F496299

General Info

Members Datasets Scaffolds Average Seq Length
2038 535 4076 190

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100398033|Ga0070661_1003980331
Length 221
Sequence MEIILLERVEKLGAIGDVVKVKDGFARNYLLPRKKALRANEANRKLFEANRARIEEENANKRSDAEKASKSVDGKTVQLIRQASNTGQLYGSVSARDIAEALEGAGAHVAKSQVVLDRPIKAIGMHEVKIALHPEVGVTVKVNVARSPEEADLQAQGIDVMAQMFERDATAFTEEFEPGLEPGIPAAEENPGTPAEAEVGISEEAPADTGTGENRSGEEEA

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
136 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
156 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
159 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
167 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
257 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
274 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
277 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
291 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
295 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
296 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
297 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
298 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
299 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
300 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
301 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
304 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
305 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
310 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
313 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
314 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
315 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
316 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
317 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
322 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
327 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
328 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
329 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
330 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
331 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
336 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
346 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
347 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
350 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
351 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
352 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
360 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
363 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
364 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
367 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
368 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
369 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
370 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
371 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
409 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
410 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
411 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
412 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
413 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
414 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
437 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
438 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
439 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
440 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
441 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
442 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
443 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
444 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
445 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
446 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
447 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
448 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
449 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
450 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
451 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
452 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
455 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
456 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
457 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
458 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
459 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
460 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
464 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
471 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
472 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
476 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
477 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
478 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
479 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
480 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
481 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
482 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
483 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
484 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
485 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
486 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
487 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
490 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
491 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
492 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
493 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
494 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
495 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
496 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
497 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
506 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
507 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
508 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
509 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
510 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
511 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
512 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
513 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
514 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
515 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
516 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
517 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
518 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
519 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
520 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
521 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
522 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
523 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
524 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
525 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
526 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
527 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
528 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
529 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
530 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
531 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
532 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
533 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
534 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
535 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 1.82
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 5.64
Nodule 0
Rhizoplane 3.29
Rhizosphere 87.34
Stem 0
Stem Tuber 0.05
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100398033 3300005344 Bacteria 1088
2 SwRhRL2b_contig_3230906 2162886007 Bacteria 1541
3 ARcpr5oldR_c000971 3300000041 Bacteria 3098
4 ARcpr5yngRDRAFT_c003421 3300000043 Bacteria 1566
5 JGI24736J21556_1000110 3300001904 Bacteria 13961
6 JGI24741J21665_1000982 3300001915 Bacteria 8568
7 JGI24741J21665_1000991 3300001915 Bacteria 8535
8 JGI24741J21665_1001534 3300001915 Bacteria 6545
9 JGI24752J21851_1000117 3300001976 Bacteria 10849
10 JGI24752J21851_1006279 3300001976 Bacteria 1553
11 JGI24747J21853_1002726 3300001978 Bacteria 1468
12 JGI24740J21852_10000594 3300001979 Bacteria 15640
13 JGI24740J21852_10001036 3300001979 Bacteria 12464
14 JGI24740J21852_10004545 3300001979 Bacteria 5971
15 JGI24740J21852_10010914 3300001979 Bacteria 3473
16 JGI24740J21852_10013016 3300001979 Bacteria 3120
17 JGI24740J21852_10019603 3300001979 Bacteria 2378
18 JGI24740J21852_10019834 3300001979 Bacteria 2360
19 JGI24740J21852_10026549 3300001979 Bacteria 1939
20 JGI24740J21852_10076847 3300001979 Bacteria 882
21 JGI24740J21852_10093189 3300001979 Bacteria 775
22 JGI24739J22299_10000311 3300001989 Bacteria 16579
23 JGI24739J22299_10005667 3300001989 Bacteria 4731
24 JGI24739J22299_10009771 3300001989 Bacteria 3568
25 JGI24739J22299_10025725 3300001989 Bacteria 2070
26 JGI24739J22299_10026329 3300001989 Bacteria 2041
27 JGI24739J22299_10028375 3300001989 Bacteria 1952
28 JGI24739J22299_10037282 3300001989 Bacteria 1638
29 JGI24739J22299_10060964 3300001989 Bacteria 1192
30 JGI24739J22299_10093185 3300001989 Bacteria 915
31 JGI24739J22299_10108056 3300001989 Bacteria 836
32 JGI24737J22298_10000013 3300001990 Bacteria 50248
33 JGI24737J22298_10000835 3300001990 Bacteria 10972
34 JGI24737J22298_10001767 3300001990 Bacteria 7736
35 JGI24737J22298_10003617 3300001990 Bacteria 5447
36 JGI24737J22298_10005360 3300001990 Bacteria 4433
37 JGI24737J22298_10008817 3300001990 Bacteria 3367
38 JGI24737J22298_10012770 3300001990 Bacteria 2738
39 JGI24737J22298_10026184 3300001990 Bacteria 1842
40 JGI24737J22298_10076503 3300001990 Bacteria 998
41 JGI24743J22301_10009940 3300001991 Bacteria 1692
42 JGI24735J21928_10002484 3300002067 Bacteria 6399
43 JGI24735J21928_10009345 3300002067 Bacteria 3150
44 JGI24735J21928_10009748 3300002067 Bacteria 3077
45 JGI24735J21928_10022329 3300002067 Bacteria 1928
46 JGI24735J21928_10037095 3300002067 Bacteria 1429
47 JGI24735J21928_10037412 3300002067 Bacteria 1423
48 JGI24735J21928_10046901 3300002067 Bacteria 1253
49 JGI24735J21928_10089369 3300002067 Bacteria 883
50 JGI24735J21928_10091937 3300002067 Bacteria 870
51 JGI24750J21931_1000571 3300002070 Bacteria 5646
52 JGI24748J21848_1000029 3300002074 Bacteria 90134
53 JGI24738J21930_10001262 3300002075 Bacteria 7103
54 JGI24738J21930_10001427 3300002075 Bacteria 6629
55 JGI24738J21930_10003000 3300002075 Bacteria 4313
56 JGI24738J21930_10004129 3300002075 Bacteria 3580
57 JGI24738J21930_10005863 3300002075 Bacteria 2919
58 JGI24738J21930_10011719 3300002075 Bacteria 1924
59 JGI24738J21930_10019475 3300002075 Bacteria 1414
60 JGI24749J21850_1000261 3300002076 Bacteria 8195
61 JGI24744J21845_10005812 3300002077 Bacteria 2556
62 JGI24034J26672_10000006 3300002239 Bacteria 294495
63 JGI24742J22300_10002400 3300002244 Bacteria 3005
64 JGI24742J22300_10014313 3300002244 Bacteria 1333
65 JGI24751J29686_10012811 3300002459 Bacteria 1730
66 JGI25164J39214_1008973 3300002772 Bacteria 990
67 JGI25150J39212_1000596 3300002774 Bacteria 14118
68 JGI25150J39212_1018431 3300002774 Bacteria 1110
69 JGI25151J46595_10013195 3300003187 Bacteria 3727
70 JGI25406J46586_10102049 3300003203 Bacteria 855
71 JGI25165J46597_1000053 3300003214 Bacteria 235857
72 JGI25165J46597_1000165 3300003214 Bacteria 104009
73 JGI25153J46596_10000006 3300003215 Bacteria 447760
74 JGI25153J46596_10000017 3300003215 Bacteria 274325
75 JGI25153J46596_10025162 3300003215 Bacteria 2132
76 rootH1_10012727 3300003316 Bacteria 3005
77 Ga0007429J51699_1036535 3300003579 Bacteria 1230
78 Ga0055525_1000040 3300003759 Bacteria 286933
79 Ga0055542_1000078 3300003762 Bacteria 131147
80 Ga0055542_1000791 3300003762 Bacteria 23476
81 Ga0055542_1009231 3300003762 Bacteria 1874
82 Ga0055529_1000007 3300003763 Bacteria 403604
83 Ga0055529_1006108 3300003763 Bacteria 1702
84 Ga0055526_1004025 3300003771 Bacteria 9032
85 Ga0055526_1041573 3300003771 Bacteria 1144
86 Ga0055537_1000962 3300003773 Bacteria 13166
87 Ga0055537_1003028 3300003773 Bacteria 5308
88 Ga0055524_1000452 3300003775 Bacteria 33994
89 Ga0055536_1017681 3300003781 Bacteria 2321
90 Ga0055530_10005445 3300003791 Bacteria 6047
91 Ga0055530_10009326 3300003791 Bacteria 3788
92 Ga0055540_1001980 3300003792 Bacteria 11454
93 Ga0055531_10000008 3300003794 Bacteria 222269
94 Ga0055531_10028572 3300003794 Bacteria 1919
95 Ga0065165_1002723 3300005262 Bacteria 14137
96 Ga0065165_1005838 3300005262 Bacteria 6705
97 Ga0065165_1007422 3300005262 Bacteria 5388
98 Ga0065165_1033397 3300005262 Bacteria 1602
99 Ga0065714_10076962 3300005288 Bacteria 2737
100 Ga0065704_10000743 3300005289 Bacteria 24338
101 Ga0065704_10153439 3300005289 Bacteria 1410
102 Ga0065704_10274314 3300005289 Bacteria 935
103 Ga0065715_10098195 3300005293 Bacteria 3583
104 Ga0065707_10083015 3300005295 Bacteria 10847
105 Ga0065707_10099471 3300005295 Bacteria 3003
106 Ga0070658_10007219 3300005327 Bacteria 8967
107 Ga0070658_10017258 3300005327 Bacteria 5777
108 Ga0070658_10019971 3300005327 Bacteria 5366
109 Ga0070658_10023993 3300005327 Bacteria 4895
110 Ga0070658_10033532 3300005327 Bacteria 4131
111 Ga0070658_10045216 3300005327 Bacteria 3560
112 Ga0070658_10046129 3300005327 Bacteria 3526
113 Ga0070658_10059369 3300005327 Bacteria 3114
114 Ga0070658_10100378 3300005327 Bacteria 2392
115 Ga0070658_10108359 3300005327 Bacteria 2299
116 Ga0070658_10167078 3300005327 Bacteria 1847
117 Ga0070658_10261987 3300005327 Bacteria 1468
118 Ga0070658_10362812 3300005327 Bacteria 1241
119 Ga0070658_10426160 3300005327 Bacteria 1141
120 Ga0070658_10426804 3300005327 Bacteria 1140
121 Ga0070658_10442405 3300005327 Bacteria 1119
122 Ga0070658_10474341 3300005327 Bacteria 1079
123 Ga0070676_10003637 3300005328 Bacteria 8065
124 Ga0070676_10004126 3300005328 Bacteria 7630
125 Ga0070676_10073929 3300005328 Bacteria 2051
126 Ga0070676_10078205 3300005328 Bacteria 2001
127 Ga0070676_10212087 3300005328 Bacteria 1275
128 Ga0070683_100057532 3300005329 Bacteria 3612
129 Ga0070683_100107355 3300005329 Bacteria 2632
130 Ga0070683_100126568 3300005329 Bacteria 2415
131 Ga0070683_100155367 3300005329 Bacteria 2170
132 Ga0070683_100232054 3300005329 Bacteria 1754
133 Ga0070683_100330394 3300005329 Bacteria 1451
134 Ga0070683_100491192 3300005329 Bacteria 1172
135 Ga0070683_100930702 3300005329 Bacteria 834
136 Ga0070690_100000002 3300005330 Bacteria 176748
137 Ga0070690_100010584 3300005330 Bacteria 5373
138 Ga0070690_100010994 3300005330 Bacteria 5284
139 Ga0070670_100005828 3300005331 Bacteria 10416
140 Ga0070670_100026630 3300005331 Bacteria 4974
141 Ga0070670_100029191 3300005331 Bacteria 4746
142 Ga0070670_100035587 3300005331 Bacteria 4285
143 Ga0070670_100070080 3300005331 Bacteria 3010
144 Ga0070670_100304119 3300005331 Bacteria 1395
145 Ga0070670_100673807 3300005331 Bacteria 929
146 Ga0070670_100705091 3300005331 Bacteria 908
147 Ga0070670_101037334 3300005331 Bacteria 746
148 Ga0070677_10008070 3300005333 Bacteria 3531
149 Ga0070677_10011538 3300005333 Bacteria 3050
150 Ga0070677_10012863 3300005333 Bacteria 2913
151 Ga0068869_100000225 3300005334 Bacteria 29577
152 Ga0068869_100000237 3300005334 Bacteria 29089
153 Ga0068869_100092294 3300005334 Bacteria 2279
154 Ga0070666_10000002 3300005335 Bacteria 478684
155 Ga0070666_10002523 3300005335 Bacteria 11076
156 Ga0070666_10023981 3300005335 Bacteria 3972
157 Ga0070666_10025521 3300005335 Bacteria 3853
158 Ga0070666_10131460 3300005335 Bacteria 1740
159 Ga0070666_10578448 3300005335 Bacteria 818
160 Ga0070666_10867401 3300005335 Bacteria 667
161 Ga0070680_100006563 3300005336 Bacteria 8850
162 Ga0070680_100028716 3300005336 Bacteria 4464
163 Ga0070680_100084875 3300005336 Bacteria 2615
164 Ga0070680_100098387 3300005336 Bacteria 2426
165 Ga0070680_100122358 3300005336 Bacteria 2172
166 Ga0070680_100295689 3300005336 Bacteria 1373
167 Ga0070682_100145093 3300005337 Bacteria 1623
168 Ga0070682_100326363 3300005337 Bacteria 1136
169 Ga0070682_100366686 3300005337 Bacteria 1079
170 Ga0070682_100594706 3300005337 Bacteria 873
171 Ga0068868_100000013 3300005338 Bacteria 110536
172 Ga0068868_100001197 3300005338 Bacteria 17815
173 Ga0068868_100002570 3300005338 Bacteria 12598
174 Ga0068868_100059688 3300005338 Bacteria 3018
175 Ga0068868_100084629 3300005338 Bacteria 2547
176 Ga0068868_100530864 3300005338 Bacteria 1034
177 Ga0068868_100677396 3300005338 Bacteria 920
178 Ga0070660_100006734 3300005339 Bacteria 7973
179 Ga0070660_100011916 3300005339 Bacteria 6202
180 Ga0070660_100012723 3300005339 Bacteria 6016
181 Ga0070660_100012788 3300005339 Bacteria 6001
182 Ga0070660_100017639 3300005339 Bacteria 5205
183 Ga0070660_100023713 3300005339 Bacteria 4548
184 Ga0070660_100030095 3300005339 Bacteria 4071
185 Ga0070660_100044682 3300005339 Bacteria 3389
186 Ga0070660_100066481 3300005339 Bacteria 2806
187 Ga0070660_100119371 3300005339 Bacteria 2103
188 Ga0070660_100174346 3300005339 Bacteria 1738
189 Ga0070660_100185020 3300005339 Bacteria 1686
190 Ga0070660_100243707 3300005339 Bacteria 1465
191 Ga0070689_100754861 3300005340 Bacteria 853
192 Ga0070691_10000673 3300005341 Bacteria 13295
193 Ga0070687_100200798 3300005343 Bacteria 1208
194 Ga0070661_100008588 3300005344 Bacteria 7063
195 Ga0070661_100011642 3300005344 Bacteria 6133
196 Ga0070661_100014173 3300005344 Bacteria 5614
197 Ga0070661_100016317 3300005344 Bacteria 5249
198 Ga0070661_100020121 3300005344 Bacteria 4758
199 Ga0070661_100035691 3300005344 Bacteria 3612
200 Ga0070661_100043002 3300005344 Bacteria 3299
201 Ga0070661_100054342 3300005344 Bacteria 2933
202 Ga0070661_100069336 3300005344 Bacteria 2592
203 Ga0070661_100072020 3300005344 Bacteria 2543
204 Ga0070661_100089673 3300005344 Bacteria 2277
205 Ga0070661_100108498 3300005344 Bacteria 2071
206 Ga0070661_100140882 3300005344 Bacteria 1817
207 Ga0070661_100159968 3300005344 Bacteria 1705
208 Ga0070661_100188976 3300005344 Bacteria 1570
209 Ga0070661_100213332 3300005344 Bacteria 1478
210 Ga0070661_100584682 3300005344 Bacteria 901
211 Ga0070661_100628744 3300005344 Bacteria 870
212 Ga0070692_10002334 3300005345 Bacteria 7323
213 Ga0070692_10022048 3300005345 Bacteria 3106
214 Ga0070668_100023073 3300005347 Bacteria 4703
215 Ga0070668_100045056 3300005347 Bacteria 3384
216 Ga0070668_100052544 3300005347 Bacteria 3140
217 Ga0070668_100094565 3300005347 Bacteria 2359
218 Ga0070668_100227246 3300005347 Bacteria 1541
219 Ga0070669_100000078 3300005353 Bacteria 94641
220 Ga0070669_100008277 3300005353 Bacteria 7424
221 Ga0070669_100061781 3300005353 Bacteria 2754
222 Ga0070669_100140188 3300005353 Bacteria 1863
223 Ga0070669_100236194 3300005353 Bacteria 1451
224 Ga0070669_100301660 3300005353 Bacteria 1288
225 Ga0070669_100378276 3300005353 Bacteria 1154
226 Ga0070669_100564065 3300005353 Bacteria 950
227 Ga0070675_100006462 3300005354 Bacteria 8999
228 Ga0070671_100001626 3300005355 Bacteria 16939
229 Ga0070671_100011784 3300005355 Bacteria 7033
230 Ga0070671_100014039 3300005355 Bacteria 6467
231 Ga0070671_100026211 3300005355 Bacteria 4789
232 Ga0070671_100030708 3300005355 Bacteria 4434
233 Ga0070671_100060274 3300005355 Bacteria 3160
234 Ga0070671_100084165 3300005355 Bacteria 2660
235 Ga0070671_100095853 3300005355 Bacteria 2487
236 Ga0070671_100131669 3300005355 Bacteria 2106
237 Ga0070671_100182805 3300005355 Bacteria 1775
238 Ga0070671_100541354 3300005355 Bacteria 1004
