F496331

General Info

Members Datasets Scaffolds Average Seq Length
2060 765 4120 234

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0115469|Ga0373934_0115469_291_1049
Length 252
Sequence MRRKPQRRKRVVEGRSARMLELRSVDAGYGTFQALFGVSLEVKAGEAVGVIGPNGAGKTTLMRVISGLIRPRAGTISMEGVDVLKTPEHRIVSLGIAHVPENRRLFPRLTVEDNLKMGAFMPEARARFAERLAFVFDLFPRMKERRHQMAGTMSGGEQQMCAIGRALMSDPKLLLLDEPSAGLAPVIVQQVFELVKRIRANGLTVLIVEQNVQQVLRVVDRAYLLEAGTIRASGKSSEMLADDQIRQAYLGV

Samples

Sample ID Description Type Environment
1 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
130 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
167 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
168 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
169 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
170 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
180 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
253 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
258 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
264 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
265 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
266 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
267 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
268 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
273 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
274 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
275 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
276 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
277 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
283 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
284 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
285 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
286 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
287 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
288 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
289 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
298 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
299 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
300 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
301 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
302 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
303 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
304 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
305 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
306 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
307 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
308 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
320 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
321 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
327 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
328 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
329 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
330 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
331 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
332 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
333 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
334 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
335 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
336 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
337 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
338 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
342 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
343 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
352 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
355 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
356 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
357 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
358 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
361 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
362 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
363 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
364 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
365 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
366 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
367 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
368 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
369 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
370 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
371 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
376 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
379 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
380 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
381 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
384 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
385 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
386 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
387 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
388 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
392 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
396 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
397 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
401 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
402 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
403 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
404 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
405 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
424 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
425 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
426 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
427 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
440 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
445 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
446 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
447 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
448 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
449 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
450 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
451 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
461 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
477 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
478 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
479 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
480 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
481 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
482 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
483 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
484 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
485 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
486 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
487 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
488 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
489 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
490 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
493 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
494 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
502 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
503 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
504 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
505 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
506 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
507 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
508 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
509 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
510 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
511 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
512 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
513 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
514 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
515 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
516 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
517 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
518 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
519 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
520 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
521 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
522 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
523 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
524 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
525 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
526 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
530 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
531 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
534 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
535 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
536 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
540 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
541 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
542 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
543 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
544 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
545 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
546 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
547 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
548 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
549 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
550 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
551 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
552 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
553 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
554 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
555 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
556 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
557 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
558 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
559 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
560 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
561 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
562 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
563 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
564 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
565 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
566 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
567 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
568 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
569 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
570 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
571 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
572 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
573 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
574 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
575 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
576 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
577 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
578 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
579 2791355199
580 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
581 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
582 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
583 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
584 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
585 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
586 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
587 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
588 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
589 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
590 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
591 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
592 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
593 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
594 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
595 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
596 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
597 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
598 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
599 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
600 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
601 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
602 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
603 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
604 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
605 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
606 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
607 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
608 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
609 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
610 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
611 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
612 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
613 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
614 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
615 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
616 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
617 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
618 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
619 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
620 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
621 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
622 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
623 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
624 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
625 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
626 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
627 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
628 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
629 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
630 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
631 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
632 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
633 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
634 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
635 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
636 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
637 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
638 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
639 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
640 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
641 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
642 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
643 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
644 2904699407
645 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
646 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
647 2906610324
648 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
649 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
650 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
651 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
652 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
653 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
654 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
655 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
656 2922368715
657 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
658 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
659 2922425934
660 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
661 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
662 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
663 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
664 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
665 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
666 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
667 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
668 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
669 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
670 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
671 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
672 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
673 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
674 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
675 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
676 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
677 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
678 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
679 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
680 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
681 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
682 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
683 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
684 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
685 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
686 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
687 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
688 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
689 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
690 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
691 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
692 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
693 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
694 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
695 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
696 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
697 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
698 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
699 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
700 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
701 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
702 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
703 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
704 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
705 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
706 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
707 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
708 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
709 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
710 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
711 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
712 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
713 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
714 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
715 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
716 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
717 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
718 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
719 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
720 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
721 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
722 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
723 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
724 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
