 3300048914 Ga0496111_0251012 Ga0496111_0251012_689_1180 162
1859 3300048915 Ga0496112_0000040 Ga0496112_0000040_71566_72060 162
1860 3300048915 Ga0496112_0202992 Ga0496112_0202992_566_1057 162
1861 3300048915 Ga0496112_0667664 Ga0496112_0667664_64_555 162
1862 3300048916 Ga0496113_0539310 Ga0496113_0539310_367_861 162
1863 3300048916 Ga0496113_1163731 Ga0496113_1163731_91_582 162
1864 3300048917 Ga0496114_1186606 Ga0496114_1186606_120_611 162
1865 3300048917 Ga0496114_1308302 Ga0496114_1308302_18_509 162
1866 3300048918 Ga0496115_0042374 Ga0496115_0042374_10_501 162
1867 3300048919 Ga0496116_0004777 Ga0496116_0004777_8276_8770 162
1868 3300048920 Ga0496117_0111358 Ga0496117_0111358_1003_1497 162
1869 3300048920 Ga0496117_0536984 Ga0496117_0536984_35_529 162
1870 3300048921 Ga0496118_0040696 Ga0496118_0040696_1881_2375 162
1871 3300048921 Ga0496118_0216079 Ga0496118_0216079_42_536 162
1872 3300048922 Ga0496119_0082079 Ga0496119_0082079_502_996 162
1873 3300048922 Ga0496119_0092898 Ga0496119_0092898_575_1069 162
1874 3300048922 Ga0496119_0222786 Ga0496119_0222786_279_773 162
1875 3300048923 Ga0496120_0200703 Ga0496120_0200703_415_909 162
1876 3300048924 Ga0496121_0000265 Ga0496121_0000265_63370_63861 162
1877 3300048924 Ga0496121_0002837 Ga0496121_0002837_23163_23657 162
1878 3300048924 Ga0496121_0003837 Ga0496121_0003837_11161_11652 162
1879 3300048924 Ga0496121_0016535 Ga0496121_0016535_4325_4819 162
1880 3300048924 Ga0496121_0141250 Ga0496121_0141250_55_552 162
1881 3300048924 Ga0496121_0155050 Ga0496121_0155050_1100_1597 162
1882 3300048924 Ga0496121_0583948 Ga0496121_0583948_65_556 162
1883 3300048925 Ga0496122_0074814 Ga0496122_0074814_1577_2074 162
1884 3300048925 Ga0496122_0114191 Ga0496122_0114191_806_1300 162
1885 3300048925 Ga0496122_0193780 Ga0496122_0193780_513_1004 162
1886 3300048927 Ga0496124_0627200 Ga0496124_0627200_178_672 162
1887 3300048928 Ga0496125_0002054 Ga0496125_0002054_19294_19788 162
1888 3300048928 Ga0496125_0047446 Ga0496125_0047446_191_685 162
1889 3300048929 Ga0496126_0005480 Ga0496126_0005480_6027_6518 162
1890 3300048929 Ga0496126_0326786 Ga0496126_0326786_629_1123 162
1891 3300048929 Ga0496126_0350187 Ga0496126_0350187_11_544 162
1892 3300048929 Ga0496126_0354501 Ga0496126_0354501_381_875 162
1893 3300048929 Ga0496126_0419105 Ga0496126_0419105_484_981 162
1894 3300048929 Ga0496126_1064547 Ga0496126_1064547_27_518 162
1895 3300049459 Ga0495678_086058 Ga0495678_086058_166_660 162
1896 3300049568 Ga0501031_0005620 Ga0501031_0005620_3213_3704 162
1897 3300049568 Ga0501031_0037214 Ga0501031_0037214_1908_2405 162
1898 3300049569 Ga0501032_0001270 Ga0501032_0001270_12829_13320 162
1899 3300049569 Ga0501032_0004513 Ga0501032_0004513_7381_7878 162
1900 3300049569 Ga0501032_0600840 Ga0501032_0600840_121_618 162
1901 3300049570 Ga0501033_0000175 Ga0501033_0000175_55020_55511 162
1902 3300049570 Ga0501033_0015137 Ga0501033_0015137_5187_5684 162
1903 3300049571 Ga0501034_0000202 Ga0501034_0000202_93308_93799 162
1904 3300049571 Ga0501034_0047397 Ga0501034_0047397_3044_3541 162
1905 3300049572 Ga0501036_0000042 Ga0501036_0000042_60224_60715 162
1906 3300049572 Ga0501036_0022055 Ga0501036_0022055_501_998 162
1907 3300049573 Ga0501037_0000100 Ga0501037_0000100_57060_57551 162
1908 3300049573 Ga0501037_0034827 Ga0501037_0034827_3093_3590 162