239 Ga0070674_100003736 3300005356 Bacteria 8585
240 Ga0070674_100044508 3300005356 Bacteria 3027
241 Ga0070674_100062222 3300005356 Bacteria 2608
242 Ga0070674_100080452 3300005356 Bacteria 2326
243 Ga0070674_100102304 3300005356 Bacteria 2089
244 Ga0070674_100629632 3300005356 Bacteria 910
245 Ga0070673_100000002 3300005364 Bacteria 225084
246 Ga0070673_100000113 3300005364 Bacteria 37191
247 Ga0070673_100021007 3300005364 Bacteria 4722
248 Ga0070673_100029419 3300005364 Bacteria 4096
249 Ga0070673_100033993 3300005364 Bacteria 3853
250 Ga0070673_100143519 3300005364 Bacteria 2016
251 Ga0070673_100149747 3300005364 Bacteria 1975
252 Ga0070673_100152269 3300005364 Bacteria 1959
253 Ga0070673_100230244 3300005364 Bacteria 1607
254 Ga0070688_100010565 3300005365 Bacteria 5097
255 Ga0070659_100003603 3300005366 Bacteria 11022
256 Ga0070659_100003637 3300005366 Bacteria 10982
257 Ga0070659_100003958 3300005366 Bacteria 10541
258 Ga0070659_100007496 3300005366 Bacteria 7928
259 Ga0070659_100007614 3300005366 Bacteria 7872
260 Ga0070659_100014821 3300005366 Bacteria 5829
261 Ga0070659_100036603 3300005366 Bacteria 3826
262 Ga0070659_100060491 3300005366 Bacteria 2992
263 Ga0070659_100076677 3300005366 Bacteria 2665
264 Ga0070659_100129735 3300005366 Bacteria 2046
265 Ga0070659_100159504 3300005366 Bacteria 1844
266 Ga0070659_100194843 3300005366 Bacteria 1666
267 Ga0070659_100222148 3300005366 Bacteria 1559
268 Ga0070659_100251614 3300005366 Bacteria 1464
269 Ga0070659_100255325 3300005366 Bacteria 1453
270 Ga0070659_100456606 3300005366 Bacteria 1084
271 Ga0070659_100710208 3300005366 Bacteria 870
272 Ga0070659_100974101 3300005366 Bacteria 744
273 Ga0070667_100007592 3300005367 Bacteria 8992
274 Ga0070667_100008122 3300005367 Bacteria 8703
275 Ga0070667_100011649 3300005367 Bacteria 7270
276 Ga0070667_100040063 3300005367 Bacteria 3928
277 Ga0070667_100044428 3300005367 Bacteria 3731
278 Ga0070667_100177674 3300005367 Bacteria 1882
279 Ga0070667_100231273 3300005367 Bacteria 1648
280 Ga0070667_100324669 3300005367 Bacteria 1389
281 Ga0070667_100378489 3300005367 Bacteria 1285
282 Ga0070667_100650041 3300005367 Bacteria 973
283 Ga0070667_100723454 3300005367 Bacteria 922
284 Ga0070714_100010147 3300005435 Bacteria 7434
285 Ga0070714_100106803 3300005435 Bacteria 2474
286 Ga0070714_100108202 3300005435 Bacteria 2457
287 Ga0070714_100136912 3300005435 Bacteria 2194
288 Ga0070714_100547661 3300005435 Bacteria 1107
289 Ga0070714_100633533 3300005435 Bacteria 1028
290 Ga0070713_100154621 3300005436 Bacteria 2043
291 Ga0070713_101275045 3300005436 Bacteria 712
292 Ga0070694_100114028 3300005444 Bacteria 1929
293 Ga0070663_100001785 3300005455 Bacteria 11967
294 Ga0070663_100002614 3300005455 Bacteria 10182
295 Ga0070663_100035078 3300005455 Bacteria 3478
296 Ga0070663_100036804 3300005455 Bacteria 3402
297 Ga0070663_100062847 3300005455 Bacteria 2678
298 Ga0070663_100072677 3300005455 Bacteria 2507
299 Ga0070663_100074794 3300005455 Bacteria 2474
300 Ga0070663_100135948 3300005455 Bacteria 1871
301 Ga0070663_100153503 3300005455 Bacteria 1767
302 Ga0070663_100473719 3300005455 Bacteria 1035
303 Ga0070663_100673606 3300005455 Bacteria 877
304 Ga0070678_100001865 3300005456 Bacteria 11367
305 Ga0070678_100006193 3300005456 Bacteria 6994
306 Ga0070678_100006524 3300005456 Bacteria 6853
307 Ga0070678_100012935 3300005456 Bacteria 5211
308 Ga0070678_100114172 3300005456 Bacteria 2118
309 Ga0070678_100321904 3300005456 Bacteria 1321
310 Ga0070678_101079006 3300005456 Bacteria 741
311 Ga0070662_100001998 3300005457 Bacteria 12506
312 Ga0070662_100005546 3300005457 Bacteria 8062
313 Ga0070662_100006784 3300005457 Bacteria 7403
314 Ga0070662_100007277 3300005457 Bacteria 7173
315 Ga0070662_100021491 3300005457 Bacteria 4406
316 Ga0070662_100040361 3300005457 Bacteria 3322
317 Ga0070662_100081331 3300005457 Bacteria 2413
318 Ga0070662_100093220 3300005457 Bacteria 2265
319 Ga0070662_100157411 3300005457 Bacteria 1774
320 Ga0070662_100255435 3300005457 Bacteria 1410
321 Ga0070662_100427614 3300005457 Bacteria 1096
322 Ga0070662_100476600 3300005457 Bacteria 1038
323 Ga0070662_100515641 3300005457 Bacteria 998
324 Ga0070662_100894096 3300005457 Bacteria 757
325 Ga0070681_10013052 3300005458 Bacteria 8249
326 Ga0070681_10053445 3300005458 Bacteria 4025
327 Ga0070681_10229528 3300005458 Bacteria 1770
328 Ga0070681_10437426 3300005458 Bacteria 1220
329 Ga0070681_10666781 3300005458 Bacteria 955
330 Ga0070681_10691416 3300005458 Bacteria 936
331 Ga0068867_100000012 3300005459 Bacteria 118831
332 Ga0068867_100001363 3300005459 Bacteria 16865
333 Ga0068867_100041848 3300005459 Bacteria 3348
334 Ga0068867_100119211 3300005459 Bacteria 2037
335 Ga0068867_100172524 3300005459 Bacteria 1714
336 Ga0068867_100193077 3300005459 Bacteria 1626
337 Ga0068867_100339272 3300005459 Bacteria 1251
338 Ga0070685_10000056 3300005466 Bacteria 68183
339 Ga0070685_10185584 3300005466 Bacteria 1342
340 Ga0070679_100035071 3300005530 Bacteria 4976
341 Ga0070679_100036988 3300005530 Bacteria 4846
342 Ga0070679_100046887 3300005530 Bacteria 4308
343 Ga0070679_100139319 3300005530 Bacteria 2406
344 Ga0070679_100181563 3300005530 Bacteria 2076
345 Ga0070679_100419492 3300005530 Bacteria 1284
346 Ga0070679_100545200 3300005530 Bacteria 1103
347 Ga0070679_100564692 3300005530 Bacteria 1081
348 Ga0070684_100080997 3300005535 Bacteria 2872
349 Ga0070684_100089976 3300005535 Bacteria 2728
350 Ga0070684_100411618 3300005535 Bacteria 1247
351 Ga0068853_100001253 3300005539 Bacteria 18134
352 Ga0068853_100001390 3300005539 Bacteria 17494
353 Ga0068853_100008536 3300005539 Bacteria 8235
354 Ga0068853_100032065 3300005539 Bacteria 4449
355 Ga0068853_100034610 3300005539 Bacteria 4288
356 Ga0068853_100041927 3300005539 Bacteria 3911
357 Ga0068853_100044210 3300005539 Bacteria 3812
358 Ga0068853_100095002 3300005539 Bacteria 2628
359 Ga0068853_100136236 3300005539 Bacteria 2201
360 Ga0068853_100168375 3300005539 Bacteria 1981
361 Ga0068853_100302858 3300005539 Bacteria 1478
362 Ga0068853_100353936 3300005539 Bacteria 1366
363 Ga0068853_100418229 3300005539 Bacteria 1257
364 Ga0068853_100574269 3300005539 Bacteria 1069
365 Ga0068853_100905068 3300005539 Bacteria 847
366 Ga0070672_100034757 3300005543 Bacteria 3827
367 Ga0070672_100052000 3300005543 Bacteria 3197
368 Ga0070672_100093351 3300005543 Bacteria 2431
369 Ga0070672_100322334 3300005543 Bacteria 1314
370 Ga0070672_100336119 3300005543 Bacteria 1285
371 Ga0070672_100524245 3300005543 Bacteria 1027
372 Ga0070672_100641005 3300005543 Bacteria 927
373 Ga0070686_100000002 3300005544 Bacteria 336303
374 Ga0070686_100030015 3300005544 Bacteria 3313
375 Ga0070686_100052566 3300005544 Bacteria 2598
376 Ga0070686_100339924 3300005544 Bacteria 1125
377 Ga0070695_100072948 3300005545 Bacteria 2252
378 Ga0070696_100125082 3300005546 Bacteria 1865
379 Ga0070696_100595710 3300005546 Bacteria 891
380 Ga0070696_100726468 3300005546 Bacteria 812
381 Ga0070693_100087267 3300005547 Bacteria 1873
382 Ga0070693_100158225 3300005547 Bacteria 1440
383 Ga0070693_100187534 3300005547 Bacteria 1335
384 Ga0070665_100000025 3300005548 Bacteria 367488
385 Ga0070665_100003898 3300005548 Bacteria 15768
386 Ga0070665_100004114 3300005548 Bacteria 15302
387 Ga0070665_100008348 3300005548 Bacteria 10477
388 Ga0070665_100014696 3300005548 Bacteria 7854
389 Ga0070665_100100753 3300005548 Bacteria 2893
390 Ga0070665_100244808 3300005548 Bacteria 1794
391 Ga0070665_100286359 3300005548 Bacteria 1650
392 Ga0070665_100999570 3300005548 Bacteria 849
393 Ga0070704_100375178 3300005549 Bacteria 1207
394 Ga0068855_100003124 3300005563 Bacteria 20269
395 Ga0068855_100005719 3300005563 Bacteria 15182
396 Ga0068855_100046618 3300005563 Bacteria 5123
397 Ga0068855_100098889 3300005563 Bacteria 3360
398 Ga0068855_100204747 3300005563 Bacteria 2220
399 Ga0068855_100225629 3300005563 Bacteria 2099
400 Ga0068855_100273721 3300005563 Bacteria 1877
401 Ga0068855_100315702 3300005563 Bacteria 1728
402 Ga0068855_100372072 3300005563 Bacteria 1570
403 Ga0068855_100386202 3300005563 Bacteria 1536
404 Ga0068855_100414184 3300005563 Bacteria 1475
405 Ga0068855_100633198 3300005563 Bacteria 1150
406 Ga0068855_100881370 3300005563 Bacteria 946
407 Ga0068855_100981388 3300005563 Bacteria 888
408 Ga0068855_101091374 3300005563 Bacteria 835
409 Ga0070664_100016140 3300005564 Bacteria 6120
410 Ga0070664_100022762 3300005564 Bacteria 5169
411 Ga0070664_100024836 3300005564 Bacteria 4963
412 Ga0070664_100026135 3300005564 Bacteria 4841
413 Ga0070664_100034407 3300005564 Bacteria 4250
414 Ga0070664_100042114 3300005564 Bacteria 3855
415 Ga0070664_100046135 3300005564 Bacteria 3680
416 Ga0070664_100051211 3300005564 Bacteria 3496
417 Ga0070664_100054109 3300005564 Bacteria 3405
418 Ga0070664_100055976 3300005564 Bacteria 3351
419 Ga0070664_100076181 3300005564 Bacteria 2882
420 Ga0070664_100079137 3300005564 Bacteria 2829
421 Ga0070664_100098785 3300005564 Bacteria 2536
422 Ga0070664_100128768 3300005564 Bacteria 2222
423 Ga0070664_100135308 3300005564 Bacteria 2167
424 Ga0070664_100254373 3300005564 Bacteria 1579
425 Ga0070664_100258121 3300005564 Bacteria 1568
426 Ga0070664_100412830 3300005564 Bacteria 1235
427 Ga0070664_100485328 3300005564 Bacteria 1137
428 Ga0068857_100000736 3300005577 Bacteria 24396
429 Ga0068857_100006657 3300005577 Bacteria 9929
430 Ga0068857_100015256 3300005577 Bacteria 6706
431 Ga0068857_100049513 3300005577 Bacteria 3727
432 Ga0068857_100067292 3300005577 Bacteria 3188
433 Ga0068857_100086426 3300005577 Bacteria 2804
434 Ga0068857_100102735 3300005577 Bacteria 2566
435 Ga0068857_100174580 3300005577 Bacteria 1954
436 Ga0068857_100181248 3300005577 Bacteria 1917
437 Ga0068857_100183849 3300005577 Bacteria 1902
438 Ga0068857_100255432 3300005577 Bacteria 1607
439 Ga0068857_100283080 3300005577 Bacteria 1525
440 Ga0068857_100512624 3300005577 Bacteria 1127
441 Ga0068854_100000306 3300005578 Bacteria 32300
442 Ga0068854_100001981 3300005578 Bacteria 12524
443 Ga0068854_100004380 3300005578 Bacteria 8905
444 Ga0068854_100005946 3300005578 Bacteria 7732
445 Ga0068854_100028745 3300005578 Bacteria 3844
446 Ga0068854_100050137 3300005578 Bacteria 2985
447 Ga0068854_100056103 3300005578 Bacteria 2838
448 Ga0068854_100108056 3300005578 Bacteria 2094
449 Ga0068854_100157827 3300005578 Bacteria 1754
450 Ga0068854_100176807 3300005578 Bacteria 1665
451 Ga0068854_100183145 3300005578 Bacteria 1637
452 Ga0068854_100193076 3300005578 Bacteria 1596
453 Ga0068854_100284143 3300005578 Bacteria 1333
454 Ga0068854_100286311 3300005578 Bacteria 1328
455 Ga0068854_100291170 3300005578 Bacteria 1318
456 Ga0068854_100300913 3300005578 Bacteria 1297
457 Ga0068854_100407423 3300005578 Bacteria 1126
458 Ga0068856_100007389 3300005614 Bacteria 10725
459 Ga0068856_100013594 3300005614 Bacteria 7878
460 Ga0068856_100038415 3300005614 Bacteria 4700
461 Ga0068856_100038930 3300005614 Bacteria 4668
462 Ga0068856_100041186 3300005614 Bacteria 4538
463 Ga0068856_100079590 3300005614 Bacteria 3250
464 Ga0068856_100103666 3300005614 Bacteria 2838
465 Ga0068856_100118846 3300005614 Bacteria 2644
466 Ga0068856_100135858 3300005614 Bacteria 2464
467 Ga0068856_100137688 3300005614 Bacteria 2447
468 Ga0068856_100241818 3300005614 Bacteria 1820
469 Ga0068856_100331344 3300005614 Bacteria 1540
470 Ga0068856_100338459 3300005614 Bacteria 1523
471 Ga0068856_100671866 3300005614 Bacteria 1056
472 Ga0068856_100705216 3300005614 Bacteria 1029
473 Ga0068856_101126795 3300005614 Bacteria 802
474 Ga0068856_101323769 3300005614 Bacteria 735
475 Ga0068856_101438005 3300005614 Bacteria 704
476 Ga0068852_100001648 3300005616 Bacteria 15244
477 Ga0068852_100010470 3300005616 Bacteria 6934
478 Ga0068852_100014770 3300005616 Bacteria 6028
479 Ga0068852_100016593 3300005616 Bacteria 5750
480 Ga0068852_100043248 3300005616 Bacteria 3819
481 Ga0068852_100044260 3300005616 Bacteria 3779
482 Ga0068852_100046086 3300005616 Bacteria 3713
483 Ga0068852_100054789 3300005616 Bacteria 3439
484 Ga0068852_100061149 3300005616 Bacteria 3272
485 Ga0068852_100081898 3300005616 Bacteria 2866
486 Ga0068852_100194808 3300005616 Bacteria 1914
487 Ga0068852_100232945 3300005616 Bacteria 1756
488 Ga0068852_100235773 3300005616 Bacteria 1746
489 Ga0068852_100256428 3300005616 Bacteria 1677
490 Ga0068852_100257697 3300005616 Bacteria 1674
491 Ga0068852_100458313 3300005616 Bacteria 1263
492 Ga0068852_100465834 3300005616 Bacteria 1253
493 Ga0068852_100475867 3300005616 Bacteria 1240
494 Ga0068852_100508471 3300005616 Bacteria 1200
495 Ga0068852_100545318 3300005616 Bacteria 1159
496 Ga0068852_101093148 3300005616 Bacteria 817
497 Ga0068859_100000689 3300005617 Bacteria 33880
498 Ga0068859_100001164 3300005617 Bacteria 26886
499 Ga0068859_100002480 3300005617 Bacteria 18766
500 Ga0068859_100032129 3300005617 Bacteria 5272
501 Ga0068859_100046919 3300005617 Bacteria 4338
502 Ga0068859_100109007 3300005617 Bacteria 2830
503 Ga0068859_100161272 3300005617 Bacteria 2321
504 Ga0068859_100407607 3300005617 Bacteria 1455
505 Ga0068859_100428816 3300005617 Bacteria 1419
506 Ga0068859_100648769 3300005617 Bacteria 1148
507 Ga0068859_101087852 3300005617 Bacteria 879
508 Ga0068864_100000764 3300005618 Bacteria 27049
509 Ga0068864_100001152 3300005618 Bacteria 21995
510 Ga0068864_100004561 3300005618 Bacteria 11373
511 Ga0068864_100007092 3300005618 Bacteria 9202
512 Ga0068864_100041416 3300005618 Bacteria 3939
513 Ga0068864_100065993 3300005618 Bacteria 3140
514 Ga0068864_100076147 3300005618 Bacteria 2931
515 Ga0068864_100114253 3300005618 Bacteria 2407
516 Ga0068864_100123463 3300005618 Bacteria 2318
517 Ga0068864_100295414 3300005618 Bacteria 1515
518 Ga0068866_10031178 3300005718 Bacteria 2565
519 Ga0068866_10129524 3300005718 Bacteria 1433
520 Ga0068866_10326062 3300005718 Bacteria 968
521 Ga0068861_100000005 3300005719 Bacteria 101677
522 Ga0068861_100003714 3300005719 Bacteria 10185
523 Ga0068861_100087199 3300005719 Bacteria 2456
524 Ga0068861_100123824 3300005719 Bacteria 2089
525 Ga0068861_100576059 3300005719 Bacteria 1029
526 Ga0068861_100876984 3300005719 Bacteria 848
527 Ga0068851_10001992 3300005834 Bacteria 8993
528 Ga0068851_10006539 3300005834 Bacteria 5324
529 Ga0068851_10012700 3300005834 Bacteria 3976
530 Ga0068851_10016068 3300005834 Bacteria 3576
531 Ga0068851_10017185 3300005834 Bacteria 3470
532 Ga0068851_10060597 3300005834 Bacteria 1938
533 Ga0068851_10079544 3300005834 Bacteria 1710
534 Ga0068870_10062275 3300005840 Bacteria 2009
535 Ga0068870_10317466 3300005840 Bacteria 989
536 Ga0068863_100000070 3300005841 Bacteria 115715
537 Ga0068863_100003743 3300005841 Bacteria 15048
538 Ga0068863_100009132 3300005841 Bacteria 9682
539 Ga0068863_100012748 3300005841 Bacteria 8107
540 Ga0068863_100020017 3300005841 Bacteria 6400
541 Ga0068863_100031670 3300005841 Bacteria 5046
542 Ga0068858_100000956 3300005842 Bacteria 29895
543 Ga0068858_100005166 3300005842 Bacteria 12785
544 Ga0068858_100006215 3300005842 Bacteria 11641
545 Ga0068858_100008940 3300005842 Bacteria 9601
546 Ga0068858_100031031 3300005842 Bacteria 4963
547 Ga0068858_100039796 3300005842 Bacteria 4358
548 Ga0068858_100111521 3300005842 Bacteria 2555
549 Ga0068858_100137772 3300005842 Bacteria 2291
550 Ga0068858_100516657 3300005842 Bacteria 1155
551 Ga0068860_100000001 3300005843 Bacteria 703043
552 Ga0068860_100006578 3300005843 Bacteria 11669
553 Ga0068860_100124167 3300005843 Bacteria 2474
554 Ga0068860_100201974 3300005843 Bacteria 1926
555 Ga0068860_100204294 3300005843 Bacteria 1915
556 Ga0068860_100214794 3300005843 Bacteria 1866
557 Ga0068860_100236066 3300005843 Bacteria 1778
558 Ga0068862_100000020 3300005844 Bacteria 219516
559 Ga0068862_100000702 3300005844 Bacteria 34174
560 Ga0068862_100001089 3300005844 Bacteria 25856
561 Ga0068862_100005835 3300005844 Bacteria 10261
562 Ga0068862_100824275 3300005844 Bacteria 907
563 Ga0081455_10000477 3300005937 Bacteria 51914
564 Ga0081540_1078141 3300005983 Bacteria 1501
565 Ga0081539_10008339 3300005985 Bacteria 9056
566 Ga0081539_10040401 3300005985 Bacteria 2738
567 Ga0081539_10063450 3300005985 Bacteria 2016
568 Ga0081539_10120854 3300005985 Bacteria 1301
569 Ga0070717_10010182 3300006028 Bacteria 7080
570 Ga0075368_10000465 3300006042 Bacteria 12005
571 Ga0075364_10191074 3300006051 Bacteria 1387
572 Ga0070716_100207191 3300006173 Bacteria 1308
573 Ga0070712_100284140 3300006175 Bacteria 1334
574 Ga0075367_10000528 3300006178 Bacteria 14436
575 Ga0075366_10007416 3300006195 Bacteria 6058
576 Ga0097621_100001363 3300006237 Bacteria 16799
577 Ga0097621_100014112 3300006237 Bacteria 5972
578 Ga0097621_100036110 3300006237 Bacteria 3953
579 Ga0097621_100072455 3300006237 Bacteria 2849
580 Ga0097621_100077246 3300006237 Bacteria 2764
581 Ga0097621_100628490 3300006237 Bacteria 983
582 Ga0075370_10035118 3300006353 Bacteria 2813
583 Ga0075370_10133409 3300006353 Bacteria 1450
584 Ga0068871_100004771 3300006358 Bacteria 9480
585 Ga0068871_100008587 3300006358 Bacteria 7343
586 Ga0068871_100196745 3300006358 Bacteria 1739
587 Ga0068871_100624407 3300006358 Bacteria 982
588 Ga0068871_100679875 3300006358 Bacteria 942
589 Ga0068871_100868813 3300006358 Bacteria 835
590 Ga0068865_100000004 3300006881 Bacteria 226236
591 Ga0068865_100014339 3300006881 Bacteria 5035
592 Ga0068865_100240340 3300006881 Bacteria 1425
593 Ga0068865_100382932 3300006881 Bacteria 1148
594 Ga0068865_100734278 3300006881 Bacteria 847
595 Ga0097620_100000689 3300006931 Bacteria 33880
596 Ga0097620_100001164 3300006931 Bacteria 26886
597 Ga0097620_100002480 3300006931 Bacteria 18766
598 Ga0097620_100032131 3300006931 Bacteria 5272
599 Ga0097620_100046919 3300006931 Bacteria 4338
600 Ga0097620_100109006 3300006931 Bacteria 2830
601 Ga0097620_100161278 3300006931 Bacteria 2321
602 Ga0097620_100407613 3300006931 Bacteria 1455
603 Ga0097620_100428767 3300006931 Bacteria 1419
604 Ga0097620_100648752 3300006931 Bacteria 1148
605 Ga0097620_101087752 3300006931 Bacteria 879
606 Ga0105251_10014991 3300009011 Bacteria 4253
607 Ga0105250_10014249 3300009092 Bacteria 3270
608 Ga0105250_10057796 3300009092 Bacteria 1556
609 Ga0105240_10004392 3300009093 Bacteria 21521
610 Ga0105240_10012494 3300009093 Bacteria 11718
611 Ga0105240_10016200 3300009093 Bacteria 10102
612 Ga0105240_10033235 3300009093 Bacteria 6668
613 Ga0105240_10168669 3300009093 Bacteria 2594
614 Ga0105240_10321673 3300009093 Bacteria 1763
615 Ga0105240_10332249 3300009093 Bacteria 1729
616 Ga0105240_10588465 3300009093 Bacteria 1227
617 Ga0105240_10854143 3300009093 Bacteria 982
618 Ga0105245_10000195 3300009098 Bacteria 57594
619 Ga0105245_10000275 3300009098 Bacteria 48749
620 Ga0105245_10026400 3300009098 Bacteria 5112
621 Ga0105247_10005531 3300009101 Bacteria 7948
622 Ga0114129_10214530 3300009147 Bacteria 2600
623 Ga0105243_10000146 3300009148 Bacteria 81008
624 Ga0105243_10000164 3300009148 Bacteria 75666
625 Ga0105243_10215368 3300009148 Bacteria 1694
626 Ga0105243_10270691 3300009148 Bacteria 1525
627 Ga0105243_10349110 3300009148 Bacteria 1358
628 Ga0105243_10358991 3300009148 Bacteria 1340
629 Ga0105241_10047496 3300009174 Bacteria 3265
630 Ga0105241_10076161 3300009174 Bacteria 2615
631 Ga0105241_10233554 3300009174 Bacteria 1551
632 Ga0105241_10305373 3300009174 Bacteria 1367
633 Ga0105241_10359582 3300009174 Bacteria 1266
634 Ga0105241_11135356 3300009174 Bacteria 737
635 Ga0105242_10000943 3300009176 Bacteria 22683
636 Ga0105242_10173450 3300009176 Bacteria 1897
637 Ga0105242_10750569 3300009176 Bacteria 960
638 Ga0105248_10002856 3300009177 Bacteria 19172
639 Ga0105248_10003607 3300009177 Bacteria 17159
640 Ga0105248_10012759 3300009177 Bacteria 9269