725 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
726 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
727 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
728 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
729 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
730 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
731 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
732 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
733 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
734 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
735 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
736 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
737 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
738 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
739 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
740 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
741 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
742 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
743 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
744 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
745 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
746 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
747 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
748 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
749 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
750 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
751 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
752 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
753 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
754 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
755 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
756 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
757 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
758 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
759 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
760 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
761 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
762 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
763 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
764 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
765 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.64
Metatranscriptomes 0
Isolates 10.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 8.5
Rhizoplane 4.71
Rhizosphere 74.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373934_0115469 3300035086 Bacteria 1091
2 JGI24032J14994_101455 3300001430 Bacteria 986
3 JGI24752J21851_1008532 3300001976 Bacteria 1337
4 JGI24739J22299_10002831 3300001989 Bacteria 6664
5 JGI24737J22298_10001577 3300001990 Bacteria 8110
6 JGI24750J21931_1000865 3300002070 Bacteria 4151
7 JGI24745J21846_1002353 3300002073 Bacteria 1925
8 JGI24748J21848_1001206 3300002074 Bacteria 2823
9 JGI24749J21850_1011129 3300002076 Bacteria 1262
10 JGI24744J21845_10003221 3300002077 Bacteria 3347
11 JGI24035J26624_1003600 3300002126 Bacteria 1461
12 JGI24034J26672_10004016 3300002239 Bacteria 2073
13 JGI24742J22300_10001206 3300002244 Bacteria 4038
14 JGI24751J29686_10002679 3300002459 Bacteria 3584
15 JGI25406J46586_10000021 3300003203 Bacteria 84514
16 JGI25153J46596_10001764 3300003215 Bacteria 12825
17 JGI25153J46596_10002778 3300003215 Bacteria 9952
18 JGI25153J46596_10007736 3300003215 Bacteria 5231
19 JGI25153J46596_10008618 3300003215 Bacteria 4853
20 JGI25160J50197_1000533 3300003354 Bacteria 21926
21 JGI25160J50197_1027443 3300003354 Bacteria 1549
22 JGI25404J52841_10021647 3300003659 Bacteria 1391
23 Ga0055539_1012039 3300003752 Bacteria 1064
24 Ga0055542_1023720 3300003762 Bacteria 857
25 Ga0055531_10010491 3300003794 Bacteria 4596
26 JGI25405J52794_10004566 3300003911 Bacteria 2470
27 JGI25405J52794_10060051 3300003911 Bacteria 821
28 Ga0065165_1000437 3300005262 Bacteria 65503
29 Ga0065165_1001951 3300005262 Bacteria 19574
30 Ga0065165_1005934 3300005262 Bacteria 6618
31 Ga0065712_10102380 3300005290 Bacteria 2007
32 Ga0065715_10114787 3300005293 Bacteria 2434
33 Ga0065715_10261091 3300005293 Bacteria 1138
34 Ga0070658_10006285 3300005327 Bacteria 9622
35 Ga0070658_10218087 3300005327 Bacteria 1613
36 Ga0070676_10001629 3300005328 Bacteria 11410
37 Ga0070676_10026881 3300005328 Bacteria 3259
38 Ga0070676_10034437 3300005328 Bacteria 2908
39 Ga0070683_100007819 3300005329 Bacteria 9055
40 Ga0070683_100014236 3300005329 Bacteria 6953
41 Ga0070683_100020043 3300005329 Bacteria 5947
42 Ga0070683_100486229 3300005329 Bacteria 1179
43 Ga0070690_100022028 3300005330 Bacteria 3896
44 Ga0070690_100033117 3300005330 Bacteria 3232
45 Ga0070690_100151901 3300005330 Bacteria 1581
46 Ga0070690_100390243 3300005330 Bacteria 1020
47 Ga0070670_100112665 3300005331 Bacteria 2345
48 Ga0070677_10000481 3300005333 Bacteria 13662
49 Ga0068869_100000216 3300005334 Bacteria 29999
50 Ga0068869_100087109 3300005334 Bacteria 2342
51 Ga0070666_10005440 3300005335 Bacteria 7806
52 Ga0070666_10023836 3300005335 Bacteria 3984
53 Ga0070666_10287891 3300005335 Bacteria 1169
54 Ga0070680_100002486 3300005336 Bacteria 13654
55 Ga0070680_100006251 3300005336 Bacteria 9034
56 Ga0070680_100032424 3300005336 Bacteria 4205
57 Ga0070680_100070553 3300005336 Bacteria 2869
58 Ga0070680_100194678 3300005336 Bacteria 1709
59 Ga0070680_100575707 3300005336 Bacteria 966
60 Ga0070682_100000853 3300005337 Bacteria 17853
61 Ga0070682_100022761 3300005337 Bacteria 3715
62 Ga0070682_100221253 3300005337 Bacteria 1348
63 Ga0070682_100468508 3300005337 Bacteria 969
64 Ga0068868_100000474 3300005338 Bacteria 26674
65 Ga0068868_100071341 3300005338 Bacteria 2770
66 Ga0068868_100250174 3300005338 Bacteria 1491
67 Ga0070660_100001322 3300005339 Bacteria 16832
68 Ga0070660_100009076 3300005339 Bacteria 6981
69 Ga0070660_100051630 3300005339 Bacteria 3167
70 Ga0070689_100000240 3300005340 Bacteria 32170
71 Ga0070689_100223665 3300005340 Bacteria 1545
72 Ga0070689_100490729 3300005340 Bacteria 1051
73 Ga0070691_10020949 3300005341 Bacteria 3023
74 Ga0070691_10189075 3300005341 Bacteria 1076
75 Ga0070687_100000302 3300005343 Bacteria 16674
76 Ga0070661_100003117 3300005344 Bacteria 11411
77 Ga0070661_100068426 3300005344 Bacteria 2609
78 Ga0070661_100131740 3300005344 Bacteria 1878
79 Ga0070661_100156278 3300005344 Bacteria 1726
80 Ga0070692_10027705 3300005345 Bacteria 2811
81 Ga0070668_100003449 3300005347 Bacteria 11674
82 Ga0070668_100076646 3300005347 Bacteria 2612
83 Ga0070668_100103710 3300005347 Bacteria 2256
84 Ga0070668_100272139 3300005347 Bacteria 1412
85 Ga0070669_100009578 3300005353 Bacteria 6899
86 Ga0070669_100302641 3300005353 Bacteria 1286
87 Ga0070675_100001762 3300005354 Bacteria 15958
88 Ga0070675_100125583 3300005354 Bacteria 2182
89 Ga0070675_100208241 3300005354 Bacteria 1699
90 Ga0070675_100651086 3300005354 Bacteria 957
91 Ga0070675_100750101 3300005354 Bacteria 891
92 Ga0070671_100002861 3300005355 Bacteria 13424
93 Ga0070671_100117771 3300005355 Bacteria 2233
94 Ga0070671_100499273 3300005355 Bacteria 1047
95 Ga0070671_100519094 3300005355 Bacteria 1026
96 Ga0070674_100002865 3300005356 Bacteria 9536
97 Ga0070674_100625549 3300005356 Bacteria 912
98 Ga0070673_100001019 3300005364 Bacteria 15855
99 Ga0070673_100034773 3300005364 Bacteria 3816
100 Ga0070673_100227232 3300005364 Bacteria 1618
101 Ga0070673_100318795 3300005364 Bacteria 1373
102 Ga0070688_100010793 3300005365 Bacteria 5049
103 Ga0070688_100022950 3300005365 Bacteria 3663
104 Ga0070659_100005117 3300005366 Bacteria 9406
105 Ga0070659_100131998 3300005366 Bacteria 2029
106 Ga0070659_100342439 3300005366 Bacteria 1253
107 Ga0070659_100393710 3300005366 Bacteria 1168
108 Ga0070667_100001650 3300005367 Bacteria 19960
109 Ga0070667_100053374 3300005367 Bacteria 3411
110 Ga0070667_100068279 3300005367 Bacteria 3024
111 Ga0070667_100547268 3300005367 Bacteria 1064
112 Ga0070703_10002778 3300005406 Bacteria 5016
113 Ga0070709_10001960 3300005434 Bacteria 11217
114 Ga0070709_10002079 3300005434 Bacteria 10849
115 Ga0070709_10008334 3300005434 Bacteria 5691
116 Ga0070709_10017458 3300005434 Bacteria 4117
117 Ga0070709_10030167 3300005434 Bacteria 3251
118 Ga0070709_10166061 3300005434 Bacteria 1539
119 Ga0070709_10173191 3300005434 Bacteria 1510
120 Ga0070709_10461647 3300005434 Bacteria 958
121 Ga0070714_100003380 3300005435 Bacteria 11890
122 Ga0070714_100004982 3300005435 Bacteria 10093
123 Ga0070714_100050541 3300005435 Bacteria 3542
124 Ga0070714_100054993 3300005435 Bacteria 3402
125 Ga0070714_100287789 3300005435 Bacteria 1528
126 Ga0070714_100320733 3300005435 Bacteria 1449
127 Ga0070713_100005503 3300005436 Bacteria 8672
128 Ga0070713_100035581 3300005436 Bacteria 4010
129 Ga0070713_100035837 3300005436 Bacteria 3998
130 Ga0070713_100175737 3300005436 Bacteria 1921
131 Ga0070713_100196071 3300005436 Bacteria 1822
132 Ga0070713_100957551 3300005436 Bacteria 825
133 Ga0070710_10005443 3300005437 Bacteria 6048
134 Ga0070701_10000281 3300005438 Bacteria 16629
135 Ga0070711_100003146 3300005439 Bacteria 9574
136 Ga0070711_100022144 3300005439 Bacteria 4115
137 Ga0070711_100039401 3300005439 Bacteria 3183
138 Ga0070711_100046760 3300005439 Bacteria 2950
139 Ga0070711_100454980 3300005439 Bacteria 1048
140 Ga0070705_100001659 3300005440 Bacteria 11660
141 Ga0070705_100025036 3300005440 Bacteria 3230
142 Ga0070700_100001804 3300005441 Bacteria 10802
143 Ga0070700_100041536 3300005441 Bacteria 2820
144 Ga0070700_100216528 3300005441 Bacteria 1354
145 Ga0070700_100498094 3300005441 Bacteria 936
146 Ga0070694_100000576 3300005444 Bacteria 20334
147 Ga0070694_100267427 3300005444 Bacteria 1299
148 Ga0070694_100326738 3300005444 Bacteria 1182
149 Ga0070708_100006158 3300005445 Bacteria 9543
150 Ga0070708_100021331 3300005445 Bacteria 5476
151 Ga0070708_100028554 3300005445 Bacteria 4802
152 Ga0070708_100070172 3300005445 Bacteria 3151
153 Ga0070708_100085640 3300005445 Bacteria 2861
154 Ga0070708_100510048 3300005445 Bacteria 1134
155 Ga0070663_100003664 3300005455 Bacteria 8901
156 Ga0070663_100070816 3300005455 Bacteria 2536
157 Ga0070663_100080851 3300005455 Bacteria 2387
158 Ga0070663_100434989 3300005455 Bacteria 1078
159 Ga0070663_100651899 3300005455 Bacteria 890
160 Ga0070678_100006300 3300005456 Bacteria 6953
161 Ga0070678_100456821 3300005456 Bacteria 1120
162 Ga0070678_100659165 3300005456 Bacteria 939
163 Ga0070662_100194302 3300005457 Bacteria 1607
164 Ga0070681_10010247 3300005458 Bacteria 9248
165 Ga0070681_10020913 3300005458 Bacteria 6554
166 Ga0070681_10150329 3300005458 Bacteria 2255
167 Ga0070681_10150518 3300005458 Bacteria 2254
168 Ga0070681_10167923 3300005458 Bacteria 2116
169 Ga0070681_10191007 3300005458 Bacteria 1967
170 Ga0068867_100002151 3300005459 Bacteria 13821
171 Ga0068867_100064551 3300005459 Bacteria 2723
172 Ga0068867_100198087 3300005459 Bacteria 1606
173 Ga0070685_10049333 3300005466 Bacteria 2428
174 Ga0070706_100084513 3300005467 Bacteria 2940
175 Ga0070706_100107179 3300005467 Bacteria 2599
176 Ga0070706_100238540 3300005467 Bacteria 1698
177 Ga0070706_100261696 3300005467 Bacteria 1615
178 Ga0070706_100609066 3300005467 Bacteria 1015
179 Ga0070706_100722283 3300005467 Bacteria 923
180 Ga0070707_100018938 3300005468 Bacteria 6483
181 Ga0070707_100040622 3300005468 Bacteria 4451
182 Ga0070707_100082900 3300005468 Bacteria 3097
183 Ga0070707_100290348 3300005468 Bacteria 1589
184 Ga0070707_100415591 3300005468 Bacteria 1305
185 Ga0070698_100001171 3300005471 Bacteria 29108
186 Ga0070698_100005791 3300005471 Bacteria 13518
187 Ga0070698_100170211 3300005471 Bacteria 2120
188 Ga0070698_100182392 3300005471 Bacteria 2037
189 Ga0070698_100189075 3300005471 Bacteria 1997
190 Ga0070698_100340811 3300005471 Bacteria 1430
191 Ga0070698_100420205 3300005471 Bacteria 1271
192 Ga0070698_100690413 3300005471 Bacteria 962
193 Ga0070698_100699625 3300005471 Bacteria 955
194 Ga0070699_100006362 3300005518 Bacteria 10297
195 Ga0070699_100006895 3300005518 Bacteria 9881
196 Ga0070699_100022064 3300005518 Bacteria 5484
197 Ga0070699_100162407 3300005518 Bacteria 1977
198 Ga0070699_100299951 3300005518 Bacteria 1441
199 Ga0070679_100003426 3300005530 Bacteria 14521
200 Ga0070679_100005687 3300005530 Bacteria 11562
201 Ga0070679_100027474 3300005530 Bacteria 5601
202 Ga0070679_100215944 3300005530 Bacteria 1880
203 Ga0070679_100239003 3300005530 Bacteria 1774
204 Ga0070679_100326452 3300005530 Bacteria 1483
205 Ga0070679_100358734 3300005530 Bacteria 1405
206 Ga0070679_100379825 3300005530 Bacteria 1360
207 Ga0070684_100011854 3300005535 Bacteria 6960
208 Ga0070684_100012047 3300005535 Bacteria 6912
209 Ga0070684_100033680 3300005535 Bacteria 4376
210 Ga0070684_100086741 3300005535 Bacteria 2778
211 Ga0070697_100019057 3300005536 Bacteria 5415
212 Ga0070697_100023652 3300005536 Bacteria 4887
213 Ga0070697_100191407 3300005536 Bacteria 1736
214 Ga0070697_100302720 3300005536 Bacteria 1374
215 Ga0070697_100444829 3300005536 Bacteria 1128
216 Ga0068853_100004149 3300005539 Bacteria 11169
217 Ga0068853_100007962 3300005539 Bacteria 8498
218 Ga0068853_100084860 3300005539 Bacteria 2775
219 Ga0068853_100266376 3300005539 Bacteria 1577
220 Ga0068853_100498279 3300005539 Bacteria 1150
221 Ga0068853_100518389 3300005539 Bacteria 1127
222 Ga0068853_100602340 3300005539 Bacteria 1043
223 Ga0068853_100731975 3300005539 Bacteria 945
224 Ga0070672_100004101 3300005543 Bacteria 9511
225 Ga0070672_100083906 3300005543 Bacteria 2558
226 Ga0070672_100190388 3300005543 Bacteria 1713
227 Ga0070672_100342323 3300005543 Bacteria 1274
228 Ga0070672_100439458 3300005543 Bacteria 1122
229 Ga0070686_100002850 3300005544 Bacteria 9524
230 Ga0070686_100371033 3300005544 Bacteria 1081
231 Ga0070695_100009940 3300005545 Bacteria 5671
232 Ga0070696_100006975 3300005546 Bacteria 7539
233 Ga0070696_100220734 3300005546 Bacteria 1422
234 Ga0070696_100284480 3300005546 Bacteria 1262
235 Ga0070693_100002142 3300005547 Bacteria 9050
236 Ga0070693_100043501 3300005547 Bacteria 2536
237 Ga0070693_100091281 3300005547 Bacteria 1836
238 Ga0070665_100003622 3300005548 Bacteria 16361
239 Ga0070665_100051658 3300005548 Bacteria 4122
240 Ga0070665_100146230 3300005548 Bacteria 2366
241 Ga0070665_100162015 3300005548 Bacteria 2238
242 Ga0070665_100167853 3300005548 Bacteria 2196
243 Ga0070665_100359247 3300005548 Bacteria 1462
244 Ga0070665_100492077 3300005548 Bacteria 1237
245 Ga0070665_100909538 3300005548 Bacteria 893
246 Ga0070704_100000444 3300005549 Bacteria 19453
247 Ga0070704_100077242 3300005549 Bacteria 2438
248 Ga0070704_100088629 3300005549 Bacteria 2299
249 Ga0068855_100035351 3300005563 Bacteria 5952
250 Ga0068855_100038019 3300005563 Bacteria 5721
251 Ga0068855_100073196 3300005563 Bacteria 3981
252 Ga0068855_100084816 3300005563 Bacteria 3666
253 Ga0068855_100131307 3300005563 Bacteria 2860
254 Ga0068855_100224204 3300005563 Bacteria 2107
255 Ga0068855_100238994 3300005563 Bacteria 2030
256 Ga0068855_100262674 3300005563 Bacteria 1923
257 Ga0068855_100389982 3300005563 Bacteria 1528
258 Ga0068855_100424422 3300005563 Bacteria 1454
259 Ga0068855_100607661 3300005563 Bacteria 1178
260 Ga0070664_100012305 3300005564 Bacteria 6953
261 Ga0070664_100193984 3300005564 Bacteria 1810
262 Ga0070664_100204358 3300005564 Bacteria 1764
263 Ga0070664_100232809 3300005564 Bacteria 1651
264 Ga0070664_100653392 3300005564 Bacteria 977
265 Ga0068857_100004239 3300005577 Bacteria 12087
266 Ga0068857_100020977 3300005577 Bacteria 5748
267 Ga0068857_100070627 3300005577 Bacteria 3111
268 Ga0068857_100168502 3300005577 Bacteria 1990
269 Ga0068857_100248392 3300005577 Bacteria 1630
270 Ga0068857_100371190 3300005577 Bacteria 1327
271 Ga0068854_100005104 3300005578 Bacteria 8270
272 Ga0068854_100137220 3300005578 Bacteria 1873
273 Ga0068856_100038973 3300005614 Bacteria 4666
274 Ga0068856_100059548 3300005614 Bacteria 3772
275 Ga0068856_100219306 3300005614 Bacteria 1917
276 Ga0068856_100242268 3300005614 Bacteria 1818
277 Ga0068856_100683695 3300005614 Bacteria 1047
278 Ga0068856_100815379 3300005614 Bacteria 953
279 Ga0070702_100001491 3300005615 Bacteria 9621
280 Ga0070702_100115063 3300005615 Bacteria 1674
281 Ga0068852_100000932 3300005616 Bacteria 19310
282 Ga0068852_100193681 3300005616 Bacteria 1920
283 Ga0068852_100327950 3300005616 Bacteria 1488
284 Ga0068852_100347483 3300005616 Bacteria 1447
285 Ga0068859_100002825 3300005617 Bacteria 17604
286 Ga0068859_100055931 3300005617 Bacteria 3970
287 Ga0068859_100108703 3300005617 Bacteria 2834
288 Ga0068864_100002030 3300005618 Bacteria 16706
289 Ga0068864_100035218 3300005618 Bacteria 4261
290 Ga0068864_100092544 3300005618 Bacteria 2669
291 Ga0068864_100504424 3300005618 Bacteria 1164
292 Ga0068866_10000638 3300005718 Bacteria 15871
293 Ga0068866_10118537 3300005718 Bacteria 1488
294 Ga0068866_10249854 3300005718 Bacteria 1084
295 Ga0068861_100004452 3300005719 Bacteria 9406
296 Ga0068851_10040747 3300005834 Bacteria 2335
297 Ga0068851_10099516 3300005834 Bacteria 1541
298 Ga0068870_10000048 3300005840 Bacteria 37476
299 Ga0068863_100001975 3300005841 Bacteria 20397
300 Ga0068863_100391832 3300005841 Bacteria 1357
301 Ga0068858_100008206 3300005842 Bacteria 10040
302 Ga0068858_100073450 3300005842 Bacteria 3174
303 Ga0068860_100000933 3300005843 Bacteria 32339
304 Ga0068860_100017528 3300005843 Bacteria 6977
305 Ga0068860_100144851 3300005843 Bacteria 2285
306 Ga0068860_100317585 3300005843 Bacteria 1528
307 Ga0068860_100689963 3300005843 Bacteria 1030
308 Ga0068862_100026562 3300005844 Bacteria 4867
309 Ga0068862_100185846 3300005844 Bacteria 1867
310 Ga0068862_100276122 3300005844 Bacteria 1538
311 Ga0081455_10002021 3300005937 Bacteria 24257
312 Ga0081455_10004363 3300005937 Bacteria 15926
313 Ga0081455_10005161 3300005937 Bacteria 14378
314 Ga0081455_10005318 3300005937 Bacteria 14137
315 Ga0081455_10010563 3300005937 Bacteria 9350
316 Ga0081455_10011965 3300005937 Bacteria 8685
317 Ga0081455_10021579 3300005937 Bacteria 6037
318 Ga0081455_10033400 3300005937 Bacteria 4624
319 Ga0081455_10043525 3300005937 Bacteria 3926
320 Ga0081455_10068940 3300005937 Bacteria 2942
321 Ga0081455_10075291 3300005937 Bacteria 2785
322 Ga0081538_10069563 3300005981 Bacteria 1949
323 Ga0081540_1000280 3300005983 Bacteria 53060
324 Ga0081540_1002252 3300005983 Bacteria 15882
325 Ga0081540_1005512 3300005983 Bacteria 9439
326 Ga0081540_1011141 3300005983 Bacteria 6035
327 Ga0081540_1011980 3300005983 Bacteria 5748
328 Ga0081540_1036034 3300005983 Bacteria 2644
329 Ga0081540_1038641 3300005983 Bacteria 2514
330 Ga0081539_10000051 3300005985 Bacteria 268337
331 Ga0081539_10000486 3300005985 Bacteria 84009
332 Ga0081539_10003351 3300005985 Bacteria 19892
333 Ga0081539_10031311 3300005985 Bacteria 3282
334 Ga0081539_10091328 3300005985 Bacteria 1573
335 Ga0070717_10000150 3300006028 Bacteria 51802
336 Ga0070717_10001555 3300006028 Bacteria 15906
337 Ga0070717_10011942 3300006028 Bacteria 6610
338 Ga0070717_10176264 3300006028 Bacteria 1862
339 Ga0075365_10003263 3300006038 Bacteria 8312
340 Ga0075365_10052047 3300006038 Bacteria 2707
341 Ga0075365_10330084 3300006038 Bacteria 1074
342 Ga0075365_10402045 3300006038 Bacteria 967
343 Ga0075368_10003112 3300006042 Bacteria 5506
344 Ga0075368_10107953 3300006042 Bacteria 1146
345 Ga0075368_10199552 3300006042 Bacteria 846