1909 3300049574 Ga0501038_0000157 Ga0501038_0000157_55005_55496 162
1910 3300049574 Ga0501038_0004335 Ga0501038_0004335_10409_10906 162
1911 3300049575 Ga0501039_0000216 Ga0501039_0000216_13074_13565 162
1912 3300049575 Ga0501039_0069527 Ga0501039_0069527_2113_2610 162
1913 3300049576 Ga0501040_0009591 Ga0501040_0009591_3808_4305 162
1914 3300049577 Ga0501041_0383483 Ga0501041_0383483_210_707 162
1915 3300049578 Ga0501042_0008128 Ga0501042_0008128_3637_4128 162
1916 3300049578 Ga0501042_0019198 Ga0501042_0019198_2339_2836 162
1917 3300049579 Ga0501043_0004658 Ga0501043_0004658_2674_3165 162
1918 3300049579 Ga0501043_0073021 Ga0501043_0073021_770_1267 162
1919 3300049580 Ga0501046_0011426 Ga0501046_0011426_3490_3987 162
1920 3300049580 Ga0501046_0022043 Ga0501046_0022043_2340_2831 162
1921 3300049581 Ga0501047_0000159 Ga0501047_0000159_21113_21604 162
1922 3300049581 Ga0501047_0006707 Ga0501047_0006707_373_870 162
1923 3300049582 Ga0501048_0005267 Ga0501048_0005267_842_1339 162
1924 3300049582 Ga0501048_0010436 Ga0501048_0010436_2523_3014 162
1925 3300049583 Ga0501067_0002974 Ga0501067_0002974_3700_4191 162
1926 3300049583 Ga0501067_0017732 Ga0501067_0017732_3411_3899 162
1927 3300049583 Ga0501067_0035174 Ga0501067_0035174_2077_2574 162
1928 3300049584 Ga0501068_0000168 Ga0501068_0000168_4206_4697 162
1929 3300049584 Ga0501068_0010825 Ga0501068_0010825_4620_5117 162
1930 3300049585 Ga0501069_0011906 Ga0501069_0011906_4012_4503 162
1931 3300049585 Ga0501069_0039165 Ga0501069_0039165_803_1300 162
1932 3300049586 Ga0501070_0016415 Ga0501070_0016415_2944_3435 162
1933 3300049586 Ga0501070_0089095 Ga0501070_0089095_1840_2337 162
1934 3300049587 Ga0501071_0039988 Ga0501071_0039988_754_1251 162
1935 3300049587 Ga0501071_0052969 Ga0501071_0052969_2229_2720 162
1936 3300049587 Ga0501071_0335709 Ga0501071_0335709_461_949 162
1937 3300049588 Ga0501072_0000475 Ga0501072_0000475_14090_14581 162
1938 3300049588 Ga0501072_0025195 Ga0501072_0025195_649_1146 162
1939 3300049589 Ga0501073_0000678 Ga0501073_0000678_4263_4754 162
1940 3300049589 Ga0501073_0029036 Ga0501073_0029036_89_586 162
1941 3300049590 Ga0501074_0000117 Ga0501074_0000117_4884_5375 162
1942 3300049590 Ga0501074_0001904 Ga0501074_0001904_12068_12565 162
1943 3300049592 Ga0501076_0030457 Ga0501076_0030457_58_555 162
1944 3300049592 Ga0501076_0126661 Ga0501076_0126661_641_1132 162
1945 3300049593 Ga0501077_0100262 Ga0501077_0100262_549_1046 162
1946 3300049741 Ga0501079_0009895 Ga0501079_0009895_2533_3024 162
1947 3300049741 Ga0501079_0205176 Ga0501079_0205176_912_1409 162
1948 3300049742 Ga0501080_0004449 Ga0501080_0004449_10288_10779 162
1949 3300049742 Ga0501080_0015418 Ga0501080_0015418_1955_2452 162
1950 3300049743 Ga0501081_0156336 Ga0501081_0156336_1024_1521 162
1951 3300049744 Ga0501083_0004228 Ga0501083_0004228_9497_9988 162
1952 3300049744 Ga0501083_0049179 Ga0501083_0049179_1846_2343 162
1953 3300049822 Ga0501035_0000172 Ga0501035_0000172_23536_24027 162
1954 3300049822 Ga0501035_0320325 Ga0501035_0320325_697_1194 162
1955 3300049822 Ga0501035_0397773 Ga0501035_0397773_277_774 162
1956 3300049823 Ga0501044_0000282 Ga0501044_0000282_46431_46922 162
1957 3300049823 Ga0501044_0359332 Ga0501044_0359332_550_1047 162