641 Ga0105248_10018539 3300009177 Bacteria 7693
642 Ga0105248_10023059 3300009177 Bacteria 6913
643 Ga0105248_10253631 3300009177 Bacteria 1980
644 Ga0105248_10350942 3300009177 Bacteria 1661
645 Ga0105248_10358555 3300009177 Bacteria 1641
646 Ga0105248_10733694 3300009177 Bacteria 1115
647 Ga0105237_10015881 3300009545 Bacteria 7829
648 Ga0105237_10018056 3300009545 Bacteria 7306
649 Ga0105237_10019254 3300009545 Bacteria 7050
650 Ga0105237_10027667 3300009545 Bacteria 5782
651 Ga0105237_10057560 3300009545 Bacteria 3890
652 Ga0105237_10194946 3300009545 Bacteria 2025
653 Ga0105237_10410907 3300009545 Bacteria 1358
654 Ga0105237_10621132 3300009545 Bacteria 1087
655 Ga0105238_10030198 3300009551 Bacteria 5515
656 Ga0105238_10032364 3300009551 Bacteria 5321
657 Ga0105238_10032773 3300009551 Bacteria 5287
658 Ga0105238_10148934 3300009551 Bacteria 2316
659 Ga0105238_10302540 3300009551 Bacteria 1583
660 Ga0105238_10361224 3300009551 Bacteria 1442
661 Ga0105238_10521334 3300009551 Bacteria 1191
662 Ga0105238_10546078 3300009551 Bacteria 1163
663 Ga0105249_10000005 3300009553 Bacteria 362467
664 Ga0105249_10000097 3300009553 Bacteria 120886
665 Ga0105249_10019285 3300009553 Bacteria 6082
666 Ga0105249_10028412 3300009553 Bacteria 5048
667 Ga0105249_10053425 3300009553 Bacteria 3693
668 Ga0105249_10061804 3300009553 Bacteria 3437
669 Ga0105249_10432012 3300009553 Bacteria 1353
670 Ga0105249_10491226 3300009553 Bacteria 1271
671 Ga0105249_10580497 3300009553 Bacteria 1174
672 Ga0105249_10903603 3300009553 Bacteria 950
673 Ga0105249_11132944 3300009553 Bacteria 853
674 Ga0105249_11379244 3300009553 Bacteria 777
675 Ga0105239_10000104 3300010375 Bacteria 117927
676 Ga0105239_10055897 3300010375 Bacteria 4330
677 Ga0105239_10145471 3300010375 Bacteria 2643
678 Ga0105239_10214248 3300010375 Bacteria 2159
679 Ga0105239_10474092 3300010375 Bacteria 1421
680 Ga0105239_10897375 3300010375 Bacteria 1017
681 Ga0105239_10908296 3300010375 Bacteria 1011
682 Ga0105239_10926436 3300010375 Bacteria 1000
683 Ga0105246_10004302 3300011119 Bacteria 8660
684 Ga0105246_10151641 3300011119 Bacteria 1755
685 Ga0105246_10255540 3300011119 Bacteria 1393
686 Ga0105246_10421353 3300011119 Bacteria 1114
687 Ga0105246_10622155 3300011119 Bacteria 936
688 Ga0157317_1000906 3300012475 Bacteria 1464
689 Ga0157327_1008778 3300012512 Bacteria 914
690 Ga0157373_10026426 3300013100 Bacteria 4193
691 Ga0157373_10039540 3300013100 Bacteria 3377
692 Ga0157373_10085128 3300013100 Bacteria 2228
693 Ga0157373_10091018 3300013100 Bacteria 2148
694 Ga0157373_10091080 3300013100 Bacteria 2147
695 Ga0157373_10158216 3300013100 Bacteria 1594
696 Ga0157373_10167203 3300013100 Bacteria 1548
697 Ga0157373_10167384 3300013100 Bacteria 1547
698 Ga0157373_10177754 3300013100 Bacteria 1498
699 Ga0157373_10203758 3300013100 Bacteria 1395
700 Ga0157373_10248363 3300013100 Bacteria 1258
701 Ga0157373_10380692 3300013100 Bacteria 1009
702 Ga0157371_10000637 3300013102 Bacteria 41589
703 Ga0157371_10033519 3300013102 Bacteria 3689
704 Ga0157371_10042412 3300013102 Bacteria 3243
705 Ga0157371_10044078 3300013102 Bacteria 3178
706 Ga0157371_10044196 3300013102 Bacteria 3172
707 Ga0157371_10054017 3300013102 Bacteria 2853
708 Ga0157371_10076807 3300013102 Bacteria 2365
709 Ga0157371_10084425 3300013102 Bacteria 2249
710 Ga0157371_10110729 3300013102 Bacteria 1949
711 Ga0157371_10305919 3300013102 Bacteria 1151
712 Ga0157371_10311198 3300013102 Bacteria 1141
713 Ga0157371_10688070 3300013102 Bacteria 765
714 Ga0157370_10004829 3300013104 Bacteria 15324
715 Ga0157370_10011178 3300013104 Bacteria 9413
716 Ga0157370_10049711 3300013104 Bacteria 4012
717 Ga0157370_10069321 3300013104 Bacteria 3331
718 Ga0157370_10072786 3300013104 Bacteria 3242
719 Ga0157370_10185576 3300013104 Bacteria 1931
720 Ga0157370_10517719 3300013104 Bacteria 1095
721 Ga0157370_10668379 3300013104 Bacteria 949
722 Ga0157370_10685037 3300013104 Bacteria 936
723 Ga0157369_10008501 3300013105 Bacteria 11771
724 Ga0157369_10018433 3300013105 Bacteria 7826
725 Ga0157369_10037284 3300013105 Bacteria 5322
726 Ga0157369_10081998 3300013105 Bacteria 3451
727 Ga0157369_10090703 3300013105 Bacteria 3263
728 Ga0157369_10178401 3300013105 Bacteria 2236
729 Ga0157369_10182533 3300013105 Bacteria 2207
730 Ga0157369_10223249 3300013105 Bacteria 1971
731 Ga0157369_10231357 3300013105 Bacteria 1932
732 Ga0157369_10313222 3300013105 Bacteria 1632
733 Ga0157369_10354454 3300013105 Bacteria 1524
734 Ga0157369_10484221 3300013105 Bacteria 1280
735 Ga0157369_10525148 3300013105 Bacteria 1224
736 Ga0157369_10640820 3300013105 Bacteria 1096
737 Ga0157369_10737342 3300013105 Bacteria 1014
738 Ga0157369_10899987 3300013105 Bacteria 907
739 Ga0157374_10001738 3300013296 Bacteria 18262
740 Ga0157374_10006891 3300013296 Bacteria 9668
741 Ga0157374_10007945 3300013296 Bacteria 9061
742 Ga0157374_10040849 3300013296 Bacteria 4273
743 Ga0157374_10092230 3300013296 Bacteria 2890
744 Ga0157374_10352727 3300013296 Bacteria 1462
745 Ga0157374_11010713 3300013296 Bacteria 851
746 Ga0157378_10000408 3300013297 Bacteria 42491
747 Ga0157378_10026677 3300013297 Bacteria 5092
748 Ga0157378_10106061 3300013297 Bacteria 2570
749 Ga0157378_10330333 3300013297 Bacteria 1484
750 Ga0163162_10017714 3300013306 Bacteria 6970
751 Ga0163162_10076882 3300013306 Bacteria 3401
752 Ga0163162_10156896 3300013306 Bacteria 2396
753 Ga0163162_10188736 3300013306 Bacteria 2188
754 Ga0163162_10213629 3300013306 Bacteria 2059
755 Ga0163162_11237229 3300013306 Bacteria 848
756 Ga0157372_10010467 3300013307 Bacteria 9871
757 Ga0157372_10068515 3300013307 Bacteria 3989
758 Ga0157372_10077873 3300013307 Bacteria 3746
759 Ga0157372_10088501 3300013307 Bacteria 3516
760 Ga0157372_10162368 3300013307 Bacteria 2582
761 Ga0157372_10186145 3300013307 Bacteria 2405
762 Ga0157372_10276877 3300013307 Bacteria 1951
763 Ga0157372_10367222 3300013307 Bacteria 1677
764 Ga0157372_10386951 3300013307 Bacteria 1629
765 Ga0157372_10434655 3300013307 Bacteria 1530
766 Ga0157372_10490966 3300013307 Bacteria 1432
767 Ga0157372_10668220 3300013307 Bacteria 1210
768 Ga0157372_10718543 3300013307 Bacteria 1162
769 Ga0157372_11134075 3300013307 Bacteria 904
770 Ga0157372_11285225 3300013307 Bacteria 844
771 Ga0157375_10005342 3300013308 Bacteria 11162
772 Ga0157375_10022053 3300013308 Bacteria 5856
773 Ga0157375_10035812 3300013308 Bacteria 4742
774 Ga0157375_10061117 3300013308 Bacteria 3739
775 Ga0157375_10569314 3300013308 Bacteria 1294
776 Ga0157375_10769756 3300013308 Bacteria 1113
777 Ga0157375_11851690 3300013308 Bacteria 716
778 Ga0163163_10000500 3300014325 Bacteria 35255
779 Ga0163163_10060897 3300014325 Bacteria 3739
780 Ga0163163_10380871 3300014325 Bacteria 1468
781 Ga0157380_10000280 3300014326 Bacteria 30637
782 Ga0157380_10001415 3300014326 Bacteria 15694
783 Ga0157380_10145536 3300014326 Bacteria 2042
784 Ga0157380_10766690 3300014326 Bacteria 978
785 Ga0157380_10983633 3300014326 Bacteria 876
786 Ga0182008_10064342 3300014497 Bacteria 1806
787 Ga0157377_10001666 3300014745 Bacteria 9679
788 Ga0157377_10039898 3300014745 Bacteria 2598
789 Ga0157377_10137769 3300014745 Bacteria 1497
790 Ga0157377_10389368 3300014745 Bacteria 946
791 Ga0157377_10573703 3300014745 Bacteria 800
792 Ga0157379_10010704 3300014968 Bacteria 7993
793 Ga0157379_10034850 3300014968 Bacteria 4488
794 Ga0157379_10050088 3300014968 Bacteria 3728
795 Ga0157379_10082736 3300014968 Bacteria 2876
796 Ga0157379_10108244 3300014968 Bacteria 2495
797 Ga0157379_10319316 3300014968 Bacteria 1418
798 Ga0157376_10000128 3300014969 Bacteria 52246
799 Ga0157376_10004672 3300014969 Bacteria 9548
800 Ga0183363_1001 3300015690 Bacteria 611534
801 Ga0163161_10002791 3300017792 Bacteria 12382
802 Ga0163161_10064295 3300017792 Bacteria 2676
803 Ga0163161_10228675 3300017792 Bacteria 1443
804 Ga0163161_10333951 3300017792 Bacteria 1201
805 Ga0197907_10628569 3300020069 Bacteria 930
806 Ga0206355_1265600 3300020076 Bacteria 671
807 Ga0206355_1403083 3300020076 Bacteria 1340
808 Ga0206351_10532014 3300020077 Bacteria 660
809 Ga0206354_10542035 3300020081 Bacteria 882
810 Ga0213875_10000897 3300021388 Bacteria 21712
811 Ga0224712_10073116 3300022467 Bacteria 1398
812 Ga0207672_1000695 3300025223 Bacteria 3853
813 Ga0209674_105486 3300025226 Bacteria 1866
814 Ga0209147_100569 3300025229 Bacteria 20626
815 Ga0209563_100019 3300025230 Bacteria 697828
816 Ga0207427_100922 3300025231 Bacteria 12594
817 Ga0207425_1000022 3300025245 Bacteria 355305
818 Ga0207425_1003889 3300025245 Bacteria 4637
819 Ga0209646_1003961 3300025246 Bacteria 2793
820 Ga0209026_1001085 3300025250 Bacteria 13075
821 Ga0209026_1013778 3300025250 Bacteria 1366
822 Ga0209148_1000026 3300025254 Bacteria 629213
823 Ga0209148_1000116 3300025254 Bacteria 190078
824 Ga0209148_1004852 3300025254 Bacteria 3201
825 Ga0209129_1000525 3300025258 Bacteria 26784
826 Ga0209233_1000098 3300025261 Bacteria 294111
827 Ga0209233_1000119 3300025261 Bacteria 235924
828 Ga0209565_1000010 3300025263 Bacteria 687724
829 Ga0209565_1000100 3300025263 Bacteria 130380
830 Ga0207666_1016789 3300025271 Bacteria 1052
831 Ga0209455_1000005 3300025272 Bacteria 1416756
832 Ga0209455_1000767 3300025272 Bacteria 18024
833 Ga0209455_1034396 3300025272 Bacteria 824
834 Ga0209673_1011463 3300025273 Bacteria 3653
835 Ga0209673_1019761 3300025273 Bacteria 2408
836 Ga0209676_1009533 3300025292 Bacteria 4178
837 Ga0209025_1000842 3300025294 Bacteria 48558
838 Ga0209564_1003336 3300025295 Bacteria 11147
839 Ga0209564_1018267 3300025295 Bacteria 2683
840 Ga0209564_1028366 3300025295 Bacteria 1792
841 Ga0209758_1000001 3300025297 Bacteria 1981790
842 Ga0209758_1000004 3300025297 Bacteria 1375322
843 Ga0209758_1011966 3300025297 Bacteria 4932
844 Ga0209758_1012371 3300025297 Bacteria 4785
845 Ga0209050_1000001 3300025298 Bacteria 3563507
846 Ga0209050_1000026 3300025298 Bacteria 499134
847 Ga0209050_1011009 3300025298 Bacteria 4361
848 Ga0209050_1022005 3300025298 Bacteria 2300
849 Ga0209256_1000010 3300025299 Bacteria 912110
850 Ga0207426_1060445 3300025302 Bacteria 1092
851 Ga0207426_1065511 3300025302 Bacteria 1030
852 Ga0209051_1000279 3300025303 Bacteria 83677
853 Ga0209257_1000009 3300025304 Bacteria 1205047
854 Ga0209257_1004523 3300025304 Bacteria 10682
855 Ga0209257_1018759 3300025304 Bacteria 2641
856 Ga0207697_10002366 3300025315 Bacteria 9823
857 Ga0207697_10012951 3300025315 Bacteria 3485
858 Ga0207697_10037553 3300025315 Bacteria 1984
859 Ga0207697_10058229 3300025315 Bacteria 1605
860 Ga0207656_10005833 3300025321 Bacteria 4386
861 Ga0207656_10014997 3300025321 Bacteria 2995
862 Ga0207656_10016553 3300025321 Bacteria 2872
863 Ga0207656_10020509 3300025321 Bacteria 2628
864 Ga0207656_10029158 3300025321 Bacteria 2270
865 Ga0207656_10034120 3300025321 Bacteria 2123
866 Ga0207656_10051737 3300025321 Bacteria 1777
867 Ga0207656_10106117 3300025321 Bacteria 1293
868 Ga0207656_10215258 3300025321 Bacteria 932
869 Ga0207696_1011929 3300025711 Bacteria 3101
870 Ga0207713_1030060 3300025735 Bacteria 2422
871 Ga0207682_10000417 3300025893 Bacteria 19557
872 Ga0207682_10032814 3300025893 Bacteria 2088
873 Ga0207692_10157007 3300025898 Bacteria 1308
874 Ga0207642_10055169 3300025899 Bacteria 1816
875 Ga0207642_10063806 3300025899 Bacteria 1724
876 Ga0207642_10193416 3300025899 Bacteria 1118
877 Ga0207710_10012743 3300025900 Bacteria 3540
878 Ga0207688_10011182 3300025901 Bacteria 4888
879 Ga0207688_10043874 3300025901 Bacteria 2491
880 Ga0207688_10103714 3300025901 Bacteria 1645
881 Ga0207688_10187341 3300025901 Bacteria 1236
882 Ga0207680_10000004 3300025903 Bacteria 827324
883 Ga0207680_10000793 3300025903 Bacteria 14887
884 Ga0207680_10002831 3300025903 Bacteria 8130
885 Ga0207680_10006622 3300025903 Bacteria 5619
886 Ga0207680_10022044 3300025903 Bacteria 3458
887 Ga0207680_10132330 3300025903 Bacteria 1645
888 Ga0207680_10292015 3300025903 Bacteria 1135
889 Ga0207680_10501621 3300025903 Bacteria 864
890 Ga0207647_10000450 3300025904 Bacteria 33415
891 Ga0207647_10001366 3300025904 Bacteria 18757
892 Ga0207647_10001428 3300025904 Bacteria 18307
893 Ga0207647_10001605 3300025904 Bacteria 17381
894 Ga0207647_10004391 3300025904 Bacteria 10461
895 Ga0207647_10005058 3300025904 Bacteria 9723
896 Ga0207647_10021214 3300025904 Bacteria 4339
897 Ga0207647_10080102 3300025904 Bacteria 1959
898 Ga0207647_10104293 3300025904 Bacteria 1680
899 Ga0207647_10121437 3300025904 Bacteria 1540
900 Ga0207647_10136520 3300025904 Bacteria 1439
901 Ga0207647_10139122 3300025904 Bacteria 1423
902 Ga0207647_10316852 3300025904 Bacteria 886
903 Ga0207645_10003385 3300025907 Bacteria 12121
904 Ga0207645_10006329 3300025907 Bacteria 8512
905 Ga0207645_10013619 3300025907 Bacteria 5473
906 Ga0207645_10020146 3300025907 Bacteria 4367
907 Ga0207645_10069037 3300025907 Bacteria 2261
908 Ga0207645_10110518 3300025907 Bacteria 1779
909 Ga0207645_10147536 3300025907 Bacteria 1534
910 Ga0207643_10327096 3300025908 Bacteria 958
911 Ga0207705_10004442 3300025909 Bacteria 10601
912 Ga0207705_10004859 3300025909 Bacteria 10090
913 Ga0207705_10005992 3300025909 Bacteria 9047
914 Ga0207705_10012595 3300025909 Bacteria 6105
915 Ga0207705_10012814 3300025909 Bacteria 6054
916 Ga0207705_10015325 3300025909 Bacteria 5501
917 Ga0207705_10016836 3300025909 Bacteria 5235
918 Ga0207705_10028578 3300025909 Bacteria 3975
919 Ga0207705_10062830 3300025909 Bacteria 2683
920 Ga0207705_10082172 3300025909 Bacteria 2349
921 Ga0207705_10092046 3300025909 Bacteria 2221
922 Ga0207705_10167823 3300025909 Bacteria 1652
923 Ga0207705_10198291 3300025909 Bacteria 1520
924 Ga0207705_10208165 3300025909 Bacteria 1483
925 Ga0207705_10240335 3300025909 Bacteria 1379
926 Ga0207705_10246870 3300025909 Bacteria 1361
927 Ga0207705_10258245 3300025909 Bacteria 1330
928 Ga0207705_10286219 3300025909 Bacteria 1262
929 Ga0207705_10413344 3300025909 Bacteria 1044
930 Ga0207705_10533777 3300025909 Bacteria 912
931 Ga0207654_10002603 3300025911 Bacteria 9152
932 Ga0207654_10015435 3300025911 Bacteria 3965
933 Ga0207707_10017099 3300025912 Bacteria 6320
934 Ga0207707_10043923 3300025912 Bacteria 3897
935 Ga0207707_10075837 3300025912 Bacteria 2934
936 Ga0207707_10280179 3300025912 Bacteria 1444
937 Ga0207707_10281123 3300025912 Bacteria 1442
938 Ga0207707_10314569 3300025912 Bacteria 1353
939 Ga0207707_10566755 3300025912 Bacteria 964
940 Ga0207707_10746584 3300025912 Bacteria 819
941 Ga0207695_10010505 3300025913 Bacteria 11324
942 Ga0207695_10017424 3300025913 Bacteria 8360
943 Ga0207695_10025246 3300025913 Bacteria 6657
944 Ga0207695_10065915 3300025913 Bacteria 3721
945 Ga0207695_10066126 3300025913 Bacteria 3715
946 Ga0207695_10165792 3300025913 Bacteria 2138
947 Ga0207695_10172618 3300025913 Bacteria 2087
948 Ga0207695_10414308 3300025913 Bacteria 1232
949 Ga0207695_10484053 3300025913 Bacteria 1120
950 Ga0207671_10001601 3300025914 Bacteria 25733
951 Ga0207671_10001907 3300025914 Bacteria 23137
952 Ga0207671_10012401 3300025914 Bacteria 6856
953 Ga0207671_10026831 3300025914 Bacteria 4310
954 Ga0207671_10109655 3300025914 Bacteria 2099
955 Ga0207671_10137492 3300025914 Bacteria 1880
956 Ga0207671_10166107 3300025914 Bacteria 1711
957 Ga0207693_10025397 3300025915 Bacteria 4698
958 Ga0207693_10281847 3300025915 Bacteria 1302
959 Ga0207663_10117300 3300025916 Bacteria 1816
960 Ga0207660_10000036 3300025917 Bacteria 65280
961 Ga0207660_10017439 3300025917 Bacteria 4771
962 Ga0207660_10090677 3300025917 Bacteria 2265
963 Ga0207660_10109095 3300025917 Bacteria 2080
964 Ga0207660_10127011 3300025917 Bacteria 1937
965 Ga0207660_10132255 3300025917 Bacteria 1900
966 Ga0207660_10146102 3300025917 Bacteria 1812
967 Ga0207660_10171320 3300025917 Bacteria 1680
968 Ga0207660_10255822 3300025917 Bacteria 1383
969 Ga0207660_10641789 3300025917 Bacteria 865
970 Ga0207660_10766184 3300025917 Bacteria 788
971 Ga0207657_10001825 3300025919 Bacteria 22973
972 Ga0207657_10003125 3300025919 Bacteria 17705
973 Ga0207657_10003140 3300025919 Bacteria 17670
974 Ga0207657_10006548 3300025919 Bacteria 12060
975 Ga0207657_10009031 3300025919 Bacteria 10066
976 Ga0207657_10009948 3300025919 Bacteria 9517
977 Ga0207657_10015454 3300025919 Bacteria 7395
978 Ga0207657_10020873 3300025919 Bacteria 6181
979 Ga0207657_10021840 3300025919 Bacteria 6011
980 Ga0207657_10023414 3300025919 Bacteria 5751
981 Ga0207657_10028619 3300025919 Bacteria 5080
982 Ga0207657_10029076 3300025919 Bacteria 5036
983 Ga0207657_10034505 3300025919 Bacteria 4548
984 Ga0207657_10036123 3300025919 Bacteria 4425
985 Ga0207657_10036409 3300025919 Bacteria 4405
986 Ga0207657_10054959 3300025919 Bacteria 3441
987 Ga0207657_10055505 3300025919 Bacteria 3421
988 Ga0207657_10069195 3300025919 Bacteria 2996
989 Ga0207657_10111534 3300025919 Bacteria 2258
990 Ga0207657_10112650 3300025919 Bacteria 2245
991 Ga0207657_10125891 3300025919 Bacteria 2104
992 Ga0207657_10152566 3300025919 Bacteria 1881
993 Ga0207657_10288960 3300025919 Bacteria 1300
994 Ga0207657_10325416 3300025919 Bacteria 1215
995 Ga0207657_10337786 3300025919 Bacteria 1189
996 Ga0207657_10421043 3300025919 Bacteria 1050
997 Ga0207657_10458634 3300025919 Bacteria 1000
998 Ga0207657_10562663 3300025919 Bacteria 891
999 Ga0207657_10634173 3300025919 Bacteria 832
1000 Ga0207649_10002156 3300025920 Bacteria 11134
1001 Ga0207649_10023188 3300025920 Bacteria 3592
1002 Ga0207649_10028053 3300025920 Bacteria 3311
1003 Ga0207649_10030980 3300025920 Bacteria 3174
1004 Ga0207649_10032642 3300025920 Bacteria 3105
1005 Ga0207649_10039151 3300025920 Bacteria 2872
1006 Ga0207649_10076629 3300025920 Bacteria 2152
1007 Ga0207649_10156205 3300025920 Bacteria 1576
1008 Ga0207649_10158723 3300025920 Bacteria 1565
1009 Ga0207649_10204995 3300025920 Bacteria 1395
1010 Ga0207649_10220816 3300025920 Bacteria 1350
1011 Ga0207649_10386137 3300025920 Bacteria 1045
1012 Ga0207649_10409089 3300025920 Bacteria 1017
1013 Ga0207649_10523493 3300025920 Bacteria 904
1014 Ga0207652_10031855 3300025921 Bacteria 4428
1015 Ga0207652_10062022 3300025921 Bacteria 3230
1016 Ga0207652_10075635 3300025921 Bacteria 2935
1017 Ga0207652_10080614 3300025921 Bacteria 2846
1018 Ga0207652_10220681 3300025921 Bacteria 1708
1019 Ga0207652_10277269 3300025921 Bacteria 1512
1020 Ga0207652_10326654 3300025921 Bacteria 1385
1021 Ga0207681_10000130 3300025923 Bacteria 61067
1022 Ga0207681_10325509 3300025923 Bacteria 1223
1023 Ga0207681_10355686 3300025923 Bacteria 1173
1024 Ga0207694_10003169 3300025924 Bacteria 13128
1025 Ga0207694_10003700 3300025924 Bacteria 12110
1026 Ga0207694_10020155 3300025924 Bacteria 5043
1027 Ga0207694_10037544 3300025924 Bacteria 3721
1028 Ga0207694_10071926 3300025924 Bacteria 2703
1029 Ga0207694_10089680 3300025924 Bacteria 2425
1030 Ga0207694_10099374 3300025924 Bacteria 2305
1031 Ga0207694_10105007 3300025924 Bacteria 2242
1032 Ga0207694_10132697 3300025924 Bacteria 1997
1033 Ga0207694_10276387 3300025924 Bacteria 1379
1034 Ga0207694_10595180 3300025924 Bacteria 930
1035 Ga0207694_10735119 3300025924 Bacteria 833
1036 Ga0207650_10036184 3300025925 Bacteria 3589
1037 Ga0207650_10052383 3300025925 Bacteria 3023
1038 Ga0207650_10116445 3300025925 Bacteria 2075
1039 Ga0207650_10199728 3300025925 Bacteria 1601
1040 Ga0207659_10076509 3300025926 Bacteria 2460
1041 Ga0207659_10449437 3300025926 Bacteria 1085
1042 Ga0207687_10003292 3300025927 Bacteria 10928
1043 Ga0207687_10010252 3300025927 Bacteria 6121
1044 Ga0207687_10058695 3300025927 Bacteria 2708
1045 Ga0207700_10113161 3300025928 Bacteria 2188
1046 Ga0207700_10175388 3300025928 Bacteria 1791
1047 Ga0207700_10933996 3300025928 Bacteria 776