346 Ga0075363_100022684 3300006048 Bacteria 3175
347 Ga0075363_100166830 3300006048 Bacteria 1249
348 Ga0075364_10026988 3300006051 Bacteria 3666
349 Ga0075364_10085514 3300006051 Bacteria 2089
350 Ga0075364_10368366 3300006051 Bacteria 980
351 Ga0075364_10402808 3300006051 Bacteria 934
352 Ga0070715_10000321 3300006163 Bacteria 11851
353 Ga0070715_10030468 3300006163 Bacteria 2182
354 Ga0070715_10039547 3300006163 Bacteria 1965
355 Ga0070715_10173242 3300006163 Bacteria 1076
356 Ga0070716_100001200 3300006173 Bacteria 11402
357 Ga0070716_100018951 3300006173 Bacteria 3591
358 Ga0070716_100105020 3300006173 Bacteria 1740
359 Ga0070716_100125734 3300006173 Bacteria 1612
360 Ga0070716_100277372 3300006173 Bacteria 1155
361 Ga0070712_100004740 3300006175 Bacteria 8407
362 Ga0070712_100057102 3300006175 Bacteria 2741
363 Ga0070712_100063106 3300006175 Bacteria 2621
364 Ga0070712_100072856 3300006175 Bacteria 2462
365 Ga0070712_100073747 3300006175 Bacteria 2449
366 Ga0070712_100118722 3300006175 Bacteria 1987
367 Ga0070712_100126287 3300006175 Bacteria 1932
368 Ga0070712_100379754 3300006175 Bacteria 1163
369 Ga0075362_10001695 3300006177 Bacteria 7145
370 Ga0075362_10107617 3300006177 Bacteria 1310
371 Ga0075362_10138886 3300006177 Bacteria 1160
372 Ga0075362_10168066 3300006177 Bacteria 1058
373 Ga0075362_10190697 3300006177 Bacteria 995
374 Ga0075367_10018878 3300006178 Bacteria 3812
375 Ga0075367_10022791 3300006178 Bacteria 3516
376 Ga0075367_10170445 3300006178 Bacteria 1356
377 Ga0075367_10247511 3300006178 Bacteria 1117
378 Ga0075367_10413578 3300006178 Bacteria 853
379 Ga0075369_10002166 3300006186 Bacteria 6941
380 Ga0075369_10045606 3300006186 Bacteria 1885
381 Ga0075369_10196443 3300006186 Bacteria 930
382 Ga0075366_10007150 3300006195 Bacteria 6148
383 Ga0075366_10025959 3300006195 Bacteria 3427
384 Ga0075366_10073201 3300006195 Bacteria 2042
385 Ga0097621_100002984 3300006237 Bacteria 11619
386 Ga0097621_100222730 3300006237 Bacteria 1644
387 Ga0097621_100871030 3300006237 Bacteria 837
388 Ga0075370_10101745 3300006353 Bacteria 1663
389 Ga0075370_10104514 3300006353 Bacteria 1641
390 Ga0075370_10110461 3300006353 Bacteria 1597
391 Ga0075370_10162316 3300006353 Bacteria 1312
392 Ga0068871_100000555 3300006358 Bacteria 25466
393 Ga0068871_100004433 3300006358 Bacteria 9765
394 Ga0068871_100447185 3300006358 Bacteria 1158
395 Ga0068871_100624562 3300006358 Bacteria 982
396 Ga0075428_100052861 3300006844 Bacteria 4451
397 Ga0075428_100058497 3300006844 Bacteria 4220
398 Ga0075430_100000042 3300006846 Bacteria 66464
399 Ga0075430_100000534 3300006846 Bacteria 28676
400 Ga0075430_100000826 3300006846 Bacteria 24185
401 Ga0075431_100086521 3300006847 Bacteria 3234
402 Ga0075431_100091253 3300006847 Bacteria 3144
403 Ga0075431_100447718 3300006847 Bacteria 1287
404 Ga0075431_100663262 3300006847 Bacteria 1023
405 Ga0075433_10006248 3300006852 Bacteria 9402
406 Ga0075433_10011316 3300006852 Bacteria 7181
407 Ga0075433_10012151 3300006852 Bacteria 6942
408 Ga0075433_10022378 3300006852 Bacteria 5306
409 Ga0075433_10207998 3300006852 Bacteria 1739
410 Ga0075433_10404271 3300006852 Bacteria 1205
411 Ga0075434_100012903 3300006871 Bacteria 7936
412 Ga0075434_100016644 3300006871 Bacteria 7071
413 Ga0075434_100017132 3300006871 Bacteria 6973
414 Ga0075434_100019982 3300006871 Bacteria 6487
415 Ga0075434_100027752 3300006871 Bacteria 5559
416 Ga0075434_100147528 3300006871 Bacteria 2373
417 Ga0075434_100163062 3300006871 Bacteria 2249
418 Ga0075434_100267252 3300006871 Bacteria 1729
419 Ga0075434_100304674 3300006871 Bacteria 1613
420 Ga0075434_100346490 3300006871 Bacteria 1507
421 Ga0075434_100368028 3300006871 Bacteria 1458
422 Ga0075429_100003563 3300006880 Bacteria 13263
423 Ga0075429_100017797 3300006880 Bacteria 6146
424 Ga0075429_100042041 3300006880 Bacteria 3979
425 Ga0075429_100062288 3300006880 Bacteria 3250
426 Ga0068865_100049753 3300006881 Bacteria 2891
427 Ga0068865_100135239 3300006881 Bacteria 1851
428 Ga0075436_100021433 3300006914 Bacteria 4437
429 Ga0075436_100051974 3300006914 Bacteria 2828
430 Ga0075436_100057781 3300006914 Bacteria 2679
431 Ga0075436_100127649 3300006914 Bacteria 1782
432 Ga0075436_100430729 3300006914 Bacteria 959
433 Ga0097620_100002825 3300006931 Bacteria 17604
434 Ga0097620_100055932 3300006931 Bacteria 3970
435 Ga0097620_100108696 3300006931 Bacteria 2834
436 Ga0099824_1004900 3300006942 Bacteria 19056
437 Ga0099824_1029293 3300006942 Bacteria 2370
438 Ga0099822_1000677 3300006943 Bacteria 34391
439 Ga0075435_100018059 3300007076 Bacteria 5352
440 Ga0075435_100045774 3300007076 Bacteria 3509
441 Ga0075435_100057475 3300007076 Bacteria 3147
442 Ga0075435_100062982 3300007076 Bacteria 3011
443 Ga0075435_100068323 3300007076 Bacteria 2894
444 Ga0075435_100084879 3300007076 Bacteria 2606
445 Ga0075435_100218901 3300007076 Bacteria 1617
446 Ga0075435_100273373 3300007076 Bacteria 1441
447 Ga0075435_100293565 3300007076 Bacteria 1389
448 Ga0075435_100307271 3300007076 Bacteria 1357
449 Ga0099794_10016964 3300007265 Bacteria 3238
450 Ga0099794_10047778 3300007265 Bacteria 2053
451 Ga0099794_10181752 3300007265 Bacteria 1074
452 Ga0099795_10058807 3300007788 Bacteria 1420
453 Ga0099795_10120237 3300007788 Bacteria 1049
454 Ga0105240_10008025 3300009093 Bacteria 15195
455 Ga0105240_10027519 3300009093 Bacteria 7441
456 Ga0105240_10033952 3300009093 Bacteria 6587
457 Ga0105240_10086994 3300009093 Bacteria 3827
458 Ga0105240_10129550 3300009093 Bacteria 3028
459 Ga0105240_10174326 3300009093 Bacteria 2544
460 Ga0105240_10191853 3300009093 Bacteria 2402
461 Ga0111539_10002792 3300009094 Bacteria 23179
462 Ga0111539_10004409 3300009094 Bacteria 18396
463 Ga0111539_10004721 3300009094 Bacteria 17807
464 Ga0111539_10016484 3300009094 Bacteria 9162
465 Ga0111539_10115084 3300009094 Bacteria 3154
466 Ga0111539_10157494 3300009094 Bacteria 2657
467 Ga0111539_10533202 3300009094 Bacteria 1368
468 Ga0111539_10754634 3300009094 Bacteria 1132
469 Ga0105245_10000370 3300009098 Bacteria 41982
470 Ga0105245_10009595 3300009098 Bacteria 8440
471 Ga0105245_10019672 3300009098 Bacteria 5916
472 Ga0105245_10313762 3300009098 Bacteria 1543
473 Ga0105245_10317008 3300009098 Bacteria 1535
474 Ga0105245_10398638 3300009098 Bacteria 1374
475 Ga0105245_10569306 3300009098 Bacteria 1156
476 Ga0105245_10706223 3300009098 Bacteria 1042
477 Ga0105247_10002042 3300009101 Bacteria 13972
478 Ga0114129_10024612 3300009147 Bacteria 8531
479 Ga0114129_10035072 3300009147 Bacteria 7087
480 Ga0114129_10057279 3300009147 Bacteria 5455
481 Ga0114129_10062807 3300009147 Bacteria 5187
482 Ga0114129_10095997 3300009147 Bacteria 4105
483 Ga0114129_10241848 3300009147 Bacteria 2426
484 Ga0114129_10685163 3300009147 Bacteria 1319
485 Ga0114129_10741655 3300009147 Bacteria 1258
486 Ga0114129_10770015 3300009147 Bacteria 1230
487 Ga0114129_11650956 3300009147 Bacteria 783
488 Ga0105243_10003045 3300009148 Bacteria 13818
489 Ga0105243_10009792 3300009148 Bacteria 7296
490 Ga0105243_10174023 3300009148 Bacteria 1867
491 Ga0105243_10632848 3300009148 Bacteria 1034
492 Ga0105243_10646984 3300009148 Bacteria 1024
493 Ga0105243_10736654 3300009148 Bacteria 965
494 Ga0105241_10001352 3300009174 Bacteria 18650
495 Ga0105241_10092438 3300009174 Bacteria 2389
496 Ga0105241_10591021 3300009174 Bacteria 1002
497 Ga0105242_10001245 3300009176 Bacteria 20067
498 Ga0105242_10234816 3300009176 Bacteria 1645
499 Ga0105242_10292772 3300009176 Bacteria 1483
500 Ga0105242_10475396 3300009176 Bacteria 1183
501 Ga0105242_10891089 3300009176 Bacteria 889
502 Ga0105248_10001324 3300009177 Bacteria 27565
503 Ga0105248_10016609 3300009177 Bacteria 8105
504 Ga0105248_10027404 3300009177 Bacteria 6343
505 Ga0105248_10137102 3300009177 Bacteria 2760
506 Ga0105248_10142505 3300009177 Bacteria 2704
507 Ga0105248_10236177 3300009177 Bacteria 2058
508 Ga0105237_10002060 3300009545 Bacteria 25535
509 Ga0105237_10051893 3300009545 Bacteria 4119
510 Ga0105237_10502841 3300009545 Bacteria 1219
511 Ga0105238_10168915 3300009551 Bacteria 2163
512 Ga0105238_10519124 3300009551 Bacteria 1194
513 Ga0105249_10011280 3300009553 Bacteria 7845
514 Ga0105249_10044003 3300009553 Bacteria 4061
515 Ga0105249_10243921 3300009553 Bacteria 1778
516 Ga0105239_10018332 3300010375 Bacteria 7738
517 Ga0105239_10046768 3300010375 Bacteria 4743
518 Ga0105239_10063519 3300010375 Bacteria 4054
519 Ga0105239_10132942 3300010375 Bacteria 2768
520 Ga0105239_10240473 3300010375 Bacteria 2032
521 Ga0105239_10326261 3300010375 Bacteria 1731
522 Ga0105239_10390965 3300010375 Bacteria 1573
523 Ga0105239_10524366 3300010375 Bacteria 1348
524 Ga0105239_10642095 3300010375 Bacteria 1212
525 Ga0105246_10000510 3300011119 Bacteria 21126
526 Ga0105246_10070617 3300011119 Bacteria 2457
527 Ga0105246_10169126 3300011119 Bacteria 1672
528 Ga0157315_1005559 3300012508 Bacteria 950
529 Ga0157373_10002949 3300013100 Bacteria 12892
530 Ga0157371_10032190 3300013102 Bacteria 3774
531 Ga0157370_10022603 3300013104 Bacteria 6257
532 Ga0157370_10042139 3300013104 Bacteria 4401
533 Ga0157370_10115657 3300013104 Bacteria 2505
534 Ga0157370_10280866 3300013104 Bacteria 1538
535 Ga0157369_10034680 3300013105 Bacteria 5535
536 Ga0157369_10045599 3300013105 Bacteria 4766
537 Ga0157369_10305824 3300013105 Bacteria 1654
538 Ga0157374_10001994 3300013296 Bacteria 17142
539 Ga0157374_10964442 3300013296 Bacteria 871
540 Ga0157378_10005283 3300013297 Bacteria 11342
541 Ga0157378_10177813 3300013297 Bacteria 2000
542 Ga0157378_10326744 3300013297 Bacteria 1492
543 Ga0163162_10018668 3300013306 Bacteria 6794
544 Ga0163162_10129762 3300013306 Bacteria 2629
545 Ga0163162_10775572 3300013306 Bacteria 1077
546 Ga0157372_10214993 3300013307 Bacteria 2228
547 Ga0157372_10676412 3300013307 Bacteria 1201
548 Ga0157375_10038248 3300013308 Bacteria 4606
549 Ga0157375_10245534 3300013308 Bacteria 1950
550 Ga0157375_10259770 3300013308 Bacteria 1898
551 Ga0157375_10299558 3300013308 Bacteria 1771
552 Ga0163163_10017133 3300014325 Bacteria 6749
553 Ga0163163_10063041 3300014325 Bacteria 3675
554 Ga0163163_10126958 3300014325 Bacteria 2589
555 Ga0163163_10393886 3300014325 Bacteria 1443
556 Ga0163163_10541197 3300014325 Bacteria 1227
557 Ga0163163_10893255 3300014325 Bacteria 952
558 Ga0163163_11035903 3300014325 Bacteria 884
559 Ga0157380_10010558 3300014326 Bacteria 6642
560 Ga0157380_10044784 3300014326 Bacteria 3469
561 Ga0157380_10278226 3300014326 Bacteria 1530
562 Ga0157380_10785985 3300014326 Bacteria 967
563 Ga0182008_10165678 3300014497 Bacteria 1114
564 Ga0182008_10242838 3300014497 Bacteria 927
565 Ga0157377_10001228 3300014745 Bacteria 10949
566 Ga0157379_10001959 3300014968 Bacteria 17038
567 Ga0157379_10133256 3300014968 Bacteria 2238
568 Ga0157379_10206894 3300014968 Bacteria 1775
569 Ga0157376_10017127 3300014969 Bacteria 5520
570 Ga0157376_10066771 3300014969 Bacteria 3041
571 Ga0157376_10739305 3300014969 Bacteria 992
572 Ga0157376_10922161 3300014969 Bacteria 892
573 Ga0182005_1039485 3300015265 Bacteria 1284
574 Ga0163161_10017343 3300017792 Bacteria 5039
575 Ga0163161_10038485 3300017792 Bacteria 3430
576 Ga0163161_10131788 3300017792 Bacteria 1886
577 Ga0214544_1000026 3300021320 Bacteria 161530
578 Ga0214542_1000025 3300021321 Bacteria 183588
579 Ga0214545_1000014 3300021324 Bacteria 183588
580 Ga0214543_1000034 3300021327 Bacteria 183712
581 Ga0213873_10006937 3300021358 Bacteria 2249
582 Ga0213876_10058129 3300021384 Bacteria 2041
583 Ga0213876_10084092 3300021384 Bacteria 1684
584 Ga0213876_10130132 3300021384 Bacteria 1337
585 Ga0213875_10093331 3300021388 Bacteria 1404
586 Ga0213871_10004587 3300021441 Bacteria 2777
587 Ga0213871_10054108 3300021441 Bacteria 1106
588 Ga0213871_10085835 3300021441 Bacteria 907
589 Ga0209677_103618 3300025253 Bacteria 4887
590 Ga0209148_1000376 3300025254 Bacteria 54217
591 Ga0209233_1009577 3300025261 Bacteria 2942
592 Ga0207666_1000081 3300025271 Bacteria 15694
593 Ga0209455_1000714 3300025272 Bacteria 19245
594 Ga0207673_1001727 3300025290 Bacteria 2419
595 Ga0209564_1011304 3300025295 Bacteria 4012
596 Ga0209758_1000141 3300025297 Bacteria 172481
597 Ga0209758_1000324 3300025297 Bacteria 91475
598 Ga0209758_1001019 3300025297 Bacteria 37066
599 Ga0209758_1002338 3300025297 Bacteria 19567
600 Ga0209758_1002921 3300025297 Bacteria 16464
601 Ga0209758_1003483 3300025297 Bacteria 14255
602 Ga0209758_1041951 3300025297 Bacteria 1703
603 Ga0209758_1081463 3300025297 Bacteria 977
604 Ga0209256_1002956 3300025299 Bacteria 12733
605 Ga0209256_1047199 3300025299 Bacteria 1061
606 Ga0207426_1000437 3300025302 Bacteria 67439
607 Ga0207426_1001139 3300025302 Bacteria 24022
608 Ga0207426_1012626 3300025302 Bacteria 3166
609 Ga0207426_1018791 3300025302 Bacteria 2429
610 Ga0207426_1021983 3300025302 Bacteria 2196
611 Ga0209257_1003859 3300025304 Bacteria 12250
612 Ga0209257_1011469 3300025304 Bacteria 4263
613 Ga0209257_1040537 3300025304 Bacteria 1388
614 Ga0207697_10000051 3300025315 Bacteria 47188
615 Ga0207697_10086702 3300025315 Bacteria 1324
616 Ga0207697_10113018 3300025315 Bacteria 1164
617 Ga0207682_10000661 3300025893 Bacteria 16103
618 Ga0207692_10002517 3300025898 Bacteria 7042
619 Ga0207692_10177558 3300025898 Bacteria 1239
620 Ga0207692_10214027 3300025898 Bacteria 1139
621 Ga0207692_10350439 3300025898 Bacteria 910
622 Ga0207642_10001892 3300025899 Bacteria 6454
623 Ga0207710_10016916 3300025900 Bacteria 3088
624 Ga0207710_10038841 3300025900 Bacteria 2105
625 Ga0207710_10079983 3300025900 Bacteria 1515
626 Ga0207688_10000702 3300025901 Bacteria 16518
627 Ga0207688_10114944 3300025901 Bacteria 1565
628 Ga0207688_10167168 3300025901 Bacteria 1306
629 Ga0207688_10411062 3300025901 Bacteria 840
630 Ga0207688_10477369 3300025901 Bacteria 779
631 Ga0207680_10009478 3300025903 Bacteria 4831
632 Ga0207680_10044806 3300025903 Bacteria 2604
633 Ga0207647_10002441 3300025904 Bacteria 14092
634 Ga0207647_10040227 3300025904 Bacteria 2946
635 Ga0207685_10010399 3300025905 Bacteria 2747
636 Ga0207685_10056738 3300025905 Bacteria 1534
637 Ga0207699_10000344 3300025906 Bacteria 24676
638 Ga0207699_10000434 3300025906 Bacteria 21301
639 Ga0207699_10035971 3300025906 Bacteria 2820
640 Ga0207699_10101229 3300025906 Bacteria 1829
641 Ga0207699_10154439 3300025906 Bacteria 1522
642 Ga0207645_10000218 3300025907 Bacteria 47372
643 Ga0207645_10027565 3300025907 Bacteria 3667
644 Ga0207645_10045314 3300025907 Bacteria 2811
645 Ga0207643_10000400 3300025908 Bacteria 28899
646 Ga0207643_10234976 3300025908 Bacteria 1125
647 Ga0207705_10358320 3300025909 Bacteria 1125
648 Ga0207705_10392607 3300025909 Bacteria 1073
649 Ga0207684_10004496 3300025910 Bacteria 13113
650 Ga0207684_10004520 3300025910 Bacteria 13068
651 Ga0207684_10012329 3300025910 Bacteria 7440
652 Ga0207684_10015203 3300025910 Bacteria 6630
653 Ga0207684_10087821 3300025910 Bacteria 2649
654 Ga0207684_10282202 3300025910 Bacteria 1432
655 Ga0207684_10292934 3300025910 Bacteria 1403
656 Ga0207654_10002726 3300025911 Bacteria 8969
657 Ga0207654_10194687 3300025911 Bacteria 1331
658 Ga0207707_10002658 3300025912 Bacteria 15980
659 Ga0207707_10011843 3300025912 Bacteria 7585
660 Ga0207707_10023997 3300025912 Bacteria 5332
661 Ga0207707_10043382 3300025912 Bacteria 3923
662 Ga0207707_10056384 3300025912 Bacteria 3418
663 Ga0207707_10063500 3300025912 Bacteria 3214
664 Ga0207707_10410557 3300025912 Bacteria 1162
665 Ga0207695_10036649 3300025913 Bacteria 5300
666 Ga0207695_10050434 3300025913 Bacteria 4378
667 Ga0207695_10085924 3300025913 Bacteria 3174
668 Ga0207695_10115522 3300025913 Bacteria 2658
669 Ga0207695_10212050 3300025913 Bacteria 1847
670 Ga0207695_10236470 3300025913 Bacteria 1729
671 Ga0207671_10131265 3300025914 Bacteria 1923
672 Ga0207671_10143288 3300025914 Bacteria 1842
673 Ga0207671_10521032 3300025914 Bacteria 948
674 Ga0207671_10529112 3300025914 Bacteria 940
675 Ga0207693_10001161 3300025915 Bacteria 23500
676 Ga0207693_10003608 3300025915 Bacteria 13212
677 Ga0207693_10035323 3300025915 Bacteria 3941
678 Ga0207693_10042279 3300025915 Bacteria 3588
679 Ga0207693_10085481 3300025915 Bacteria 2471
680 Ga0207693_10132528 3300025915 Bacteria 1959
681 Ga0207693_10206011 3300025915 Bacteria 1546
682 Ga0207693_10269282 3300025915 Bacteria 1335
683 Ga0207693_10321843 3300025915 Bacteria 1210
684 Ga0207693_10365645 3300025915 Bacteria 1129
685 Ga0207663_10000926 3300025916 Bacteria 13406
686 Ga0207663_10012457 3300025916 Bacteria 4599
687 Ga0207660_10002897 3300025917 Bacteria 11208
688 Ga0207660_10010384 3300025917 Bacteria 6041
689 Ga0207660_10013462 3300025917 Bacteria 5361
690 Ga0207660_10495516 3300025917 Bacteria 991
691 Ga0207660_10651928 3300025917 Bacteria 858
692 Ga0207662_10000678 3300025918 Bacteria 15500
693 Ga0207657_10003448 3300025919 Bacteria 16876
694 Ga0207657_10075202 3300025919 Bacteria 2851
695 Ga0207657_10095681 3300025919 Bacteria 2471
696 Ga0207657_10138003 3300025919 Bacteria 1994
697 Ga0207657_10166205 3300025919 Bacteria 1789
698 Ga0207657_10560607 3300025919 Bacteria 893
699 Ga0207649_10001450 3300025920 Bacteria 13956
700 Ga0207652_10005840 3300025921 Bacteria 9970
701 Ga0207652_10006902 3300025921 Bacteria 9146
702 Ga0207652_10008077 3300025921 Bacteria 8447
703 Ga0207652_10016789 3300025921 Bacteria 5982
704 Ga0207652_10211430 3300025921 Bacteria 1746
705 Ga0207652_10346504 3300025921 Bacteria 1341
706 Ga0207646_10003037 3300025922 Bacteria 19308
707 Ga0207646_10078591 3300025922 Bacteria 2949
708 Ga0207646_10159870 3300025922 Bacteria 2032
709 Ga0207646_10244434 3300025922 Bacteria 1621
710 Ga0207646_10525802 3300025922 Bacteria 1065
711 Ga0207681_10001264 3300025923 Bacteria 16325
712 Ga0207681_10203390 3300025923 Bacteria 1522
713 Ga0207681_10259340 3300025923 Bacteria 1360
714 Ga0207694_10113941 3300025924 Bacteria 2153
715 Ga0207694_10125399 3300025924 Bacteria 2054
716 Ga0207694_10153373 3300025924 Bacteria 1857
717 Ga0207694_10296268 3300025924 Bacteria 1331
718 Ga0207694_10464238 3300025924 Bacteria 1058
719 Ga0207650_10043914 3300025925 Bacteria 3283
720 Ga0207650_10085722 3300025925 Bacteria 2397
721 Ga0207650_10219732 3300025925 Bacteria 1529
722 Ga0207659_10004045 3300025926 Bacteria 8850
723 Ga0207659_10248312 3300025926 Bacteria 1443
724 Ga0207659_10421962 3300025926 Bacteria 1119
725 Ga0207687_10007913 3300025927 Bacteria 6965
726 Ga0207687_10040438 3300025927 Bacteria 3196
727 Ga0207687_10427047 3300025927 Bacteria 1095
728 Ga0207700_10001395 3300025928 Bacteria 13709
729 Ga0207700_10015437 3300025928 Bacteria 5039
730 Ga0207700_10015756 3300025928 Bacteria 4998
731 Ga0207700_10090002 3300025928 Bacteria 2420
732 Ga0207700_10096610 3300025928 Bacteria 2346
733 Ga0207700_10101360 3300025928 Bacteria 2297
734 Ga0207700_10524626 3300025928 Bacteria 1050
735 Ga0207664_10023034 3300025929 Bacteria 4661
736 Ga0207664_10064254 3300025929 Bacteria 2935
737 Ga0207664_10145777 3300025929 Bacteria 2007
738 Ga0207664_10726649 3300025929 Bacteria 893
739 Ga0207644_10044060 3300025931 Bacteria 3168
740 Ga0207644_10091325 3300025931 Bacteria 2270
741 Ga0207644_10114849 3300025931 Bacteria 2041
742 Ga0207690_10003720 3300025932 Bacteria 9064
743 Ga0207690_10103954 3300025932 Bacteria 2034
744 Ga0207706_10016490 3300025933 Bacteria 6667
745 Ga0207706_10168370 3300025933 Bacteria 1925
746 Ga0207706_10176636 3300025933 Bacteria 1876
747 Ga0207706_10199102 3300025933 Bacteria 1757
748 Ga0207706_10297489 3300025933 Bacteria 1406