1958 3300049824 Ga0501045_0030903 Ga0501045_0030903_1909_2406 162
1959 3300049824 Ga0501045_0275163 Ga0501045_0275163_453_944 162
1960 3300049824 Ga0501045_0544144 Ga0501045_0544144_317_805 162
1961 3300050491 nmdc:mga00v17_105861_c1 nmdc:mga00v17_105861_c1_351_845 162
1962 3300050492 nmdc:mga0yw44_175931_c1 nmdc:mga0yw44_175931_c1_696_1187 162
1963 3300050492 nmdc:mga0yw44_24529_c1 nmdc:mga0yw44_24529_c1_875_1369 162
1964 3300050512 nmdc:mga0n895_113627_c1 nmdc:mga0n895_113627_c1_1787_2275 162
1965 3300050512 nmdc:mga0n895_728338_c1 nmdc:mga0n895_728338_c1_169_660 162
1966 3300050516 nmdc:mga0sz30_159126_c1 nmdc:mga0sz30_159126_c1_11_505 162
1967 3300050516 nmdc:mga0sz30_1763_c1 nmdc:mga0sz30_1763_c1_5523_6017 162
1968 3300053080 Ga0500635_0024895 Ga0500635_0024895_93_584 162
1969 3300053084 Ga0495595_0389504 Ga0495595_0389504_121_612 162
1970 3300053085 Ga0495619_0305695 Ga0495619_0305695_249_740 162
1971 3300053087 Ga0500643_039291 Ga0500643_039291_458_952 162
1972 3300053088 Ga0500644_0011683 Ga0500644_0011683_389_883 162
1973 3300053088 Ga0500644_0374348 Ga0500644_0374348_79_570 162
1974 3300053090 Ga0500646_0084705 Ga0500646_0084705_156_650 162
1975 3300053093 Ga0500651_0001377 Ga0500651_0001377_1523_2017 162
1976 3300053094 Ga0500566_0002104 Ga0500566_0002104_3902_4396 162
1977 3300053096 Ga0500641_0038330 Ga0500641_0038330_974_1468 162
1978 3300053098 Ga0500650_0016352 Ga0500650_0016352_1325_1819 162
1979 3300053104 Ga0500556_0000195 Ga0500556_0000195_22768_23262 162
1980 3300053105 Ga0500557_031893 Ga0500557_031893_458_952 162
1981 3300053108 Ga0500562_095183 Ga0500562_095183_180_674 162
1982 3300053109 Ga0500569_153803 Ga0500569_153803_212_706 162
1983 3300053116 Ga0500592_000692 Ga0500592_000692_4088_4582 162
1984 3300053117 Ga0500593_193951 Ga0500593_193951_48_542 162
1985 3300053118 Ga0500594_0027401 Ga0500594_0027401_527_1021 162
1986 3300053118 Ga0500594_0053663 Ga0500594_0053663_417_911 162
1987 3300053119 Ga0500595_003662 Ga0500595_003662_519_1013 162
1988 3300053119 Ga0500595_005876 Ga0500595_005876_2351_2842 162
1989 3300053121 Ga0500607_139392 Ga0500607_139392_472_966 162
1990 3300053125 Ga0500618_008174 Ga0500618_008174_2126_2620 162
1991 3300053125 Ga0500618_046364 Ga0500618_046364_421_918 162
1992 3300053130 Ga0500642_0000012 Ga0500642_0000012_22795_23289 162
1993 3300053130 Ga0500642_0004650 Ga0500642_0004650_3756_4250 162
1994 3300053131 Ga0500652_000146 Ga0500652_000146_23165_23659 162
1995 3300053136 Ga0500559_0005374 Ga0500559_0005374_5252_5746 162
1996 3300053136 Ga0500559_0475973 Ga0500559_0475973_51_548 162
1997 3300053138 Ga0500564_127084 Ga0500564_127084_209_703 162
1998 3300053139 Ga0500568_0002038 Ga0500568_0002038_8418_8912 162
1999 3300053139 Ga0500568_0008058 Ga0500568_0008058_274_768 162
2000 3300053142 Ga0500577_0001485 Ga0500577_0001485_3672_4172 162
2001 3300053142 Ga0500577_0040634 Ga0500577_0040634_235_729 162
2002 3300053145 Ga0500586_004216 Ga0500586_004216_482_976 162
2003 3300053148 Ga0500590_064864 Ga0500590_064864_901_1395 162
2004 3300053150 Ga0500603_004752 Ga0500603_004752_648_1139 162
2005 3300053151 Ga0500604_0043149 Ga0500604_0043149_857_1351 162
2006 3300053153 Ga0500616_0000046 Ga0500616_0000046_296888_297379 162
2007 3300053153 Ga0500616_0001093 Ga0500616_0001093_10975_11469 162