1048 Ga0207664_10046964 3300025929 Bacteria 3390
1049 Ga0207664_10132594 3300025929 Bacteria 2099
1050 Ga0207664_10174266 3300025929 Bacteria 1843
1051 Ga0207664_10209192 3300025929 Bacteria 1687
1052 Ga0207664_10418532 3300025929 Bacteria 1193
1053 Ga0207644_10000363 3300025931 Bacteria 29548
1054 Ga0207644_10003018 3300025931 Bacteria 10832
1055 Ga0207644_10008816 3300025931 Bacteria 6604
1056 Ga0207644_10008908 3300025931 Bacteria 6573
1057 Ga0207644_10013604 3300025931 Bacteria 5431
1058 Ga0207644_10023299 3300025931 Bacteria 4239
1059 Ga0207644_10036016 3300025931 Bacteria 3472
1060 Ga0207644_10038172 3300025931 Bacteria 3381
1061 Ga0207644_10047287 3300025931 Bacteria 3070
1062 Ga0207644_10348761 3300025931 Bacteria 1201
1063 Ga0207644_10465715 3300025931 Bacteria 1039
1064 Ga0207690_10000213 3300025932 Bacteria 44040
1065 Ga0207690_10004314 3300025932 Bacteria 8395
1066 Ga0207690_10010821 3300025932 Bacteria 5436
1067 Ga0207690_10024735 3300025932 Bacteria 3763
1068 Ga0207690_10027937 3300025932 Bacteria 3570
1069 Ga0207690_10034020 3300025932 Bacteria 3280
1070 Ga0207690_10035483 3300025932 Bacteria 3221
1071 Ga0207690_10045082 3300025932 Bacteria 2911
1072 Ga0207690_10045727 3300025932 Bacteria 2894
1073 Ga0207690_10096898 3300025932 Bacteria 2098
1074 Ga0207690_10138636 3300025932 Bacteria 1789
1075 Ga0207690_10171634 3300025932 Bacteria 1625
1076 Ga0207690_10303147 3300025932 Bacteria 1251
1077 Ga0207690_10397065 3300025932 Bacteria 1099
1078 Ga0207690_10435543 3300025932 Bacteria 1051
1079 Ga0207690_10679649 3300025932 Bacteria 845
1080 Ga0207690_10952634 3300025932 Bacteria 713
1081 Ga0207706_10001681 3300025933 Bacteria 21822
1082 Ga0207706_10002348 3300025933 Bacteria 18484
1083 Ga0207706_10002904 3300025933 Bacteria 16576
1084 Ga0207706_10004412 3300025933 Bacteria 13222
1085 Ga0207706_10005362 3300025933 Bacteria 11952
1086 Ga0207706_10012962 3300025933 Bacteria 7587
1087 Ga0207706_10018444 3300025933 Bacteria 6280
1088 Ga0207706_10019463 3300025933 Bacteria 6107
1089 Ga0207706_10044942 3300025933 Bacteria 3913
1090 Ga0207706_10067025 3300025933 Bacteria 3158
1091 Ga0207706_10070052 3300025933 Bacteria 3084
1092 Ga0207706_10150961 3300025933 Bacteria 2043
1093 Ga0207706_10165081 3300025933 Bacteria 1946
1094 Ga0207706_10205273 3300025933 Bacteria 1728
1095 Ga0207706_10559277 3300025933 Bacteria 984
1096 Ga0207686_10000999 3300025934 Bacteria 16788
1097 Ga0207686_10970650 3300025934 Bacteria 688
1098 Ga0207709_10000123 3300025935 Bacteria 115697
1099 Ga0207709_10000314 3300025935 Bacteria 52842
1100 Ga0207709_10307373 3300025935 Bacteria 1181
1101 Ga0207709_10422633 3300025935 Bacteria 1024
1102 Ga0207670_10339522 3300025936 Bacteria 1187
1103 Ga0207669_10002136 3300025937 Bacteria 8381
1104 Ga0207669_10054957 3300025937 Bacteria 2408
1105 Ga0207669_10161434 3300025937 Bacteria 1583
1106 Ga0207669_10359783 3300025937 Bacteria 1127
1107 Ga0207704_10000005 3300025938 Bacteria 225353
1108 Ga0207704_10075826 3300025938 Bacteria 2152
1109 Ga0207704_10113325 3300025938 Bacteria 1839
1110 Ga0207704_10333352 3300025938 Bacteria 1175
1111 Ga0207665_10200106 3300025939 Bacteria 1455
1112 Ga0207691_10010358 3300025940 Bacteria 8942
1113 Ga0207691_10034600 3300025940 Bacteria 4696
1114 Ga0207691_10044424 3300025940 Bacteria 4091
1115 Ga0207691_10049113 3300025940 Bacteria 3866
1116 Ga0207691_10057057 3300025940 Bacteria 3555
1117 Ga0207691_10129459 3300025940 Bacteria 2230
1118 Ga0207691_10159692 3300025940 Bacteria 1978
1119 Ga0207691_10404640 3300025940 Bacteria 1164
1120 Ga0207691_10565857 3300025940 Bacteria 963
1121 Ga0207711_10000044 3300025941 Bacteria 157113
1122 Ga0207711_10003187 3300025941 Bacteria 14306
1123 Ga0207711_10004961 3300025941 Bacteria 11295
1124 Ga0207711_10006432 3300025941 Bacteria 9891
1125 Ga0207711_10029068 3300025941 Bacteria 4659
1126 Ga0207711_10060446 3300025941 Bacteria 3266
1127 Ga0207711_10091717 3300025941 Bacteria 2672
1128 Ga0207711_10132160 3300025941 Bacteria 2239
1129 Ga0207711_10346012 3300025941 Bacteria 1376
1130 Ga0207711_10426594 3300025941 Bacteria 1234
1131 Ga0207689_10000043 3300025942 Bacteria 93054
1132 Ga0207689_10005657 3300025942 Bacteria 11121
1133 Ga0207689_10016412 3300025942 Bacteria 6269
1134 Ga0207689_10288442 3300025942 Bacteria 1359
1135 Ga0207661_10040495 3300025944 Bacteria 3663
1136 Ga0207661_10127973 3300025944 Bacteria 2171
1137 Ga0207661_10313167 3300025944 Bacteria 1409
1138 Ga0207661_10438891 3300025944 Bacteria 1188
1139 Ga0207661_10534221 3300025944 Bacteria 1073
1140 Ga0207661_10581081 3300025944 Bacteria 1027
1141 Ga0207679_10004475 3300025945 Bacteria 8712
1142 Ga0207679_10005586 3300025945 Bacteria 7883
1143 Ga0207679_10033250 3300025945 Bacteria 3628
1144 Ga0207679_10056546 3300025945 Bacteria 2897
1145 Ga0207679_10066090 3300025945 Bacteria 2709
1146 Ga0207679_10070193 3300025945 Bacteria 2639
1147 Ga0207679_10109487 3300025945 Bacteria 2177
1148 Ga0207679_10124193 3300025945 Bacteria 2060
1149 Ga0207679_10252079 3300025945 Bacteria 1501
1150 Ga0207679_10302456 3300025945 Bacteria 1379
1151 Ga0207679_10325497 3300025945 Bacteria 1332
1152 Ga0207679_10370994 3300025945 Bacteria 1253
1153 Ga0207679_10372305 3300025945 Bacteria 1250
1154 Ga0207679_10440840 3300025945 Bacteria 1153
1155 Ga0207679_10447834 3300025945 Bacteria 1145
1156 Ga0207679_10503309 3300025945 Bacteria 1081
1157 Ga0207679_10633586 3300025945 Bacteria 966
1158 Ga0207679_10947482 3300025945 Bacteria 788
1159 Ga0207667_10000651 3300025949 Bacteria 45008
1160 Ga0207667_10041692 3300025949 Bacteria 4881
1161 Ga0207667_10066424 3300025949 Bacteria 3759
1162 Ga0207667_10087197 3300025949 Bacteria 3229
1163 Ga0207667_10089128 3300025949 Bacteria 3189
1164 Ga0207667_10120141 3300025949 Bacteria 2708
1165 Ga0207667_10158549 3300025949 Bacteria 2328
1166 Ga0207667_10169517 3300025949 Bacteria 2244
1167 Ga0207667_10204134 3300025949 Bacteria 2027
1168 Ga0207667_10349703 3300025949 Bacteria 1507
1169 Ga0207667_10373400 3300025949 Bacteria 1453
1170 Ga0207667_10671361 3300025949 Bacteria 1040
1171 Ga0207667_10774955 3300025949 Bacteria 957
1172 Ga0207651_10000007 3300025960 Bacteria 225286
1173 Ga0207651_10005083 3300025960 Bacteria 6714
1174 Ga0207651_10008872 3300025960 Bacteria 5460
1175 Ga0207651_10011246 3300025960 Bacteria 5001
1176 Ga0207651_10055669 3300025960 Bacteria 2718
1177 Ga0207651_10055861 3300025960 Bacteria 2714
1178 Ga0207651_10117747 3300025960 Bacteria 2008
1179 Ga0207651_10120928 3300025960 Bacteria 1985
1180 Ga0207712_10000001 3300025961 Bacteria 750309
1181 Ga0207712_10000074 3300025961 Bacteria 120822
1182 Ga0207712_10013236 3300025961 Bacteria 5286
1183 Ga0207712_10242519 3300025961 Bacteria 1452
1184 Ga0207712_10255236 3300025961 Bacteria 1419
1185 Ga0207712_10301749 3300025961 Bacteria 1314
1186 Ga0207668_10008280 3300025972 Bacteria 6195
1187 Ga0207668_10070743 3300025972 Bacteria 2489
1188 Ga0207668_10076582 3300025972 Bacteria 2409
1189 Ga0207668_10282118 3300025972 Bacteria 1362
1190 Ga0207668_10288027 3300025972 Bacteria 1350
1191 Ga0207640_10001822 3300025981 Bacteria 11433
1192 Ga0207640_10002785 3300025981 Bacteria 9373
1193 Ga0207640_10014906 3300025981 Bacteria 4486
1194 Ga0207640_10017347 3300025981 Bacteria 4211
1195 Ga0207640_10022813 3300025981 Bacteria 3753
1196 Ga0207640_10050048 3300025981 Bacteria 2709
1197 Ga0207640_10068326 3300025981 Bacteria 2381
1198 Ga0207640_10107282 3300025981 Bacteria 1971
1199 Ga0207640_10129763 3300025981 Bacteria 1820
1200 Ga0207640_10145116 3300025981 Bacteria 1735
1201 Ga0207640_10148408 3300025981 Bacteria 1719
1202 Ga0207640_10221716 3300025981 Bacteria 1448
1203 Ga0207640_10226516 3300025981 Bacteria 1435
1204 Ga0207640_10371929 3300025981 Bacteria 1155
1205 Ga0207658_10001041 3300025986 Bacteria 22533
1206 Ga0207658_10001339 3300025986 Bacteria 19300
1207 Ga0207658_10007902 3300025986 Bacteria 7245
1208 Ga0207658_10020014 3300025986 Bacteria 4632
1209 Ga0207658_10047562 3300025986 Bacteria 3140
1210 Ga0207658_10053779 3300025986 Bacteria 2976
1211 Ga0207658_10077777 3300025986 Bacteria 2532
1212 Ga0207658_10282923 3300025986 Bacteria 1422
1213 Ga0207658_10510136 3300025986 Bacteria 1072
1214 Ga0207658_10600986 3300025986 Bacteria 988
1215 Ga0207658_10655569 3300025986 Bacteria 946
1216 Ga0207658_10894046 3300025986 Bacteria 808
1217 Ga0207677_10000085 3300026023 Bacteria 78393
1218 Ga0207677_10007135 3300026023 Bacteria 6153
1219 Ga0207677_10007140 3300026023 Bacteria 6151
1220 Ga0207677_10020495 3300026023 Bacteria 4015
1221 Ga0207677_10376244 3300026023 Bacteria 1197
1222 Ga0207677_10404616 3300026023 Bacteria 1158
1223 Ga0207703_10000661 3300026035 Bacteria 34492
1224 Ga0207703_10002210 3300026035 Bacteria 17083
1225 Ga0207703_10004178 3300026035 Bacteria 11907
1226 Ga0207703_10007316 3300026035 Bacteria 8776
1227 Ga0207703_10009056 3300026035 Bacteria 7838
1228 Ga0207703_10009152 3300026035 Bacteria 7796
1229 Ga0207703_10026676 3300026035 Bacteria 4550
1230 Ga0207703_10109164 3300026035 Bacteria 2358
1231 Ga0207703_10489289 3300026035 Bacteria 1153
1232 Ga0207639_10000138 3300026041 Bacteria 54326
1233 Ga0207639_10000306 3300026041 Bacteria 34858
1234 Ga0207639_10002847 3300026041 Bacteria 11617
1235 Ga0207639_10010651 3300026041 Bacteria 6367
1236 Ga0207639_10018714 3300026041 Bacteria 4925
1237 Ga0207639_10059006 3300026041 Bacteria 2954
1238 Ga0207639_10173707 3300026041 Bacteria 1827
1239 Ga0207639_10202438 3300026041 Bacteria 1704
1240 Ga0207639_10242398 3300026041 Bacteria 1568
1241 Ga0207639_10479070 3300026041 Bacteria 1134
1242 Ga0207639_10487501 3300026041 Bacteria 1124
1243 Ga0207639_10504622 3300026041 Bacteria 1106
1244 Ga0207678_10000625 3300026067 Bacteria 32330
1245 Ga0207678_10002012 3300026067 Bacteria 18467
1246 Ga0207678_10003288 3300026067 Bacteria 14580
1247 Ga0207678_10019982 3300026067 Bacteria 5886
1248 Ga0207678_10035972 3300026067 Bacteria 4311
1249 Ga0207678_10054068 3300026067 Bacteria 3458
1250 Ga0207678_10055159 3300026067 Bacteria 3423
1251 Ga0207678_10060312 3300026067 Bacteria 3263
1252 Ga0207678_10065532 3300026067 Bacteria 3119
1253 Ga0207678_10110234 3300026067 Bacteria 2348
1254 Ga0207678_10126217 3300026067 Bacteria 2183
1255 Ga0207678_10160114 3300026067 Bacteria 1922
1256 Ga0207678_10285847 3300026067 Bacteria 1416
1257 Ga0207678_10310163 3300026067 Bacteria 1357
1258 Ga0207678_10314333 3300026067 Bacteria 1347
1259 Ga0207678_10331210 3300026067 Bacteria 1311
1260 Ga0207678_10417137 3300026067 Bacteria 1164
1261 Ga0207678_10637089 3300026067 Bacteria 936
1262 Ga0207678_10638400 3300026067 Bacteria 935
1263 Ga0207708_10029953 3300026075 Bacteria 4127
1264 Ga0207702_10003043 3300026078 Bacteria 15581
1265 Ga0207702_10012870 3300026078 Bacteria 6959
1266 Ga0207702_10033646 3300026078 Bacteria 4282
1267 Ga0207702_10056816 3300026078 Bacteria 3324
1268 Ga0207702_10073569 3300026078 Bacteria 2947
1269 Ga0207702_10088682 3300026078 Bacteria 2703
1270 Ga0207702_10127183 3300026078 Bacteria 2289
1271 Ga0207702_10162382 3300026078 Bacteria 2041
1272 Ga0207702_10182347 3300026078 Bacteria 1934
1273 Ga0207702_10213686 3300026078 Bacteria 1794
1274 Ga0207702_10253694 3300026078 Bacteria 1653
1275 Ga0207702_10357344 3300026078 Bacteria 1399
1276 Ga0207702_10429509 3300026078 Bacteria 1279
1277 Ga0207702_10443963 3300026078 Bacteria 1258
1278 Ga0207702_10451684 3300026078 Bacteria 1247
1279 Ga0207702_10789345 3300026078 Bacteria 938
1280 Ga0207702_10916668 3300026078 Bacteria 868
1281 Ga0207702_11067361 3300026078 Bacteria 801
1282 Ga0207641_10000033 3300026088 Bacteria 219261
1283 Ga0207641_10002463 3300026088 Bacteria 17101
1284 Ga0207641_10017686 3300026088 Bacteria 5838
1285 Ga0207641_10074338 3300026088 Bacteria 2931
1286 Ga0207641_10182174 3300026088 Bacteria 1925
1287 Ga0207641_10362799 3300026088 Bacteria 1383
1288 Ga0207641_11536028 3300026088 Bacteria 667
1289 Ga0207648_10000005 3300026089 Bacteria 225083
1290 Ga0207648_10009542 3300026089 Bacteria 9282
1291 Ga0207648_10017604 3300026089 Bacteria 6491
1292 Ga0207648_10066045 3300026089 Bacteria 3155
1293 Ga0207648_10085498 3300026089 Bacteria 2751
1294 Ga0207648_10182280 3300026089 Bacteria 1859
1295 Ga0207648_10299460 3300026089 Bacteria 1442
1296 Ga0207648_10315417 3300026089 Bacteria 1404
1297 Ga0207648_11105398 3300026089 Bacteria 743
1298 Ga0207676_10000193 3300026095 Bacteria 53147
1299 Ga0207676_10001310 3300026095 Bacteria 18517
1300 Ga0207676_10002304 3300026095 Bacteria 13699
1301 Ga0207676_10008893 3300026095 Bacteria 7145
1302 Ga0207676_10014208 3300026095 Bacteria 5720
1303 Ga0207676_10274732 3300026095 Bacteria 1527
1304 Ga0207674_10005155 3300026116 Bacteria 15575
1305 Ga0207674_10008541 3300026116 Bacteria 11814
1306 Ga0207674_10008911 3300026116 Bacteria 11530
1307 Ga0207674_10010054 3300026116 Bacteria 10763
1308 Ga0207674_10011026 3300026116 Bacteria 10165
1309 Ga0207674_10026848 3300026116 Bacteria 6107
1310 Ga0207674_10115284 3300026116 Bacteria 2658
1311 Ga0207674_10205783 3300026116 Bacteria 1917
1312 Ga0207674_11268491 3300026116 Bacteria 706
1313 Ga0207674_11278756 3300026116 Bacteria 703
1314 Ga0207675_100000020 3300026118 Bacteria 117374
1315 Ga0207675_100003055 3300026118 Bacteria 16418
1316 Ga0207675_100014477 3300026118 Bacteria 7353
1317 Ga0207675_100123581 3300026118 Bacteria 2450
1318 Ga0207675_100135492 3300026118 Bacteria 2336
1319 Ga0207675_100152747 3300026118 Bacteria 2198
1320 Ga0207675_100217470 3300026118 Bacteria 1840
1321 Ga0207683_10002608 3300026121 Bacteria 15739
1322 Ga0207683_10005676 3300026121 Bacteria 10700
1323 Ga0207683_10007711 3300026121 Bacteria 9219
1324 Ga0207683_10022069 3300026121 Bacteria 5462
1325 Ga0207683_10025235 3300026121 Bacteria 5125
1326 Ga0207683_10143345 3300026121 Bacteria 2153
1327 Ga0207683_10334750 3300026121 Bacteria 1388
1328 Ga0207683_10773740 3300026121 Bacteria 891
1329 Ga0207698_10000751 3300026142 Bacteria 18819
1330 Ga0207698_10001376 3300026142 Bacteria 14155
1331 Ga0207698_10004176 3300026142 Bacteria 8786
1332 Ga0207698_10004925 3300026142 Bacteria 8187
1333 Ga0207698_10013479 3300026142 Bacteria 5394
1334 Ga0207698_10016964 3300026142 Bacteria 4927
1335 Ga0207698_10018354 3300026142 Bacteria 4764
1336 Ga0207698_10020656 3300026142 Bacteria 4537
1337 Ga0207698_10035079 3300026142 Bacteria 3666
1338 Ga0207698_10063830 3300026142 Bacteria 2884
1339 Ga0207698_10070641 3300026142 Bacteria 2767
1340 Ga0207698_10101973 3300026142 Bacteria 2381
1341 Ga0207698_10105999 3300026142 Bacteria 2343
1342 Ga0207698_10110081 3300026142 Bacteria 2306
1343 Ga0207698_10125131 3300026142 Bacteria 2184
1344 Ga0207698_10236368 3300026142 Bacteria 1662
1345 Ga0207698_10315678 3300026142 Bacteria 1461
1346 Ga0207698_10380246 3300026142 Bacteria 1343
1347 Ga0207698_10492571 3300026142 Bacteria 1191
1348 Ga0207698_10951321 3300026142 Bacteria 868
1349 Ga0209967_1012570 3300027364 Bacteria 1197
1350 Ga0209999_1018098 3300027543 Bacteria 1288
1351 Ga0209970_1014509 3300027614 Bacteria 1309
1352 Ga0209813_10000642 3300027866 Bacteria 8057
1353 Ga0209974_10020267 3300027876 Bacteria 2204
1354 Ga0268266_10000028 3300028379 Bacteria 425294
1355 Ga0268266_10000315 3300028379 Bacteria 76532
1356 Ga0268266_10032675 3300028379 Bacteria 4421
1357 Ga0268266_10040809 3300028379 Bacteria 3957
1358 Ga0268266_10154815 3300028379 Bacteria 2069
1359 Ga0268266_10494660 3300028379 Bacteria 1167
1360 Ga0268265_10000524 3300028380 Bacteria 39127
1361 Ga0268265_10000655 3300028380 Bacteria 34369
1362 Ga0268265_10000877 3300028380 Bacteria 28171
1363 Ga0268265_10004694 3300028380 Bacteria 9433
1364 Ga0268265_10037695 3300028380 Bacteria 3550
1365 Ga0268265_10081652 3300028380 Bacteria 2553
1366 Ga0268265_10157984 3300028380 Bacteria 1921
1367 Ga0268265_10595854 3300028380 Bacteria 1055
1368 Ga0268265_11491259 3300028380 Bacteria 680
1369 Ga0268264_10000006 3300028381 Bacteria 827324
1370 Ga0268264_10000594 3300028381 Bacteria 43886
1371 Ga0268264_10030328 3300028381 Bacteria 4432
1372 Ga0268264_10066778 3300028381 Bacteria 3034
1373 Ga0268264_10222948 3300028381 Bacteria 1736
1374 Ga0268264_10226230 3300028381 Bacteria 1725
1375 Ga0268264_10246579 3300028381 Bacteria 1657
1376 Ga0268264_11242710 3300028381 Bacteria 755
1377 Ga0307517_10010919 3300028786 Bacteria 12655
1378 Ga0307517_10015604 3300028786 Bacteria 10076
1379 Ga0316182_1051886 3300030745 Bacteria 1311
1380 Ga0307513_10324308 3300031456 Bacteria 1297
1381 Ga0307408_100034262 3300031548 Bacteria 3555
1382 Ga0307408_100063351 3300031548 Bacteria 2704
1383 Ga0307408_100166926 3300031548 Bacteria 1754
1384 Ga0307408_100468283 3300031548 Bacteria 1096
1385 Ga0307405_10006669 3300031731 Bacteria 5700
1386 Ga0307405_10011630 3300031731 Bacteria 4624
1387 Ga0307405_10032333 3300031731 Bacteria 3092
1388 Ga0307405_10078060 3300031731 Bacteria 2153
1389 Ga0307405_10106086 3300031731 Bacteria 1894
1390 Ga0307405_10208850 3300031731 Bacteria 1423
1391 Ga0307405_10544027 3300031731 Bacteria 938
1392 Ga0307405_10993554 3300031731 Bacteria 715
1393 Ga0307413_10528879 3300031824 Bacteria 952
1394 Ga0307413_10601644 3300031824 Bacteria 900
1395 Ga0307410_10004647 3300031852 Bacteria 7132
1396 Ga0307410_10035455 3300031852 Bacteria 3240
1397 Ga0307410_10362872 3300031852 Bacteria 1160
1398 Ga0307410_10813577 3300031852 Bacteria 795
1399 Ga0307406_10008063 3300031901 Bacteria 5866
1400 Ga0307406_10008583 3300031901 Bacteria 5704
1401 Ga0307406_10546600 3300031901 Bacteria 947
1402 Ga0307407_10014619 3300031903 Bacteria 3851
1403 Ga0307407_10075741 3300031903 Bacteria 2018
1404 Ga0307412_10010301 3300031911 Bacteria 5384
1405 Ga0307412_10011200 3300031911 Bacteria 5189
1406 Ga0307412_10070371 3300031911 Bacteria 2384
1407 Ga0307412_10130640 3300031911 Bacteria 1823
1408 Ga0307412_10969519 3300031911 Bacteria 749
1409 Ga0307409_100030466 3300031995 Bacteria 3876
1410 Ga0307409_100091735 3300031995 Bacteria 2490
1411 Ga0307409_100093100 3300031995 Bacteria 2475
1412 Ga0307409_100124455 3300031995 Bacteria 2190
1413 Ga0307409_100269587 3300031995 Bacteria 1567
1414 Ga0307409_100412273 3300031995 Bacteria 1294
1415 Ga0307409_100470045 3300031995 Bacteria 1218
1416 Ga0307409_100532302 3300031995 Bacteria 1150
1417 Ga0307409_101135797 3300031995 Bacteria 803
1418 Ga0307416_100003438 3300032002 Bacteria 9303
1419 Ga0307416_100013884 3300032002 Bacteria 5492
1420 Ga0307416_100817329 3300032002 Bacteria 1028
1421 Ga0307416_101282137 3300032002 Bacteria 838
1422 Ga0307414_10001010 3300032004 Bacteria 14378
1423 Ga0307414_10220923 3300032004 Bacteria 1555
1424 Ga0307414_10226144 3300032004 Bacteria 1539
1425 Ga0307414_10357465 3300032004 Bacteria 1255
1426 Ga0307414_10474124 3300032004 Bacteria 1102
1427 Ga0307414_10506148 3300032004 Bacteria 1069
1428 Ga0307414_10542168 3300032004 Bacteria 1035
1429 Ga0307411_10003341 3300032005 Bacteria 7428
1430 Ga0307411_10006255 3300032005 Bacteria 5939
1431 Ga0307411_10151432 3300032005 Bacteria 1724
1432 Ga0307411_10175894 3300032005 Bacteria 1619
1433 Ga0307411_10289723 3300032005 Bacteria 1307
1434 Ga0307411_10357127 3300032005 Bacteria 1193
1435 Ga0307411_10376988 3300032005 Bacteria 1165
1436 Ga0307411_10635061 3300032005 Bacteria 922
1437 Ga0307411_10723282 3300032005 Bacteria 869
1438 Ga0307415_100030148 3300032126 Bacteria 3477
1439 Ga0307415_100081448 3300032126 Bacteria 2312
1440 Ga0307415_100116218 3300032126 Bacteria 1995
1441 Ga0307415_100134814 3300032126 Bacteria 1876
1442 Ga0307510_10119138 3300033180 Bacteria 2350
1443 Ga0307510_10232056 3300033180 Bacteria 1347
1444 Ga0373923_0033469 3300035111 Bacteria 2081
1445 Ga0373941_0119195 3300035115 Bacteria 939
1446 Ga0373941_0151102 3300035115 Bacteria 852
1447 Ga0373954_0082775 3300035118 Bacteria 1535