749 Ga0207706_10518744 3300025933 Bacteria 1027
750 Ga0207686_10012733 3300025934 Bacteria 4631
751 Ga0207686_10017495 3300025934 Bacteria 4040
752 Ga0207709_10001798 3300025935 Bacteria 14367
753 Ga0207709_10056378 3300025935 Bacteria 2432
754 Ga0207709_10081552 3300025935 Bacteria 2086
755 Ga0207670_10003328 3300025936 Bacteria 8522
756 Ga0207670_10046656 3300025936 Bacteria 2880
757 Ga0207670_10073089 3300025936 Bacteria 2377
758 Ga0207669_10002357 3300025937 Bacteria 8031
759 Ga0207669_10047148 3300025937 Bacteria 2550
760 Ga0207704_10000896 3300025938 Bacteria 13231
761 Ga0207704_10047543 3300025938 Bacteria 2565
762 Ga0207665_10000228 3300025939 Bacteria 38348
763 Ga0207665_10000715 3300025939 Bacteria 22506
764 Ga0207665_10002595 3300025939 Bacteria 12150
765 Ga0207665_10019118 3300025939 Bacteria 4501
766 Ga0207665_10023485 3300025939 Bacteria 4063
767 Ga0207665_10149363 3300025939 Bacteria 1673
768 Ga0207665_10327372 3300025939 Bacteria 1151
769 Ga0207691_10000940 3300025940 Bacteria 28841
770 Ga0207691_10059780 3300025940 Bacteria 3464
771 Ga0207691_10063675 3300025940 Bacteria 3344
772 Ga0207691_10146323 3300025940 Bacteria 2080
773 Ga0207691_10373640 3300025940 Bacteria 1217
774 Ga0207711_10032480 3300025941 Bacteria 4413
775 Ga0207711_10034481 3300025941 Bacteria 4286
776 Ga0207711_10041197 3300025941 Bacteria 3932
777 Ga0207711_10041697 3300025941 Bacteria 3909
778 Ga0207711_10095313 3300025941 Bacteria 2624
779 Ga0207711_10115517 3300025941 Bacteria 2392
780 Ga0207711_10339338 3300025941 Bacteria 1390
781 Ga0207711_10486060 3300025941 Bacteria 1150
782 Ga0207689_10000514 3300025942 Bacteria 36737
783 Ga0207689_10069377 3300025942 Bacteria 2896
784 Ga0207689_10145972 3300025942 Bacteria 1949
785 Ga0207689_10435858 3300025942 Bacteria 1094
786 Ga0207689_10881434 3300025942 Bacteria 755
787 Ga0207661_10001969 3300025944 Bacteria 14136
788 Ga0207661_10012879 3300025944 Bacteria 6097
789 Ga0207661_10029500 3300025944 Bacteria 4214
790 Ga0207661_10125062 3300025944 Bacteria 2195
791 Ga0207661_10208332 3300025944 Bacteria 1722
792 Ga0207661_10297372 3300025944 Bacteria 1446
793 Ga0207679_10000099 3300025945 Bacteria 74047
794 Ga0207679_10224032 3300025945 Bacteria 1584
795 Ga0207679_10598458 3300025945 Bacteria 993
796 Ga0207667_10019759 3300025949 Bacteria 7509
797 Ga0207667_10040667 3300025949 Bacteria 4950
798 Ga0207667_10042644 3300025949 Bacteria 4821
799 Ga0207667_10098778 3300025949 Bacteria 3012
800 Ga0207667_10209760 3300025949 Bacteria 1997
801 Ga0207667_10399499 3300025949 Bacteria 1399
802 Ga0207667_10410416 3300025949 Bacteria 1379
803 Ga0207667_10482505 3300025949 Bacteria 1258
804 Ga0207667_10648856 3300025949 Bacteria 1061
805 Ga0207651_10000609 3300025960 Bacteria 15073
806 Ga0207712_10001402 3300025961 Bacteria 16444
807 Ga0207712_10164503 3300025961 Bacteria 1727
808 Ga0207712_10402077 3300025961 Bacteria 1151
809 Ga0207668_10008221 3300025972 Bacteria 6215
810 Ga0207668_10069987 3300025972 Bacteria 2500
811 Ga0207668_10075220 3300025972 Bacteria 2427
812 Ga0207668_10438243 3300025972 Bacteria 1112
813 Ga0207640_10001310 3300025981 Bacteria 13493
814 Ga0207640_10083988 3300025981 Bacteria 2185
815 Ga0207658_10021213 3300025986 Bacteria 4506
816 Ga0207658_10329427 3300025986 Bacteria 1324
817 Ga0207658_10444865 3300025986 Bacteria 1146
818 Ga0207677_10000495 3300026023 Bacteria 25594
819 Ga0207677_10020041 3300026023 Bacteria 4052
820 Ga0207703_10005812 3300026035 Bacteria 9883
821 Ga0207703_10250211 3300026035 Bacteria 1597
822 Ga0207703_10254113 3300026035 Bacteria 1585
823 Ga0207703_10393259 3300026035 Bacteria 1285
824 Ga0207703_10404414 3300026035 Bacteria 1267
825 Ga0207703_10760488 3300026035 Bacteria 924
826 Ga0207639_10006228 3300026041 Bacteria 8104
827 Ga0207639_10058222 3300026041 Bacteria 2971
828 Ga0207639_10062266 3300026041 Bacteria 2884
829 Ga0207639_10132413 3300026041 Bacteria 2066
830 Ga0207639_10456287 3300026041 Bacteria 1161
831 Ga0207678_10004568 3300026067 Bacteria 12452
832 Ga0207678_10015651 3300026067 Bacteria 6667
833 Ga0207678_10076090 3300026067 Bacteria 2875
834 Ga0207678_10083060 3300026067 Bacteria 2740
835 Ga0207678_10095571 3300026067 Bacteria 2539
836 Ga0207678_10313045 3300026067 Bacteria 1350
837 Ga0207678_10473513 3300026067 Bacteria 1090
838 Ga0207708_10016215 3300026075 Bacteria 5598
839 Ga0207708_10059563 3300026075 Bacteria 2915
840 Ga0207702_10012301 3300026078 Bacteria 7123
841 Ga0207702_10018427 3300026078 Bacteria 5775
842 Ga0207702_10067051 3300026078 Bacteria 3079
843 Ga0207702_10473207 3300026078 Bacteria 1218
844 Ga0207702_10782605 3300026078 Bacteria 943
845 Ga0207641_10021071 3300026088 Bacteria 5357
846 Ga0207641_10204516 3300026088 Bacteria 1823
847 Ga0207648_10000575 3300026089 Bacteria 41197
848 Ga0207648_10179928 3300026089 Bacteria 1871
849 Ga0207676_10006987 3300026095 Bacteria 8001
850 Ga0207676_10011122 3300026095 Bacteria 6424
851 Ga0207676_10263449 3300026095 Bacteria 1557
852 Ga0207676_10551129 3300026095 Bacteria 1101
853 Ga0207676_10797397 3300026095 Bacteria 921
854 Ga0207674_10002439 3300026116 Bacteria 23481
855 Ga0207674_10008791 3300026116 Bacteria 11628
856 Ga0207674_10053695 3300026116 Bacteria 4106
857 Ga0207674_10088944 3300026116 Bacteria 3081
858 Ga0207674_10097261 3300026116 Bacteria 2927
859 Ga0207674_10109561 3300026116 Bacteria 2737
860 Ga0207674_10239446 3300026116 Bacteria 1762
861 Ga0207674_10632272 3300026116 Bacteria 1034
862 Ga0207674_10678099 3300026116 Bacteria 995
863 Ga0207675_100002824 3300026118 Bacteria 17080
864 Ga0207675_100184205 3300026118 Bacteria 2001
865 Ga0207675_100185079 3300026118 Bacteria 1996
866 Ga0207675_100843026 3300026118 Bacteria 931
867 Ga0207683_10093675 3300026121 Bacteria 2677
868 Ga0207683_10107125 3300026121 Bacteria 2500
869 Ga0207683_10159116 3300026121 Bacteria 2041
870 Ga0207683_10484988 3300026121 Bacteria 1141
871 Ga0207698_10002620 3300026142 Bacteria 10693
872 Ga0207698_10083446 3300026142 Bacteria 2586
873 Ga0207698_10178948 3300026142 Bacteria 1876
874 Ga0207698_10435391 3300026142 Bacteria 1262
875 Ga0207698_10536270 3300026142 Bacteria 1144
876 Ga0209389_1000004 3300027296 Bacteria 263759
877 Ga0209389_1000023 3300027296 Bacteria 150730
878 Ga0209589_1000006 3300027357 Bacteria 436292
879 Ga0209589_1000010 3300027357 Bacteria 237657
880 Ga0209489_100007 3300027361 Bacteria 436292
881 Ga0209489_100011 3300027361 Bacteria 244710
882 Ga0209489_100777 3300027361 Bacteria 63061
883 Ga0209700_100008 3300027363 Bacteria 436292
884 Ga0209700_100013 3300027363 Bacteria 341906
885 Ga0209179_1002360 3300027512 Bacteria 2538
886 Ga0209998_10001529 3300027717 Bacteria 5563
887 Ga0209813_10097234 3300027866 Bacteria 997
888 Ga0209974_10007886 3300027876 Bacteria 3654
889 Ga0207428_10000033 3300027907 Bacteria 232081
890 Ga0207428_10000094 3300027907 Bacteria 123649
891 Ga0207428_10000736 3300027907 Bacteria 37641
892 Ga0207428_10034078 3300027907 Bacteria 4176
893 Ga0207428_10318688 3300027907 Bacteria 1148
894 Ga0268266_10007855 3300028379 Bacteria 9556
895 Ga0268266_10060020 3300028379 Bacteria 3277
896 Ga0268266_10150629 3300028379 Bacteria 2096
897 Ga0268266_10203391 3300028379 Bacteria 1813
898 Ga0268266_10205402 3300028379 Bacteria 1804
899 Ga0268266_10588732 3300028379 Bacteria 1068
900 Ga0268266_10734807 3300028379 Bacteria 952
901 Ga0268266_10747995 3300028379 Bacteria 943
902 Ga0268265_10002253 3300028380 Bacteria 14759
903 Ga0268265_10072751 3300028380 Bacteria 2682
904 Ga0268265_10255958 3300028380 Bacteria 1553
905 Ga0268264_10004708 3300028381 Bacteria 11595
906 Ga0268264_10016894 3300028381 Bacteria 5974
907 Ga0268264_10032913 3300028381 Bacteria 4254
908 Ga0268264_10510910 3300028381 Bacteria 1173
909 Ga0307517_10000102 3300028786 Bacteria 123775
910 Ga0307511_10000269 3300030521 Bacteria 54080
911 Ga0265332_10118070 3300031238 Bacteria 1115
912 Ga0265328_10071118 3300031239 Bacteria 1279
913 Ga0265340_10030010 3300031247 Bacteria 2728
914 Ga0265339_10110557 3300031249 Bacteria 1422
915 Ga0265316_10028234 3300031344 Bacteria 4631
916 Ga0265316_10158346 3300031344 Bacteria 1694
917 Ga0307509_10139585 3300031507 Bacteria 2362
918 Ga0307408_100261023 3300031548 Bacteria 1434
919 Ga0307508_10215758 3300031616 Bacteria 1519
920 Ga0307516_10036663 3300031730 Bacteria 4907
921 Ga0307405_10306430 3300031731 Bacteria 1207
922 Ga0307413_10121182 3300031824 Bacteria 1772
923 Ga0307410_10233390 3300031852 Bacteria 1422
924 Ga0307407_10187867 3300031903 Bacteria 1375
925 Ga0307412_10289483 3300031911 Bacteria 1290
926 Ga0307412_10753256 3300031911 Bacteria 841
927 Ga0307409_100448725 3300031995 Bacteria 1244
928 Ga0307409_100952146 3300031995 Bacteria 874
929 Ga0307411_10065049 3300032005 Bacteria 2444
930 Ga0307411_10118477 3300032005 Bacteria 1910
931 Ga0307411_10168777 3300032005 Bacteria 1648
932 Ga0307415_100428961 3300032126 Bacteria 1137
933 Ga0307415_100657546 3300032126 Bacteria 940
934 Ga0307510_10027691 3300033180 Bacteria 6487
935 Ga0307510_10069562 3300033180 Bacteria 3524
936 Ga0315911_1000010 3300033442 Bacteria 322197
937 Ga0373950_0001102 3300034818 Bacteria 3453
938 Ga0373958_0002389 3300034819 Bacteria 2622
939 Ga0373938_0001160 3300034957 Bacteria 4244
940 Ga0373926_0002880 3300035083 Bacteria 5512
941 Ga0373928_0014131 3300035084 Bacteria 1610
942 Ga0373934_0054354 3300035086 Bacteria 1590
943 Ga0373934_0056776 3300035086 Bacteria 1557
944 Ga0373940_0011418 3300035088 Bacteria 2109
945 Ga0373944_0019486 3300035089 Bacteria 1947
946 Ga0373949_0000927 3300035090 Bacteria 9141
947 Ga0373951_0002101 3300035091 Bacteria 5104
948 Ga0373951_0073904 3300035091 Bacteria 873
949 Ga0373923_0002326 3300035111 Bacteria 5821
950 Ga0373923_0040341 3300035111 Bacteria 1921
951 Ga0373932_0006222 3300035112 Bacteria 2820
952 Ga0373932_0014847 3300035112 Bacteria 1965
953 Ga0373932_0058549 3300035112 Bacteria 1164
954 Ga0373936_0005468 3300035113 Bacteria 4793
955 Ga0373936_0018584 3300035113 Bacteria 2686
956 Ga0373936_0150221 3300035113 Bacteria 1010
957 Ga0373939_0001513 3300035114 Bacteria 5637
958 Ga0373939_0029562 3300035114 Bacteria 1569
959 Ga0373939_0041635 3300035114 Bacteria 1385
960 Ga0373941_0000449 3300035115 Bacteria 8206
961 Ga0373941_0002582 3300035115 Bacteria 4010
962 Ga0373941_0004659 3300035115 Bacteria 3181
963 Ga0373941_0105772 3300035115 Bacteria 986
964 Ga0373945_0010695 3300035116 Bacteria 3026
965 Ga0373953_0000420 3300035117 Bacteria 11547
966 Ga0373953_0014626 3300035117 Bacteria 2827
967 Ga0373953_0021876 3300035117 Bacteria 2405
968 Ga0373953_0076725 3300035117 Bacteria 1385
969 Ga0373953_0164912 3300035117 Bacteria 953
970 Ga0373954_0000663 3300035118 Bacteria 13181
971 Ga0373954_0056577 3300035118 Bacteria 1846
972 Ga0373954_0062480 3300035118 Bacteria 1759
973 Ga0373956_0000275 3300035119 Bacteria 20650
974 Ga0373956_0103162 3300035119 Bacteria 1324
975 Ga0373957_0000426 3300035120 Bacteria 10649
976 Ga0373957_0049589 3300035120 Bacteria 1603
977 Ga0373957_0050517 3300035120 Bacteria 1589
978 Ga0373957_0126366 3300035120 Bacteria 1038
979 Ga0373957_0139518 3300035120 Bacteria 990
980 Ga0373957_0151219 3300035120 Bacteria 953
981 Ga0373960_0003445 3300035121 Bacteria 3583
982 Ga0373960_0080636 3300035121 Bacteria 1024
983 Ga0373943_0000424 3300035170 Bacteria 17836
984 Ga0373943_0006136 3300035170 Bacteria 5399
985 Ga0373943_0028636 3300035170 Bacteria 2626
986 Ga0373943_0046732 3300035170 Bacteria 2113
987 Ga0373943_0118531 3300035170 Bacteria 1404
988 Ga0373946_0003275 3300035171 Bacteria 5751
989 Ga0373946_0031028 3300035171 Bacteria 2137
990 Ga0373955_0000510 3300035172 Bacteria 16513
991 Ga0373955_0016347 3300035172 Bacteria 3650
992 Ga0373955_0056665 3300035172 Bacteria 2150
993 Ga0373942_0027753 3300035207 Bacteria 1475
994 Ga0373962_0003492 3300035242 Bacteria 3777
995 Ga0373924_0004208 3300035410 Bacteria 5014
996 Ga0373924_0066506 3300035410 Bacteria 1515
997 Ga0373931_0001672 3300035691 Bacteria 9597
998 Ga0373931_0006356 3300035691 Bacteria 5516
999 Ga0373931_0008479 3300035691 Bacteria 4878
1000 Ga0373931_0066158 3300035691 Bacteria 1960
1001 Ga0373931_0089514 3300035691 Bacteria 1712
1002 Ga0373931_0313329 3300035691 Bacteria 972
1003 Ga0373931_0325217 3300035691 Bacteria 956
1004 Ga0373935_0000229 3300035692 Bacteria 27393
1005 Ga0373935_0000882 3300035692 Bacteria 16207
1006 Ga0373935_0019969 3300035692 Bacteria 4089
1007 Ga0373935_0218091 3300035692 Bacteria 1324
1008 Ga0373935_0286870 3300035692 Bacteria 1160
1009 Ga0373927_0000071 3300035695 Bacteria 73794
1010 Ga0373927_0000414 3300035695 Bacteria 32784
1011 Ga0373927_0007062 3300035695 Bacteria 7614
1012 Ga0373927_0011507 3300035695 Bacteria 5895
1013 Ga0373927_0025829 3300035695 Bacteria 3839
1014 Ga0373927_0030092 3300035695 Bacteria 3542
1015 Ga0373927_0099124 3300035695 Bacteria 1895
1016 Ga0373927_0103253 3300035695 Bacteria 1855
1017 Ga0373927_0284219 3300035695 Bacteria 1088
1018 Ga0373927_0332372 3300035695 Bacteria 1001
1019 Ga0373927_0528331 3300035695 Bacteria 780
1020 Ga0373933_0004204 3300035724 Bacteria 7938
1021 Ga0373933_0029183 3300035724 Bacteria 3187
1022 Ga0373933_0034112 3300035724 Bacteria 2964
1023 Ga0373933_0239607 3300035724 Bacteria 1166
1024 Ga0373933_0286839 3300035724 Bacteria 1064
1025 Ga0373947_0000275 3300035725 Bacteria 29242
1026 Ga0373947_0000540 3300035725 Bacteria 22139
1027 Ga0373947_0003876 3300035725 Bacteria 8805
1028 Ga0373947_0004993 3300035725 Bacteria 7766
1029 Ga0373947_0017419 3300035725 Bacteria 4132
1030 Ga0373947_0036936 3300035725 Bacteria 2897
1031 Ga0373947_0147132 3300035725 Bacteria 1515
1032 Ga0373947_0258951 3300035725 Bacteria 1152
1033 Ga0373937_0031431 3300036401 Bacteria 4811
1034 Ga0373937_0039136 3300036401 Bacteria 4322
1035 Ga0373937_0045462 3300036401 Bacteria 4012
1036 Ga0373937_0045643 3300036401 Bacteria 4004
1037 Ga0373937_0070190 3300036401 Bacteria 3231
1038 Ga0373937_0193491 3300036401 Bacteria 1911
1039 Ga0373937_0212345 3300036401 Bacteria 1821
1040 Ga0373937_0261930 3300036401 Bacteria 1630
1041 Ga0373937_0389320 3300036401 Bacteria 1322
1042 Ga0373925_0002725 3300037068 Bacteria 13982
1043 Ga0373925_0030853 3300037068 Bacteria 3936
1044 Ga0373925_0040457 3300037068 Bacteria 3451
1045 Ga0373925_0054967 3300037068 Bacteria 2979
1046 Ga0373925_0087640 3300037068 Bacteria 2376
1047 Ga0373925_0100456 3300037068 Bacteria 2223
1048 Ga0373925_0120831 3300037068 Bacteria 2033
1049 Ga0373925_0206794 3300037068 Bacteria 1563
1050 Ga0373925_0391554 3300037068 Bacteria 1132
1051 Ga0373925_0457061 3300037068 Bacteria 1046
1052 Ga0373925_0471153 3300037068 Bacteria 1030
1053 Ga0395899_0008599 3300037312 Bacteria 7860
1054 Ga0395899_0171700 3300037312 Bacteria 1527
1055 Ga0395900_0013738 3300037418 Bacteria 8266
1056 Ga0395900_0021345 3300037418 Bacteria 6619
1057 Ga0395900_0054470 3300037418 Bacteria 4119
1058 Ga0395900_0259612 3300037418 Bacteria 1736
1059 Ga0395900_0796875 3300037418 Bacteria 873
1060 Ga0395898_0006919 3300037466 Bacteria 12054
1061 Ga0395898_0024139 3300037466 Bacteria 6136
1062 Ga0395898_0065456 3300037466 Bacteria 3524
1063 Ga0395898_0140754 3300037466 Bacteria 2310
1064 Ga0395905_0030266 3300037471 Bacteria 5102
1065 Ga0395905_0176477 3300037471 Bacteria 2006
1066 Ga0395905_0284582 3300037471 Bacteria 1540
1067 Ga0395905_0577770 3300037471 Bacteria 1025
1068 Ga0436364_0066511 3300037853 Bacteria 1328
1069 Ga0436364_0680312 3300037853 Bacteria 1567
1070 Ga0395901_0005295 3300038443 Bacteria 13040
1071 Ga0395901_0025268 3300038443 Bacteria 6097
1072 Ga0395901_0157594 3300038443 Bacteria 2384
1073 Ga0395901_0222005 3300038443 Bacteria 1975
1074 Ga0395901_0566758 3300038443 Bacteria 1149
1075 Ga0395901_0896520 3300038443 Bacteria 869
1076 Ga0436365_0290905 3300039437 Bacteria 1072
1077 Ga0436365_0643464 3300039437 Bacteria 2985
1078 Ga0436365_0906128 3300039437 Bacteria 7419
1079 Ga0436365_1318098 3300039437 Bacteria 1012
1080 Ga0436365_1835535 3300039437 Bacteria 1691
1081 Ga0436365_1883031 3300039437 Bacteria 10380
1082 Ga0436360_0160052 3300039438 Bacteria 1084
1083 Ga0436360_0336915 3300039438 Bacteria 1525
1084 Ga0436360_0347139 3300039438 Bacteria 1440
1085 Ga0436360_0372244 3300039438 Bacteria 1021
1086 Ga0436360_0467044 3300039438 Bacteria 14377
1087 Ga0436361_0486257 3300039447 Bacteria 2823
1088 Ga0436361_0927272 3300039447 Bacteria 4436
1089 Ga0436361_1221223 3300039447 Bacteria 2181
1090 Ga0436363_1356934 3300039450 Bacteria 848
1091 Ga0436363_1697326 3300039450 Bacteria 1541
1092 Ga0436362_0313826 3300039453 Bacteria 1179
1093 Ga0436362_0755152 3300039453 Bacteria 1378
1094 Ga0436362_0815359 3300039453 Bacteria 2728
1095 Ga0439465_0041847 3300041413 Bacteria 1484
1096 Ga0451793_0668962 3300041452 Bacteria 892
1097 Ga0451795_0064442 3300041456 Bacteria 1167
1098 Ga0451800_0438865 3300041459 Bacteria 1622
1099 Ga0451835_1226713 3300041492 Bacteria 790
1100 Ga0451847_0960825 3300041503 Bacteria 972
1101 Ga0451577_0047462 3300042876 Bacteria 3840
1102 Ga0466969_0016988 3300044656 Bacteria 3802
1103 Ga0466972_0000193 3300044658 Bacteria 46863
1104 Ga0466972_0014447 3300044658 Bacteria 3954
1105 Ga0453683_0025310 3300044673 Bacteria 3772
1106 Ga0466965_0176727 3300044683 Bacteria 1125
1107 Ga0466966_0000551 3300044684 Bacteria 23873
1108 Ga0466961_0000020 3300044693 Bacteria 107610
1109 Ga0466963_0014002 3300044694 Bacteria 4939
1110 Ga0466963_0119916 3300044694 Bacteria 1809
1111 Ga0466963_0231314 3300044694 Bacteria 1295
1112 Ga0453684_0024772 3300044712 Bacteria 8747
1113 Ga0466968_0009179 3300044735 Bacteria 3803
1114 Ga0466957_0076196 3300044842 Bacteria 2082
1115 Ga0466960_0039543 3300044901 Bacteria 2225
1116 Ga0466959_0037674 3300045049 Bacteria 3574
1117 Ga0451576_0030558 3300045051 Bacteria 5756
1118 Ga0451576_0034448 3300045051 Bacteria 5378
1119 Ga0451576_0054640 3300045051 Bacteria 4181
1120 Ga0451576_0076080 3300045051 Bacteria 3494
1121 Ga0451576_0274464 3300045051 Bacteria 1762
1122 Ga0466967_0002756 3300045976 Bacteria 11112
1123 Ga0466967_0014710 3300045976 Bacteria 6109
1124 Ga0466967_0070110 3300045976 Bacteria 3135
1125 Ga0466967_0100278 3300045976 Bacteria 2646
1126 Ga0495617_026442 3300046452 Bacteria 1954
1127 Ga0495592_0003051 3300046454 Bacteria 11938
1128 Ga0495592_0003383 3300046454 Bacteria 11439
1129 Ga0495592_0036322 3300046454 Bacteria 3711
1130 Ga0495592_0049426 3300046454 Bacteria 3126
1131 Ga0495592_0058136 3300046454 Bacteria 2852
1132 Ga0495592_0160159 3300046454 Bacteria 1549
1133 Ga0495603_0000035 3300046455 Bacteria 57510
1134 Ga0495603_0001059 3300046455 Bacteria 15931
1135 Ga0495603_0006718 3300046455 Bacteria 6905
1136 Ga0495603_0007225 3300046455 Bacteria 6667
1137 Ga0495603_0021313 3300046455 Bacteria 3925
1138 Ga0495603_0048434 3300046455 Bacteria 2530
1139 Ga0495603_0132535 3300046455 Bacteria 1451
1140 Ga0495603_0386525 3300046455 Bacteria 802
1141 Ga0495590_0039422 3300046457 Bacteria 1648
1142 Ga0495590_0103306 3300046457 Bacteria 1013
1143 Ga0495590_0172169 3300046457 Bacteria 789
1144 Ga0495629_0000081 3300046459 Bacteria 85305
1145 Ga0495629_0000269 3300046459 Bacteria 45206
1146 Ga0495629_0000612 3300046459 Bacteria 29083
1147 Ga0495629_0011200 3300046459 Bacteria 6512
1148 Ga0495629_0058439 3300046459 Bacteria 2696
1149 Ga0495629_0090143 3300046459 Bacteria 2139
1150 Ga0495629_0129759 3300046459 Bacteria 1756
1151 Ga0495629_0312568 3300046459 Bacteria 1075
1152 Ga0495638_0004483 3300046460 Bacteria 10577