2008 3300053156 Ga0500622_0137669 Ga0500622_0137669_269_763 162
2009 3300053160 Ga0500633_0022339 Ga0500633_0022339_443_937 162
2010 3300053177 Ga0500636_0019749 Ga0500636_0019749_199_693 162
2011 3300053178 Ga0500637_0029315 Ga0500637_0029315_22_516 162
2012 3300053727 Ga0500611_079236 Ga0500611_079236_222_716 162
2013 3300053730 Ga0500645_031444 Ga0500645_031444_752_1246 162
2014 3300053730 Ga0500645_033030 Ga0500645_033030_539_1033 162
2015 3300054114 Ga0501084_0002863 Ga0501084_0002863_8242_8733 162
2016 3300054114 Ga0501084_0032538 Ga0501084_0032538_1959_2456 162
2017 3300059491 Ga0587070_114810 Ga0587070_114810_48_536 162
2018 3300059492 Ga0587073_0192516 Ga0587073_0192516_17_508 162
2019 3300059493 Ga0587077_134966 Ga0587077_134966_39_530 162
2020 3300059493 Ga0587077_142152 Ga0587077_142152_110_598 162
2021 3300059503 Ga0587080_047642 Ga0587080_047642_18_506 162
2022 3300059505 Ga0587083_0077395 Ga0587083_0077395_102_590 162
2023 3300059506 Ga0587085_092389 Ga0587085_092389_111_599 162
2024 3300059506 Ga0587085_096377 Ga0587085_096377_108_596 162
2025 3300059508 Ga0587088_103635 Ga0587088_103635_118_606 162
2026 3300059508 Ga0587088_110329 Ga0587088_110329_23_511 162
2027 3300059639 Ga0587062_042191 Ga0587062_042191_238_726 162
2028 3300059641 Ga0587068_088907 Ga0587068_088907_17_505 162
2029 3300059642 Ga0587069_066389 Ga0587069_066389_17_508 162
2030 3300059652 Ga0587107_051245 Ga0587107_051245_18_506 162
2031 3300060344 Ga0587071_072381 Ga0587071_072381_100_588 162
2032 3300060346 Ga0587111_0093287 Ga0587111_0093287_119_607 162
2033 3300060353 Ga0501082_0024686 Ga0501082_0024686_1126_1623 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

53

147

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u1h-assembly3.cif.gz_C crystal structure of the c-terminal peptidoglycan binding domain of oprf (pa1777) from pseudomonas aeruginosa 0.8917 56 140
6u83-assembly1.cif.gz_A ompa-like domain of fopa1 from francisella tularensis subsp. tularensis schu s4 0.8715 56 140
4g88-assembly4.cif.gz_G crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii 0.864 56 140
5wtp-assembly2.cif.gz_B crystal structure of the c-terminal domain of outer membrane protein a (ompa) from capnocytophaga gingivalis 0.8511 56 140
5wtl-assembly4.cif.gz_D crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis 0.8507 56 140
ID Description Score Start End Superfamily
5u1hB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9047 56 140 3.30.1330.60
3td4B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8685 56 140 3.30.1330.60
3oonA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8612 56 136 3.30.1330.60
5wtpB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8511 56 140 3.30.1330.60
af_P0A910_199_343_3.30.1330.60 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8501 56 139 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A2P7P2D3-F1-model_v4 deleted 0.9845 40 120
AF-A0A4Q3YQX1-F1-model_v4 OmpA family protein 0.983 41 124 GO:0009279
AF-A0A350YPD8-F1-model_v4 OmpA-like domain-containing protein 0.9694 56 136 GO:0009279
AF-A0A848XK22-F1-model_v4 OmpA family protein 0.9686 56 131 GO:0009279
AF-A0A6L9YMP8-F1-model_v4 OmpA family protein 0.9684 56 133 GO:0009279

Feature Viewer

pLDDT pTM Quality
77.18 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map