1448 Ga0373960_0049190 3300035121 Bacteria 1246
1449 Ga0373960_0138379 3300035121 Bacteria 822
1450 Ga0373943_0455470 3300035170 Bacteria 744
1451 Ga0373942_0063647 3300035207 Bacteria 1062
1452 Ga0373931_0009585 3300035691 Bacteria 4634
1453 Ga0373935_0047789 3300035692 Bacteria 2707
1454 Ga0373935_0069053 3300035692 Bacteria 2275
1455 Ga0373927_0025599 3300035695 Bacteria 3858
1456 Ga0373933_0122438 3300035724 Bacteria 1630
1457 Ga0373937_0085639 3300036401 Bacteria 2916
1458 Ga0373925_0036385 3300037068 Bacteria 3633
1459 Ga0395899_0000103 3300037312 Bacteria 147274
1460 Ga0395899_0001950 3300037312 Bacteria 16977
1461 Ga0395899_0015182 3300037312 Bacteria 5872
1462 Ga0395899_0024414 3300037312 Bacteria 4570
1463 Ga0395899_0034866 3300037312 Bacteria 3779
1464 Ga0395899_0040739 3300037312 Bacteria 3473
1465 Ga0395899_0053354 3300037312 Bacteria 2993
1466 Ga0395899_0053589 3300037312 Bacteria 2986
1467 Ga0395899_0107111 3300037312 Bacteria 2012
1468 Ga0395899_0109509 3300037312 Bacteria 1987
1469 Ga0395899_0154352 3300037312 Bacteria 1625
1470 Ga0395899_0162610 3300037312 Bacteria 1576
1471 Ga0395899_0176237 3300037312 Bacteria 1503
1472 Ga0395899_0181294 3300037312 Bacteria 1478
1473 Ga0395899_0209042 3300037312 Bacteria 1357
1474 Ga0395899_0219249 3300037312 Bacteria 1318
1475 Ga0395899_0289571 3300037312 Bacteria 1111
1476 Ga0395899_0685876 3300037312 Bacteria 644
1477 Ga0395900_0000093 3300037418 Bacteria 166505
1478 Ga0395900_0000325 3300037418 Bacteria 70579
1479 Ga0395900_0001087 3300037418 Bacteria 34570
1480 Ga0395900_0001290 3300037418 Bacteria 30554
1481 Ga0395900_0020586 3300037418 Bacteria 6738
1482 Ga0395900_0023955 3300037418 Bacteria 6247
1483 Ga0395900_0028278 3300037418 Bacteria 5743
1484 Ga0395900_0034108 3300037418 Bacteria 5239
1485 Ga0395900_0045255 3300037418 Bacteria 4533
1486 Ga0395900_0048120 3300037418 Bacteria 4392
1487 Ga0395900_0048535 3300037418 Bacteria 4373
1488 Ga0395900_0091818 3300037418 Bacteria 3119
1489 Ga0395900_0109184 3300037418 Bacteria 2842
1490 Ga0395900_0109823 3300037418 Bacteria 2833
1491 Ga0395900_0125689 3300037418 Bacteria 2630
1492 Ga0395900_0128722 3300037418 Bacteria 2595
1493 Ga0395900_0129797 3300037418 Bacteria 2583
1494 Ga0395900_0146278 3300037418 Bacteria 2416
1495 Ga0395900_0157340 3300037418 Bacteria 2320
1496 Ga0395900_0165784 3300037418 Bacteria 2251
1497 Ga0395900_0191350 3300037418 Bacteria 2075
1498 Ga0395900_0196867 3300037418 Bacteria 2041
1499 Ga0395900_0263737 3300037418 Bacteria 1719
1500 Ga0395900_0294916 3300037418 Bacteria 1609
1501 Ga0395900_0350852 3300037418 Bacteria 1449
1502 Ga0395900_0414088 3300037418 Bacteria 1309
1503 Ga0395900_0427492 3300037418 Bacteria 1284
1504 Ga0395900_0582892 3300037418 Bacteria 1060
1505 Ga0395900_0745429 3300037418 Bacteria 910
1506 Ga0395900_0906782 3300037418 Bacteria 804
1507 Ga0395898_0000053 3300037466 Bacteria 279600
1508 Ga0395898_0006749 3300037466 Bacteria 12226
1509 Ga0395898_0072459 3300037466 Bacteria 3328
1510 Ga0395898_0086177 3300037466 Bacteria 3027
1511 Ga0395898_0100601 3300037466 Bacteria 2776
1512 Ga0395898_0146453 3300037466 Bacteria 2260
1513 Ga0395898_0213635 3300037466 Bacteria 1840
1514 Ga0395898_0330150 3300037466 Bacteria 1454
1515 Ga0395898_0335348 3300037466 Bacteria 1442
1516 Ga0395898_0357119 3300037466 Bacteria 1393
1517 Ga0395898_0424649 3300037466 Bacteria 1267
1518 Ga0395898_0514147 3300037466 Bacteria 1138
1519 Ga0395898_0619179 3300037466 Bacteria 1025
1520 Ga0395898_0666448 3300037466 Bacteria 982
1521 Ga0395898_0976618 3300037466 Bacteria 783
1522 Ga0395905_0000031 3300037471 Bacteria 286757
1523 Ga0395905_0000218 3300037471 Bacteria 87745
1524 Ga0395905_0000298 3300037471 Bacteria 72500
1525 Ga0395905_0002160 3300037471 Bacteria 22295
1526 Ga0395905_0003525 3300037471 Bacteria 16688
1527 Ga0395905_0004981 3300037471 Bacteria 13682
1528 Ga0395905_0011188 3300037471 Bacteria 8676
1529 Ga0395905_0021011 3300037471 Bacteria 6181
1530 Ga0395905_0024148 3300037471 Bacteria 5738
1531 Ga0395905_0024791 3300037471 Bacteria 5660
1532 Ga0395905_0029054 3300037471 Bacteria 5210
1533 Ga0395905_0032012 3300037471 Bacteria 4947
1534 Ga0395905_0034086 3300037471 Bacteria 4780
1535 Ga0395905_0045674 3300037471 Bacteria 4108
1536 Ga0395905_0066550 3300037471 Bacteria 3374
1537 Ga0395905_0069718 3300037471 Bacteria 3293
1538 Ga0395905_0087794 3300037471 Bacteria 2915
1539 Ga0395905_0091962 3300037471 Bacteria 2844
1540 Ga0395905_0133389 3300037471 Bacteria 2336
1541 Ga0395905_0149610 3300037471 Bacteria 2196
1542 Ga0395905_0165759 3300037471 Bacteria 2076
1543 Ga0395905_0176931 3300037471 Bacteria 2003
1544 Ga0395905_0179700 3300037471 Bacteria 1986
1545 Ga0395905_0183937 3300037471 Bacteria 1962
1546 Ga0395905_0262478 3300037471 Bacteria 1612
1547 Ga0395905_0311521 3300037471 Bacteria 1462
1548 Ga0395905_0343273 3300037471 Bacteria 1384
1549 Ga0395905_0365865 3300037471 Bacteria 1335
1550 Ga0395905_0379500 3300037471 Bacteria 1307
1551 Ga0395905_0609346 3300037471 Bacteria 994
1552 Ga0395905_0643619 3300037471 Bacteria 962
1553 Ga0395905_0691054 3300037471 Bacteria 922
1554 Ga0395905_0827664 3300037471 Bacteria 828
1555 Ga0395905_0852610 3300037471 Bacteria 814
1556 Ga0395905_1053264 3300037471 Bacteria 716
1557 Ga0436364_0267368 3300037853 Bacteria 35795
1558 Ga0436364_1244538 3300037853 Bacteria 1142
1559 Ga0395901_0000603 3300038443 Bacteria 41824
1560 Ga0395901_0001133 3300038443 Bacteria 28265
1561 Ga0395901_0002869 3300038443 Bacteria 17398
1562 Ga0395901_0003360 3300038443 Bacteria 16117
1563 Ga0395901_0007049 3300038443 Bacteria 11362
1564 Ga0395901_0015960 3300038443 Bacteria 7651
1565 Ga0395901_0042410 3300038443 Bacteria 4717
1566 Ga0395901_0043460 3300038443 Bacteria 4661
1567 Ga0395901_0048919 3300038443 Bacteria 4391
1568 Ga0395901_0059325 3300038443 Bacteria 3981
1569 Ga0395901_0062942 3300038443 Bacteria 3861
1570 Ga0395901_0075822 3300038443 Bacteria 3508
1571 Ga0395901_0103747 3300038443 Bacteria 2983
1572 Ga0395901_0119896 3300038443 Bacteria 2764
1573 Ga0395901_0134330 3300038443 Bacteria 2600
1574 Ga0395901_0187633 3300038443 Bacteria 2168
1575 Ga0395901_0211757 3300038443 Bacteria 2028
1576 Ga0395901_0215873 3300038443 Bacteria 2006
1577 Ga0395901_0238206 3300038443 Bacteria 1898
1578 Ga0395901_0245240 3300038443 Bacteria 1867
1579 Ga0395901_0285573 3300038443 Bacteria 1713
1580 Ga0395901_0297482 3300038443 Bacteria 1673
1581 Ga0395901_0487641 3300038443 Bacteria 1256
1582 Ga0395901_0615440 3300038443 Bacteria 1093
1583 Ga0395901_0700679 3300038443 Bacteria 1010
1584 Ga0395901_0980212 3300038443 Bacteria 822
1585 Ga0395901_1052899 3300038443 Bacteria 786
1586 Ga0237819_00997 3300038705 Bacteria 8549
1587 Ga0237816_01348 3300039145 Bacteria 1986
1588 Ga0436365_1759449 3300039437 Bacteria 1090
1589 Ga0436365_1765941 3300039437 Bacteria 1102
1590 Ga0436363_1307031 3300039450 Bacteria 709
1591 Ga0439436_0010448 3300041404 Bacteria 2831
1592 Ga0439438_080358 3300041405 Bacteria 800
1593 Ga0439439_0015658 3300041406 Bacteria 1853
1594 Ga0439466_0063717 3300041411 Bacteria 1183
1595 Ga0439465_0012432 3300041413 Bacteria 2661
1596 Ga0439465_0024370 3300041413 Bacteria 1906
1597 Ga0451787_474471 3300041441 Bacteria 821
1598 Ga0451795_1296634 3300041456 Bacteria 1282
1599 Ga0451833_0859678 3300041491 Bacteria 1356
1600 Ga0451853_1878420 3300041512 Bacteria 1848
1601 Ga0439431_0000266 3300041997 Bacteria 10688
1602 Ga0439431_0001884 3300041997 Bacteria 4650
1603 Ga0439442_006828 3300042002 Bacteria 2291
1604 Ga0439445_0057548 3300042004 Bacteria 1058
1605 Ga0439448_0014521 3300042005 Bacteria 2376
1606 Ga0439448_0041089 3300042005 Bacteria 1495
1607 Ga0439449_0016693 3300042007 Bacteria 2758
1608 Ga0439449_0066737 3300042007 Bacteria 1327
1609 Ga0439452_012996 3300042010 Bacteria 2348
1610 Ga0439455_0001059 3300042012 Bacteria 4360
1611 Ga0439457_009600 3300042014 Bacteria 2248
1612 Ga0439462_0000072 3300042015 Bacteria 15184
1613 Ga0450890_007651 3300042127 Bacteria 1382
1614 Ga0450894_022132 3300042131 Bacteria 861
1615 Ga0439446_0090261 3300042156 Bacteria 958
1616 Ga0439458_0000003 3300042157 Bacteria 33633
1617 Ga0439458_0001169 3300042157 Bacteria 6661
1618 Ga0439434_0017782 3300042435 Bacteria 2127
1619 Ga0439464_0016573 3300042439 Bacteria 1993
1620 Ga0439464_0049328 3300042439 Bacteria 1214
1621 Ga0439460_0049043 3300042461 Bacteria 1261
1622 Ga0466969_0070561 3300044656 Bacteria 1680
1623 Ga0466972_0016710 3300044658 Bacteria 3669
1624 Ga0466972_0099084 3300044658 Bacteria 1379
1625 Ga0466973_0265260 3300044659 Bacteria 1191
1626 Ga0466965_0064703 3300044683 Bacteria 1831
1627 Ga0466966_0000001 3300044684 Bacteria 410376
1628 Ga0466966_0035584 3300044684 Bacteria 3216
1629 Ga0466966_0045811 3300044684 Bacteria 2795
1630 Ga0466966_0124094 3300044684 Bacteria 1584
1631 Ga0466966_0269109 3300044684 Bacteria 1025
1632 Ga0466961_0010293 3300044693 Bacteria 5960
1633 Ga0466961_0011461 3300044693 Bacteria 5670
1634 Ga0466961_0066414 3300044693 Bacteria 2291
1635 Ga0466961_0262323 3300044693 Bacteria 1059
1636 Ga0466963_0001571 3300044694 Bacteria 12383
1637 Ga0466963_0005775 3300044694 Bacteria 7279
1638 Ga0466963_0012123 3300044694 Bacteria 5269
1639 Ga0466963_0015629 3300044694 Bacteria 4706
1640 Ga0466963_0027255 3300044694 Bacteria 3657
1641 Ga0466963_0076558 3300044694 Bacteria 2259
1642 Ga0466963_0110260 3300044694 Bacteria 1889
1643 Ga0466963_0145563 3300044694 Bacteria 1643
1644 Ga0466963_0286199 3300044694 Bacteria 1158
1645 Ga0466963_0362192 3300044694 Bacteria 1021
1646 Ga0466963_0436933 3300044694 Bacteria 923
1647 Ga0466964_0011968 3300044706 Bacteria 3280
1648 Ga0466971_0007970 3300044719 Bacteria 4617
1649 Ga0466971_0010170 3300044719 Bacteria 4108
1650 Ga0466971_0071253 3300044719 Bacteria 1579
1651 Ga0466971_0112712 3300044719 Bacteria 1256
1652 Ga0466968_0069985 3300044735 Bacteria 1525
1653 Ga0466968_0162402 3300044735 Bacteria 1031
1654 Ga0466970_0018332 3300044765 Bacteria 3622
1655 Ga0466970_0018657 3300044765 Bacteria 3594
1656 Ga0466970_0124328 3300044765 Bacteria 1414
1657 Ga0466957_0003468 3300044842 Bacteria 8660
1658 Ga0466957_0003546 3300044842 Bacteria 8595
1659 Ga0466957_0018902 3300044842 Bacteria 4050
1660 Ga0466957_0095064 3300044842 Bacteria 1871
1661 Ga0466957_0277146 3300044842 Bacteria 1121
1662 Ga0466957_0359512 3300044842 Bacteria 989
1663 Ga0466957_0582018 3300044842 Bacteria 782
1664 Ga0466960_0023437 3300044901 Bacteria 2771
1665 Ga0466960_0079156 3300044901 Bacteria 1652
1666 Ga0466959_0002064 3300045049 Bacteria 12709
1667 Ga0466959_0049401 3300045049 Bacteria 3090
1668 Ga0466959_0070810 3300045049 Bacteria 2526
1669 Ga0466959_0093564 3300045049 Bacteria 2157
1670 Ga0466959_0212995 3300045049 Bacteria 1342
1671 Ga0466958_0000867 3300045836 Bacteria 13493
1672 Ga0466958_0036365 3300045836 Bacteria 2947
1673 Ga0466958_0128384 3300045836 Bacteria 1591
1674 Ga0466958_0131142 3300045836 Bacteria 1574
1675 Ga0466958_0165135 3300045836 Bacteria 1400
1676 Ga0466958_0410413 3300045836 Bacteria 875
1677 Ga0466958_0437855 3300045836 Bacteria 846
1678 Ga0466967_0021736 3300045976 Bacteria 5219
1679 Ga0466967_0032298 3300045976 Bacteria 4418
1680 Ga0466967_0046607 3300045976 Bacteria 3775
1681 Ga0466967_0053683 3300045976 Bacteria 3543
1682 Ga0466967_0055341 3300045976 Bacteria 3494
1683 Ga0466967_0093266 3300045976 Bacteria 2739
1684 Ga0466967_0166106 3300045976 Bacteria 2074
1685 Ga0466967_0268400 3300045976 Bacteria 1634
1686 Ga0466967_0282024 3300045976 Bacteria 1594
1687 Ga0466967_0661833 3300045976 Bacteria 1033
1688 Ga0466967_0706066 3300045976 Bacteria 999
1689 Ga0466967_0858709 3300045976 Bacteria 902
1690 Ga0495617_003757 3300046452 Bacteria 5632
1691 Ga0495627_000621 3300046453 Bacteria 28245
1692 Ga0495627_013170 3300046453 Bacteria 2914
1693 Ga0495590_0276979 3300046457 Bacteria 628
1694 Ga0495650_0000058 3300046471 Bacteria 302308
1695 Ga0495585_0015180 3300046492 Bacteria 4476
1696 Ga0495607_0066211 3300046501 Bacteria 2034
1697 Ga0495583_0000111 3300046506 Bacteria 138300
1698 Ga0495583_0037338 3300046506 Bacteria 2303
1699 Ga0495606_0021008 3300046507 Bacteria 4792
1700 Ga0495606_0068197 3300046507 Bacteria 2251
1701 Ga0495610_0000072 3300046512 Bacteria 120618
1702 Ga0495616_0112830 3300046513 Bacteria 1261
1703 Ga0495631_0166832 3300046518 Bacteria 944
1704 Ga0495631_0252170 3300046518 Bacteria 752
1705 Ga0495632_0000007 3300046519 Bacteria 343246
1706 Ga0495632_0145657 3300046519 Bacteria 1097
1707 Ga0495632_0163809 3300046519 Bacteria 1023
1708 Ga0495637_0000971 3300046520 Bacteria 18217
1709 Ga0495637_0026836 3300046520 Bacteria 2581
1710 Ga0495643_0000005 3300046522 Bacteria 443135
1711 Ga0495643_0025789 3300046522 Bacteria 3323
1712 Ga0495648_0001438 3300046524 Bacteria 23303
1713 Ga0495648_0084734 3300046524 Bacteria 1793
1714 Ga0495648_0188419 3300046524 Bacteria 1042
1715 Ga0495663_0000005 3300046525 Bacteria 342265
1716 Ga0495663_0076555 3300046525 Bacteria 1072
1717 Ga0495663_0131859 3300046525 Bacteria 843
1718 Ga0495642_0016307 3300046528 Bacteria 2894
1719 Ga0495598_0007441 3300046537 Bacteria 2513
1720 Ga0495621_0000481 3300046539 Bacteria 9812
1721 Ga0495621_0000528 3300046539 Bacteria 9462
1722 Ga0495597_0115110 3300046542 Bacteria 1125
1723 Ga0495622_0007809 3300046557 Bacteria 4967
1724 Ga0495633_0001368 3300046558 Bacteria 19079
1725 Ga0495633_0002896 3300046558 Bacteria 11765
1726 Ga0495633_0007470 3300046558 Bacteria 6284
1727 Ga0495633_0117301 3300046558 Bacteria 1233
1728 Ga0495668_0000759 3300046616 Bacteria 37993
1729 Ga0495625_0000064 3300046660 Bacteria 174730
1730 Ga0495625_0000189 3300046660 Bacteria 97637
1731 Ga0495625_0005244 3300046660 Bacteria 11925
1732 Ga0495625_0133908 3300046660 Bacteria 1676
1733 Ga0495625_0222655 3300046660 Bacteria 1236
1734 Ga0495625_0349640 3300046660 Bacteria 935
1735 Ga0495661_0046403 3300046665 Bacteria 2653
1736 Ga0495623_0066877 3300046679 Bacteria 2244
1737 Ga0495669_0000512 3300046684 Bacteria 17642
1738 Ga0495669_0007442 3300046684 Bacteria 4592
1739 Ga0495669_0048972 3300046684 Bacteria 1891
1740 Ga0495669_0051272 3300046684 Bacteria 1852
1741 Ga0495669_0339313 3300046684 Bacteria 726
1742 Ga0495670_0000004 3300046691 Bacteria 310086
1743 Ga0495670_0003293 3300046691 Bacteria 7958
1744 Ga0495671_0000007 3300046692 Bacteria 443069
1745 Ga0495649_0048964 3300046694 Bacteria 2296
1746 Ga0495600_0000530 3300046809 Bacteria 19818
1747 Ga0495636_0053222 3300047318 Bacteria 1699
1748 Ga0495683_0011752 3300047323 Bacteria 4604
1749 Ga0495687_003705 3300047443 Bacteria 10864
1750 Ga0495687_010391 3300047443 Bacteria 5108
1751 Ga0495677_0006237 3300047445 Bacteria 4502
1752 Ga0495677_0022715 3300047445 Bacteria 2276
1753 Ga0495677_0038412 3300047445 Bacteria 1749
1754 Ga0495685_059613 3300047447 Bacteria 1288
1755 Ga0495673_0016342 3300047469 Bacteria 3795
1756 Ga0495673_0029007 3300047469 Bacteria 2615
1757 Ga0495681_0000043 3300047470 Bacteria 115514
1758 Ga0495681_0012249 3300047470 Bacteria 5052
1759 Ga0495681_0143425 3300047470 Bacteria 1007
1760 Ga0495686_0000060 3300047472 Bacteria 237402
1761 Ga0495686_0000091 3300047472 Bacteria 190563
1762 Ga0495686_0000904 3300047472 Bacteria 37345
1763 Ga0495686_0016391 3300047472 Bacteria 5026
1764 Ga0495686_0045492 3300047472 Bacteria 2777
1765 Ga0495686_0292211 3300047472 Bacteria 902
1766 Ga0495686_0326206 3300047472 Bacteria 840
1767 Ga0495602_0084339 3300048088 Bacteria 2659
1768 Ga0495615_0048339 3300048090 Bacteria 1087
1769 Ga0496100_0002351 3300048903 Bacteria 9571
1770 Ga0496100_0460623 3300048903 Bacteria 976
1771 Ga0496101_0000292 3300048904 Bacteria 34928
1772 Ga0496101_0025402 3300048904 Bacteria 4111
1773 Ga0496101_0170624 3300048904 Bacteria 1672
1774 Ga0496101_0414389 3300048904 Bacteria 1062
1775 Ga0496102_0016210 3300048905 Bacteria 6512
1776 Ga0496102_0162422 3300048905 Bacteria 2101
1777 Ga0496102_0464439 3300048905 Bacteria 1187
1778 Ga0496103_0000643 3300048906 Bacteria 26435
1779 Ga0496103_0109934 3300048906 Bacteria 1750
1780 Ga0496103_0213293 3300048906 Bacteria 1241
1781 Ga0496103_0443807 3300048906 Bacteria 832
1782 Ga0496104_0364311 3300048907 Bacteria 1358
1783 Ga0496104_0485077 3300048907 Bacteria 1147
1784 Ga0496104_0654645 3300048907 Bacteria 959
1785 Ga0496105_0051276 3300048908 Bacteria 3409
1786 Ga0496105_0099313 3300048908 Bacteria 2404
1787 Ga0496105_0191429 3300048908 Bacteria 1672
1788 Ga0496105_0257059 3300048908 Bacteria 1414
1789 Ga0496106_0014932 3300048909 Bacteria 5744
1790 Ga0496106_0043116 3300048909 Bacteria 3385
1791 Ga0496107_0003345 3300048910 Bacteria 10711
1792 Ga0496107_0011839 3300048910 Bacteria 6091
1793 Ga0496107_0049890 3300048910 Bacteria 3016
1794 Ga0496107_0069946 3300048910 Bacteria 2548
1795 Ga0496107_0080557 3300048910 Bacteria 2374
1796 Ga0496107_0139776 3300048910 Bacteria 1790
1797 Ga0496108_0001766 3300048911 Bacteria 17208
1798 Ga0496108_0001779 3300048911 Bacteria 17174
1799 Ga0496108_0046675 3300048911 Bacteria 3619
1800 Ga0496108_0047520 3300048911 Bacteria 3587
1801 Ga0496108_0318470 3300048911 Bacteria 1356
1802 Ga0496109_0004339 3300048912 Bacteria 11850
1803 Ga0496109_0010384 3300048912 Bacteria 7951
1804 Ga0496109_0010905 3300048912 Bacteria 7784
1805 Ga0496109_0012943 3300048912 Bacteria 7214
1806 Ga0496109_0085318 3300048912 Bacteria 2914
1807 Ga0496109_0092296 3300048912 Bacteria 2801
1808 Ga0496110_0001965 3300048913 Bacteria 15272
1809 Ga0496110_0008211 3300048913 Bacteria 8391
1810 Ga0496110_0043663 3300048913 Bacteria 3915
1811 Ga0496110_0137047 3300048913 Bacteria 2212
1812 Ga0496110_0775515 3300048913 Bacteria 863
1813 Ga0496111_0000323 3300048914 Bacteria 23780
1814 Ga0496111_0014202 3300048914 Bacteria 5434
1815 Ga0496111_0014437 3300048914 Bacteria 5395
1816 Ga0496111_0117561 3300048914 Bacteria 1962
1817 Ga0496111_0206021 3300048914 Bacteria 1462
1818 Ga0496111_0336937 3300048914 Bacteria 1117
1819 Ga0496112_0000161 3300048915 Bacteria 42407
1820 Ga0496112_0006533 3300048915 Bacteria 10253
1821 Ga0496112_0006858 3300048915 Bacteria 10042
1822 Ga0496112_0020565 3300048915 Bacteria 6257
1823 Ga0496112_0092289 3300048915 Bacteria 2997
1824 Ga0496112_0126383 3300048915 Bacteria 2527
1825 Ga0496112_0523582 3300048915 Bacteria 1120
1826 Ga0496113_0001079 3300048916 Bacteria 14769
1827 Ga0496113_0004623 3300048916 Bacteria 8484
1828 Ga0496113_0016895 3300048916 Bacteria 5051
1829 Ga0496113_0106545 3300048916 Bacteria 2177
1830 Ga0496113_0376792 3300048916 Bacteria 1139
1831 Ga0496114_0000092 3300048917 Bacteria 64974
1832 Ga0496115_0000428 3300048918 Bacteria 34193
1833 Ga0496116_0011628 3300048919 Bacteria 7263
1834 Ga0496116_0231958 3300048919 Bacteria 935
1835 Ga0496117_0005240 3300048920 Bacteria 13757
1836 Ga0496117_0009462 3300048920 Bacteria 9064
1837 Ga0496117_0121334 3300048920 Bacteria 1605
1838 Ga0496117_0128330 3300048920 Bacteria 1542
1839 Ga0496117_0171657 3300048920 Bacteria 1258
1840 Ga0496118_0000811 3300048921 Bacteria 49879
1841 Ga0496118_0020700 3300048921 Bacteria 5824
1842 Ga0496118_0125414 3300048921 Bacteria 1663
1843 Ga0496118_0126319 3300048921 Bacteria 1654
1844 Ga0496118_0330670 3300048921 Bacteria 822
1845 Ga0496118_0358344 3300048921 Bacteria 774
1846 Ga0496119_0107113 3300048922 Bacteria 1559
1847 Ga0496120_0023040 3300048923 Bacteria 3904
1848 Ga0496120_0082963 3300048923 Bacteria 1731
1849 Ga0496121_0000072 3300048924 Bacteria 244975
1850 Ga0496121_0000347 3300048924 Bacteria 96608
1851 Ga0496121_0000349 3300048924 Bacteria 96428
1852 Ga0496121_0018980 3300048924 Bacteria 6899
1853 Ga0496121_0048291 3300048924 Bacteria 3622
1854 Ga0496121_0072540 3300048924 Bacteria 2763
1855 Ga0496122_0067295 3300048925 Bacteria 2581