1153 Ga0495638_0105267 3300046460 Bacteria 1681
1154 Ga0495641_0005556 3300046461 Bacteria 8464
1155 Ga0495641_0008400 3300046461 Bacteria 6307
1156 Ga0495641_0019447 3300046461 Bacteria 3473
1157 Ga0495651_0005350 3300046462 Bacteria 9794
1158 Ga0495651_0009999 3300046462 Bacteria 7292
1159 Ga0495651_0030088 3300046462 Bacteria 4234
1160 Ga0495651_0031301 3300046462 Bacteria 4149
1161 Ga0495651_0031832 3300046462 Bacteria 4112
1162 Ga0495651_0113904 3300046462 Bacteria 1996
1163 Ga0495651_0148779 3300046462 Bacteria 1690
1164 Ga0495653_0000399 3300046463 Bacteria 34847
1165 Ga0495653_0036295 3300046463 Bacteria 3883
1166 Ga0495653_0057546 3300046463 Bacteria 2958
1167 Ga0495653_0070117 3300046463 Bacteria 2624
1168 Ga0495653_0153653 3300046463 Bacteria 1605
1169 Ga0495650_0036071 3300046471 Bacteria 2169
1170 Ga0495650_0064595 3300046471 Bacteria 1455
1171 Ga0495580_0000449 3300046472 Bacteria 34081
1172 Ga0495580_0005664 3300046472 Bacteria 10275
1173 Ga0495580_0058049 3300046472 Bacteria 2723
1174 Ga0495580_0058144 3300046472 Bacteria 2721
1175 Ga0495580_0100922 3300046472 Bacteria 2007
1176 Ga0495580_0405326 3300046472 Bacteria 919
1177 Ga0495582_0000021 3300046473 Bacteria 88264
1178 Ga0495582_0024180 3300046473 Bacteria 3322
1179 Ga0495582_0030917 3300046473 Bacteria 2941
1180 Ga0495582_0258821 3300046473 Bacteria 998
1181 Ga0495582_0354229 3300046473 Bacteria 845
1182 Ga0495605_0144926 3300046474 Bacteria 1063
1183 Ga0495639_0000010 3300046475 Bacteria 93685
1184 Ga0495639_0009316 3300046475 Bacteria 4210
1185 Ga0495639_0162912 3300046475 Bacteria 1080
1186 Ga0495639_0196875 3300046475 Bacteria 985
1187 Ga0495662_0000261 3300046476 Bacteria 22323
1188 Ga0495662_0008429 3300046476 Bacteria 5070
1189 Ga0495662_0016950 3300046476 Bacteria 3525
1190 Ga0495662_0025894 3300046476 Bacteria 2833
1191 Ga0495662_0034302 3300046476 Bacteria 2450
1192 Ga0495662_0088131 3300046476 Bacteria 1512
1193 Ga0495664_0000736 3300046477 Bacteria 16729
1194 Ga0495664_0004738 3300046477 Bacteria 7434
1195 Ga0495664_0007307 3300046477 Bacteria 6129
1196 Ga0495664_0007928 3300046477 Bacteria 5912
1197 Ga0495664_0028294 3300046477 Bacteria 3273
1198 Ga0495664_0092367 3300046477 Bacteria 1820
1199 Ga0495664_0238942 3300046477 Bacteria 1099
1200 Ga0495584_0025120 3300046491 Bacteria 3020
1201 Ga0495585_0001696 3300046492 Bacteria 16820
1202 Ga0495585_0189940 3300046492 Bacteria 1051
1203 Ga0495585_0278597 3300046492 Bacteria 827
1204 Ga0495594_0000979 3300046499 Bacteria 14837
1205 Ga0495594_0021023 3300046499 Bacteria 3481
1206 Ga0495594_0292065 3300046499 Bacteria 929
1207 Ga0495607_0014000 3300046501 Bacteria 5238
1208 Ga0495583_0138614 3300046506 Bacteria 1014
1209 Ga0495606_0001170 3300046507 Bacteria 37016
1210 Ga0495606_0146458 3300046507 Bacteria 1390
1211 Ga0495608_0001226 3300046511 Bacteria 18178
1212 Ga0495608_0016478 3300046511 Bacteria 5114
1213 Ga0495608_0021826 3300046511 Bacteria 4391
1214 Ga0495608_0031182 3300046511 Bacteria 3605
1215 Ga0495608_0034772 3300046511 Bacteria 3401
1216 Ga0495608_0069160 3300046511 Bacteria 2307
1217 Ga0495608_0089598 3300046511 Bacteria 1991
1218 Ga0495618_0014879 3300046514 Bacteria 4746
1219 Ga0495618_0014997 3300046514 Bacteria 4726
1220 Ga0495618_0026734 3300046514 Bacteria 3590
1221 Ga0495618_0059293 3300046514 Bacteria 2425
1222 Ga0495618_0078648 3300046514 Bacteria 2102
1223 Ga0495618_0293219 3300046514 Bacteria 1012
1224 Ga0495628_0009019 3300046516 Bacteria 8533
1225 Ga0495628_0012048 3300046516 Bacteria 7293
1226 Ga0495628_0029893 3300046516 Bacteria 4415
1227 Ga0495628_0069679 3300046516 Bacteria 2743
1228 Ga0495628_0106266 3300046516 Bacteria 2162
1229 Ga0495628_0435079 3300046516 Bacteria 954
1230 Ga0495628_0533755 3300046516 Bacteria 844
1231 Ga0495630_0002218 3300046517 Bacteria 13534
1232 Ga0495630_0021361 3300046517 Bacteria 4780
1233 Ga0495630_0280144 3300046517 Bacteria 1274
1234 Ga0495630_0283650 3300046517 Bacteria 1265
1235 Ga0495630_0464862 3300046517 Bacteria 969
1236 Ga0495630_0619573 3300046517 Bacteria 829
1237 Ga0495632_0166000 3300046519 Bacteria 1015
1238 Ga0495637_0067395 3300046520 Bacteria 1453
1239 Ga0495637_0099910 3300046520 Bacteria 1135
1240 Ga0495643_0006750 3300046522 Bacteria 7506
1241 Ga0495644_0003755 3300046523 Bacteria 5977
1242 Ga0495648_0212507 3300046524 Bacteria 960
1243 Ga0495663_0032939 3300046525 Bacteria 1545
1244 Ga0495666_0031225 3300046526 Bacteria 2610
1245 Ga0495666_0108952 3300046526 Bacteria 1302
1246 Ga0495652_0006874 3300046529 Bacteria 10531
1247 Ga0495652_0008672 3300046529 Bacteria 9267
1248 Ga0495652_0019786 3300046529 Bacteria 5990
1249 Ga0495652_0079863 3300046529 Bacteria 2703
1250 Ga0495665_0002966 3300046531 Bacteria 9167
1251 Ga0495665_0009534 3300046531 Bacteria 5259
1252 Ga0495665_0024212 3300046531 Bacteria 3261
1253 Ga0495665_0031922 3300046531 Bacteria 2818
1254 Ga0495640_0002964 3300046533 Bacteria 13677
1255 Ga0495640_0013343 3300046533 Bacteria 6244
1256 Ga0495640_0018374 3300046533 Bacteria 5189
1257 Ga0495640_0027630 3300046533 Bacteria 4090
1258 Ga0495640_0032420 3300046533 Bacteria 3722
1259 Ga0495586_0001814 3300046535 Bacteria 11645
1260 Ga0495586_0034389 3300046535 Bacteria 2722
1261 Ga0495586_0248171 3300046535 Bacteria 1015
1262 Ga0495587_0001432 3300046536 Bacteria 15878
1263 Ga0495587_0006986 3300046536 Bacteria 7331
1264 Ga0495587_0015759 3300046536 Bacteria 4713
1265 Ga0495587_0022963 3300046536 Bacteria 3836
1266 Ga0495587_0034748 3300046536 Bacteria 3039
1267 Ga0495587_0059702 3300046536 Bacteria 2237
1268 Ga0495587_0202228 3300046536 Bacteria 1123
1269 Ga0495587_0347696 3300046536 Bacteria 827
1270 Ga0495598_0085697 3300046537 Bacteria 1018
1271 Ga0495598_0108743 3300046537 Bacteria 927
1272 Ga0495598_0122732 3300046537 Bacteria 882
1273 Ga0495621_0082598 3300046539 Bacteria 1200
1274 Ga0495621_0102940 3300046539 Bacteria 1088
1275 Ga0495597_0067621 3300046542 Bacteria 1545
1276 Ga0495645_0001776 3300046543 Bacteria 14687
1277 Ga0495645_0001836 3300046543 Bacteria 14435
1278 Ga0495645_0002109 3300046543 Bacteria 13497
1279 Ga0495645_0008749 3300046543 Bacteria 7070
1280 Ga0495645_0019408 3300046543 Bacteria 4895
1281 Ga0495645_0148712 3300046543 Bacteria 1629
1282 Ga0495645_0466439 3300046543 Bacteria 794
1283 Ga0495622_0008049 3300046557 Bacteria 4887
1284 Ga0495622_0010565 3300046557 Bacteria 4261
1285 Ga0495622_0127322 3300046557 Bacteria 1161
1286 Ga0495633_0056982 3300046558 Bacteria 1836
1287 Ga0495633_0118360 3300046558 Bacteria 1227
1288 Ga0495633_0262006 3300046558 Bacteria 788
1289 Ga0495667_0001452 3300046559 Bacteria 15607
1290 Ga0495667_0008441 3300046559 Bacteria 6992
1291 Ga0495667_0020781 3300046559 Bacteria 4430
1292 Ga0495667_0021237 3300046559 Bacteria 4380
1293 Ga0495667_0023177 3300046559 Bacteria 4183
1294 Ga0495667_0042971 3300046559 Bacteria 2996
1295 Ga0495667_0044112 3300046559 Bacteria 2953
1296 Ga0495667_0206978 3300046559 Bacteria 1254
1297 Ga0495656_0004963 3300046615 Bacteria 4583
1298 Ga0495656_0012418 3300046615 Bacteria 3142
1299 Ga0495668_0025425 3300046616 Bacteria 3364
1300 Ga0495668_0081519 3300046616 Bacteria 1775
1301 Ga0495668_0196923 3300046616 Bacteria 1103
1302 Ga0495634_0000261 3300046642 Bacteria 49735
1303 Ga0495634_0006321 3300046642 Bacteria 9017
1304 Ga0495634_0011593 3300046642 Bacteria 6413
1305 Ga0495634_0017261 3300046642 Bacteria 5153
1306 Ga0495634_0039498 3300046642 Bacteria 3213
1307 Ga0495634_0072933 3300046642 Bacteria 2257
1308 Ga0495634_0096210 3300046642 Bacteria 1917
1309 Ga0495611_0004521 3300046648 Bacteria 6000
1310 Ga0495611_0054665 3300046648 Bacteria 1805
1311 Ga0495611_0163640 3300046648 Bacteria 1040
1312 Ga0495625_0049301 3300046660 Bacteria 3028
1313 Ga0495625_0256375 3300046660 Bacteria 1133
1314 Ga0495635_0000088 3300046663 Bacteria 54355
1315 Ga0495635_0000438 3300046663 Bacteria 26330
1316 Ga0495635_0001380 3300046663 Bacteria 16199
1317 Ga0495635_0003521 3300046663 Bacteria 10832
1318 Ga0495635_0006545 3300046663 Bacteria 8131
1319 Ga0495635_0017940 3300046663 Bacteria 4943
1320 Ga0495635_0049932 3300046663 Bacteria 2884
1321 Ga0495659_0001977 3300046664 Bacteria 6744
1322 Ga0495661_0054082 3300046665 Bacteria 2412
1323 Ga0495661_0176969 3300046665 Bacteria 1133
1324 Ga0495588_0019653 3300046674 Bacteria 3311
1325 Ga0495588_0051556 3300046674 Bacteria 2119
1326 Ga0495588_0088287 3300046674 Bacteria 1622
1327 Ga0495588_0213546 3300046674 Bacteria 1019
1328 Ga0495657_0008178 3300046675 Bacteria 8016
1329 Ga0495657_0010455 3300046675 Bacteria 6983
1330 Ga0495657_0012948 3300046675 Bacteria 6176
1331 Ga0495657_0041171 3300046675 Bacteria 3164
1332 Ga0495657_0061813 3300046675 Bacteria 2477
1333 Ga0495657_0242498 3300046675 Bacteria 1087
1334 Ga0495657_0319519 3300046675 Bacteria 923
1335 Ga0495599_0001137 3300046678 Bacteria 15035
1336 Ga0495599_0010283 3300046678 Bacteria 5726
1337 Ga0495599_0035710 3300046678 Bacteria 3121
1338 Ga0495599_0082276 3300046678 Bacteria 2011
1339 Ga0495599_0231136 3300046678 Bacteria 1129
1340 Ga0495623_0006628 3300046679 Bacteria 7538
1341 Ga0495623_0010588 3300046679 Bacteria 5969
1342 Ga0495623_0012243 3300046679 Bacteria 5556
1343 Ga0495646_0002433 3300046680 Bacteria 11422
1344 Ga0495646_0022684 3300046680 Bacteria 3957
1345 Ga0495646_0026635 3300046680 Bacteria 3629
1346 Ga0495646_0048965 3300046680 Bacteria 2566
1347 Ga0495646_0057288 3300046680 Bacteria 2333
1348 Ga0495646_0088987 3300046680 Bacteria 1787
1349 Ga0495647_0003550 3300046681 Bacteria 4998
1350 Ga0495647_0054257 3300046681 Bacteria 1565
1351 Ga0495658_0000771 3300046683 Bacteria 17323
1352 Ga0495658_0000892 3300046683 Bacteria 16047
1353 Ga0495613_0027628 3300046689 Bacteria 4223
1354 Ga0495613_0040776 3300046689 Bacteria 3439
1355 Ga0495613_0045342 3300046689 Bacteria 3252
1356 Ga0495613_0053833 3300046689 Bacteria 2960
1357 Ga0495613_0100556 3300046689 Bacteria 2088
1358 Ga0495613_0111521 3300046689 Bacteria 1970
1359 Ga0495613_0181685 3300046689 Bacteria 1489
1360 Ga0495613_0273999 3300046689 Bacteria 1173
1361 Ga0495613_0508572 3300046689 Bacteria 810
1362 Ga0495624_0000682 3300046690 Bacteria 26624
1363 Ga0495624_0001570 3300046690 Bacteria 17622
1364 Ga0495624_0099630 3300046690 Bacteria 1789
1365 Ga0495624_0115349 3300046690 Bacteria 1651
1366 Ga0495624_0120586 3300046690 Bacteria 1610
1367 Ga0495624_0217723 3300046690 Bacteria 1158
1368 Ga0495624_0222201 3300046690 Bacteria 1145
1369 Ga0495624_0236040 3300046690 Bacteria 1107
1370 Ga0495624_0368895 3300046690 Bacteria 863
1371 Ga0495670_0011391 3300046691 Bacteria 4373
1372 Ga0495671_0078355 3300046692 Bacteria 1620
1373 Ga0495671_0320799 3300046692 Bacteria 744
1374 Ga0495649_0119141 3300046694 Bacteria 1396
1375 Ga0495589_0033211 3300046794 Bacteria 2593
1376 Ga0495600_0000484 3300046809 Bacteria 20528
1377 Ga0495600_0010662 3300046809 Bacteria 5709
1378 Ga0495600_0018989 3300046809 Bacteria 4387
1379 Ga0495600_0023629 3300046809 Bacteria 3955
1380 Ga0495600_0041250 3300046809 Bacteria 3007
1381 Ga0495600_0072934 3300046809 Bacteria 2242
1382 Ga0495660_0150270 3300046810 Bacteria 1151
1383 Ga0495581_0000018 3300047315 Bacteria 58791
1384 Ga0495581_0012302 3300047315 Bacteria 4958
1385 Ga0495581_0025033 3300047315 Bacteria 3459
1386 Ga0495581_0077638 3300047315 Bacteria 1922
1387 Ga0495581_0114277 3300047315 Bacteria 1570
1388 Ga0495604_0002253 3300047317 Bacteria 15447
1389 Ga0495604_0005171 3300047317 Bacteria 10334
1390 Ga0495604_0007540 3300047317 Bacteria 8607
1391 Ga0495604_0027161 3300047317 Bacteria 4554
1392 Ga0495604_0048968 3300047317 Bacteria 3285
1393 Ga0495604_0052328 3300047317 Bacteria 3163
1394 Ga0495604_0159461 3300047317 Bacteria 1595
1395 Ga0495604_0223755 3300047317 Bacteria 1294
1396 Ga0495604_0532106 3300047317 Bacteria 759
1397 Ga0495636_0177866 3300047318 Bacteria 964
1398 Ga0495674_0000209 3300047319 Bacteria 48240
1399 Ga0495674_0001257 3300047319 Bacteria 24613
1400 Ga0495674_0006731 3300047319 Bacteria 11003
1401 Ga0495674_0021689 3300047319 Bacteria 5939
1402 Ga0495674_0024470 3300047319 Bacteria 5548
1403 Ga0495674_0074686 3300047319 Bacteria 2918
1404 Ga0495674_0120810 3300047319 Bacteria 2213
1405 Ga0495674_0237631 3300047319 Bacteria 1502
1406 Ga0495674_0708636 3300047319 Bacteria 789
1407 Ga0495672_0039117 3300047320 Bacteria 2886
1408 Ga0495676_0033822 3300047321 Bacteria 4297
1409 Ga0495676_0067018 3300047321 Bacteria 2779
1410 Ga0495676_0086311 3300047321 Bacteria 2362
1411 Ga0495676_0104485 3300047321 Bacteria 2090
1412 Ga0495676_0153223 3300047321 Bacteria 1638
1413 Ga0495676_0244022 3300047321 Bacteria 1228
1414 Ga0495680_0004231 3300047322 Bacteria 13778
1415 Ga0495680_0006139 3300047322 Bacteria 11212
1416 Ga0495680_0013803 3300047322 Bacteria 7030
1417 Ga0495680_0024657 3300047322 Bacteria 4987
1418 Ga0495680_0046879 3300047322 Bacteria 3405
1419 Ga0495680_0064241 3300047322 Bacteria 2815
1420 Ga0495680_0123588 3300047322 Bacteria 1909
1421 Ga0495687_046397 3300047443 Bacteria 1876
1422 Ga0495675_0000977 3300047444 Bacteria 17351
1423 Ga0495675_0006091 3300047444 Bacteria 7382
1424 Ga0495675_0010571 3300047444 Bacteria 5769
1425 Ga0495675_0060191 3300047444 Bacteria 2407
1426 Ga0495675_0069346 3300047444 Bacteria 2226
1427 Ga0495677_0029191 3300047445 Bacteria 2005
1428 Ga0495679_029497 3300047446 Bacteria 1789
1429 Ga0495673_0051765 3300047469 Bacteria 1797
1430 Ga0495681_0038580 3300047470 Bacteria 2340
1431 Ga0495684_0001326 3300047471 Bacteria 19921
1432 Ga0495684_0001766 3300047471 Bacteria 17346
1433 Ga0495684_0003044 3300047471 Bacteria 13189
1434 Ga0495684_0003129 3300047471 Bacteria 12980
1435 Ga0495684_0049314 3300047471 Bacteria 3217
1436 Ga0495684_0052451 3300047471 Bacteria 3112
1437 Ga0495684_0052531 3300047471 Bacteria 3110
1438 Ga0495686_0224797 3300047472 Bacteria 1066
1439 Ga0495593_0000072 3300047673 Bacteria 43039
1440 Ga0495593_0000566 3300047673 Bacteria 21032
1441 Ga0495593_0002269 3300047673 Bacteria 11530
1442 Ga0495593_0015862 3300047673 Bacteria 4257
1443 Ga0495593_0185378 3300047673 Bacteria 1048
1444 Ga0495602_0001719 3300048088 Bacteria 21809
1445 Ga0495602_0004704 3300048088 Bacteria 14269
1446 Ga0495602_0024014 3300048088 Bacteria 5922
1447 Ga0495602_0087538 3300048088 Bacteria 2596
1448 Ga0495602_0430429 3300048088 Bacteria 935
1449 Ga0495602_0649444 3300048088 Bacteria 721
1450 Ga0495614_0036953 3300048089 Bacteria 2096
1451 Ga0495615_0014600 3300048090 Bacteria 1664
1452 Ga0496100_0005319 3300048903 Bacteria 6918
1453 Ga0496100_0153339 3300048903 Bacteria 1646
1454 Ga0496100_0226189 3300048903 Bacteria 1375
1455 Ga0496100_0274498 3300048903 Bacteria 1255
1456 Ga0496101_0001907 3300048904 Bacteria 12604
1457 Ga0496101_0057214 3300048904 Bacteria 2819
1458 Ga0496101_0094499 3300048904 Bacteria 2228
1459 Ga0496101_0292434 3300048904 Bacteria 1275
1460 Ga0496101_0315057 3300048904 Bacteria 1227
1461 Ga0496101_0329958 3300048904 Bacteria 1197
1462 Ga0496101_0378703 3300048904 Bacteria 1113
1463 Ga0496101_0430554 3300048904 Bacteria 1040
1464 Ga0496102_0010809 3300048905 Bacteria 7862
1465 Ga0496102_0017860 3300048905 Bacteria 6220
1466 Ga0496102_0019492 3300048905 Bacteria 5974
1467 Ga0496102_0324782 3300048905 Bacteria 1449
1468 Ga0496102_0611337 3300048905 Bacteria 1013
1469 Ga0496103_0001565 3300048906 Bacteria 15132
1470 Ga0496103_0047327 3300048906 Bacteria 2657
1471 Ga0496103_0080656 3300048906 Bacteria 2046
1472 Ga0496103_0112794 3300048906 Bacteria 1728
1473 Ga0496103_0237458 3300048906 Bacteria 1172
1474 Ga0496104_0002128 3300048907 Bacteria 17188
1475 Ga0496104_0049007 3300048907 Bacteria 3983
1476 Ga0496104_0083814 3300048907 Bacteria 3041
1477 Ga0496104_0106223 3300048907 Bacteria 2690
1478 Ga0496104_0178751 3300048907 Bacteria 2032
1479 Ga0496104_0264469 3300048907 Bacteria 1632
1480 Ga0496105_0022082 3300048908 Bacteria 5153
1481 Ga0496105_0219624 3300048908 Bacteria 1547
1482 Ga0496105_0321217 3300048908 Bacteria 1241
1483 Ga0496106_0019749 3300048909 Bacteria 4997
1484 Ga0496106_0020041 3300048909 Bacteria 4960
1485 Ga0496106_0217121 3300048909 Bacteria 1524
1486 Ga0496106_0251050 3300048909 Bacteria 1414
1487 Ga0496106_0452910 3300048909 Bacteria 1031
1488 Ga0496106_0507082 3300048909 Bacteria 969
1489 Ga0496107_0001840 3300048910 Bacteria 13399
1490 Ga0496107_0057813 3300048910 Bacteria 2803
1491 Ga0496107_0086918 3300048910 Bacteria 2282
1492 Ga0496107_0304359 3300048910 Bacteria 1186
1493 Ga0496107_0328796 3300048910 Bacteria 1137
1494 Ga0496107_0423238 3300048910 Bacteria 990
1495 Ga0496107_0551691 3300048910 Bacteria 853
1496 Ga0496108_0052175 3300048911 Bacteria 3426
1497 Ga0496108_0134651 3300048911 Bacteria 2125
1498 Ga0496108_0207421 3300048911 Bacteria 1701
1499 Ga0496108_0470939 3300048911 Bacteria 1097
1500 Ga0496109_0000150 3300048912 Bacteria 68777
1501 Ga0496109_0016079 3300048912 Bacteria 6538
1502 Ga0496109_0027717 3300048912 Bacteria 5061
1503 Ga0496109_0052091 3300048912 Bacteria 3730
1504 Ga0496109_0052472 3300048912 Bacteria 3716
1505 Ga0496109_0056795 3300048912 Bacteria 3571
1506 Ga0496109_0521510 3300048912 Bacteria 1121
1507 Ga0496110_0028124 3300048913 Bacteria 4825
1508 Ga0496110_0053806 3300048913 Bacteria 3540
1509 Ga0496110_0123850 3300048913 Bacteria 2331
1510 Ga0496110_0640976 3300048913 Bacteria 962
1511 Ga0496111_0016595 3300048914 Bacteria 5078
1512 Ga0496111_0024135 3300048914 Bacteria 4278
1513 Ga0496111_0143132 3300048914 Bacteria 1772
1514 Ga0496111_0149377 3300048914 Bacteria 1733
1515 Ga0496111_0163513 3300048914 Bacteria 1653
1516 Ga0496111_0181744 3300048914 Bacteria 1563
1517 Ga0496111_0290760 3300048914 Bacteria 1212
1518 Ga0496111_0401403 3300048914 Bacteria 1013
1519 Ga0496112_0000004 3300048915 Bacteria 553294
1520 Ga0496112_0017832 3300048915 Bacteria 6681
1521 Ga0496112_0019008 3300048915 Bacteria 6477
1522 Ga0496112_0020263 3300048915 Bacteria 6300
1523 Ga0496112_0044369 3300048915 Bacteria 4355
1524 Ga0496112_0079630 3300048915 Bacteria 3241
1525 Ga0496112_0213500 3300048915 Bacteria 1886
1526 Ga0496112_0256251 3300048915 Bacteria 1700
1527 Ga0496112_0259874 3300048915 Bacteria 1686
1528 Ga0496112_0294237 3300048915 Bacteria 1569
1529 Ga0496112_0748508 3300048915 Bacteria 903
1530 Ga0496113_0035814 3300048916 Bacteria 3632
1531 Ga0496113_0054096 3300048916 Bacteria 3004
1532 Ga0496113_0148147 3300048916 Bacteria 1850
1533 Ga0496113_0259726 3300048916 Bacteria 1387
1534 Ga0496114_0008932 3300048917 Bacteria 7944
1535 Ga0496114_0025141 3300048917 Bacteria 4865
1536 Ga0496114_0028221 3300048917 Bacteria 4604
1537 Ga0496114_0029850 3300048917 Bacteria 4483
1538 Ga0496114_0650014 3300048917 Bacteria 927
1539 Ga0496114_0859466 3300048917 Bacteria 787
1540 Ga0496115_0001528 3300048918 Bacteria 16623
1541 Ga0496115_0014005 3300048918 Bacteria 6071
1542 Ga0496115_0024954 3300048918 Bacteria 4651
1543 Ga0496115_0394046 3300048918 Bacteria 1124
1544 Ga0496115_0521791 3300048918 Bacteria 952
1545 Ga0496117_0148086 3300048920 Bacteria 1394
1546 Ga0496118_0056637 3300048921 Bacteria 2945
1547 Ga0496118_0271058 3300048921 Bacteria 951
1548 Ga0496119_0051978 3300048922 Bacteria 2513
1549 Ga0496120_0009415 3300048923 Bacteria 6938
1550 Ga0496120_0104879 3300048923 Bacteria 1487
1551 Ga0496121_0109905 3300048924 Bacteria 2105
1552 Ga0496121_0141220 3300048924 Bacteria 1786
1553 Ga0496121_0170687 3300048924 Bacteria 1580
1554 Ga0496121_0188737 3300048924 Bacteria 1480
1555 Ga0496121_0212880 3300048924 Bacteria 1368
1556 Ga0496124_0016688 3300048927 Bacteria 6967