1856 Ga0496122_0085973 3300048925 Bacteria 2167
1857 Ga0496123_0044190 3300048926 Bacteria 3049
1858 Ga0496124_0000739 3300048927 Bacteria 53515
1859 Ga0496124_0138395 3300048927 Bacteria 1925
1860 Ga0496124_0223914 3300048927 Bacteria 1412
1861 Ga0496124_0419293 3300048927 Bacteria 923
1862 Ga0496124_0536752 3300048927 Bacteria 775
1863 Ga0496125_0029187 3300048928 Bacteria 4962
1864 Ga0496125_0040228 3300048928 Bacteria 4013
1865 Ga0496125_0102662 3300048928 Bacteria 2100
1866 Ga0496125_0132121 3300048928 Bacteria 1755
1867 Ga0496126_0044387 3300048929 Bacteria 4094
1868 Ga0496126_0215458 3300048929 Bacteria 1615
1869 Ga0496126_0608755 3300048929 Bacteria 860
1870 Ga0501306_005744 3300049127 Bacteria 1435
1871 Ga0501306_005768 3300049127 Bacteria 1433
1872 Ga0501309_032117 3300049129 Bacteria 778
1873 Ga0501309_033098 3300049129 Bacteria 769
1874 Ga0501310_035028 3300049130 Bacteria 680
1875 Ga0501305_006306 3300049161 Bacteria 1468
1876 Ga0501307_014062 3300049162 Bacteria 973
1877 Ga0495678_019508 3300049459 Bacteria 3023
1878 Ga0495682_0029467 3300049460 Bacteria 2033
1879 Ga0495682_0054194 3300049460 Bacteria 1456
1880 Ga0501290_000007 3300049513 Bacteria 38548
1881 Ga0501292_000015 3300049515 Bacteria 64087
1882 Ga0501294_000459 3300049517 Bacteria 4795
1883 Ga0501300_002035 3300049523 Bacteria 3015
1884 Ga0501311_027722 3300049527 Bacteria 805
1885 Ga0501312_006891 3300049528 Bacteria 1435
1886 Ga0501313_010755 3300049529 Bacteria 1047
1887 Ga0501314_002498 3300049530 Bacteria 1426
1888 Ga0501315_011815 3300049531 Bacteria 1071
1889 Ga0501317_000859 3300049533 Bacteria 2388
1890 Ga0501317_008890 3300049533 Bacteria 1168
1891 Ga0501323_027378 3300049539 Bacteria 785
1892 Ga0501323_027665 3300049539 Bacteria 782
1893 Ga0501324_002322 3300049540 Bacteria 1368
1894 Ga0501324_008476 3300049540 Bacteria 907
1895 Ga0501333_002519 3300049549 Bacteria 1078
1896 Ga0501335_002933 3300049551 Bacteria 1420
1897 Ga0501337_005934 3300049553 Bacteria 826
1898 Ga0501338_03161 3300049554 Bacteria 964
1899 Ga0501031_0401735 3300049568 Bacteria 886
1900 Ga0501032_0143636 3300049569 Bacteria 1571
1901 Ga0501033_0156163 3300049570 Bacteria 1644
1902 Ga0501034_0056271 3300049571 Bacteria 3958
1903 Ga0501034_0298252 3300049571 Bacteria 1549
1904 Ga0501036_0518949 3300049572 Bacteria 991
1905 Ga0501043_0150904 3300049579 Bacteria 1819
1906 Ga0501043_0214668 3300049579 Bacteria 1490
1907 Ga0501046_0236856 3300049580 Bacteria 1347
1908 Ga0501047_0076865 3300049581 Bacteria 3213
1909 Ga0501047_0520160 3300049581 Bacteria 1016
1910 Ga0501047_0689180 3300049581 Bacteria 840
1911 Ga0501068_0173040 3300049584 Bacteria 1363
1912 Ga0501070_0080765 3300049586 Bacteria 2690
1913 Ga0501070_0210243 3300049586 Bacteria 1597
1914 Ga0501198_007662 3300049649 Bacteria 1556
1915 Ga0501206_001153 3300049653 Bacteria 3295
1916 Ga0501209_111683 3300049656 Bacteria 807
1917 Ga0501222_001017 3300049662 Bacteria 3992
1918 Ga0501223_000042 3300049663 Bacteria 44258
1919 Ga0501223_000214 3300049663 Bacteria 14812
1920 Ga0501223_004972 3300049663 Bacteria 2812
1921 Ga0501224_000031 3300049664 Bacteria 43294
1922 Ga0501224_008638 3300049664 Bacteria 1486
1923 Ga0501227_066995 3300049665 Bacteria 928
1924 Ga0501233_000068 3300049668 Bacteria 13583
1925 Ga0501233_065502 3300049668 Bacteria 911
1926 Ga0501235_008358 3300049669 Bacteria 2258
1927 Ga0501235_013185 3300049669 Bacteria 1819
1928 Ga0501249_000079 3300049679 Bacteria 31536
1929 Ga0501257_001257 3300049686 Bacteria 5208
1930 Ga0501261_001291 3300049690 Bacteria 3075
1931 Ga0501221_004253 3300049704 Bacteria 2374
1932 Ga0501225_0000070 3300049705 Bacteria 33694
1933 Ga0501225_0000520 3300049705 Bacteria 12018
1934 Ga0501225_0003808 3300049705 Bacteria 4533
1935 Ga0501225_0019156 3300049705 Bacteria 1894
1936 Ga0501225_0108329 3300049705 Bacteria 817
1937 Ga0501229_012675 3300049706 Bacteria 1078
1938 Ga0501234_001986 3300049707 Bacteria 3235
1939 Ga0501245_003957 3300049708 Bacteria 2025
1940 Ga0501080_0090579 3300049742 Bacteria 2841
1941 Ga0501080_0226892 3300049742 Bacteria 1708
1942 Ga0501262_006069 3300049759 Bacteria 1438
1943 Ga0501272_015792 3300049769 Bacteria 880
1944 Ga0501273_010471 3300049770 Bacteria 1140
1945 Ga0501279_000015 3300049775 Bacteria 64426
1946 Ga0501279_013398 3300049775 Bacteria 1123
1947 Ga0501280_000076 3300049776 Bacteria 26206
1948 Ga0501281_00692 3300049777 Bacteria 2928
1949 Ga0501282_017523 3300049778 Bacteria 781
1950 Ga0501035_0320754 3300049822 Bacteria 1302
1951 Ga0501044_0055834 3300049823 Bacteria 4055
1952 Ga0501044_0061238 3300049823 Bacteria 3851
1953 Ga0501044_0505326 3300049823 Bacteria 1109
1954 Ga0501204_024551 3300049850 Bacteria 806
1955 Ga0501226_000051 3300049853 Bacteria 49149
1956 nmdc:mga00v17_334012_c1 3300050491 Bacteria 985
1957 nmdc:mga0yw44_521925_c1 3300050492 Bacteria 806
1958 nmdc:mga06z11_513_c1 3300050494 Bacteria 14293
1959 nmdc:mga04h51_241_c1 3300050495 Bacteria 14370
1960 nmdc:mga07m45_107902_c1 3300050496 Bacteria 1602
1961 nmdc:mga07m45_70943_c1 3300050496 Bacteria 1982
1962 nmdc:mga0qj67_45931_c1 3300050509 Bacteria 3446
1963 Ga0495612_0109925 3300053078 Bacteria 1179
1964 Ga0500610_0000069 3300053079 Bacteria 31273
1965 Ga0500643_000166 3300053087 Bacteria 65586
1966 Ga0500643_001656 3300053087 Bacteria 12420
1967 Ga0500643_008204 3300053087 Bacteria 4129
1968 Ga0500643_017972 3300053087 Bacteria 2356
1969 Ga0500643_042974 3300053087 Bacteria 1319
1970 Ga0500566_0000633 3300053094 Bacteria 19622
1971 Ga0500641_0015756 3300053096 Bacteria 2810
1972 Ga0500555_000965 3300053103 Bacteria 9967
1973 Ga0500562_124647 3300053108 Bacteria 702
1974 Ga0500572_153674 3300053111 Bacteria 752
1975 Ga0500592_000226 3300053116 Bacteria 10274
1976 Ga0500595_017070 3300053119 Bacteria 2690
1977 Ga0500597_016953 3300053120 Bacteria 2791
1978 Ga0500642_0000268 3300053130 Bacteria 19498
1979 Ga0500652_063317 3300053131 Bacteria 1526
1980 Ga0500559_0000227 3300053136 Bacteria 44722
1981 Ga0500559_0009983 3300053136 Bacteria 4090
1982 Ga0500559_0162447 3300053136 Bacteria 1050
1983 Ga0500568_0006231 3300053139 Bacteria 6021
1984 Ga0500573_0000045 3300053140 Bacteria 98878
1985 Ga0500604_0017646 3300053151 Bacteria 1979
1986 Ga0500616_0009696 3300053153 Bacteria 5825
1987 Ga0500622_0336067 3300053156 Bacteria 632
1988 Ga0500624_000001 3300053157 Bacteria 284974
1989 Ga0500627_0276073 3300053158 Bacteria 739
1990 Ga0500639_167588 3300053163 Bacteria 990
1991 Ga0500637_0001304 3300053178 Bacteria 10485
1992 Ga0500637_0318890 3300053178 Bacteria 840
1993 Ga0500611_000848 3300053727 Bacteria 3173
1994 Ga0500645_000037 3300053730 Bacteria 112944
1995 Ga0500645_064700 3300053730 Bacteria 1054
1996 Ga0500596_013838 3300053735 Bacteria 1216
1997 Ga0587084_006819 3300059477 Bacteria 1399
1998 Ga0587090_005411 3300059510 Bacteria 1599
1999 Ga0587092_008218 3300059512 Bacteria 1373
2000 Ga0587101_025311 3300059623 Bacteria 888
2001 Ga0587068_043091 3300059641 Bacteria 823
2002 Ga0587076_089455 3300059645 Bacteria 671
2003 Ga0587079_052713 3300059647 Bacteria 859
2004 Ga0587120_014612 3300059659 Bacteria 703
2005 Ga0466962_0003328 3300061719 Bacteria 7636
2006 Ga0466962_0064663 3300061719 Bacteria 1746
2007 Ga0466962_0081669 3300061719 Bacteria 1546
2008 Ga0466962_0112922 3300061719 Bacteria 1309
2009 2512643284 2512564014 Bacteria 4639632
2010 2600200515 2599185354 Bacteria 4398675
2011 2644037113 2643221605 Bacteria 4772303
2012 2644043639 2643221606 Bacteria 5588032
2013 2644126311 2643221622 Bacteria 4212502
2014 2644393798 2643221671 Bacteria 5496681
2015 2738850997 2738541301 Bacteria 4834102
2016 2738866727 2738541304 Bacteria 4833665
2017 2739299244 2738543022 Bacteria 4835059
2018 2739360923 2738543033 Bacteria 4833336
2019 2753763703 2751185897 Bacteria 5322941
2020 2778123886 2775507255 Bacteria 3945731
2021 2830076774 2830075706 Bacteria 3855215
2022 2879166782 2879163058 Bacteria 4223965
2023 2885427816 2885427238 Bacteria 2291351
2024 2896430826 2896429255 Bacteria 2557483
2025 2919141385 2919138771 Bacteria 5281312
2026 2919711411 2919709256 Bacteria 4318106
2027 2928027773 2928027323 Bacteria 4382488
2028 2928103881 2928100450 Bacteria 4837635
2029 2928527193 2928526807 Bacteria 4760224
2030 2928961810 2928959182 Bacteria 4725774
2031 2928969321 2928968154 Bacteria 4633371
2032 2946788040 2946787523 Bacteria 4366789
2033 2984557934 2984555340 Bacteria 4247089
2034 2984567701 2984564862 Bacteria 4339992
2035 2990267382 2990265787 Bacteria 3943888
2036 2993358752 2993356040 Bacteria 4247105
2037 2993695383 2993693658 Bacteria 4040749
2038 8057103717 8057101203 Bacteria 5034064
2039 Ga0070661_100398033
2040 SwRhRL2b_contig_3230906
2041 ARcpr5oldR_c000971
2042 ARcpr5yngRDRAFT_c003421
2043 JGI24736J21556_1000110
2044 JGI24741J21665_1000982
2045 JGI24741J21665_1000991
2046 JGI24741J21665_1001534
2047 JGI24752J21851_1000117
2048 JGI24752J21851_1006279
2049 JGI24747J21853_1002726
2050 JGI24740J21852_10000594
2051 JGI24740J21852_10001036
2052 JGI24740J21852_10004545
2053 JGI24740J21852_10010914
2054 JGI24740J21852_10013016
2055 JGI24740J21852_10019603
2056 JGI24740J21852_10019834
2057 JGI24740J21852_10026549
2058 JGI24740J21852_10076847
2059 JGI24740J21852_10093189
2060 JGI24739J22299_10000311
2061 JGI24739J22299_10005667
2062 JGI24739J22299_10009771
2063 JGI24739J22299_10025725
2064 JGI24739J22299_10026329
2065 JGI24739J22299_10028375
2066 JGI24739J22299_10037282
2067 JGI24739J22299_10060964
2068 JGI24739J22299_10093185
2069 JGI24739J22299_10108056
2070 JGI24737J22298_10000013
2071 JGI24737J22298_10000835
2072 JGI24737J22298_10001767
2073 JGI24737J22298_10003617
2074 JGI24737J22298_10005360
2075 JGI24737J22298_10008817
2076 JGI24737J22298_10012770
2077 JGI24737J22298_10026184
2078 JGI24737J22298_10076503
2079 JGI24743J22301_10009940
2080 JGI24735J21928_10002484
2081 JGI24735J21928_10009345
2082 JGI24735J21928_10009748
2083 JGI24735J21928_10022329
2084 JGI24735J21928_10037095
2085 JGI24735J21928_10037412
2086 JGI24735J21928_10046901
2087 JGI24735J21928_10089369
2088 JGI24735J21928_10091937
2089 JGI24750J21931_1000571
2090 JGI24748J21848_1000029
2091 JGI24738J21930_10001262
2092 JGI24738J21930_10001427
2093 JGI24738J21930_10003000
2094 JGI24738J21930_10004129
2095 JGI24738J21930_10005863
2096 JGI24738J21930_10011719
2097 JGI24738J21930_10019475
2098 JGI24749J21850_1000261
2099 JGI24744J21845_10005812
2100 JGI24034J26672_10000006
2101 JGI24742J22300_10002400
2102 JGI24742J22300_10014313
2103 JGI24751J29686_10012811
2104 JGI25164J39214_1008973
2105 JGI25150J39212_1000596
2106 JGI25150J39212_1018431
2107 JGI25151J46595_10013195
2108 JGI25406J46586_10102049
2109 JGI25165J46597_1000053
2110 JGI25165J46597_1000165
2111 JGI25153J46596_10000006
2112 JGI25153J46596_10000017
2113 JGI25153J46596_10025162
2114 rootH1_10012727
2115 Ga0007429J51699_1036535
2116 Ga0055525_1000040
2117 Ga0055542_1000078
2118 Ga0055542_1000791
2119 Ga0055542_1009231
2120 Ga0055529_1000007
2121 Ga0055529_1006108
2122 Ga0055526_1004025
2123 Ga0055526_1041573
2124 Ga0055537_1000962
2125 Ga0055537_1003028
2126 Ga0055524_1000452
2127 Ga0055536_1017681
2128 Ga0055530_10005445
2129 Ga0055530_10009326
2130 Ga0055540_1001980
2131 Ga0055531_10000008
2132 Ga0055531_10028572
2133 Ga0065165_1002723
2134 Ga0065165_1005838
2135 Ga0065165_1007422
2136 Ga0065165_1033397
2137 Ga0065714_10076962
2138 Ga0065704_10000743
2139 Ga0065704_10153439
2140 Ga0065704_10274314
2141 Ga0065715_10098195
2142 Ga0065707_10083015
2143 Ga0065707_10099471
2144 Ga0070658_10007219
2145 Ga0070658_10017258
2146 Ga0070658_10019971
2147 Ga0070658_10023993
2148 Ga0070658_10033532
2149 Ga0070658_10045216
2150 Ga0070658_10046129
2151 Ga0070658_10059369
2152 Ga0070658_10100378
2153 Ga0070658_10108359
2154 Ga0070658_10167078
2155 Ga0070658_10261987
2156 Ga0070658_10362812
2157 Ga0070658_10426160
2158 Ga0070658_10426804
2159 Ga0070658_10442405
2160 Ga0070658_10474341
2161 Ga0070676_10003637
2162 Ga0070676_10004126
2163 Ga0070676_10073929
2164 Ga0070676_10078205
2165 Ga0070676_10212087
2166 Ga0070683_100057532
2167 Ga0070683_100107355
2168 Ga0070683_100126568
2169 Ga0070683_100155367
2170 Ga0070683_100232054
2171 Ga0070683_100330394
2172 Ga0070683_100491192
2173 Ga0070683_100930702
2174 Ga0070690_100000002
2175 Ga0070690_100010584
2176 Ga0070690_100010994
2177 Ga0070670_100005828
2178 Ga0070670_100026630
2179 Ga0070670_100029191
2180 Ga0070670_100035587
2181 Ga0070670_100070080
2182 Ga0070670_100304119
2183 Ga0070670_100673807
2184 Ga0070670_100705091
2185 Ga0070670_101037334
2186 Ga0070677_10008070
2187 Ga0070677_10011538
2188 Ga0070677_10012863
2189 Ga0068869_100000225
2190 Ga0068869_100000237
2191 Ga0068869_100092294
2192 Ga0070666_10000002
2193 Ga0070666_10002523
2194 Ga0070666_10023981
2195 Ga0070666_10025521
2196 Ga0070666_10131460
2197 Ga0070666_10578448
2198 Ga0070666_10867401
2199 Ga0070680_100006563
2200 Ga0070680_100028716
2201 Ga0070680_100084875
2202 Ga0070680_100098387
2203 Ga0070680_100122358
2204 Ga0070680_100295689
2205 Ga0070682_100145093
2206 Ga0070682_100326363
2207 Ga0070682_100366686
2208 Ga0070682_100594706
2209 Ga0068868_100000013
2210 Ga0068868_100001197
2211 Ga0068868_100002570
2212 Ga0068868_100059688
2213 Ga0068868_100084629
2214 Ga0068868_100530864
2215 Ga0068868_100677396
2216 Ga0070660_100006734
2217 Ga0070660_100011916
2218 Ga0070660_100012723
2219 Ga0070660_100012788
2220 Ga0070660_100017639
2221 Ga0070660_100023713
2222 Ga0070660_100030095
2223 Ga0070660_100044682
2224 Ga0070660_100066481
2225 Ga0070660_100119371
2226 Ga0070660_100174346
2227 Ga0070660_100185020
2228 Ga0070660_100243707
2229 Ga0070689_100754861
2230 Ga0070691_10000673
2231 Ga0070687_100200798
2232 Ga0070661_100008588
2233 Ga0070661_100011642
2234 Ga0070661_100014173
2235 Ga0070661_100016317
2236 Ga0070661_100020121
2237 Ga0070661_100035691
2238 Ga0070661_100043002
2239 Ga0070661_100054342
2240 Ga0070661_100069336
2241 Ga0070661_100072020
2242 Ga0070661_100089673
2243 Ga0070661_100108498
2244 Ga0070661_100140882
2245 Ga0070661_100159968
2246 Ga0070661_100188976
2247 Ga0070661_100213332
2248 Ga0070661_100584682
2249 Ga0070661_100628744
2250 Ga0070692_10002334
2251 Ga0070692_10022048
2252 Ga0070668_100023073
2253 Ga0070668_100045056
2254 Ga0070668_100052544
2255 Ga0070668_100094565
2256 Ga0070668_100227246
2257 Ga0070669_100000078
2258 Ga0070669_100008277
2259 Ga0070669_100061781
2260 Ga0070669_100140188
2261 Ga0070669_100236194
2262 Ga0070669_100301660
2263 Ga0070669_100378276
2264 Ga0070669_100564065
2265 Ga0070675_100006462
2266 Ga0070671_100001626
2267 Ga0070671_100011784
2268 Ga0070671_100014039
2269 Ga0070671_100026211
2270 Ga0070671_100030708
2271 Ga0070671_100060274
2272 Ga0070671_100084165
2273 Ga0070671_100095853
2274 Ga0070671_100131669
2275 Ga0070671_100182805
2276 Ga0070671_100541354
2277 Ga0070674_100003736
2278 Ga0070674_100044508
2279 Ga0070674_100062222
2280 Ga0070674_100080452
2281 Ga0070674_100102304
2282 Ga0070674_100629632
2283 Ga0070673_100000002
2284 Ga0070673_100000113
2285 Ga0070673_100021007
2286 Ga0070673_100029419
2287 Ga0070673_100033993
2288 Ga0070673_100143519
2289 Ga0070673_100149747
2290 Ga0070673_100152269
2291 Ga0070673_100230244
2292 Ga0070688_100010565
2293 Ga0070659_100003603
2294 Ga0070659_100003637
2295 Ga0070659_100003958
2296 Ga0070659_100007496
2297 Ga0070659_100007614
2298 Ga0070659_100014821
2299 Ga0070659_100036603
2300 Ga0070659_100060491
2301 Ga0070659_100076677
2302 Ga0070659_100129735
2303 Ga0070659_100159504
2304 Ga0070659_100194843
2305 Ga0070659_100222148
2306 Ga0070659_100251614
2307 Ga0070659_100255325
2308 Ga0070659_100456606
2309 Ga0070659_100710208
2310 Ga0070659_100974101
2311 Ga0070667_100007592
2312 Ga0070667_100008122
2313 Ga0070667_100011649
2314 Ga0070667_100040063
2315 Ga0070667_100044428
2316 Ga0070667_100177674
2317 Ga0070667_100231273
2318 Ga0070667_100324669
2319 Ga0070667_100378489
2320 Ga0070667_100650041
2321 Ga0070667_100723454
2322 Ga0070714_100010147
2323 Ga0070714_100106803
2324 Ga0070714_100108202
2325 Ga0070714_100136912
2326 Ga0070714_100547661
2327 Ga0070714_100633533
2328 Ga0070713_100154621
2329 Ga0070713_101275045
2330 Ga0070694_100114028
2331 Ga0070663_100001785
2332 Ga0070663_100002614
2333 Ga0070663_100035078
2334 Ga0070663_100036804
2335 Ga0070663_100062847
2336 Ga0070663_100072677
2337 Ga0070663_100074794
2338 Ga0070663_100135948
2339 Ga0070663_100153503
2340 Ga0070663_100473719
2341 Ga0070663_100673606
2342 Ga0070678_100001865
2343 Ga0070678_100006193
2344 Ga0070678_100006524
2345 Ga0070678_100012935
2346 Ga0070678_100114172
2347 Ga0070678_100321904
2348 Ga0070678_101079006
2349 Ga0070662_100001998
2350 Ga0070662_100005546
2351 Ga0070662_100006784
2352 Ga0070662_100007277
2353 Ga0070662_100021491
2354 Ga0070662_100040361
2355 Ga0070662_100081331
2356 Ga0070662_100093220
2357 Ga0070662_100157411
2358 Ga0070662_100255435
2359 Ga0070662_100427614
2360 Ga0070662_100476600
2361 Ga0070662_100515641
2362 Ga0070662_100894096
2363 Ga0070681_10013052
2364 Ga0070681_10053445
2365 Ga0070681_10229528
2366 Ga0070681_10437426
2367 Ga0070681_10666781
2368 Ga0070681_10691416
2369 Ga0068867_100000012
2370 Ga0068867_100001363
2371 Ga0068867_100041848
2372 Ga0068867_100119211
2373 Ga0068867_100172524
2374 Ga0068867_100193077
2375 Ga0068867_100339272
2376 Ga0070685_10000056
2377 Ga0070685_10185584
2378 Ga0070679_100035071
2379 Ga0070679_100036988
2380 Ga0070679_100046887
2381 Ga0070679_100139319
2382 Ga0070679_100181563
2383 Ga0070679_100419492
2384 Ga0070679_100545200
2385 Ga0070679_100564692
2386 Ga0070684_100080997
2387 Ga0070684_100089976
2388 Ga0070684_100411618
2389 Ga0068853_100001253
2390 Ga0068853_100001390
2391 Ga0068853_100008536
2392 Ga0068853_100032065
2393 Ga0068853_100034610
2394 Ga0068853_100041927
2395 Ga0068853_100044210
2396 Ga0068853_100095002
2397 Ga0068853_100136236
2398 Ga0068853_100168375
2399 Ga0068853_100302858
2400 Ga0068853_100353936
2401 Ga0068853_100418229
2402 Ga0068853_100574269
2403 Ga0068853_100905068
2404 Ga0070672_100034757
2405 Ga0070672_100052000
2406 Ga0070672_100093351
2407 Ga0070672_100322334
2408 Ga0070672_100336119
2409 Ga0070672_100524245
2410 Ga0070672_100641005
2411 Ga0070686_100000002
2412 Ga0070686_100030015
2413 Ga0070686_100052566
2414 Ga0070686_100339924
2415 Ga0070695_100072948
2416 Ga0070696_100125082
2417 Ga0070696_100595710
2418 Ga0070696_100726468
2419 Ga0070693_100087267
2420 Ga0070693_100158225
2421 Ga0070693_100187534
2422 Ga0070665_100000025
2423 Ga0070665_100003898
2424 Ga0070665_100004114
2425 Ga0070665_100008348
2426 Ga0070665_100014696
2427 Ga0070665_100100753
2428 Ga0070665_100244808
2429 Ga0070665_100286359
2430 Ga0070665_100999570
2431 Ga0070704_100375178
2432 Ga0068855_100003124
2433 Ga0068855_100005719
2434 Ga0068855_100046618
2435 Ga0068855_100098889
2436 Ga0068855_100204747
2437 Ga0068855_100225629
2438 Ga0068855_100273721
2439 Ga0068855_100315702
2440 Ga0068855_100372072
2441 Ga0068855_100386202
2442 Ga0068855_100414184
2443 Ga0068855_100633198
2444 Ga0068855_100881370
2445 Ga0068855_100981388
2446 Ga0068855_101091374
2447 Ga0070664_100016140
2448 Ga0070664_100022762
2449 Ga0070664_100024836
2450 Ga0070664_100026135
2451 Ga0070664_100034407
2452 Ga0070664_100042114
2453 Ga0070664_100046135
2454 Ga0070664_100051211
2455 Ga0070664_100054109
2456 Ga0070664_100055976
2457 Ga0070664_100076181
2458 Ga0070664_100079137
2459 Ga0070664_100098785
2460 Ga0070664_100128768
2461 Ga0070664_100135308
2462 Ga0070664_100254373
2463 Ga0070664_100258121
2464 Ga0070664_100412830
2465 Ga0070664_100485328
2466 Ga0068857_100000736
2467 Ga0068857_100006657
2468 Ga0068857_100015256
2469 Ga0068857_100049513
2470 Ga0068857_100067292
2471 Ga0068857_100086426