1557 Ga0496124_0453357 3300048927 Bacteria 874
1558 Ga0496125_0150162 3300048928 Bacteria 1602
1559 Ga0496125_0160175 3300048928 Bacteria 1530
1560 Ga0496125_0350792 3300048928 Bacteria 881
1561 Ga0496126_0057994 3300048929 Bacteria 3492
1562 Ga0496126_0180399 3300048929 Bacteria 1794
1563 Ga0496126_0199725 3300048929 Bacteria 1689
1564 Ga0496126_0367099 3300048929 Bacteria 1174
1565 Ga0495682_0064921 3300049460 Bacteria 1316
1566 Ga0501031_0043171 3300049568 Bacteria 2943
1567 Ga0501032_0051419 3300049569 Bacteria 2778
1568 Ga0501032_0340751 3300049569 Bacteria 966
1569 Ga0501033_0149871 3300049570 Bacteria 1683
1570 Ga0501033_0179414 3300049570 Bacteria 1518
1571 Ga0501034_0000516 3300049571 Bacteria 62005
1572 Ga0501034_0001552 3300049571 Bacteria 30135
1573 Ga0501034_0003894 3300049571 Bacteria 16794
1574 Ga0501034_0050571 3300049571 Bacteria 4191
1575 Ga0501034_0078997 3300049571 Bacteria 3293
1576 Ga0501034_0586588 3300049571 Bacteria 1021
1577 Ga0501036_0001269 3300049572 Bacteria 19346
1578 Ga0501036_0020963 3300049572 Bacteria 5489
1579 Ga0501036_0043623 3300049572 Bacteria 3798
1580 Ga0501036_0047889 3300049572 Bacteria 3619
1581 Ga0501037_0003480 3300049573 Bacteria 11423
1582 Ga0501037_0045797 3300049573 Bacteria 3209
1583 Ga0501037_0093001 3300049573 Bacteria 2180
1584 Ga0501037_0346723 3300049573 Bacteria 1025
1585 Ga0501038_0028938 3300049574 Bacteria 4915
1586 Ga0501038_0041063 3300049574 Bacteria 4035
1587 Ga0501038_0073051 3300049574 Bacteria 2905
1588 Ga0501039_0021697 3300049575 Bacteria 4927
1589 Ga0501039_0094523 3300049575 Bacteria 2330
1590 Ga0501039_0562619 3300049575 Bacteria 894
1591 Ga0501040_0007018 3300049576 Bacteria 7299
1592 Ga0501041_0016019 3300049577 Bacteria 4455
1593 Ga0501041_0116157 3300049577 Bacteria 1661
1594 Ga0501042_0148565 3300049578 Bacteria 1690
1595 Ga0501043_0000487 3300049579 Bacteria 35542
1596 Ga0501043_0029788 3300049579 Bacteria 4288
1597 Ga0501043_0030237 3300049579 Bacteria 4255
1598 Ga0501046_0087631 3300049580 Bacteria 2398
1599 Ga0501046_0205932 3300049580 Bacteria 1462
1600 Ga0501046_0259680 3300049580 Bacteria 1276
1601 Ga0501046_0281340 3300049580 Bacteria 1218
1602 Ga0501047_0000100 3300049581 Bacteria 105717
1603 Ga0501047_0028382 3300049581 Bacteria 5394
1604 Ga0501047_0083315 3300049581 Bacteria 3073
1605 Ga0501047_0085392 3300049581 Bacteria 3032
1606 Ga0501047_0212292 3300049581 Bacteria 1793
1607 Ga0501047_0304858 3300049581 Bacteria 1434
1608 Ga0501048_0000473 3300049582 Bacteria 28132
1609 Ga0501048_0033115 3300049582 Bacteria 3735
1610 Ga0501048_0035259 3300049582 Bacteria 3602
1611 Ga0501048_0181363 3300049582 Bacteria 1492
1612 Ga0501067_0115028 3300049583 Bacteria 1496
1613 Ga0501067_0178284 3300049583 Bacteria 1183
1614 Ga0501068_0010393 3300049584 Bacteria 5228
1615 Ga0501068_0011379 3300049584 Bacteria 5023
1616 Ga0501068_0252815 3300049584 Bacteria 1123
1617 Ga0501069_0066639 3300049585 Bacteria 2013
1618 Ga0501069_0207053 3300049585 Bacteria 1138
1619 Ga0501069_0287193 3300049585 Bacteria 963
1620 Ga0501070_0011913 3300049586 Bacteria 7345
1621 Ga0501070_0025193 3300049586 Bacteria 4988
1622 Ga0501070_0029112 3300049586 Bacteria 4632
1623 Ga0501070_0075293 3300049586 Bacteria 2794
1624 Ga0501070_0076780 3300049586 Bacteria 2765
1625 Ga0501070_0542075 3300049586 Bacteria 932
1626 Ga0501071_0011457 3300049587 Bacteria 5975
1627 Ga0501071_0166155 3300049587 Bacteria 1651
1628 Ga0501072_0011074 3300049588 Bacteria 6882
1629 Ga0501072_0085609 3300049588 Bacteria 2500
1630 Ga0501073_0132390 3300049589 Bacteria 1728
1631 Ga0501073_0220771 3300049589 Bacteria 1309
1632 Ga0501073_0330382 3300049589 Bacteria 1052
1633 Ga0501074_0022003 3300049590 Bacteria 4631
1634 Ga0501074_0039132 3300049590 Bacteria 3434
1635 Ga0501074_0093316 3300049590 Bacteria 2155
1636 Ga0501074_0184153 3300049590 Bacteria 1489
1637 Ga0501075_0173499 3300049591 Bacteria 1645
1638 Ga0501075_0177078 3300049591 Bacteria 1627
1639 Ga0501075_0215794 3300049591 Bacteria 1463
1640 Ga0501075_0397268 3300049591 Bacteria 1051
1641 Ga0501076_0005575 3300049592 Bacteria 9066
1642 Ga0501076_0082122 3300049592 Bacteria 2587
1643 Ga0501076_0159112 3300049592 Bacteria 1839
1644 Ga0501077_0046434 3300049593 Bacteria 2759
1645 Ga0501079_0063486 3300049741 Bacteria 2849
1646 Ga0501079_0075956 3300049741 Bacteria 2598
1647 Ga0501079_0143903 3300049741 Bacteria 1857
1648 Ga0501079_0173111 3300049741 Bacteria 1683
1649 Ga0501080_0000030 3300049742 Bacteria 87736
1650 Ga0501080_0015129 3300049742 Bacteria 7109
1651 Ga0501080_0092344 3300049742 Bacteria 2811
1652 Ga0501080_0163888 3300049742 Bacteria 2052
1653 Ga0501080_0164174 3300049742 Bacteria 2050
1654 Ga0501080_0476801 3300049742 Bacteria 1117
1655 Ga0501083_0010799 3300049744 Bacteria 6423
1656 Ga0501083_0053257 3300049744 Bacteria 2717
1657 Ga0501083_0097668 3300049744 Bacteria 1938
1658 Ga0501083_0168596 3300049744 Bacteria 1431
1659 Ga0501035_0031108 3300049822 Bacteria 4861
1660 Ga0501035_0091654 3300049822 Bacteria 2674
1661 Ga0501035_0233349 3300049822 Bacteria 1567
1662 Ga0501035_0299506 3300049822 Bacteria 1355
1663 Ga0501044_0004101 3300049823 Bacteria 16333
1664 Ga0501044_0068340 3300049823 Bacteria 3619
1665 Ga0501044_0103293 3300049823 Bacteria 2865
1666 Ga0501044_0127841 3300049823 Bacteria 2537
1667 Ga0501045_0005395 3300049824 Bacteria 8854
1668 Ga0501045_0285430 3300049824 Bacteria 1229
1669 Ga0501045_0290739 3300049824 Bacteria 1216
1670 nmdc:mga03683_2720_c1 3300050489 Bacteria 5547
1671 nmdc:mga03683_8320_c1 3300050489 Bacteria 3642
1672 nmdc:mga03683_86334_c1 3300050489 Bacteria 1362
1673 nmdc:mga03683_96266_c1 3300050489 Bacteria 1296
1674 nmdc:mga03n38_137830_c1 3300050490 Bacteria 1216
1675 nmdc:mga03n38_156905_c1 3300050490 Bacteria 1149
1676 nmdc:mga03n38_28451_c1 3300050490 Bacteria 2330
1677 nmdc:mga03n38_97492_c1 3300050490 Bacteria 1412
1678 nmdc:mga00v17_307382_c1 3300050491 Bacteria 1030
1679 nmdc:mga00v17_346397_c1 3300050491 Bacteria 966
1680 nmdc:mga00v17_9842_c1 3300050491 Bacteria 5195
1681 nmdc:mga0yw44_227931_c1 3300050492 Bacteria 1236
1682 nmdc:mga0yw44_242352_c1 3300050492 Bacteria 1199
1683 nmdc:mga0yw44_39189_c1 3300050492 Bacteria 2808
1684 nmdc:mga0yw44_432270_c1 3300050492 Bacteria 892
1685 nmdc:mga0yw44_6189_c1 3300050492 Bacteria 5755
1686 nmdc:mga0yw44_86569_c1 3300050492 Bacteria 1974
1687 nmdc:mga0yw44_98283_c1 3300050492 Bacteria 1861
1688 nmdc:mga0k408_10484_c1 3300050493 Bacteria 5013
1689 nmdc:mga0k408_160651_c1 3300050493 Bacteria 1338
1690 nmdc:mga0k408_212834_c1 3300050493 Bacteria 1154
1691 nmdc:mga06z11_112858_c1 3300050494 Bacteria 1507
1692 nmdc:mga06z11_131565_c1 3300050494 Bacteria 1406
1693 nmdc:mga06z11_41063_c1 3300050494 Bacteria 2313
1694 nmdc:mga06z11_45012_c1 3300050494 Bacteria 2229
1695 nmdc:mga06z11_9486_c1 3300050494 Bacteria 4103
1696 nmdc:mga07m45_122738_c1 3300050496 Bacteria 1501
1697 nmdc:mga07m45_14653_c2 3300050496 Bacteria 3672
1698 nmdc:mga07m45_259827_c1 3300050496 Bacteria 1010
1699 nmdc:mga07m45_296730_c1 3300050496 Bacteria 940
1700 nmdc:mga07m45_355731_c1 3300050496 Bacteria 851
1701 nmdc:mga07m45_43458_c1 3300050496 Bacteria 2519
1702 nmdc:mga07m45_46368_c1 3300050496 Bacteria 2442
1703 nmdc:mga05p37_135935_c1 3300050507 Bacteria 3014
1704 nmdc:mga05p37_13694_c1 3300050507 Bacteria 9720
1705 nmdc:mga05p37_26731_c1 3300050507 Bacteria 7018
1706 nmdc:mga05p37_33096_c1 3300050507 Bacteria 6331
1707 nmdc:mga05p37_719155_c1 3300050507 Bacteria 1106
1708 nmdc:mga05p37_7310_c1 3300050507 Bacteria 13031
1709 nmdc:mga05p37_76550_c1 3300050507 Bacteria 4119
1710 nmdc:mga09592_22873_c1 3300050508 Bacteria 5157
1711 nmdc:mga09592_42022_c1 3300050508 Bacteria 3846
1712 nmdc:mga09592_59060_c1 3300050508 Bacteria 3243
1713 nmdc:mga0qj67_15559_c1 3300050509 Bacteria 5760
1714 nmdc:mga0qj67_21501_c1 3300050509 Bacteria 4950
1715 nmdc:mga0qj67_4674_c1 3300050509 Bacteria 9939
1716 nmdc:mga06r32_4896_c1 3300050510 Bacteria 12062
1717 nmdc:mga06r32_8384_c1 3300050510 Bacteria 9308
1718 nmdc:mga08y16_12186_c1 3300050511 Bacteria 9038
1719 nmdc:mga08y16_170800_c1 3300050511 Bacteria 2258
1720 nmdc:mga08y16_22091_c1 3300050511 Bacteria 6718
1721 nmdc:mga08y16_243008_c1 3300050511 Bacteria 1861
1722 nmdc:mga08y16_47150_c1 3300050511 Bacteria 4511
1723 nmdc:mga08y16_518_c1 3300050511 Bacteria 35625
1724 nmdc:mga08y16_549471_c1 3300050511 Bacteria 1169
1725 nmdc:mga08y16_6788_c1 3300050511 Bacteria 12011
1726 nmdc:mga0n895_1010768_c1 3300050512 Bacteria 812
1727 nmdc:mga0n895_102857_c1 3300050512 Bacteria 2868
1728 nmdc:mga0n895_121567_c1 3300050512 Bacteria 2632
1729 nmdc:mga0n895_180064_c1 3300050512 Bacteria 2145
1730 nmdc:mga0n895_2094_c1 3300050512 Bacteria 15379
1731 nmdc:mga0n895_22338_c1 3300050512 Bacteria 5932
1732 nmdc:mga0n895_24114_c1 3300050512 Bacteria 5729
1733 nmdc:mga0n895_255905_c1 3300050512 Bacteria 1777
1734 nmdc:mga0n895_27310_c1 3300050512 Bacteria 5421
1735 nmdc:mga0n895_338465_c1 3300050512 Bacteria 1524
1736 nmdc:mga0n895_43907_c1 3300050512 Bacteria 4359
1737 nmdc:mga0n895_460921_c1 3300050512 Bacteria 1283
1738 nmdc:mga0n895_513772_c1 3300050512 Bacteria 1206
1739 nmdc:mga0n895_77721_c1 3300050512 Bacteria 3302
1740 nmdc:mga0rr50_175981_c1 3300050513 Bacteria 1746
1741 nmdc:mga0rr50_260119_c1 3300050513 Bacteria 1444
1742 nmdc:mga0rr50_439470_c1 3300050513 Bacteria 1105
1743 nmdc:mga0rr50_540865_c1 3300050513 Bacteria 992
1744 nmdc:mga0rr50_55745_c1 3300050513 Bacteria 2950
1745 nmdc:mga0rr50_5686_c1 3300050513 Bacteria 7468
1746 nmdc:mga0rr50_64444_c1 3300050513 Bacteria 2772
1747 nmdc:mga0rr50_74118_c1 3300050513 Bacteria 2604
1748 nmdc:mga08x19_102299_c1 3300050514 Bacteria 1902
1749 nmdc:mga08x19_16318_c1 3300050514 Bacteria 4528
1750 nmdc:mga0a205_10809_c1 3300050515 Bacteria 8399
1751 nmdc:mga0a205_13485_c1 3300050515 Bacteria 7610
1752 nmdc:mga0a205_14827_c1 3300050515 Bacteria 7273
1753 nmdc:mga0a205_156394_c1 3300050515 Bacteria 2178
1754 nmdc:mga0a205_218030_c1 3300050515 Bacteria 1795
1755 nmdc:mga0a205_278891_c1 3300050515 Bacteria 1547
1756 nmdc:mga0a205_32169_c1 3300050515 Bacteria 5030
1757 nmdc:mga0a205_401749_c1 3300050515 Bacteria 1234
1758 nmdc:mga0a205_42582_c1 3300050515 Bacteria 4376
1759 nmdc:mga0a205_439879_c1 3300050515 Bacteria 1165
1760 nmdc:mga0a205_830_c1 3300050515 Bacteria 25159
1761 nmdc:mga0sz30_156896_c1 3300050516 Bacteria 1008
1762 nmdc:mga0sz30_16015_c1 3300050516 Bacteria 2970
1763 nmdc:mga0sz30_445_c1 3300050516 Bacteria 15645
1764 Ga0495601_0001195 3300053077 Bacteria 14210
1765 Ga0495601_0001471 3300053077 Bacteria 12982
1766 Ga0495601_0017967 3300053077 Bacteria 4299
1767 Ga0495601_0051327 3300053077 Bacteria 2603
1768 Ga0495601_0144129 3300053077 Bacteria 1554
1769 Ga0495601_0380192 3300053077 Bacteria 916
1770 Ga0495612_0000353 3300053078 Bacteria 18580
1771 Ga0495612_0008637 3300053078 Bacteria 4129
1772 Ga0495612_0009709 3300053078 Bacteria 3897
1773 Ga0495612_0012593 3300053078 Bacteria 3409
1774 Ga0495612_0191469 3300053078 Bacteria 900
1775 Ga0500610_0189819 3300053079 Bacteria 999
1776 Ga0500610_0207161 3300053079 Bacteria 940
1777 Ga0500635_0033796 3300053080 Bacteria 1671
1778 Ga0495595_0000480 3300053084 Bacteria 15215
1779 Ga0495595_0010420 3300053084 Bacteria 3863
1780 Ga0495595_0018087 3300053084 Bacteria 3041
1781 Ga0495595_0018501 3300053084 Bacteria 3011
1782 Ga0495595_0029627 3300053084 Bacteria 2451
1783 Ga0495595_0036616 3300053084 Bacteria 2228
1784 Ga0495595_0088199 3300053084 Bacteria 1485
1785 Ga0495619_0000289 3300053085 Bacteria 35778
1786 Ga0495619_0000332 3300053085 Bacteria 33066
1787 Ga0495619_0001043 3300053085 Bacteria 18161
1788 Ga0495619_0009100 3300053085 Bacteria 6268
1789 Ga0495619_0010184 3300053085 Bacteria 5922
1790 Ga0495619_0028628 3300053085 Bacteria 3595
1791 Ga0495619_0166402 3300053085 Bacteria 1524
1792 Ga0495619_0206487 3300053085 Bacteria 1360
1793 Ga0495619_0219870 3300053085 Bacteria 1316
1794 Ga0495619_0299895 3300053085 Bacteria 1113
1795 Ga0495619_0303757 3300053085 Bacteria 1105
1796 Ga0495619_0315886 3300053085 Bacteria 1082
1797 Ga0500643_000018 3300053087 Bacteria 296505
1798 Ga0500651_0314768 3300053093 Bacteria 895
1799 Ga0500566_0006255 3300053094 Bacteria 7073
1800 Ga0500641_0005072 3300053096 Bacteria 4667
1801 Ga0500641_0119136 3300053096 Bacteria 1137
1802 Ga0500556_0071241 3300053104 Bacteria 1298
1803 Ga0500557_000008 3300053105 Bacteria 127284
1804 Ga0500569_021584 3300053109 Bacteria 1704
1805 Ga0500595_000232 3300053119 Bacteria 37646
1806 Ga0500595_006829 3300053119 Bacteria 4804
1807 Ga0500595_031382 3300053119 Bacteria 1783
1808 Ga0500608_090211 3300053122 Bacteria 1434
1809 Ga0500642_0000067 3300053130 Bacteria 56324
1810 Ga0500642_0210912 3300053130 Bacteria 901
1811 Ga0500655_030900 3300053133 Bacteria 1032
1812 Ga0500559_0014503 3300053136 Bacteria 3330
1813 Ga0500568_0002596 3300053139 Bacteria 10496
1814 Ga0500568_0040908 3300053139 Bacteria 1864
1815 Ga0500568_0042033 3300053139 Bacteria 1833
1816 Ga0500577_0163473 3300053142 Bacteria 949
1817 Ga0500603_005284 3300053150 Bacteria 2772
1818 Ga0500603_048434 3300053150 Bacteria 1156
1819 Ga0500604_0095341 3300053151 Bacteria 976
1820 Ga0500604_0123838 3300053151 Bacteria 866
1821 Ga0500616_0002167 3300053153 Bacteria 16975
1822 Ga0500620_043958 3300053155 Bacteria 1476
1823 Ga0500622_0006295 3300053156 Bacteria 6929
1824 Ga0500638_005675 3300053162 Bacteria 5010
1825 Ga0500639_206626 3300053163 Bacteria 837
1826 Ga0500636_0000847 3300053177 Bacteria 16470
1827 Ga0500637_0000260 3300053178 Bacteria 19731
1828 Ga0500637_0000405 3300053178 Bacteria 16453
1829 Ga0500649_094163 3300053722 Bacteria 1196
1830 Ga0500625_012504 3300053729 Bacteria 3881
1831 Ga0500645_026262 3300053730 Bacteria 1771
1832 Ga0500645_031912 3300053730 Bacteria 1582
1833 Ga0500599_000323 3300053736 Bacteria 4694
1834 Ga0500601_000062 3300053737 Bacteria 22260
1835 Ga0501084_0002367 3300054114 Bacteria 15172
1836 Ga0501084_0197701 3300054114 Bacteria 1696
1837 Ga0501084_0214409 3300054114 Bacteria 1624
1838 Ga0500661_000357 3300055283 Bacteria 8385
1839 Ga0501082_0041592 3300060353 Bacteria 3962
1840 Ga0466962_0261961 3300061719 Bacteria 851
1841 Ga0530510_0002069 3300061734 Bacteria 13788
1842 Ga0530510_0291292 3300061734 Bacteria 1220
1843 2507510892 2507262055 Bacteria 8048963
1844 2508544705 2508501009 Bacteria 7784016
1845 2508697067 2508501042 Bacteria 8719808
1846 2511394421 2511231028 Bacteria 8046582
1847 2513629156 2513237092 Bacteria 8341956
1848 2513637597 2513237094 Bacteria 8789602
1849 2513649553 2513237095 Bacteria 8976980
1850 2513654906 2513237096 Bacteria 8722461
1851 2513697329 2513237101 Bacteria 7952346
1852 2513700057 2513237102 Bacteria 7703324
1853 2513719256 2513237104 Bacteria 10034502
1854 2513861296 2513237137 Bacteria 9558895
1855 2513874543 2513237139 Bacteria 8737671
1856 2513891331 2513237141 Bacteria 8496279
1857 2513916071 2513237145 Bacteria 8979722
1858 2514015555 2513237161 Bacteria 8871253
1859 2515625564 2515154112 Bacteria 8294334
1860 2517100471 2517093001 Bacteria 9002274
1861 2517894626 2517572143 Bacteria 9484767
1862 2524437332 2524023205 Bacteria 8918781
1863 2524534357 2524023228 Bacteria 10118060
1864 2528853218 2528768022 Bacteria 10457665
1865 2617350649 2617270735 Bacteria 9163226
1866 2617377940 2617270741 Bacteria 8201522
1867 2671119053 2667528175 Bacteria 7532676
1868 2723843177 2721755755 Bacteria 8322773
1869 2728747713 2728368998 Bacteria 8720350
1870 2745076807 2744054633 Bacteria 8678936
1871 2793065175 2791355196 Bacteria 7323613
1872 2793072306 2791355197 Bacteria 8420563
1873 2793083114
1874 2805916538 2802429603 Bacteria 8777136
1875 2818238023 2816332527 Bacteria 8933356
1876 2824606125 2824600985 Bacteria 8488197
1877 2824616047 2824609381 Bacteria 8672835
1878 2824618973 2824617872 Bacteria 8814715
1879 2824627507 2824626560 Bacteria 8813858
1880 2824638832 2824635225 Bacteria 8785348
1881 2824649011 2824644064 Bacteria 8743947
1882 2824657345 2824653114 Bacteria 8493680
1883 2824663086 2824661429 Bacteria 9877870
1884 2824676953 2824671348 Bacteria 8369588
1885 2824682052 2824679649 Bacteria 8248951
1886 2824693642 2824687955 Bacteria 8360029
1887 2824698723 2824696289 Bacteria 8335049
1888 2824706497 2824704595 Bacteria 9667483
1889 2824716477 2824714736 Bacteria 8717648
1890 2824726423 2824723954 Bacteria 8758240
1891 2824737952 2824732956 Bacteria 7810675
1892 2824753004 2824746037 Bacteria 7911610
1893 2824756955 2824753945 Bacteria 9787441
1894 2824769751 2824763712 Bacteria 9792355
1895 2838127781 2838122688 Bacteria 8803140
1896 2841943074 2841941048 Bacteria 8688029
1897 2841956095 2841949485 Bacteria 8680857
1898 2841960333 2841957949 Bacteria 8652217
1899 2841968284 2841966195 Bacteria 8673214
1900 2841970328 2841966195 Bacteria 8673214
1901 2841976502 2841974524 Bacteria 8931498
1902 2841987878 2841983080 Bacteria 8395090
1903 2842042823 2842038055 Bacteria 8002051
1904 2842050864 2842045827 Bacteria 8006841
1905 2844317039 2844315083 Bacteria 8138177
1906 2847938455 2847930680 Bacteria 9342022
1907 2847944347 2847939898 Bacteria 8606328
1908 2849081410 2849076700 Bacteria 7039503
1909 2857512072 2857509624 Bacteria 7472071
1910 2874597617 2874590934 Bacteria 8299676
1911 2874612487 2874604998 Bacteria 7834745
1912 2874618412 2874612657 Bacteria 8252029
1913 2874623542 2874620515 Bacteria 8290088
1914 2874630521 2874628541 Bacteria 8630250
1915 2874649181 2874645413 Bacteria 8214782
1916 2876767783 2876761206 Bacteria 10111113
1917 2876774910 2876771140 Bacteria 8287509
1918 2876810636 2876808645 Bacteria 8824342
1919 2876822338 2876818435 Bacteria 8274608
1920 2879077998 2879074833 Bacteria 8279565
1921 2879088694 2879083081 Bacteria 8587928
1922 2879103945 2879099564 Bacteria 10442239
1923 2879117931 2879110137 Bacteria 8907982
1924 2879132451 2879127579 Bacteria 8294491
1925 2879145250 2879142872 Bacteria 8267021
1926 2881370569 2881364244 Bacteria 7710352
1927 2881667334 2881665667 Bacteria 8175609
1928 2885367041 2885366525 Bacteria 8326213
1929 2885378084 2885374607 Bacteria 8927485
1930 2885416537 2885409591 Bacteria 9235467
1931 2888381660 2888378607 Bacteria 9652610
1932 2888388973 2888388044 Bacteria 7304136
1933 2888422050 2888419890 Bacteria 7857137
1934 2889033516 2889033259 Bacteria 9099371
1935 2903735005 2903727486 Bacteria 8281579
1936 2903754861 2903748898 Bacteria 9972761
1937 2904667654 2904666416 Bacteria 8226587
1938 2904697036 2904690495 Bacteria 9412302
1939 2904705653
1940 2904719081 2904711408 Bacteria 9771557
1941 2906604122 2906602504 Bacteria 8295279
1942 2906611360
1943 2906633019 2906626472 Bacteria 8826946
1944 2906643464 2906635258 Bacteria 8601019
1945 2906648246 2906643746 Bacteria 8722424
1946 2906661312 2906660503 Bacteria 8595048
1947 2908744942 2908739725 Bacteria 8628932
1948 2908762695 2908756301 Bacteria 8864324
1949 2908782010 2908775508 Bacteria 8092255
1950 2922362693 2922361189 Bacteria 7436256
1951 2922371330
1952 2922390322 2922386360 Bacteria 7017218
1953 2922393766 2922393267 Bacteria 8285685
1954 2922428014
1955 2929619708 2929615660 Bacteria 9193770
1956 2929627821 2929624759 Bacteria 9339455
1957 2932786040 2932784394 Bacteria 9704911
1958 2932798193 2932794094 Bacteria 7915132
1959 2932803986 2932801729 Bacteria 7987968
1960 2932817012 2932809354 Bacteria 9135765
1961 2932822497 2932818245 Bacteria 9955613
1962 2932831084 2932828146 Bacteria 9745859
1963 2933581627 2933577622 Bacteria 9116884