2472 Ga0068857_100102735
2473 Ga0068857_100174580
2474 Ga0068857_100181248
2475 Ga0068857_100183849
2476 Ga0068857_100255432
2477 Ga0068857_100283080
2478 Ga0068857_100512624
2479 Ga0068854_100000306
2480 Ga0068854_100001981
2481 Ga0068854_100004380
2482 Ga0068854_100005946
2483 Ga0068854_100028745
2484 Ga0068854_100050137
2485 Ga0068854_100056103
2486 Ga0068854_100108056
2487 Ga0068854_100157827
2488 Ga0068854_100176807
2489 Ga0068854_100183145
2490 Ga0068854_100193076
2491 Ga0068854_100284143
2492 Ga0068854_100286311
2493 Ga0068854_100291170
2494 Ga0068854_100300913
2495 Ga0068854_100407423
2496 Ga0068856_100007389
2497 Ga0068856_100013594
2498 Ga0068856_100038415
2499 Ga0068856_100038930
2500 Ga0068856_100041186
2501 Ga0068856_100079590
2502 Ga0068856_100103666
2503 Ga0068856_100118846
2504 Ga0068856_100135858
2505 Ga0068856_100137688
2506 Ga0068856_100241818
2507 Ga0068856_100331344
2508 Ga0068856_100338459
2509 Ga0068856_100671866
2510 Ga0068856_100705216
2511 Ga0068856_101126795
2512 Ga0068856_101323769
2513 Ga0068856_101438005
2514 Ga0068852_100001648
2515 Ga0068852_100010470
2516 Ga0068852_100014770
2517 Ga0068852_100016593
2518 Ga0068852_100043248
2519 Ga0068852_100044260
2520 Ga0068852_100046086
2521 Ga0068852_100054789
2522 Ga0068852_100061149
2523 Ga0068852_100081898
2524 Ga0068852_100194808
2525 Ga0068852_100232945
2526 Ga0068852_100235773
2527 Ga0068852_100256428
2528 Ga0068852_100257697
2529 Ga0068852_100458313
2530 Ga0068852_100465834
2531 Ga0068852_100475867
2532 Ga0068852_100508471
2533 Ga0068852_100545318
2534 Ga0068852_101093148
2535 Ga0068859_100000689
2536 Ga0068859_100001164
2537 Ga0068859_100002480
2538 Ga0068859_100032129
2539 Ga0068859_100046919
2540 Ga0068859_100109007
2541 Ga0068859_100161272
2542 Ga0068859_100407607
2543 Ga0068859_100428816
2544 Ga0068859_100648769
2545 Ga0068859_101087852
2546 Ga0068864_100000764
2547 Ga0068864_100001152
2548 Ga0068864_100004561
2549 Ga0068864_100007092
2550 Ga0068864_100041416
2551 Ga0068864_100065993
2552 Ga0068864_100076147
2553 Ga0068864_100114253
2554 Ga0068864_100123463
2555 Ga0068864_100295414
2556 Ga0068866_10031178
2557 Ga0068866_10129524
2558 Ga0068866_10326062
2559 Ga0068861_100000005
2560 Ga0068861_100003714
2561 Ga0068861_100087199
2562 Ga0068861_100123824
2563 Ga0068861_100576059
2564 Ga0068861_100876984
2565 Ga0068851_10001992
2566 Ga0068851_10006539
2567 Ga0068851_10012700
2568 Ga0068851_10016068
2569 Ga0068851_10017185
2570 Ga0068851_10060597
2571 Ga0068851_10079544
2572 Ga0068870_10062275
2573 Ga0068870_10317466
2574 Ga0068863_100000070
2575 Ga0068863_100003743
2576 Ga0068863_100009132
2577 Ga0068863_100012748
2578 Ga0068863_100020017
2579 Ga0068863_100031670
2580 Ga0068858_100000956
2581 Ga0068858_100005166
2582 Ga0068858_100006215
2583 Ga0068858_100008940
2584 Ga0068858_100031031
2585 Ga0068858_100039796
2586 Ga0068858_100111521
2587 Ga0068858_100137772
2588 Ga0068858_100516657
2589 Ga0068860_100000001
2590 Ga0068860_100006578
2591 Ga0068860_100124167
2592 Ga0068860_100201974
2593 Ga0068860_100204294
2594 Ga0068860_100214794
2595 Ga0068860_100236066
2596 Ga0068862_100000020
2597 Ga0068862_100000702
2598 Ga0068862_100001089
2599 Ga0068862_100005835
2600 Ga0068862_100824275
2601 Ga0081455_10000477
2602 Ga0081540_1078141
2603 Ga0081539_10008339
2604 Ga0081539_10040401
2605 Ga0081539_10063450
2606 Ga0081539_10120854
2607 Ga0070717_10010182
2608 Ga0075368_10000465
2609 Ga0075364_10191074
2610 Ga0070716_100207191
2611 Ga0070712_100284140
2612 Ga0075367_10000528
2613 Ga0075366_10007416
2614 Ga0097621_100001363
2615 Ga0097621_100014112
2616 Ga0097621_100036110
2617 Ga0097621_100072455
2618 Ga0097621_100077246
2619 Ga0097621_100628490
2620 Ga0075370_10035118
2621 Ga0075370_10133409
2622 Ga0068871_100004771
2623 Ga0068871_100008587
2624 Ga0068871_100196745
2625 Ga0068871_100624407
2626 Ga0068871_100679875
2627 Ga0068871_100868813
2628 Ga0068865_100000004
2629 Ga0068865_100014339
2630 Ga0068865_100240340
2631 Ga0068865_100382932
2632 Ga0068865_100734278
2633 Ga0097620_100000689
2634 Ga0097620_100001164
2635 Ga0097620_100002480
2636 Ga0097620_100032131
2637 Ga0097620_100046919
2638 Ga0097620_100109006
2639 Ga0097620_100161278
2640 Ga0097620_100407613
2641 Ga0097620_100428767
2642 Ga0097620_100648752
2643 Ga0097620_101087752
2644 Ga0105251_10014991
2645 Ga0105250_10014249
2646 Ga0105250_10057796
2647 Ga0105240_10004392
2648 Ga0105240_10012494
2649 Ga0105240_10016200
2650 Ga0105240_10033235
2651 Ga0105240_10168669
2652 Ga0105240_10321673
2653 Ga0105240_10332249
2654 Ga0105240_10588465
2655 Ga0105240_10854143
2656 Ga0105245_10000195
2657 Ga0105245_10000275
2658 Ga0105245_10026400
2659 Ga0105247_10005531
2660 Ga0114129_10214530
2661 Ga0105243_10000146
2662 Ga0105243_10000164
2663 Ga0105243_10215368
2664 Ga0105243_10270691
2665 Ga0105243_10349110
2666 Ga0105243_10358991
2667 Ga0105241_10047496
2668 Ga0105241_10076161
2669 Ga0105241_10233554
2670 Ga0105241_10305373
2671 Ga0105241_10359582
2672 Ga0105241_11135356
2673 Ga0105242_10000943
2674 Ga0105242_10173450
2675 Ga0105242_10750569
2676 Ga0105248_10002856
2677 Ga0105248_10003607
2678 Ga0105248_10012759
2679 Ga0105248_10018539
2680 Ga0105248_10023059
2681 Ga0105248_10253631
2682 Ga0105248_10350942
2683 Ga0105248_10358555
2684 Ga0105248_10733694
2685 Ga0105237_10015881
2686 Ga0105237_10018056
2687 Ga0105237_10019254
2688 Ga0105237_10027667
2689 Ga0105237_10057560
2690 Ga0105237_10194946
2691 Ga0105237_10410907
2692 Ga0105237_10621132
2693 Ga0105238_10030198
2694 Ga0105238_10032364
2695 Ga0105238_10032773
2696 Ga0105238_10148934
2697 Ga0105238_10302540
2698 Ga0105238_10361224
2699 Ga0105238_10521334
2700 Ga0105238_10546078
2701 Ga0105249_10000005
2702 Ga0105249_10000097
2703 Ga0105249_10019285
2704 Ga0105249_10028412
2705 Ga0105249_10053425
2706 Ga0105249_10061804
2707 Ga0105249_10432012
2708 Ga0105249_10491226
2709 Ga0105249_10580497
2710 Ga0105249_10903603
2711 Ga0105249_11132944
2712 Ga0105249_11379244
2713 Ga0105239_10000104
2714 Ga0105239_10055897
2715 Ga0105239_10145471
2716 Ga0105239_10214248
2717 Ga0105239_10474092
2718 Ga0105239_10897375
2719 Ga0105239_10908296
2720 Ga0105239_10926436
2721 Ga0105246_10004302
2722 Ga0105246_10151641
2723 Ga0105246_10255540
2724 Ga0105246_10421353
2725 Ga0105246_10622155
2726 Ga0157317_1000906
2727 Ga0157327_1008778
2728 Ga0157373_10026426
2729 Ga0157373_10039540
2730 Ga0157373_10085128
2731 Ga0157373_10091018
2732 Ga0157373_10091080
2733 Ga0157373_10158216
2734 Ga0157373_10167203
2735 Ga0157373_10167384
2736 Ga0157373_10177754
2737 Ga0157373_10203758
2738 Ga0157373_10248363
2739 Ga0157373_10380692
2740 Ga0157371_10000637
2741 Ga0157371_10033519
2742 Ga0157371_10042412
2743 Ga0157371_10044078
2744 Ga0157371_10044196
2745 Ga0157371_10054017
2746 Ga0157371_10076807
2747 Ga0157371_10084425
2748 Ga0157371_10110729
2749 Ga0157371_10305919
2750 Ga0157371_10311198
2751 Ga0157371_10688070
2752 Ga0157370_10004829
2753 Ga0157370_10011178
2754 Ga0157370_10049711
2755 Ga0157370_10069321
2756 Ga0157370_10072786
2757 Ga0157370_10185576
2758 Ga0157370_10517719
2759 Ga0157370_10668379
2760 Ga0157370_10685037
2761 Ga0157369_10008501
2762 Ga0157369_10018433
2763 Ga0157369_10037284
2764 Ga0157369_10081998
2765 Ga0157369_10090703
2766 Ga0157369_10178401
2767 Ga0157369_10182533
2768 Ga0157369_10223249
2769 Ga0157369_10231357
2770 Ga0157369_10313222
2771 Ga0157369_10354454
2772 Ga0157369_10484221
2773 Ga0157369_10525148
2774 Ga0157369_10640820
2775 Ga0157369_10737342
2776 Ga0157369_10899987
2777 Ga0157374_10001738
2778 Ga0157374_10006891
2779 Ga0157374_10007945
2780 Ga0157374_10040849
2781 Ga0157374_10092230
2782 Ga0157374_10352727
2783 Ga0157374_11010713
2784 Ga0157378_10000408
2785 Ga0157378_10026677
2786 Ga0157378_10106061
2787 Ga0157378_10330333
2788 Ga0163162_10017714
2789 Ga0163162_10076882
2790 Ga0163162_10156896
2791 Ga0163162_10188736
2792 Ga0163162_10213629
2793 Ga0163162_11237229
2794 Ga0157372_10010467
2795 Ga0157372_10068515
2796 Ga0157372_10077873
2797 Ga0157372_10088501
2798 Ga0157372_10162368
2799 Ga0157372_10186145
2800 Ga0157372_10276877
2801 Ga0157372_10367222
2802 Ga0157372_10386951
2803 Ga0157372_10434655
2804 Ga0157372_10490966
2805 Ga0157372_10668220
2806 Ga0157372_10718543
2807 Ga0157372_11134075
2808 Ga0157372_11285225
2809 Ga0157375_10005342
2810 Ga0157375_10022053
2811 Ga0157375_10035812
2812 Ga0157375_10061117
2813 Ga0157375_10569314
2814 Ga0157375_10769756
2815 Ga0157375_11851690
2816 Ga0163163_10000500
2817 Ga0163163_10060897
2818 Ga0163163_10380871
2819 Ga0157380_10000280
2820 Ga0157380_10001415
2821 Ga0157380_10145536
2822 Ga0157380_10766690
2823 Ga0157380_10983633
2824 Ga0182008_10064342
2825 Ga0157377_10001666
2826 Ga0157377_10039898
2827 Ga0157377_10137769
2828 Ga0157377_10389368
2829 Ga0157377_10573703
2830 Ga0157379_10010704
2831 Ga0157379_10034850
2832 Ga0157379_10050088
2833 Ga0157379_10082736
2834 Ga0157379_10108244
2835 Ga0157379_10319316
2836 Ga0157376_10000128
2837 Ga0157376_10004672
2838 Ga0183363_1001
2839 Ga0163161_10002791
2840 Ga0163161_10064295
2841 Ga0163161_10228675
2842 Ga0163161_10333951
2843 Ga0197907_10628569
2844 Ga0206355_1265600
2845 Ga0206355_1403083
2846 Ga0206351_10532014
2847 Ga0206354_10542035
2848 Ga0213875_10000897
2849 Ga0224712_10073116
2850 Ga0207672_1000695
2851 Ga0209674_105486
2852 Ga0209147_100569
2853 Ga0209563_100019
2854 Ga0207427_100922
2855 Ga0207425_1000022
2856 Ga0207425_1003889
2857 Ga0209646_1003961
2858 Ga0209026_1001085
2859 Ga0209026_1013778
2860 Ga0209148_1000026
2861 Ga0209148_1000116
2862 Ga0209148_1004852
2863 Ga0209129_1000525
2864 Ga0209233_1000098
2865 Ga0209233_1000119
2866 Ga0209565_1000010
2867 Ga0209565_1000100
2868 Ga0207666_1016789
2869 Ga0209455_1000005
2870 Ga0209455_1000767
2871 Ga0209455_1034396
2872 Ga0209673_1011463
2873 Ga0209673_1019761
2874 Ga0209676_1009533
2875 Ga0209025_1000842
2876 Ga0209564_1003336
2877 Ga0209564_1018267
2878 Ga0209564_1028366
2879 Ga0209758_1000001
2880 Ga0209758_1000004
2881 Ga0209758_1011966
2882 Ga0209758_1012371
2883 Ga0209050_1000001
2884 Ga0209050_1000026
2885 Ga0209050_1011009
2886 Ga0209050_1022005
2887 Ga0209256_1000010
2888 Ga0207426_1060445
2889 Ga0207426_1065511
2890 Ga0209051_1000279
2891 Ga0209257_1000009
2892 Ga0209257_1004523
2893 Ga0209257_1018759
2894 Ga0207697_10002366
2895 Ga0207697_10012951
2896 Ga0207697_10037553
2897 Ga0207697_10058229
2898 Ga0207656_10005833
2899 Ga0207656_10014997
2900 Ga0207656_10016553
2901 Ga0207656_10020509
2902 Ga0207656_10029158
2903 Ga0207656_10034120
2904 Ga0207656_10051737
2905 Ga0207656_10106117
2906 Ga0207656_10215258
2907 Ga0207696_1011929
2908 Ga0207713_1030060
2909 Ga0207682_10000417
2910 Ga0207682_10032814
2911 Ga0207692_10157007
2912 Ga0207642_10055169
2913 Ga0207642_10063806
2914 Ga0207642_10193416
2915 Ga0207710_10012743
2916 Ga0207688_10011182
2917 Ga0207688_10043874
2918 Ga0207688_10103714
2919 Ga0207688_10187341
2920 Ga0207680_10000004
2921 Ga0207680_10000793
2922 Ga0207680_10002831
2923 Ga0207680_10006622
2924 Ga0207680_10022044
2925 Ga0207680_10132330
2926 Ga0207680_10292015
2927 Ga0207680_10501621
2928 Ga0207647_10000450
2929 Ga0207647_10001366
2930 Ga0207647_10001428
2931 Ga0207647_10001605
2932 Ga0207647_10004391
2933 Ga0207647_10005058
2934 Ga0207647_10021214
2935 Ga0207647_10080102
2936 Ga0207647_10104293
2937 Ga0207647_10121437
2938 Ga0207647_10136520
2939 Ga0207647_10139122
2940 Ga0207647_10316852
2941 Ga0207645_10003385
2942 Ga0207645_10006329
2943 Ga0207645_10013619
2944 Ga0207645_10020146
2945 Ga0207645_10069037
2946 Ga0207645_10110518
2947 Ga0207645_10147536
2948 Ga0207643_10327096
2949 Ga0207705_10004442
2950 Ga0207705_10004859
2951 Ga0207705_10005992
2952 Ga0207705_10012595
2953 Ga0207705_10012814
2954 Ga0207705_10015325
2955 Ga0207705_10016836
2956 Ga0207705_10028578
2957 Ga0207705_10062830
2958 Ga0207705_10082172
2959 Ga0207705_10092046
2960 Ga0207705_10167823
2961 Ga0207705_10198291
2962 Ga0207705_10208165
2963 Ga0207705_10240335
2964 Ga0207705_10246870
2965 Ga0207705_10258245
2966 Ga0207705_10286219
2967 Ga0207705_10413344
2968 Ga0207705_10533777
2969 Ga0207654_10002603
2970 Ga0207654_10015435
2971 Ga0207707_10017099
2972 Ga0207707_10043923
2973 Ga0207707_10075837
2974 Ga0207707_10280179
2975 Ga0207707_10281123
2976 Ga0207707_10314569
2977 Ga0207707_10566755
2978 Ga0207707_10746584
2979 Ga0207695_10010505
2980 Ga0207695_10017424
2981 Ga0207695_10025246
2982 Ga0207695_10065915
2983 Ga0207695_10066126
2984 Ga0207695_10165792
2985 Ga0207695_10172618
2986 Ga0207695_10414308
2987 Ga0207695_10484053
2988 Ga0207671_10001601
2989 Ga0207671_10001907
2990 Ga0207671_10012401
2991 Ga0207671_10026831
2992 Ga0207671_10109655
2993 Ga0207671_10137492
2994 Ga0207671_10166107
2995 Ga0207693_10025397
2996 Ga0207693_10281847
2997 Ga0207663_10117300
2998 Ga0207660_10000036
2999 Ga0207660_10017439
3000 Ga0207660_10090677
3001 Ga0207660_10109095
3002 Ga0207660_10127011
3003 Ga0207660_10132255
3004 Ga0207660_10146102
3005 Ga0207660_10171320
3006 Ga0207660_10255822
3007 Ga0207660_10641789
3008 Ga0207660_10766184
3009 Ga0207657_10001825
3010 Ga0207657_10003125
3011 Ga0207657_10003140
3012 Ga0207657_10006548
3013 Ga0207657_10009031
3014 Ga0207657_10009948
3015 Ga0207657_10015454
3016 Ga0207657_10020873
3017 Ga0207657_10021840
3018 Ga0207657_10023414
3019 Ga0207657_10028619
3020 Ga0207657_10029076
3021 Ga0207657_10034505
3022 Ga0207657_10036123
3023 Ga0207657_10036409
3024 Ga0207657_10054959
3025 Ga0207657_10055505
3026 Ga0207657_10069195
3027 Ga0207657_10111534
3028 Ga0207657_10112650
3029 Ga0207657_10125891
3030 Ga0207657_10152566
3031 Ga0207657_10288960
3032 Ga0207657_10325416
3033 Ga0207657_10337786
3034 Ga0207657_10421043
3035 Ga0207657_10458634
3036 Ga0207657_10562663
3037 Ga0207657_10634173
3038 Ga0207649_10002156
3039 Ga0207649_10023188
3040 Ga0207649_10028053
3041 Ga0207649_10030980
3042 Ga0207649_10032642
3043 Ga0207649_10039151
3044 Ga0207649_10076629
3045 Ga0207649_10156205
3046 Ga0207649_10158723
3047 Ga0207649_10204995
3048 Ga0207649_10220816
3049 Ga0207649_10386137
3050 Ga0207649_10409089
3051 Ga0207649_10523493
3052 Ga0207652_10031855
3053 Ga0207652_10062022
3054 Ga0207652_10075635
3055 Ga0207652_10080614
3056 Ga0207652_10220681
3057 Ga0207652_10277269
3058 Ga0207652_10326654
3059 Ga0207681_10000130
3060 Ga0207681_10325509
3061 Ga0207681_10355686
3062 Ga0207694_10003169
3063 Ga0207694_10003700
3064 Ga0207694_10020155
3065 Ga0207694_10037544
3066 Ga0207694_10071926
3067 Ga0207694_10089680
3068 Ga0207694_10099374
3069 Ga0207694_10105007
3070 Ga0207694_10132697
3071 Ga0207694_10276387
3072 Ga0207694_10595180
3073 Ga0207694_10735119
3074 Ga0207650_10036184
3075 Ga0207650_10052383
3076 Ga0207650_10116445
3077 Ga0207650_10199728
3078 Ga0207659_10076509
3079 Ga0207659_10449437
3080 Ga0207687_10003292
3081 Ga0207687_10010252
3082 Ga0207687_10058695
3083 Ga0207700_10113161
3084 Ga0207700_10175388
3085 Ga0207700_10933996
3086 Ga0207664_10046964
3087 Ga0207664_10132594
3088 Ga0207664_10174266
3089 Ga0207664_10209192
3090 Ga0207664_10418532
3091 Ga0207644_10000363
3092 Ga0207644_10003018
3093 Ga0207644_10008816
3094 Ga0207644_10008908
3095 Ga0207644_10013604
3096 Ga0207644_10023299
3097 Ga0207644_10036016
3098 Ga0207644_10038172
3099 Ga0207644_10047287
3100 Ga0207644_10348761
3101 Ga0207644_10465715
3102 Ga0207690_10000213
3103 Ga0207690_10004314
3104 Ga0207690_10010821
3105 Ga0207690_10024735
3106 Ga0207690_10027937
3107 Ga0207690_10034020
3108 Ga0207690_10035483
3109 Ga0207690_10045082
3110 Ga0207690_10045727
3111 Ga0207690_10096898
3112 Ga0207690_10138636
3113 Ga0207690_10171634
3114 Ga0207690_10303147
3115 Ga0207690_10397065
3116 Ga0207690_10435543
3117 Ga0207690_10679649
3118 Ga0207690_10952634
3119 Ga0207706_10001681
3120 Ga0207706_10002348
3121 Ga0207706_10002904
3122 Ga0207706_10004412
3123 Ga0207706_10005362
3124 Ga0207706_10012962
3125 Ga0207706_10018444
3126 Ga0207706_10019463
3127 Ga0207706_10044942
3128 Ga0207706_10067025
3129 Ga0207706_10070052
3130 Ga0207706_10150961
3131 Ga0207706_10165081
3132 Ga0207706_10205273
3133 Ga0207706_10559277
3134 Ga0207686_10000999
3135 Ga0207686_10970650
3136 Ga0207709_10000123
3137 Ga0207709_10000314
3138 Ga0207709_10307373
3139 Ga0207709_10422633
3140 Ga0207670_10339522
3141 Ga0207669_10002136
3142 Ga0207669_10054957
3143 Ga0207669_10161434
3144 Ga0207669_10359783
3145 Ga0207704_10000005
3146 Ga0207704_10075826
3147 Ga0207704_10113325
3148 Ga0207704_10333352
3149 Ga0207665_10200106
3150 Ga0207691_10010358
3151 Ga0207691_10034600
3152 Ga0207691_10044424
3153 Ga0207691_10049113
3154 Ga0207691_10057057
3155 Ga0207691_10129459
3156 Ga0207691_10159692
3157 Ga0207691_10404640
3158 Ga0207691_10565857
3159 Ga0207711_10000044
3160 Ga0207711_10003187
3161 Ga0207711_10004961
3162 Ga0207711_10006432
3163 Ga0207711_10029068
3164 Ga0207711_10060446
3165 Ga0207711_10091717
3166 Ga0207711_10132160
3167 Ga0207711_10346012
3168 Ga0207711_10426594
3169 Ga0207689_10000043
3170 Ga0207689_10005657
3171 Ga0207689_10016412
3172 Ga0207689_10288442
3173 Ga0207661_10040495
3174 Ga0207661_10127973
3175 Ga0207661_10313167
3176 Ga0207661_10438891
3177 Ga0207661_10534221
3178 Ga0207661_10581081
3179 Ga0207679_10004475
3180 Ga0207679_10005586
3181 Ga0207679_10033250
3182 Ga0207679_10056546
3183 Ga0207679_10066090
3184 Ga0207679_10070193
3185 Ga0207679_10109487
3186 Ga0207679_10124193
3187 Ga0207679_10252079
3188 Ga0207679_10302456
3189 Ga0207679_10325497
3190 Ga0207679_10370994
3191 Ga0207679_10372305
3192 Ga0207679_10440840
3193 Ga0207679_10447834
3194 Ga0207679_10503309
3195 Ga0207679_10633586
3196 Ga0207679_10947482
3197 Ga0207667_10000651
3198 Ga0207667_10041692
3199 Ga0207667_10066424
3200 Ga0207667_10087197
3201 Ga0207667_10089128
3202 Ga0207667_10120141
3203 Ga0207667_10158549
3204 Ga0207667_10169517
3205 Ga0207667_10204134
3206 Ga0207667_10349703
3207 Ga0207667_10373400
3208 Ga0207667_10671361
3209 Ga0207667_10774955
3210 Ga0207651_10000007
3211 Ga0207651_10005083
3212 Ga0207651_10008872
3213 Ga0207651_10011246
3214 Ga0207651_10055669
3215 Ga0207651_10055861
3216 Ga0207651_10117747
3217 Ga0207651_10120928
3218 Ga0207712_10000001
3219 Ga0207712_10000074
3220 Ga0207712_10013236
3221 Ga0207712_10242519
3222 Ga0207712_10255236
3223 Ga0207712_10301749
3224 Ga0207668_10008280
3225 Ga0207668_10070743
3226 Ga0207668_10076582
3227 Ga0207668_10282118
3228 Ga0207668_10288027
3229 Ga0207640_10001822
3230 Ga0207640_10002785
3231 Ga0207640_10014906
3232 Ga0207640_10017347
3233 Ga0207640_10022813
3234 Ga0207640_10050048
3235 Ga0207640_10068326
3236 Ga0207640_10107282
3237 Ga0207640_10129763
3238 Ga0207640_10145116
3239 Ga0207640_10148408
3240 Ga0207640_10221716
3241 Ga0207640_10226516
3242 Ga0207640_10371929
3243 Ga0207658_10001041
3244 Ga0207658_10001339
3245 Ga0207658_10007902
3246 Ga0207658_10020014
3247 Ga0207658_10047562
3248 Ga0207658_10053779
3249 Ga0207658_10077777
3250 Ga0207658_10282923
3251 Ga0207658_10510136
3252 Ga0207658_10600986
3253 Ga0207658_10655569
3254 Ga0207658_10894046
3255 Ga0207677_10000085
3256 Ga0207677_10007135
3257 Ga0207677_10007140
3258 Ga0207677_10020495
3259 Ga0207677_10376244
3260 Ga0207677_10404616
3261 Ga0207703_10000661
3262 Ga0207703_10002210
3263 Ga0207703_10004178
3264 Ga0207703_10007316
3265 Ga0207703_10009056
3266 Ga0207703_10009152
3267 Ga0207703_10026676
3268 Ga0207703_10109164
3269 Ga0207703_10489289
3270 Ga0207639_10000138
3271 Ga0207639_10000306
3272 Ga0207639_10002847
3273 Ga0207639_10010651
3274 Ga0207639_10018714
3275 Ga0207639_10059006
3276 Ga0207639_10173707
3277 Ga0207639_10202438
3278 Ga0207639_10242398
3279 Ga0207639_10479070
3280 Ga0207639_10487501
3281 Ga0207639_10504622
3282 Ga0207678_10000625
3283 Ga0207678_10002012
3284 Ga0207678_10003288
3285 Ga0207678_10019982