1964 2935612890 2935608549 Bacteria 8203142
1965 2935624129 2935616580 Bacteria 9032984
1966 2935632061 2935630451 Bacteria 8169952
1967 2935640225 2935638405 Bacteria 10015038
1968 2935655015 2935648319 Bacteria 8801166
1969 2935663895 2935656913 Bacteria 8965014
1970 2935666937 2935665750 Bacteria 9571747
1971 2935680424 2935675223 Bacteria 9928132
1972 2935690068 2935684952 Bacteria 9590419
1973 2935699850 2935694250 Bacteria 9291695
1974 2935704692 2935703347 Bacteria 10242284
1975 2935722220 2935713505 Bacteria 9608509
1976 2935731529 2935722832 Bacteria 9608746
1977 2935735383 2935732158 Bacteria 9706831
1978 2935745346 2935741537 Bacteria 9707219
1979 2935755079 2935750917 Bacteria 9590372
1980 2935762407 2935760218 Bacteria 9817913
1981 2935775442 2935769743 Bacteria 7878163
1982 2935780344 2935777560 Bacteria 8077691
1983 2935790691 2935785616 Bacteria 7962367
1984 2935799126 2935793552 Bacteria 8012592
1985 2935803905 2935801545 Bacteria 9301974
1986 2935811823 2935810662 Bacteria 9401221
1987 2935824378 2935819856 Bacteria 8261050
1988 2935829708 2935827899 Bacteria 10038562
1989 2935842960 2935837841 Bacteria 9454360
1990 2935852477 2935847175 Bacteria 8228321
1991 2935862371 2935855204 Bacteria 9035059
1992 2935870506 2935864058 Bacteria 9784707
1993 2935881088 2935873716 Bacteria 9632195
1994 2935884208 2935883170 Bacteria 7964738
1995 2935912368 2935908558 Bacteria 8568796
1996 2935923958 2935916978 Bacteria 9113783
1997 2935929397 2935926038 Bacteria 8601059
1998 2935936028 2935934488 Bacteria 8602579
1999 2935949928 2935942939 Bacteria 8599779
2000 2935957306 2935951376 Bacteria 8602333
2001 2935962175 2935959822 Bacteria 7869783
2002 2935968337 2935967501 Bacteria 8603075
2003 2935976523 2935975950 Bacteria 8347125
2004 2935988031 2935984226 Bacteria 8302647
2005 2935993585 2935992306 Bacteria 9802711
2006 2936004481 2936002035 Bacteria 9362176
2007 2936018036 2936011229 Bacteria 8801034
2008 2936026554 2936019824 Bacteria 8804134
2009 2936035297 2936028420 Bacteria 8965941
2010 2936038406 2936037263 Bacteria 9446081
2011 2936053431 2936046547 Bacteria 8903709
2012 2936059412 2936055302 Bacteria 8785755
2013 2940561641 2940556831 Bacteria 9590747
2014 2941508009 2941507105 Bacteria 8166816
2015 2941515486 2941515067 Bacteria 8166720
2016 2941523939 2941523033 Bacteria 8169134
2017 2941533820 2941531003 Bacteria 7653939
2018 2941544184 2941538514 Bacteria 9402094
2019 3005477713 3005474847 Bacteria 9259049
2020 3005485386 3005483717 Bacteria 7877331
2021 3005507242 3005506211 Bacteria 6943378
2022 3005594602 3005587118 Bacteria 7794411
2023 3005596681 3005594810 Bacteria 8716512
2024 3005712749 3005710791 Bacteria 7622528
2025 8006933140 8006926726 Bacteria 6749210
2026 8006933500 8006933436 Bacteria 10410654
2027 8006971306 8006964411 Bacteria 8966052
2028 8006983173 8006973647 Bacteria 10679141
2029 8006989256 8006984368 Bacteria 9651211
2030 8006997731 8006994254 Bacteria 8309700
2031 8016516297 8016511872 Bacteria 9921665
2032 8016523692 8016522445 Bacteria 8156687
2033 8016541474 8016539877 Bacteria 8155419
2034 8016551781 8016548790 Bacteria 8155074
2035 8016560168 8016557553 Bacteria 8154380
2036 8016566866 8016566248 Bacteria 8158151
2037 8016579598 8016575299 Bacteria 8154085
2038 8016589270 8016583857 Bacteria 10421953
2039 8016598085 8016595262 Bacteria 8149947
2040 8016604225 8016603502 Bacteria 8731218
2041 8016620808 8016613128 Bacteria 8794220
2042 8016629181 8016622563 Bacteria 7999408
2043 8016633707 8016630954 Bacteria 9217207
2044 8017060237 8017057580 Bacteria 10023680
2045 8019536904 8019530166 Bacteria 8155624
2046 8019542627 8019538911 Bacteria 7872763
2047 8019559416 8019555841 Bacteria 9642137
2048 8019579759 8019576017 Bacteria 10049540
2049 8019587469 8019586578 Bacteria 10212056
2050 8019603873 8019597564 Bacteria 10041141
2051 8019614665 8019608314 Bacteria 10042931
2052 8019636906 8019629233 Bacteria 8687553
2053 8019642702 8019638758 Bacteria 9062356
2054 8019649883 8019648815 Bacteria 10014479
2055 8019664725 8019659431 Bacteria 8577854
2056 8019674311 8019668869 Bacteria 8791617
2057 8055749036 8055742211 Bacteria 9226248
2058 8056674772 8056673599 Bacteria 7871253
2059 8056695058 8056689827 Bacteria 6712655
2060 8056969885 8056967851 Bacteria 9038162
2061 Ga0373934_0115469
2062 JGI24032J14994_101455
2063 JGI24752J21851_1008532
2064 JGI24739J22299_10002831
2065 JGI24737J22298_10001577
2066 JGI24750J21931_1000865
2067 JGI24745J21846_1002353
2068 JGI24748J21848_1001206
2069 JGI24749J21850_1011129
2070 JGI24744J21845_10003221
2071 JGI24035J26624_1003600
2072 JGI24034J26672_10004016
2073 JGI24742J22300_10001206
2074 JGI24751J29686_10002679
2075 JGI25406J46586_10000021
2076 JGI25153J46596_10001764
2077 JGI25153J46596_10002778
2078 JGI25153J46596_10007736
2079 JGI25153J46596_10008618
2080 JGI25160J50197_1000533
2081 JGI25160J50197_1027443
2082 JGI25404J52841_10021647
2083 Ga0055539_1012039
2084 Ga0055542_1023720
2085 Ga0055531_10010491
2086 JGI25405J52794_10004566
2087 JGI25405J52794_10060051
2088 Ga0065165_1000437
2089 Ga0065165_1001951
2090 Ga0065165_1005934
2091 Ga0065712_10102380
2092 Ga0065715_10114787
2093 Ga0065715_10261091
2094 Ga0070658_10006285
2095 Ga0070658_10218087
2096 Ga0070676_10001629
2097 Ga0070676_10026881
2098 Ga0070676_10034437
2099 Ga0070683_100007819
2100 Ga0070683_100014236
2101 Ga0070683_100020043
2102 Ga0070683_100486229
2103 Ga0070690_100022028
2104 Ga0070690_100033117
2105 Ga0070690_100151901
2106 Ga0070690_100390243
2107 Ga0070670_100112665
2108 Ga0070677_10000481
2109 Ga0068869_100000216
2110 Ga0068869_100087109
2111 Ga0070666_10005440
2112 Ga0070666_10023836
2113 Ga0070666_10287891
2114 Ga0070680_100002486
2115 Ga0070680_100006251
2116 Ga0070680_100032424
2117 Ga0070680_100070553
2118 Ga0070680_100194678
2119 Ga0070680_100575707
2120 Ga0070682_100000853
2121 Ga0070682_100022761
2122 Ga0070682_100221253
2123 Ga0070682_100468508
2124 Ga0068868_100000474
2125 Ga0068868_100071341
2126 Ga0068868_100250174
2127 Ga0070660_100001322
2128 Ga0070660_100009076
2129 Ga0070660_100051630
2130 Ga0070689_100000240
2131 Ga0070689_100223665
2132 Ga0070689_100490729
2133 Ga0070691_10020949
2134 Ga0070691_10189075
2135 Ga0070687_100000302
2136 Ga0070661_100003117
2137 Ga0070661_100068426
2138 Ga0070661_100131740
2139 Ga0070661_100156278
2140 Ga0070692_10027705
2141 Ga0070668_100003449
2142 Ga0070668_100076646
2143 Ga0070668_100103710
2144 Ga0070668_100272139
2145 Ga0070669_100009578
2146 Ga0070669_100302641
2147 Ga0070675_100001762
2148 Ga0070675_100125583
2149 Ga0070675_100208241
2150 Ga0070675_100651086
2151 Ga0070675_100750101
2152 Ga0070671_100002861
2153 Ga0070671_100117771
2154 Ga0070671_100499273
2155 Ga0070671_100519094
2156 Ga0070674_100002865
2157 Ga0070674_100625549
2158 Ga0070673_100001019
2159 Ga0070673_100034773
2160 Ga0070673_100227232
2161 Ga0070673_100318795
2162 Ga0070688_100010793
2163 Ga0070688_100022950
2164 Ga0070659_100005117
2165 Ga0070659_100131998
2166 Ga0070659_100342439
2167 Ga0070659_100393710
2168 Ga0070667_100001650
2169 Ga0070667_100053374
2170 Ga0070667_100068279
2171 Ga0070667_100547268
2172 Ga0070703_10002778
2173 Ga0070709_10001960
2174 Ga0070709_10002079
2175 Ga0070709_10008334
2176 Ga0070709_10017458
2177 Ga0070709_10030167
2178 Ga0070709_10166061
2179 Ga0070709_10173191
2180 Ga0070709_10461647
2181 Ga0070714_100003380
2182 Ga0070714_100004982
2183 Ga0070714_100050541
2184 Ga0070714_100054993
2185 Ga0070714_100287789
2186 Ga0070714_100320733
2187 Ga0070713_100005503
2188 Ga0070713_100035581
2189 Ga0070713_100035837
2190 Ga0070713_100175737
2191 Ga0070713_100196071
2192 Ga0070713_100957551
2193 Ga0070710_10005443
2194 Ga0070701_10000281
2195 Ga0070711_100003146
2196 Ga0070711_100022144
2197 Ga0070711_100039401
2198 Ga0070711_100046760
2199 Ga0070711_100454980
2200 Ga0070705_100001659
2201 Ga0070705_100025036
2202 Ga0070700_100001804
2203 Ga0070700_100041536
2204 Ga0070700_100216528
2205 Ga0070700_100498094
2206 Ga0070694_100000576
2207 Ga0070694_100267427
2208 Ga0070694_100326738
2209 Ga0070708_100006158
2210 Ga0070708_100021331
2211 Ga0070708_100028554
2212 Ga0070708_100070172
2213 Ga0070708_100085640
2214 Ga0070708_100510048
2215 Ga0070663_100003664
2216 Ga0070663_100070816
2217 Ga0070663_100080851
2218 Ga0070663_100434989
2219 Ga0070663_100651899
2220 Ga0070678_100006300
2221 Ga0070678_100456821
2222 Ga0070678_100659165
2223 Ga0070662_100194302
2224 Ga0070681_10010247
2225 Ga0070681_10020913
2226 Ga0070681_10150329
2227 Ga0070681_10150518
2228 Ga0070681_10167923
2229 Ga0070681_10191007
2230 Ga0068867_100002151
2231 Ga0068867_100064551
2232 Ga0068867_100198087
2233 Ga0070685_10049333
2234 Ga0070706_100084513
2235 Ga0070706_100107179
2236 Ga0070706_100238540
2237 Ga0070706_100261696
2238 Ga0070706_100609066
2239 Ga0070706_100722283
2240 Ga0070707_100018938
2241 Ga0070707_100040622
2242 Ga0070707_100082900
2243 Ga0070707_100290348
2244 Ga0070707_100415591
2245 Ga0070698_100001171
2246 Ga0070698_100005791
2247 Ga0070698_100170211
2248 Ga0070698_100182392
2249 Ga0070698_100189075
2250 Ga0070698_100340811
2251 Ga0070698_100420205
2252 Ga0070698_100690413
2253 Ga0070698_100699625
2254 Ga0070699_100006362
2255 Ga0070699_100006895
2256 Ga0070699_100022064
2257 Ga0070699_100162407
2258 Ga0070699_100299951
2259 Ga0070679_100003426
2260 Ga0070679_100005687
2261 Ga0070679_100027474
2262 Ga0070679_100215944
2263 Ga0070679_100239003
2264 Ga0070679_100326452
2265 Ga0070679_100358734
2266 Ga0070679_100379825
2267 Ga0070684_100011854
2268 Ga0070684_100012047
2269 Ga0070684_100033680
2270 Ga0070684_100086741
2271 Ga0070697_100019057
2272 Ga0070697_100023652
2273 Ga0070697_100191407
2274 Ga0070697_100302720
2275 Ga0070697_100444829
2276 Ga0068853_100004149
2277 Ga0068853_100007962
2278 Ga0068853_100084860
2279 Ga0068853_100266376
2280 Ga0068853_100498279
2281 Ga0068853_100518389
2282 Ga0068853_100602340
2283 Ga0068853_100731975
2284 Ga0070672_100004101
2285 Ga0070672_100083906
2286 Ga0070672_100190388
2287 Ga0070672_100342323
2288 Ga0070672_100439458
2289 Ga0070686_100002850
2290 Ga0070686_100371033
2291 Ga0070695_100009940
2292 Ga0070696_100006975
2293 Ga0070696_100220734
2294 Ga0070696_100284480
2295 Ga0070693_100002142
2296 Ga0070693_100043501
2297 Ga0070693_100091281
2298 Ga0070665_100003622
2299 Ga0070665_100051658
2300 Ga0070665_100146230
2301 Ga0070665_100162015
2302 Ga0070665_100167853
2303 Ga0070665_100359247
2304 Ga0070665_100492077
2305 Ga0070665_100909538
2306 Ga0070704_100000444
2307 Ga0070704_100077242
2308 Ga0070704_100088629
2309 Ga0068855_100035351
2310 Ga0068855_100038019
2311 Ga0068855_100073196
2312 Ga0068855_100084816
2313 Ga0068855_100131307
2314 Ga0068855_100224204
2315 Ga0068855_100238994
2316 Ga0068855_100262674
2317 Ga0068855_100389982
2318 Ga0068855_100424422
2319 Ga0068855_100607661
2320 Ga0070664_100012305
2321 Ga0070664_100193984
2322 Ga0070664_100204358
2323 Ga0070664_100232809
2324 Ga0070664_100653392
2325 Ga0068857_100004239
2326 Ga0068857_100020977
2327 Ga0068857_100070627
2328 Ga0068857_100168502
2329 Ga0068857_100248392
2330 Ga0068857_100371190
2331 Ga0068854_100005104
2332 Ga0068854_100137220
2333 Ga0068856_100038973
2334 Ga0068856_100059548
2335 Ga0068856_100219306
2336 Ga0068856_100242268
2337 Ga0068856_100683695
2338 Ga0068856_100815379
2339 Ga0070702_100001491
2340 Ga0070702_100115063
2341 Ga0068852_100000932
2342 Ga0068852_100193681
2343 Ga0068852_100327950
2344 Ga0068852_100347483
2345 Ga0068859_100002825
2346 Ga0068859_100055931
2347 Ga0068859_100108703
2348 Ga0068864_100002030
2349 Ga0068864_100035218
2350 Ga0068864_100092544
2351 Ga0068864_100504424
2352 Ga0068866_10000638
2353 Ga0068866_10118537
2354 Ga0068866_10249854
2355 Ga0068861_100004452
2356 Ga0068851_10040747
2357 Ga0068851_10099516
2358 Ga0068870_10000048
2359 Ga0068863_100001975
2360 Ga0068863_100391832
2361 Ga0068858_100008206
2362 Ga0068858_100073450
2363 Ga0068860_100000933
2364 Ga0068860_100017528
2365 Ga0068860_100144851
2366 Ga0068860_100317585
2367 Ga0068860_100689963
2368 Ga0068862_100026562
2369 Ga0068862_100185846
2370 Ga0068862_100276122
2371 Ga0081455_10002021
2372 Ga0081455_10004363
2373 Ga0081455_10005161
2374 Ga0081455_10005318
2375 Ga0081455_10010563
2376 Ga0081455_10011965
2377 Ga0081455_10021579
2378 Ga0081455_10033400
2379 Ga0081455_10043525
2380 Ga0081455_10068940
2381 Ga0081455_10075291
2382 Ga0081538_10069563
2383 Ga0081540_1000280
2384 Ga0081540_1002252
2385 Ga0081540_1005512
2386 Ga0081540_1011141
2387 Ga0081540_1011980
2388 Ga0081540_1036034
2389 Ga0081540_1038641
2390 Ga0081539_10000051
2391 Ga0081539_10000486
2392 Ga0081539_10003351
2393 Ga0081539_10031311
2394 Ga0081539_10091328
2395 Ga0070717_10000150
2396 Ga0070717_10001555
2397 Ga0070717_10011942
2398 Ga0070717_10176264
2399 Ga0075365_10003263
2400 Ga0075365_10052047
2401 Ga0075365_10330084
2402 Ga0075365_10402045
2403 Ga0075368_10003112
2404 Ga0075368_10107953
2405 Ga0075368_10199552
2406 Ga0075363_100022684
2407 Ga0075363_100166830
2408 Ga0075364_10026988
2409 Ga0075364_10085514
2410 Ga0075364_10368366
2411 Ga0075364_10402808
2412 Ga0070715_10000321
2413 Ga0070715_10030468
2414 Ga0070715_10039547
2415 Ga0070715_10173242
2416 Ga0070716_100001200
2417 Ga0070716_100018951
2418 Ga0070716_100105020
2419 Ga0070716_100125734
2420 Ga0070716_100277372
2421 Ga0070712_100004740
2422 Ga0070712_100057102
2423 Ga0070712_100063106
2424 Ga0070712_100072856
2425 Ga0070712_100073747
2426 Ga0070712_100118722
2427 Ga0070712_100126287
2428 Ga0070712_100379754
2429 Ga0075362_10001695
2430 Ga0075362_10107617
2431 Ga0075362_10138886
2432 Ga0075362_10168066
2433 Ga0075362_10190697
2434 Ga0075367_10018878
2435 Ga0075367_10022791
2436 Ga0075367_10170445
2437 Ga0075367_10247511
2438 Ga0075367_10413578
2439 Ga0075369_10002166
2440 Ga0075369_10045606
2441 Ga0075369_10196443
2442 Ga0075366_10007150
2443 Ga0075366_10025959
2444 Ga0075366_10073201
2445 Ga0097621_100002984
2446 Ga0097621_100222730
2447 Ga0097621_100871030
2448 Ga0075370_10101745
2449 Ga0075370_10104514
2450 Ga0075370_10110461
2451 Ga0075370_10162316
2452 Ga0068871_100000555
2453 Ga0068871_100004433
2454 Ga0068871_100447185
2455 Ga0068871_100624562
2456 Ga0075428_100052861
2457 Ga0075428_100058497
2458 Ga0075430_100000042
2459 Ga0075430_100000534
2460 Ga0075430_100000826
2461 Ga0075431_100086521
2462 Ga0075431_100091253
2463 Ga0075431_100447718
2464 Ga0075431_100663262
2465 Ga0075433_10006248
2466 Ga0075433_10011316
2467 Ga0075433_10012151
2468 Ga0075433_10022378
2469 Ga0075433_10207998
2470 Ga0075433_10404271
2471 Ga0075434_100012903
2472 Ga0075434_100016644
2473 Ga0075434_100017132
2474 Ga0075434_100019982
2475 Ga0075434_100027752
2476 Ga0075434_100147528
2477 Ga0075434_100163062
2478 Ga0075434_100267252
2479 Ga0075434_100304674
2480 Ga0075434_100346490
2481 Ga0075434_100368028
2482 Ga0075429_100003563
2483 Ga0075429_100017797
2484 Ga0075429_100042041
2485 Ga0075429_100062288
2486 Ga0068865_100049753
2487 Ga0068865_100135239
2488 Ga0075436_100021433
2489 Ga0075436_100051974
2490 Ga0075436_100057781
2491 Ga0075436_100127649
2492 Ga0075436_100430729
2493 Ga0097620_100002825
2494 Ga0097620_100055932
2495 Ga0097620_100108696
2496 Ga0099824_1004900
2497 Ga0099824_1029293
2498 Ga0099822_1000677
2499 Ga0075435_100018059
2500 Ga0075435_100045774
2501 Ga0075435_100057475
2502 Ga0075435_100062982
2503 Ga0075435_100068323
2504 Ga0075435_100084879
2505 Ga0075435_100218901
2506 Ga0075435_100273373
2507 Ga0075435_100293565
2508 Ga0075435_100307271
2509 Ga0099794_10016964
2510 Ga0099794_10047778
2511 Ga0099794_10181752
2512 Ga0099795_10058807
2513 Ga0099795_10120237
2514 Ga0105240_10008025
2515 Ga0105240_10027519
2516 Ga0105240_10033952
2517 Ga0105240_10086994
2518 Ga0105240_10129550
2519 Ga0105240_10174326
2520 Ga0105240_10191853
2521 Ga0111539_10002792
2522 Ga0111539_10004409
2523 Ga0111539_10004721
2524 Ga0111539_10016484
2525 Ga0111539_10115084
2526 Ga0111539_10157494
2527 Ga0111539_10533202
2528 Ga0111539_10754634
2529 Ga0105245_10000370
2530 Ga0105245_10009595
2531 Ga0105245_10019672
2532 Ga0105245_10313762
2533 Ga0105245_10317008
2534 Ga0105245_10398638
2535 Ga0105245_10569306
2536 Ga0105245_10706223
2537 Ga0105247_10002042
2538 Ga0114129_10024612
2539 Ga0114129_10035072
2540 Ga0114129_10057279
2541 Ga0114129_10062807
2542 Ga0114129_10095997
2543 Ga0114129_10241848
2544 Ga0114129_10685163
2545 Ga0114129_10741655
2546 Ga0114129_10770015
2547 Ga0114129_11650956
2548 Ga0105243_10003045
2549 Ga0105243_10009792
2550 Ga0105243_10174023
2551 Ga0105243_10632848
2552 Ga0105243_10646984
2553 Ga0105243_10736654
2554 Ga0105241_10001352
2555 Ga0105241_10092438
2556 Ga0105241_10591021
2557 Ga0105242_10001245
2558 Ga0105242_10234816
2559 Ga0105242_10292772
2560 Ga0105242_10475396
2561 Ga0105242_10891089
2562 Ga0105248_10001324
2563 Ga0105248_10016609
2564 Ga0105248_10027404
2565 Ga0105248_10137102
2566 Ga0105248_10142505
2567 Ga0105248_10236177
2568 Ga0105237_10002060
2569 Ga0105237_10051893
2570 Ga0105237_10502841
2571 Ga0105238_10168915
2572 Ga0105238_10519124
2573 Ga0105249_10011280
2574 Ga0105249_10044003
2575 Ga0105249_10243921
2576 Ga0105239_10018332
2577 Ga0105239_10046768
2578 Ga0105239_10063519
2579 Ga0105239_10132942
2580 Ga0105239_10240473
2581 Ga0105239_10326261
2582 Ga0105239_10390965
2583 Ga0105239_10524366
2584 Ga0105239_10642095
2585 Ga0105246_10000510
2586 Ga0105246_10070617
2587 Ga0105246_10169126
2588 Ga0157315_1005559
2589 Ga0157373_10002949
2590 Ga0157371_10032190
2591 Ga0157370_10022603
2592 Ga0157370_10042139
2593 Ga0157370_10115657
2594 Ga0157370_10280866
2595 Ga0157369_10034680
2596 Ga0157369_10045599
2597 Ga0157369_10305824
2598 Ga0157374_10001994
2599 Ga0157374_10964442
2600 Ga0157378_10005283
2601 Ga0157378_10177813
2602 Ga0157378_10326744
2603 Ga0163162_10018668
2604 Ga0163162_10129762
2605 Ga0163162_10775572
2606 Ga0157372_10214993
2607 Ga0157372_10676412
2608 Ga0157375_10038248
2609 Ga0157375_10245534
2610 Ga0157375_10259770
2611 Ga0157375_10299558
2612 Ga0163163_10017133
2613 Ga0163163_10063041
2614 Ga0163163_10126958
2615 Ga0163163_10393886
2616 Ga0163163_10541197
2617 Ga0163163_10893255
2618 Ga0163163_11035903
2619 Ga0157380_10010558
2620 Ga0157380_10044784
2621 Ga0157380_10278226
2622 Ga0157380_10785985
2623 Ga0182008_10165678
2624 Ga0182008_10242838
2625 Ga0157377_10001228
2626 Ga0157379_10001959
2627 Ga0157379_10133256
2628 Ga0157379_10206894
2629 Ga0157376_10017127
2630 Ga0157376_10066771
2631 Ga0157376_10739305
2632 Ga0157376_10922161
2633 Ga0182005_1039485
2634 Ga0163161_10017343
2635 Ga0163161_10038485
2636 Ga0163161_10131788
2637 Ga0214544_1000026
2638 Ga0214542_1000025
2639 Ga0214545_1000014
2640 Ga0214543_1000034
2641 Ga0213873_10006937
2642 Ga0213876_10058129
2643 Ga0213876_10084092
2644 Ga0213876_10130132
2645 Ga0213875_10093331
2646 Ga0213871_10004587
2647 Ga0213871_10054108
2648 Ga0213871_10085835
2649 Ga0209677_103618
2650 Ga0209148_1000376
2651 Ga0209233_1009577
2652 Ga0207666_1000081
2653 Ga0209455_1000714
2654 Ga0207673_1001727
2655 Ga0209564_1011304
2656 Ga0209758_1000141
2657 Ga0209758_1000324
2658 Ga0209758_1001019
2659 Ga0209758_1002338
2660 Ga0209758_1002921
2661 Ga0209758_1003483
2662 Ga0209758_1041951
2663 Ga0209758_1081463
2664 Ga0209256_1002956
2665 Ga0209256_1047199
2666 Ga0207426_1000437
2667 Ga0207426_1001139
2668 Ga0207426_1012626
2669 Ga0207426_1018791
2670 Ga0207426_1021983
2671 Ga0209257_1003859
2672 Ga0209257_1011469
2673 Ga0209257_1040537
2674 Ga0207697_10000051
2675 Ga0207697_10086702