3286 Ga0207678_10035972
3287 Ga0207678_10054068
3288 Ga0207678_10055159
3289 Ga0207678_10060312
3290 Ga0207678_10065532
3291 Ga0207678_10110234
3292 Ga0207678_10126217
3293 Ga0207678_10160114
3294 Ga0207678_10285847
3295 Ga0207678_10310163
3296 Ga0207678_10314333
3297 Ga0207678_10331210
3298 Ga0207678_10417137
3299 Ga0207678_10637089
3300 Ga0207678_10638400
3301 Ga0207708_10029953
3302 Ga0207702_10003043
3303 Ga0207702_10012870
3304 Ga0207702_10033646
3305 Ga0207702_10056816
3306 Ga0207702_10073569
3307 Ga0207702_10088682
3308 Ga0207702_10127183
3309 Ga0207702_10162382
3310 Ga0207702_10182347
3311 Ga0207702_10213686
3312 Ga0207702_10253694
3313 Ga0207702_10357344
3314 Ga0207702_10429509
3315 Ga0207702_10443963
3316 Ga0207702_10451684
3317 Ga0207702_10789345
3318 Ga0207702_10916668
3319 Ga0207702_11067361
3320 Ga0207641_10000033
3321 Ga0207641_10002463
3322 Ga0207641_10017686
3323 Ga0207641_10074338
3324 Ga0207641_10182174
3325 Ga0207641_10362799
3326 Ga0207641_11536028
3327 Ga0207648_10000005
3328 Ga0207648_10009542
3329 Ga0207648_10017604
3330 Ga0207648_10066045
3331 Ga0207648_10085498
3332 Ga0207648_10182280
3333 Ga0207648_10299460
3334 Ga0207648_10315417
3335 Ga0207648_11105398
3336 Ga0207676_10000193
3337 Ga0207676_10001310
3338 Ga0207676_10002304
3339 Ga0207676_10008893
3340 Ga0207676_10014208
3341 Ga0207676_10274732
3342 Ga0207674_10005155
3343 Ga0207674_10008541
3344 Ga0207674_10008911
3345 Ga0207674_10010054
3346 Ga0207674_10011026
3347 Ga0207674_10026848
3348 Ga0207674_10115284
3349 Ga0207674_10205783
3350 Ga0207674_11268491
3351 Ga0207674_11278756
3352 Ga0207675_100000020
3353 Ga0207675_100003055
3354 Ga0207675_100014477
3355 Ga0207675_100123581
3356 Ga0207675_100135492
3357 Ga0207675_100152747
3358 Ga0207675_100217470
3359 Ga0207683_10002608
3360 Ga0207683_10005676
3361 Ga0207683_10007711
3362 Ga0207683_10022069
3363 Ga0207683_10025235
3364 Ga0207683_10143345
3365 Ga0207683_10334750
3366 Ga0207683_10773740
3367 Ga0207698_10000751
3368 Ga0207698_10001376
3369 Ga0207698_10004176
3370 Ga0207698_10004925
3371 Ga0207698_10013479
3372 Ga0207698_10016964
3373 Ga0207698_10018354
3374 Ga0207698_10020656
3375 Ga0207698_10035079
3376 Ga0207698_10063830
3377 Ga0207698_10070641
3378 Ga0207698_10101973
3379 Ga0207698_10105999
3380 Ga0207698_10110081
3381 Ga0207698_10125131
3382 Ga0207698_10236368
3383 Ga0207698_10315678
3384 Ga0207698_10380246
3385 Ga0207698_10492571
3386 Ga0207698_10951321
3387 Ga0209967_1012570
3388 Ga0209999_1018098
3389 Ga0209970_1014509
3390 Ga0209813_10000642
3391 Ga0209974_10020267
3392 Ga0268266_10000028
3393 Ga0268266_10000315
3394 Ga0268266_10032675
3395 Ga0268266_10040809
3396 Ga0268266_10154815
3397 Ga0268266_10494660
3398 Ga0268265_10000524
3399 Ga0268265_10000655
3400 Ga0268265_10000877
3401 Ga0268265_10004694
3402 Ga0268265_10037695
3403 Ga0268265_10081652
3404 Ga0268265_10157984
3405 Ga0268265_10595854
3406 Ga0268265_11491259
3407 Ga0268264_10000006
3408 Ga0268264_10000594
3409 Ga0268264_10030328
3410 Ga0268264_10066778
3411 Ga0268264_10222948
3412 Ga0268264_10226230
3413 Ga0268264_10246579
3414 Ga0268264_11242710
3415 Ga0307517_10010919
3416 Ga0307517_10015604
3417 Ga0316182_1051886
3418 Ga0307513_10324308
3419 Ga0307408_100034262
3420 Ga0307408_100063351
3421 Ga0307408_100166926
3422 Ga0307408_100468283
3423 Ga0307405_10006669
3424 Ga0307405_10011630
3425 Ga0307405_10032333
3426 Ga0307405_10078060
3427 Ga0307405_10106086
3428 Ga0307405_10208850
3429 Ga0307405_10544027
3430 Ga0307405_10993554
3431 Ga0307413_10528879
3432 Ga0307413_10601644
3433 Ga0307410_10004647
3434 Ga0307410_10035455
3435 Ga0307410_10362872
3436 Ga0307410_10813577
3437 Ga0307406_10008063
3438 Ga0307406_10008583
3439 Ga0307406_10546600
3440 Ga0307407_10014619
3441 Ga0307407_10075741
3442 Ga0307412_10010301
3443 Ga0307412_10011200
3444 Ga0307412_10070371
3445 Ga0307412_10130640
3446 Ga0307412_10969519
3447 Ga0307409_100030466
3448 Ga0307409_100091735
3449 Ga0307409_100093100
3450 Ga0307409_100124455
3451 Ga0307409_100269587
3452 Ga0307409_100412273
3453 Ga0307409_100470045
3454 Ga0307409_100532302
3455 Ga0307409_101135797
3456 Ga0307416_100003438
3457 Ga0307416_100013884
3458 Ga0307416_100817329
3459 Ga0307416_101282137
3460 Ga0307414_10001010
3461 Ga0307414_10220923
3462 Ga0307414_10226144
3463 Ga0307414_10357465
3464 Ga0307414_10474124
3465 Ga0307414_10506148
3466 Ga0307414_10542168
3467 Ga0307411_10003341
3468 Ga0307411_10006255
3469 Ga0307411_10151432
3470 Ga0307411_10175894
3471 Ga0307411_10289723
3472 Ga0307411_10357127
3473 Ga0307411_10376988
3474 Ga0307411_10635061
3475 Ga0307411_10723282
3476 Ga0307415_100030148
3477 Ga0307415_100081448
3478 Ga0307415_100116218
3479 Ga0307415_100134814
3480 Ga0307510_10119138
3481 Ga0307510_10232056
3482 Ga0373923_0033469
3483 Ga0373941_0119195
3484 Ga0373941_0151102
3485 Ga0373954_0082775
3486 Ga0373960_0049190
3487 Ga0373960_0138379
3488 Ga0373943_0455470
3489 Ga0373942_0063647
3490 Ga0373931_0009585
3491 Ga0373935_0047789
3492 Ga0373935_0069053
3493 Ga0373927_0025599
3494 Ga0373933_0122438
3495 Ga0373937_0085639
3496 Ga0373925_0036385
3497 Ga0395899_0000103
3498 Ga0395899_0001950
3499 Ga0395899_0015182
3500 Ga0395899_0024414
3501 Ga0395899_0034866
3502 Ga0395899_0040739
3503 Ga0395899_0053354
3504 Ga0395899_0053589
3505 Ga0395899_0107111
3506 Ga0395899_0109509
3507 Ga0395899_0154352
3508 Ga0395899_0162610
3509 Ga0395899_0176237
3510 Ga0395899_0181294
3511 Ga0395899_0209042
3512 Ga0395899_0219249
3513 Ga0395899_0289571
3514 Ga0395899_0685876
3515 Ga0395900_0000093
3516 Ga0395900_0000325
3517 Ga0395900_0001087
3518 Ga0395900_0001290
3519 Ga0395900_0020586
3520 Ga0395900_0023955
3521 Ga0395900_0028278
3522 Ga0395900_0034108
3523 Ga0395900_0045255
3524 Ga0395900_0048120
3525 Ga0395900_0048535
3526 Ga0395900_0091818
3527 Ga0395900_0109184
3528 Ga0395900_0109823
3529 Ga0395900_0125689
3530 Ga0395900_0128722
3531 Ga0395900_0129797
3532 Ga0395900_0146278
3533 Ga0395900_0157340
3534 Ga0395900_0165784
3535 Ga0395900_0191350
3536 Ga0395900_0196867
3537 Ga0395900_0263737
3538 Ga0395900_0294916
3539 Ga0395900_0350852
3540 Ga0395900_0414088
3541 Ga0395900_0427492
3542 Ga0395900_0582892
3543 Ga0395900_0745429
3544 Ga0395900_0906782
3545 Ga0395898_0000053
3546 Ga0395898_0006749
3547 Ga0395898_0072459
3548 Ga0395898_0086177
3549 Ga0395898_0100601
3550 Ga0395898_0146453
3551 Ga0395898_0213635
3552 Ga0395898_0330150
3553 Ga0395898_0335348
3554 Ga0395898_0357119
3555 Ga0395898_0424649
3556 Ga0395898_0514147
3557 Ga0395898_0619179
3558 Ga0395898_0666448
3559 Ga0395898_0976618
3560 Ga0395905_0000031
3561 Ga0395905_0000218
3562 Ga0395905_0000298
3563 Ga0395905_0002160
3564 Ga0395905_0003525
3565 Ga0395905_0004981
3566 Ga0395905_0011188
3567 Ga0395905_0021011
3568 Ga0395905_0024148
3569 Ga0395905_0024791
3570 Ga0395905_0029054
3571 Ga0395905_0032012
3572 Ga0395905_0034086
3573 Ga0395905_0045674
3574 Ga0395905_0066550
3575 Ga0395905_0069718
3576 Ga0395905_0087794
3577 Ga0395905_0091962
3578 Ga0395905_0133389
3579 Ga0395905_0149610
3580 Ga0395905_0165759
3581 Ga0395905_0176931
3582 Ga0395905_0179700
3583 Ga0395905_0183937
3584 Ga0395905_0262478
3585 Ga0395905_0311521
3586 Ga0395905_0343273
3587 Ga0395905_0365865
3588 Ga0395905_0379500
3589 Ga0395905_0609346
3590 Ga0395905_0643619
3591 Ga0395905_0691054
3592 Ga0395905_0827664
3593 Ga0395905_0852610
3594 Ga0395905_1053264
3595 Ga0436364_0267368
3596 Ga0436364_1244538
3597 Ga0395901_0000603
3598 Ga0395901_0001133
3599 Ga0395901_0002869
3600 Ga0395901_0003360
3601 Ga0395901_0007049
3602 Ga0395901_0015960
3603 Ga0395901_0042410
3604 Ga0395901_0043460
3605 Ga0395901_0048919
3606 Ga0395901_0059325
3607 Ga0395901_0062942
3608 Ga0395901_0075822
3609 Ga0395901_0103747
3610 Ga0395901_0119896
3611 Ga0395901_0134330
3612 Ga0395901_0187633
3613 Ga0395901_0211757
3614 Ga0395901_0215873
3615 Ga0395901_0238206
3616 Ga0395901_0245240
3617 Ga0395901_0285573
3618 Ga0395901_0297482
3619 Ga0395901_0487641
3620 Ga0395901_0615440
3621 Ga0395901_0700679
3622 Ga0395901_0980212
3623 Ga0395901_1052899
3624 Ga0237819_00997
3625 Ga0237816_01348
3626 Ga0436365_1759449
3627 Ga0436365_1765941
3628 Ga0436363_1307031
3629 Ga0439436_0010448
3630 Ga0439438_080358
3631 Ga0439439_0015658
3632 Ga0439466_0063717
3633 Ga0439465_0012432
3634 Ga0439465_0024370
3635 Ga0451787_474471
3636 Ga0451795_1296634
3637 Ga0451833_0859678
3638 Ga0451853_1878420
3639 Ga0439431_0000266
3640 Ga0439431_0001884
3641 Ga0439442_006828
3642 Ga0439445_0057548
3643 Ga0439448_0014521
3644 Ga0439448_0041089
3645 Ga0439449_0016693
3646 Ga0439449_0066737
3647 Ga0439452_012996
3648 Ga0439455_0001059
3649 Ga0439457_009600
3650 Ga0439462_0000072
3651 Ga0450890_007651
3652 Ga0450894_022132
3653 Ga0439446_0090261
3654 Ga0439458_0000003
3655 Ga0439458_0001169
3656 Ga0439434_0017782
3657 Ga0439464_0016573
3658 Ga0439464_0049328
3659 Ga0439460_0049043
3660 Ga0466969_0070561
3661 Ga0466972_0016710
3662 Ga0466972_0099084
3663 Ga0466973_0265260
3664 Ga0466965_0064703
3665 Ga0466966_0000001
3666 Ga0466966_0035584
3667 Ga0466966_0045811
3668 Ga0466966_0124094
3669 Ga0466966_0269109
3670 Ga0466961_0010293
3671 Ga0466961_0011461
3672 Ga0466961_0066414
3673 Ga0466961_0262323
3674 Ga0466963_0001571
3675 Ga0466963_0005775
3676 Ga0466963_0012123
3677 Ga0466963_0015629
3678 Ga0466963_0027255
3679 Ga0466963_0076558
3680 Ga0466963_0110260
3681 Ga0466963_0145563
3682 Ga0466963_0286199
3683 Ga0466963_0362192
3684 Ga0466963_0436933
3685 Ga0466964_0011968
3686 Ga0466971_0007970
3687 Ga0466971_0010170
3688 Ga0466971_0071253
3689 Ga0466971_0112712
3690 Ga0466968_0069985
3691 Ga0466968_0162402
3692 Ga0466970_0018332
3693 Ga0466970_0018657
3694 Ga0466970_0124328
3695 Ga0466957_0003468
3696 Ga0466957_0003546
3697 Ga0466957_0018902
3698 Ga0466957_0095064
3699 Ga0466957_0277146
3700 Ga0466957_0359512
3701 Ga0466957_0582018
3702 Ga0466960_0023437
3703 Ga0466960_0079156
3704 Ga0466959_0002064
3705 Ga0466959_0049401
3706 Ga0466959_0070810
3707 Ga0466959_0093564
3708 Ga0466959_0212995
3709 Ga0466958_0000867
3710 Ga0466958_0036365
3711 Ga0466958_0128384
3712 Ga0466958_0131142
3713 Ga0466958_0165135
3714 Ga0466958_0410413
3715 Ga0466958_0437855
3716 Ga0466967_0021736
3717 Ga0466967_0032298
3718 Ga0466967_0046607
3719 Ga0466967_0053683
3720 Ga0466967_0055341
3721 Ga0466967_0093266
3722 Ga0466967_0166106
3723 Ga0466967_0268400
3724 Ga0466967_0282024
3725 Ga0466967_0661833
3726 Ga0466967_0706066
3727 Ga0466967_0858709
3728 Ga0495617_003757
3729 Ga0495627_000621
3730 Ga0495627_013170
3731 Ga0495590_0276979
3732 Ga0495650_0000058
3733 Ga0495585_0015180
3734 Ga0495607_0066211
3735 Ga0495583_0000111
3736 Ga0495583_0037338
3737 Ga0495606_0021008
3738 Ga0495606_0068197
3739 Ga0495610_0000072
3740 Ga0495616_0112830
3741 Ga0495631_0166832
3742 Ga0495631_0252170
3743 Ga0495632_0000007
3744 Ga0495632_0145657
3745 Ga0495632_0163809
3746 Ga0495637_0000971
3747 Ga0495637_0026836
3748 Ga0495643_0000005
3749 Ga0495643_0025789
3750 Ga0495648_0001438
3751 Ga0495648_0084734
3752 Ga0495648_0188419
3753 Ga0495663_0000005
3754 Ga0495663_0076555
3755 Ga0495663_0131859
3756 Ga0495642_0016307
3757 Ga0495598_0007441
3758 Ga0495621_0000481
3759 Ga0495621_0000528
3760 Ga0495597_0115110
3761 Ga0495622_0007809
3762 Ga0495633_0001368
3763 Ga0495633_0002896
3764 Ga0495633_0007470
3765 Ga0495633_0117301
3766 Ga0495668_0000759
3767 Ga0495625_0000064
3768 Ga0495625_0000189
3769 Ga0495625_0005244
3770 Ga0495625_0133908
3771 Ga0495625_0222655
3772 Ga0495625_0349640
3773 Ga0495661_0046403
3774 Ga0495623_0066877
3775 Ga0495669_0000512
3776 Ga0495669_0007442
3777 Ga0495669_0048972
3778 Ga0495669_0051272
3779 Ga0495669_0339313
3780 Ga0495670_0000004
3781 Ga0495670_0003293
3782 Ga0495671_0000007
3783 Ga0495649_0048964
3784 Ga0495600_0000530
3785 Ga0495636_0053222
3786 Ga0495683_0011752
3787 Ga0495687_003705
3788 Ga0495687_010391
3789 Ga0495677_0006237
3790 Ga0495677_0022715
3791 Ga0495677_0038412
3792 Ga0495685_059613
3793 Ga0495673_0016342
3794 Ga0495673_0029007
3795 Ga0495681_0000043
3796 Ga0495681_0012249
3797 Ga0495681_0143425
3798 Ga0495686_0000060
3799 Ga0495686_0000091
3800 Ga0495686_0000904
3801 Ga0495686_0016391
3802 Ga0495686_0045492
3803 Ga0495686_0292211
3804 Ga0495686_0326206
3805 Ga0495602_0084339
3806 Ga0495615_0048339
3807 Ga0496100_0002351
3808 Ga0496100_0460623
3809 Ga0496101_0000292
3810 Ga0496101_0025402
3811 Ga0496101_0170624
3812 Ga0496101_0414389
3813 Ga0496102_0016210
3814 Ga0496102_0162422
3815 Ga0496102_0464439
3816 Ga0496103_0000643
3817 Ga0496103_0109934
3818 Ga0496103_0213293
3819 Ga0496103_0443807
3820 Ga0496104_0364311
3821 Ga0496104_0485077
3822 Ga0496104_0654645
3823 Ga0496105_0051276
3824 Ga0496105_0099313
3825 Ga0496105_0191429
3826 Ga0496105_0257059
3827 Ga0496106_0014932
3828 Ga0496106_0043116
3829 Ga0496107_0003345
3830 Ga0496107_0011839
3831 Ga0496107_0049890
3832 Ga0496107_0069946
3833 Ga0496107_0080557
3834 Ga0496107_0139776
3835 Ga0496108_0001766
3836 Ga0496108_0001779
3837 Ga0496108_0046675
3838 Ga0496108_0047520
3839 Ga0496108_0318470
3840 Ga0496109_0004339
3841 Ga0496109_0010384
3842 Ga0496109_0010905
3843 Ga0496109_0012943
3844 Ga0496109_0085318
3845 Ga0496109_0092296
3846 Ga0496110_0001965
3847 Ga0496110_0008211
3848 Ga0496110_0043663
3849 Ga0496110_0137047
3850 Ga0496110_0775515
3851 Ga0496111_0000323
3852 Ga0496111_0014202
3853 Ga0496111_0014437
3854 Ga0496111_0117561
3855 Ga0496111_0206021
3856 Ga0496111_0336937
3857 Ga0496112_0000161
3858 Ga0496112_0006533
3859 Ga0496112_0006858
3860 Ga0496112_0020565
3861 Ga0496112_0092289
3862 Ga0496112_0126383
3863 Ga0496112_0523582
3864 Ga0496113_0001079
3865 Ga0496113_0004623
3866 Ga0496113_0016895
3867 Ga0496113_0106545
3868 Ga0496113_0376792
3869 Ga0496114_0000092
3870 Ga0496115_0000428
3871 Ga0496116_0011628
3872 Ga0496116_0231958
3873 Ga0496117_0005240
3874 Ga0496117_0009462
3875 Ga0496117_0121334
3876 Ga0496117_0128330
3877 Ga0496117_0171657
3878 Ga0496118_0000811
3879 Ga0496118_0020700
3880 Ga0496118_0125414
3881 Ga0496118_0126319
3882 Ga0496118_0330670
3883 Ga0496118_0358344
3884 Ga0496119_0107113
3885 Ga0496120_0023040
3886 Ga0496120_0082963
3887 Ga0496121_0000072
3888 Ga0496121_0000347
3889 Ga0496121_0000349
3890 Ga0496121_0018980
3891 Ga0496121_0048291
3892 Ga0496121_0072540
3893 Ga0496122_0067295
3894 Ga0496122_0085973
3895 Ga0496123_0044190
3896 Ga0496124_0000739
3897 Ga0496124_0138395
3898 Ga0496124_0223914
3899 Ga0496124_0419293
3900 Ga0496124_0536752
3901 Ga0496125_0029187
3902 Ga0496125_0040228
3903 Ga0496125_0102662
3904 Ga0496125_0132121
3905 Ga0496126_0044387
3906 Ga0496126_0215458
3907 Ga0496126_0608755
3908 Ga0501306_005744
3909 Ga0501306_005768
3910 Ga0501309_032117
3911 Ga0501309_033098
3912 Ga0501310_035028
3913 Ga0501305_006306
3914 Ga0501307_014062
3915 Ga0495678_019508
3916 Ga0495682_0029467
3917 Ga0495682_0054194
3918 Ga0501290_000007
3919 Ga0501292_000015
3920 Ga0501294_000459
3921 Ga0501300_002035
3922 Ga0501311_027722
3923 Ga0501312_006891
3924 Ga0501313_010755
3925 Ga0501314_002498
3926 Ga0501315_011815
3927 Ga0501317_000859
3928 Ga0501317_008890
3929 Ga0501323_027378
3930 Ga0501323_027665
3931 Ga0501324_002322
3932 Ga0501324_008476
3933 Ga0501333_002519
3934 Ga0501335_002933
3935 Ga0501337_005934
3936 Ga0501338_03161
3937 Ga0501031_0401735
3938 Ga0501032_0143636
3939 Ga0501033_0156163
3940 Ga0501034_0056271
3941 Ga0501034_0298252
3942 Ga0501036_0518949
3943 Ga0501043_0150904
3944 Ga0501043_0214668
3945 Ga0501046_0236856
3946 Ga0501047_0076865
3947 Ga0501047_0520160
3948 Ga0501047_0689180
3949 Ga0501068_0173040
3950 Ga0501070_0080765
3951 Ga0501070_0210243
3952 Ga0501198_007662
3953 Ga0501206_001153
3954 Ga0501209_111683
3955 Ga0501222_001017
3956 Ga0501223_000042
3957 Ga0501223_000214
3958 Ga0501223_004972
3959 Ga0501224_000031
3960 Ga0501224_008638
3961 Ga0501227_066995
3962 Ga0501233_000068
3963 Ga0501233_065502
3964 Ga0501235_008358
3965 Ga0501235_013185
3966 Ga0501249_000079
3967 Ga0501257_001257
3968 Ga0501261_001291
3969 Ga0501221_004253
3970 Ga0501225_0000070
3971 Ga0501225_0000520
3972 Ga0501225_0003808
3973 Ga0501225_0019156
3974 Ga0501225_0108329
3975 Ga0501229_012675
3976 Ga0501234_001986
3977 Ga0501245_003957
3978 Ga0501080_0090579
3979 Ga0501080_0226892
3980 Ga0501262_006069
3981 Ga0501272_015792
3982 Ga0501273_010471
3983 Ga0501279_000015
3984 Ga0501279_013398
3985 Ga0501280_000076
3986 Ga0501281_00692
3987 Ga0501282_017523
3988 Ga0501035_0320754
3989 Ga0501044_0055834
3990 Ga0501044_0061238
3991 Ga0501044_0505326
3992 Ga0501204_024551
3993 Ga0501226_000051
3994 nmdc:mga00v17_334012_c1
3995 nmdc:mga0yw44_521925_c1
3996 nmdc:mga06z11_513_c1
3997 nmdc:mga04h51_241_c1
3998 nmdc:mga07m45_107902_c1
3999 nmdc:mga07m45_70943_c1
4000 nmdc:mga0qj67_45931_c1
4001 Ga0495612_0109925
4002 Ga0500610_0000069
4003 Ga0500643_000166
4004 Ga0500643_001656
4005 Ga0500643_008204
4006 Ga0500643_017972
4007 Ga0500643_042974
4008 Ga0500566_0000633
4009 Ga0500641_0015756
4010 Ga0500555_000965
4011 Ga0500562_124647
4012 Ga0500572_153674
4013 Ga0500592_000226
4014 Ga0500595_017070
4015 Ga0500597_016953
4016 Ga0500642_0000268
4017 Ga0500652_063317
4018 Ga0500559_0000227
4019 Ga0500559_0009983
4020 Ga0500559_0162447
4021 Ga0500568_0006231
4022 Ga0500573_0000045
4023 Ga0500604_0017646
4024 Ga0500616_0009696
4025 Ga0500622_0336067
4026 Ga0500624_000001
4027 Ga0500627_0276073
4028 Ga0500639_167588
4029 Ga0500637_0001304
4030 Ga0500637_0318890
4031 Ga0500611_000848
4032 Ga0500645_000037
4033 Ga0500645_064700
4034 Ga0500596_013838
4035 Ga0587084_006819
4036 Ga0587090_005411
4037 Ga0587092_008218
4038 Ga0587101_025311
4039 Ga0587068_043091
4040 Ga0587076_089455
4041 Ga0587079_052713
4042 Ga0587120_014612
4043 Ga0466962_0003328
4044 Ga0466962_0064663
4045 Ga0466962_0081669
4046 Ga0466962_0112922
4047 2512643284
4048 2600200515
4049 2644037113
4050 2644043639
4051 2644126311
4052 2644393798
4053 2738850997
4054 2738866727
4055 2739299244
4056 2739360923
4057 2753763703
4058 2778123886
4059 2830076774
4060 2879166782
4061 2885427816
4062 2896430826
4063 2919141385
4064 2919711411
4065 2928027773
4066 2928103881
4067 2928527193
4068 2928961810
4069 2928969321
4070 2946788040
4071 2984557934
4072 2984567701
4073 2990267382
4074 2993358752
4075 2993695383
4076 8057103717

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.97

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

63

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9875 1 40
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.9856 1 40
8am9-assembly1.cif.gz_h cryo-em structure of the proline-rich antimicrobial peptide drosocin bound to the elongating ribosome 0.9852 1 40
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 0.983 1 39
7y7e-assembly1.cif.gz_h structure of the bacterial ribosome with human trna asp(manq34) and mrna(gau) 0.9809 1 39
ID Description Score Start End Superfamily
af_P0A7R1_1_50_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9756 1 48 3.40.5.10
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9712 3 42 3.40.5.10
af_Q2G2T3_1_54_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9567 1 48 3.40.5.10
af_Q54QM2_41_88_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9475 3 48 3.40.5.10
3kniI01 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.947 1 58 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A653T3B7-F1-model_v4 LSU ribosomal protein L9p 0.9369 63 139 GO:0003735
GO:0005840
GO:0006412
AF-A0A656G2Q0-F1-model_v4 50S ribosomal protein L9 0.9234 52 137 GO:0003735
GO:0005840
GO:0006412
AF-A0A353K5N8-F1-model_v4 deleted 0.9179 54 139
AF-A0A7X6NEA0-F1-model_v4 deleted 0.9085 52 136
AF-X1M0K0-F1-model_v4 Large ribosomal subunit protein bL9 C-terminal domain-containing protein 0.9054 65 139 GO:0003735
GO:0005840
GO:0006412

Map