2676 Ga0207697_10113018
2677 Ga0207682_10000661
2678 Ga0207692_10002517
2679 Ga0207692_10177558
2680 Ga0207692_10214027
2681 Ga0207692_10350439
2682 Ga0207642_10001892
2683 Ga0207710_10016916
2684 Ga0207710_10038841
2685 Ga0207710_10079983
2686 Ga0207688_10000702
2687 Ga0207688_10114944
2688 Ga0207688_10167168
2689 Ga0207688_10411062
2690 Ga0207688_10477369
2691 Ga0207680_10009478
2692 Ga0207680_10044806
2693 Ga0207647_10002441
2694 Ga0207647_10040227
2695 Ga0207685_10010399
2696 Ga0207685_10056738
2697 Ga0207699_10000344
2698 Ga0207699_10000434
2699 Ga0207699_10035971
2700 Ga0207699_10101229
2701 Ga0207699_10154439
2702 Ga0207645_10000218
2703 Ga0207645_10027565
2704 Ga0207645_10045314
2705 Ga0207643_10000400
2706 Ga0207643_10234976
2707 Ga0207705_10358320
2708 Ga0207705_10392607
2709 Ga0207684_10004496
2710 Ga0207684_10004520
2711 Ga0207684_10012329
2712 Ga0207684_10015203
2713 Ga0207684_10087821
2714 Ga0207684_10282202
2715 Ga0207684_10292934
2716 Ga0207654_10002726
2717 Ga0207654_10194687
2718 Ga0207707_10002658
2719 Ga0207707_10011843
2720 Ga0207707_10023997
2721 Ga0207707_10043382
2722 Ga0207707_10056384
2723 Ga0207707_10063500
2724 Ga0207707_10410557
2725 Ga0207695_10036649
2726 Ga0207695_10050434
2727 Ga0207695_10085924
2728 Ga0207695_10115522
2729 Ga0207695_10212050
2730 Ga0207695_10236470
2731 Ga0207671_10131265
2732 Ga0207671_10143288
2733 Ga0207671_10521032
2734 Ga0207671_10529112
2735 Ga0207693_10001161
2736 Ga0207693_10003608
2737 Ga0207693_10035323
2738 Ga0207693_10042279
2739 Ga0207693_10085481
2740 Ga0207693_10132528
2741 Ga0207693_10206011
2742 Ga0207693_10269282
2743 Ga0207693_10321843
2744 Ga0207693_10365645
2745 Ga0207663_10000926
2746 Ga0207663_10012457
2747 Ga0207660_10002897
2748 Ga0207660_10010384
2749 Ga0207660_10013462
2750 Ga0207660_10495516
2751 Ga0207660_10651928
2752 Ga0207662_10000678
2753 Ga0207657_10003448
2754 Ga0207657_10075202
2755 Ga0207657_10095681
2756 Ga0207657_10138003
2757 Ga0207657_10166205
2758 Ga0207657_10560607
2759 Ga0207649_10001450
2760 Ga0207652_10005840
2761 Ga0207652_10006902
2762 Ga0207652_10008077
2763 Ga0207652_10016789
2764 Ga0207652_10211430
2765 Ga0207652_10346504
2766 Ga0207646_10003037
2767 Ga0207646_10078591
2768 Ga0207646_10159870
2769 Ga0207646_10244434
2770 Ga0207646_10525802
2771 Ga0207681_10001264
2772 Ga0207681_10203390
2773 Ga0207681_10259340
2774 Ga0207694_10113941
2775 Ga0207694_10125399
2776 Ga0207694_10153373
2777 Ga0207694_10296268
2778 Ga0207694_10464238
2779 Ga0207650_10043914
2780 Ga0207650_10085722
2781 Ga0207650_10219732
2782 Ga0207659_10004045
2783 Ga0207659_10248312
2784 Ga0207659_10421962
2785 Ga0207687_10007913
2786 Ga0207687_10040438
2787 Ga0207687_10427047
2788 Ga0207700_10001395
2789 Ga0207700_10015437
2790 Ga0207700_10015756
2791 Ga0207700_10090002
2792 Ga0207700_10096610
2793 Ga0207700_10101360
2794 Ga0207700_10524626
2795 Ga0207664_10023034
2796 Ga0207664_10064254
2797 Ga0207664_10145777
2798 Ga0207664_10726649
2799 Ga0207644_10044060
2800 Ga0207644_10091325
2801 Ga0207644_10114849
2802 Ga0207690_10003720
2803 Ga0207690_10103954
2804 Ga0207706_10016490
2805 Ga0207706_10168370
2806 Ga0207706_10176636
2807 Ga0207706_10199102
2808 Ga0207706_10297489
2809 Ga0207706_10518744
2810 Ga0207686_10012733
2811 Ga0207686_10017495
2812 Ga0207709_10001798
2813 Ga0207709_10056378
2814 Ga0207709_10081552
2815 Ga0207670_10003328
2816 Ga0207670_10046656
2817 Ga0207670_10073089
2818 Ga0207669_10002357
2819 Ga0207669_10047148
2820 Ga0207704_10000896
2821 Ga0207704_10047543
2822 Ga0207665_10000228
2823 Ga0207665_10000715
2824 Ga0207665_10002595
2825 Ga0207665_10019118
2826 Ga0207665_10023485
2827 Ga0207665_10149363
2828 Ga0207665_10327372
2829 Ga0207691_10000940
2830 Ga0207691_10059780
2831 Ga0207691_10063675
2832 Ga0207691_10146323
2833 Ga0207691_10373640
2834 Ga0207711_10032480
2835 Ga0207711_10034481
2836 Ga0207711_10041197
2837 Ga0207711_10041697
2838 Ga0207711_10095313
2839 Ga0207711_10115517
2840 Ga0207711_10339338
2841 Ga0207711_10486060
2842 Ga0207689_10000514
2843 Ga0207689_10069377
2844 Ga0207689_10145972
2845 Ga0207689_10435858
2846 Ga0207689_10881434
2847 Ga0207661_10001969
2848 Ga0207661_10012879
2849 Ga0207661_10029500
2850 Ga0207661_10125062
2851 Ga0207661_10208332
2852 Ga0207661_10297372
2853 Ga0207679_10000099
2854 Ga0207679_10224032
2855 Ga0207679_10598458
2856 Ga0207667_10019759
2857 Ga0207667_10040667
2858 Ga0207667_10042644
2859 Ga0207667_10098778
2860 Ga0207667_10209760
2861 Ga0207667_10399499
2862 Ga0207667_10410416
2863 Ga0207667_10482505
2864 Ga0207667_10648856
2865 Ga0207651_10000609
2866 Ga0207712_10001402
2867 Ga0207712_10164503
2868 Ga0207712_10402077
2869 Ga0207668_10008221
2870 Ga0207668_10069987
2871 Ga0207668_10075220
2872 Ga0207668_10438243
2873 Ga0207640_10001310
2874 Ga0207640_10083988
2875 Ga0207658_10021213
2876 Ga0207658_10329427
2877 Ga0207658_10444865
2878 Ga0207677_10000495
2879 Ga0207677_10020041
2880 Ga0207703_10005812
2881 Ga0207703_10250211
2882 Ga0207703_10254113
2883 Ga0207703_10393259
2884 Ga0207703_10404414
2885 Ga0207703_10760488
2886 Ga0207639_10006228
2887 Ga0207639_10058222
2888 Ga0207639_10062266
2889 Ga0207639_10132413
2890 Ga0207639_10456287
2891 Ga0207678_10004568
2892 Ga0207678_10015651
2893 Ga0207678_10076090
2894 Ga0207678_10083060
2895 Ga0207678_10095571
2896 Ga0207678_10313045
2897 Ga0207678_10473513
2898 Ga0207708_10016215
2899 Ga0207708_10059563
2900 Ga0207702_10012301
2901 Ga0207702_10018427
2902 Ga0207702_10067051
2903 Ga0207702_10473207
2904 Ga0207702_10782605
2905 Ga0207641_10021071
2906 Ga0207641_10204516
2907 Ga0207648_10000575
2908 Ga0207648_10179928
2909 Ga0207676_10006987
2910 Ga0207676_10011122
2911 Ga0207676_10263449
2912 Ga0207676_10551129
2913 Ga0207676_10797397
2914 Ga0207674_10002439
2915 Ga0207674_10008791
2916 Ga0207674_10053695
2917 Ga0207674_10088944
2918 Ga0207674_10097261
2919 Ga0207674_10109561
2920 Ga0207674_10239446
2921 Ga0207674_10632272
2922 Ga0207674_10678099
2923 Ga0207675_100002824
2924 Ga0207675_100184205
2925 Ga0207675_100185079
2926 Ga0207675_100843026
2927 Ga0207683_10093675
2928 Ga0207683_10107125
2929 Ga0207683_10159116
2930 Ga0207683_10484988
2931 Ga0207698_10002620
2932 Ga0207698_10083446
2933 Ga0207698_10178948
2934 Ga0207698_10435391
2935 Ga0207698_10536270
2936 Ga0209389_1000004
2937 Ga0209389_1000023
2938 Ga0209589_1000006
2939 Ga0209589_1000010
2940 Ga0209489_100007
2941 Ga0209489_100011
2942 Ga0209489_100777
2943 Ga0209700_100008
2944 Ga0209700_100013
2945 Ga0209179_1002360
2946 Ga0209998_10001529
2947 Ga0209813_10097234
2948 Ga0209974_10007886
2949 Ga0207428_10000033
2950 Ga0207428_10000094
2951 Ga0207428_10000736
2952 Ga0207428_10034078
2953 Ga0207428_10318688
2954 Ga0268266_10007855
2955 Ga0268266_10060020
2956 Ga0268266_10150629
2957 Ga0268266_10203391
2958 Ga0268266_10205402
2959 Ga0268266_10588732
2960 Ga0268266_10734807
2961 Ga0268266_10747995
2962 Ga0268265_10002253
2963 Ga0268265_10072751
2964 Ga0268265_10255958
2965 Ga0268264_10004708
2966 Ga0268264_10016894
2967 Ga0268264_10032913
2968 Ga0268264_10510910
2969 Ga0307517_10000102
2970 Ga0307511_10000269
2971 Ga0265332_10118070
2972 Ga0265328_10071118
2973 Ga0265340_10030010
2974 Ga0265339_10110557
2975 Ga0265316_10028234
2976 Ga0265316_10158346
2977 Ga0307509_10139585
2978 Ga0307408_100261023
2979 Ga0307508_10215758
2980 Ga0307516_10036663
2981 Ga0307405_10306430
2982 Ga0307413_10121182
2983 Ga0307410_10233390
2984 Ga0307407_10187867
2985 Ga0307412_10289483
2986 Ga0307412_10753256
2987 Ga0307409_100448725
2988 Ga0307409_100952146
2989 Ga0307411_10065049
2990 Ga0307411_10118477
2991 Ga0307411_10168777
2992 Ga0307415_100428961
2993 Ga0307415_100657546
2994 Ga0307510_10027691
2995 Ga0307510_10069562
2996 Ga0315911_1000010
2997 Ga0373950_0001102
2998 Ga0373958_0002389
2999 Ga0373938_0001160
3000 Ga0373926_0002880
3001 Ga0373928_0014131
3002 Ga0373934_0054354
3003 Ga0373934_0056776
3004 Ga0373940_0011418
3005 Ga0373944_0019486
3006 Ga0373949_0000927
3007 Ga0373951_0002101
3008 Ga0373951_0073904
3009 Ga0373923_0002326
3010 Ga0373923_0040341
3011 Ga0373932_0006222
3012 Ga0373932_0014847
3013 Ga0373932_0058549
3014 Ga0373936_0005468
3015 Ga0373936_0018584
3016 Ga0373936_0150221
3017 Ga0373939_0001513
3018 Ga0373939_0029562
3019 Ga0373939_0041635
3020 Ga0373941_0000449
3021 Ga0373941_0002582
3022 Ga0373941_0004659
3023 Ga0373941_0105772
3024 Ga0373945_0010695
3025 Ga0373953_0000420
3026 Ga0373953_0014626
3027 Ga0373953_0021876
3028 Ga0373953_0076725
3029 Ga0373953_0164912
3030 Ga0373954_0000663
3031 Ga0373954_0056577
3032 Ga0373954_0062480
3033 Ga0373956_0000275
3034 Ga0373956_0103162
3035 Ga0373957_0000426
3036 Ga0373957_0049589
3037 Ga0373957_0050517
3038 Ga0373957_0126366
3039 Ga0373957_0139518
3040 Ga0373957_0151219
3041 Ga0373960_0003445
3042 Ga0373960_0080636
3043 Ga0373943_0000424
3044 Ga0373943_0006136
3045 Ga0373943_0028636
3046 Ga0373943_0046732
3047 Ga0373943_0118531
3048 Ga0373946_0003275
3049 Ga0373946_0031028
3050 Ga0373955_0000510
3051 Ga0373955_0016347
3052 Ga0373955_0056665
3053 Ga0373942_0027753
3054 Ga0373962_0003492
3055 Ga0373924_0004208
3056 Ga0373924_0066506
3057 Ga0373931_0001672
3058 Ga0373931_0006356
3059 Ga0373931_0008479
3060 Ga0373931_0066158
3061 Ga0373931_0089514
3062 Ga0373931_0313329
3063 Ga0373931_0325217
3064 Ga0373935_0000229
3065 Ga0373935_0000882
3066 Ga0373935_0019969
3067 Ga0373935_0218091
3068 Ga0373935_0286870
3069 Ga0373927_0000071
3070 Ga0373927_0000414
3071 Ga0373927_0007062
3072 Ga0373927_0011507
3073 Ga0373927_0025829
3074 Ga0373927_0030092
3075 Ga0373927_0099124
3076 Ga0373927_0103253
3077 Ga0373927_0284219
3078 Ga0373927_0332372
3079 Ga0373927_0528331
3080 Ga0373933_0004204
3081 Ga0373933_0029183
3082 Ga0373933_0034112
3083 Ga0373933_0239607
3084 Ga0373933_0286839
3085 Ga0373947_0000275
3086 Ga0373947_0000540
3087 Ga0373947_0003876
3088 Ga0373947_0004993
3089 Ga0373947_0017419
3090 Ga0373947_0036936
3091 Ga0373947_0147132
3092 Ga0373947_0258951
3093 Ga0373937_0031431
3094 Ga0373937_0039136
3095 Ga0373937_0045462
3096 Ga0373937_0045643
3097 Ga0373937_0070190
3098 Ga0373937_0193491
3099 Ga0373937_0212345
3100 Ga0373937_0261930
3101 Ga0373937_0389320
3102 Ga0373925_0002725
3103 Ga0373925_0030853
3104 Ga0373925_0040457
3105 Ga0373925_0054967
3106 Ga0373925_0087640
3107 Ga0373925_0100456
3108 Ga0373925_0120831
3109 Ga0373925_0206794
3110 Ga0373925_0391554
3111 Ga0373925_0457061
3112 Ga0373925_0471153
3113 Ga0395899_0008599
3114 Ga0395899_0171700
3115 Ga0395900_0013738
3116 Ga0395900_0021345
3117 Ga0395900_0054470
3118 Ga0395900_0259612
3119 Ga0395900_0796875
3120 Ga0395898_0006919
3121 Ga0395898_0024139
3122 Ga0395898_0065456
3123 Ga0395898_0140754
3124 Ga0395905_0030266
3125 Ga0395905_0176477
3126 Ga0395905_0284582
3127 Ga0395905_0577770
3128 Ga0436364_0066511
3129 Ga0436364_0680312
3130 Ga0395901_0005295
3131 Ga0395901_0025268
3132 Ga0395901_0157594
3133 Ga0395901_0222005
3134 Ga0395901_0566758
3135 Ga0395901_0896520
3136 Ga0436365_0290905
3137 Ga0436365_0643464
3138 Ga0436365_0906128
3139 Ga0436365_1318098
3140 Ga0436365_1835535
3141 Ga0436365_1883031
3142 Ga0436360_0160052
3143 Ga0436360_0336915
3144 Ga0436360_0347139
3145 Ga0436360_0372244
3146 Ga0436360_0467044
3147 Ga0436361_0486257
3148 Ga0436361_0927272
3149 Ga0436361_1221223
3150 Ga0436363_1356934
3151 Ga0436363_1697326
3152 Ga0436362_0313826
3153 Ga0436362_0755152
3154 Ga0436362_0815359
3155 Ga0439465_0041847
3156 Ga0451793_0668962
3157 Ga0451795_0064442
3158 Ga0451800_0438865
3159 Ga0451835_1226713
3160 Ga0451847_0960825
3161 Ga0451577_0047462
3162 Ga0466969_0016988
3163 Ga0466972_0000193
3164 Ga0466972_0014447
3165 Ga0453683_0025310
3166 Ga0466965_0176727
3167 Ga0466966_0000551
3168 Ga0466961_0000020
3169 Ga0466963_0014002
3170 Ga0466963_0119916
3171 Ga0466963_0231314
3172 Ga0453684_0024772
3173 Ga0466968_0009179
3174 Ga0466957_0076196
3175 Ga0466960_0039543
3176 Ga0466959_0037674
3177 Ga0451576_0030558
3178 Ga0451576_0034448
3179 Ga0451576_0054640
3180 Ga0451576_0076080
3181 Ga0451576_0274464
3182 Ga0466967_0002756
3183 Ga0466967_0014710
3184 Ga0466967_0070110
3185 Ga0466967_0100278
3186 Ga0495617_026442
3187 Ga0495592_0003051
3188 Ga0495592_0003383
3189 Ga0495592_0036322
3190 Ga0495592_0049426
3191 Ga0495592_0058136
3192 Ga0495592_0160159
3193 Ga0495603_0000035
3194 Ga0495603_0001059
3195 Ga0495603_0006718
3196 Ga0495603_0007225
3197 Ga0495603_0021313
3198 Ga0495603_0048434
3199 Ga0495603_0132535
3200 Ga0495603_0386525
3201 Ga0495590_0039422
3202 Ga0495590_0103306
3203 Ga0495590_0172169
3204 Ga0495629_0000081
3205 Ga0495629_0000269
3206 Ga0495629_0000612
3207 Ga0495629_0011200
3208 Ga0495629_0058439
3209 Ga0495629_0090143
3210 Ga0495629_0129759
3211 Ga0495629_0312568
3212 Ga0495638_0004483
3213 Ga0495638_0105267
3214 Ga0495641_0005556
3215 Ga0495641_0008400
3216 Ga0495641_0019447
3217 Ga0495651_0005350
3218 Ga0495651_0009999
3219 Ga0495651_0030088
3220 Ga0495651_0031301
3221 Ga0495651_0031832
3222 Ga0495651_0113904
3223 Ga0495651_0148779
3224 Ga0495653_0000399
3225 Ga0495653_0036295
3226 Ga0495653_0057546
3227 Ga0495653_0070117
3228 Ga0495653_0153653
3229 Ga0495650_0036071
3230 Ga0495650_0064595
3231 Ga0495580_0000449
3232 Ga0495580_0005664
3233 Ga0495580_0058049
3234 Ga0495580_0058144
3235 Ga0495580_0100922
3236 Ga0495580_0405326
3237 Ga0495582_0000021
3238 Ga0495582_0024180
3239 Ga0495582_0030917
3240 Ga0495582_0258821
3241 Ga0495582_0354229
3242 Ga0495605_0144926
3243 Ga0495639_0000010
3244 Ga0495639_0009316
3245 Ga0495639_0162912
3246 Ga0495639_0196875
3247 Ga0495662_0000261
3248 Ga0495662_0008429
3249 Ga0495662_0016950
3250 Ga0495662_0025894
3251 Ga0495662_0034302
3252 Ga0495662_0088131
3253 Ga0495664_0000736
3254 Ga0495664_0004738
3255 Ga0495664_0007307
3256 Ga0495664_0007928
3257 Ga0495664_0028294
3258 Ga0495664_0092367
3259 Ga0495664_0238942
3260 Ga0495584_0025120
3261 Ga0495585_0001696
3262 Ga0495585_0189940
3263 Ga0495585_0278597
3264 Ga0495594_0000979
3265 Ga0495594_0021023
3266 Ga0495594_0292065
3267 Ga0495607_0014000
3268 Ga0495583_0138614
3269 Ga0495606_0001170
3270 Ga0495606_0146458
3271 Ga0495608_0001226
3272 Ga0495608_0016478
3273 Ga0495608_0021826
3274 Ga0495608_0031182
3275 Ga0495608_0034772
3276 Ga0495608_0069160
3277 Ga0495608_0089598
3278 Ga0495618_0014879
3279 Ga0495618_0014997
3280 Ga0495618_0026734
3281 Ga0495618_0059293
3282 Ga0495618_0078648
3283 Ga0495618_0293219
3284 Ga0495628_0009019
3285 Ga0495628_0012048
3286 Ga0495628_0029893
3287 Ga0495628_0069679
3288 Ga0495628_0106266
3289 Ga0495628_0435079
3290 Ga0495628_0533755
3291 Ga0495630_0002218
3292 Ga0495630_0021361
3293 Ga0495630_0280144
3294 Ga0495630_0283650
3295 Ga0495630_0464862
3296 Ga0495630_0619573
3297 Ga0495632_0166000
3298 Ga0495637_0067395
3299 Ga0495637_0099910
3300 Ga0495643_0006750
3301 Ga0495644_0003755
3302 Ga0495648_0212507
3303 Ga0495663_0032939
3304 Ga0495666_0031225
3305 Ga0495666_0108952
3306 Ga0495652_0006874
3307 Ga0495652_0008672
3308 Ga0495652_0019786
3309 Ga0495652_0079863
3310 Ga0495665_0002966
3311 Ga0495665_0009534
3312 Ga0495665_0024212
3313 Ga0495665_0031922
3314 Ga0495640_0002964
3315 Ga0495640_0013343
3316 Ga0495640_0018374
3317 Ga0495640_0027630
3318 Ga0495640_0032420
3319 Ga0495586_0001814
3320 Ga0495586_0034389
3321 Ga0495586_0248171
3322 Ga0495587_0001432
3323 Ga0495587_0006986
3324 Ga0495587_0015759
3325 Ga0495587_0022963
3326 Ga0495587_0034748
3327 Ga0495587_0059702
3328 Ga0495587_0202228
3329 Ga0495587_0347696
3330 Ga0495598_0085697
3331 Ga0495598_0108743
3332 Ga0495598_0122732
3333 Ga0495621_0082598
3334 Ga0495621_0102940
3335 Ga0495597_0067621
3336 Ga0495645_0001776
3337 Ga0495645_0001836
3338 Ga0495645_0002109
3339 Ga0495645_0008749
3340 Ga0495645_0019408
3341 Ga0495645_0148712
3342 Ga0495645_0466439
3343 Ga0495622_0008049
3344 Ga0495622_0010565
3345 Ga0495622_0127322
3346 Ga0495633_0056982
3347 Ga0495633_0118360
3348 Ga0495633_0262006
3349 Ga0495667_0001452
3350 Ga0495667_0008441
3351 Ga0495667_0020781
3352 Ga0495667_0021237
3353 Ga0495667_0023177
3354 Ga0495667_0042971
3355 Ga0495667_0044112
3356 Ga0495667_0206978
3357 Ga0495656_0004963
3358 Ga0495656_0012418
3359 Ga0495668_0025425
3360 Ga0495668_0081519
3361 Ga0495668_0196923
3362 Ga0495634_0000261
3363 Ga0495634_0006321
3364 Ga0495634_0011593
3365 Ga0495634_0017261
3366 Ga0495634_0039498
3367 Ga0495634_0072933
3368 Ga0495634_0096210
3369 Ga0495611_0004521
3370 Ga0495611_0054665
3371 Ga0495611_0163640
3372 Ga0495625_0049301
3373 Ga0495625_0256375
3374 Ga0495635_0000088
3375 Ga0495635_0000438
3376 Ga0495635_0001380
3377 Ga0495635_0003521
3378 Ga0495635_0006545
3379 Ga0495635_0017940
3380 Ga0495635_0049932
3381 Ga0495659_0001977
3382 Ga0495661_0054082
3383 Ga0495661_0176969
3384 Ga0495588_0019653
3385 Ga0495588_0051556
3386 Ga0495588_0088287
3387 Ga0495588_0213546
3388 Ga0495657_0008178
3389 Ga0495657_0010455
3390 Ga0495657_0012948
3391 Ga0495657_0041171
3392 Ga0495657_0061813
3393 Ga0495657_0242498
3394 Ga0495657_0319519
3395 Ga0495599_0001137
3396 Ga0495599_0010283
3397 Ga0495599_0035710
3398 Ga0495599_0082276
3399 Ga0495599_0231136
3400 Ga0495623_0006628
3401 Ga0495623_0010588
3402 Ga0495623_0012243
3403 Ga0495646_0002433
3404 Ga0495646_0022684
3405 Ga0495646_0026635
3406 Ga0495646_0048965
3407 Ga0495646_0057288
3408 Ga0495646_0088987
3409 Ga0495647_0003550
3410 Ga0495647_0054257
3411 Ga0495658_0000771
3412 Ga0495658_0000892
3413 Ga0495613_0027628
3414 Ga0495613_0040776
3415 Ga0495613_0045342
3416 Ga0495613_0053833
3417 Ga0495613_0100556
3418 Ga0495613_0111521
3419 Ga0495613_0181685
3420 Ga0495613_0273999
3421 Ga0495613_0508572
3422 Ga0495624_0000682
3423 Ga0495624_0001570
3424 Ga0495624_0099630
3425 Ga0495624_0115349
3426 Ga0495624_0120586
3427 Ga0495624_0217723
3428 Ga0495624_0222201
3429 Ga0495624_0236040
3430 Ga0495624_0368895
3431 Ga0495670_0011391
3432 Ga0495671_0078355
3433 Ga0495671_0320799
3434 Ga0495649_0119141
3435 Ga0495589_0033211
3436 Ga0495600_0000484
3437 Ga0495600_0010662
3438 Ga0495600_0018989
3439 Ga0495600_0023629
3440 Ga0495600_0041250
3441 Ga0495600_0072934
3442 Ga0495660_0150270
3443 Ga0495581_0000018
3444 Ga0495581_0012302
3445 Ga0495581_0025033
3446 Ga0495581_0077638
3447 Ga0495581_0114277
3448 Ga0495604_0002253
3449 Ga0495604_0005171
3450 Ga0495604_0007540
3451 Ga0495604_0027161
3452 Ga0495604_0048968
3453 Ga0495604_0052328
3454 Ga0495604_0159461
3455 Ga0495604_0223755
3456 Ga0495604_0532106
3457 Ga0495636_0177866
3458 Ga0495674_0000209
3459 Ga0495674_0001257
3460 Ga0495674_0006731
3461 Ga0495674_0021689
3462 Ga0495674_0024470
3463 Ga0495674_0074686
3464 Ga0495674_0120810
3465 Ga0495674_0237631
3466 Ga0495674_0708636
3467 Ga0495672_0039117
3468 Ga0495676_0033822
3469 Ga0495676_0067018
3470 Ga0495676_0086311
3471 Ga0495676_0104485
3472 Ga0495676_0153223
3473 Ga0495676_0244022
3474 Ga0495680_0004231
3475 Ga0495680_0006139
3476 Ga0495680_0013803
3477 Ga0495680_0024657
3478 Ga0495680_0046879
3479 Ga0495680_0064241
3480 Ga0495680_0123588
3481 Ga0495687_046397
3482 Ga0495675_0000977
3483 Ga0495675_0006091
3484 Ga0495675_0010571
3485 Ga0495675_0060191
3486 Ga0495675_0069346
3487 Ga0495677_0029191
3488 Ga0495679_029497
3489 Ga0495673_0051765
3490 Ga0495681_0038580
3491 Ga0495684_0001326
3492 Ga0495684_0001766
3493 Ga0495684_0003044
3494 Ga0495684_0003129
3495 Ga0495684_0049314
3496 Ga0495684_0052451
3497 Ga0495684_0052531
3498 Ga0495686_0224797
3499 Ga0495593_0000072
3500 Ga0495593_0000566
3501 Ga0495593_0002269
3502 Ga0495593_0015862
3503 Ga0495593_0185378
3504 Ga0495602_0001719
3505 Ga0495602_0004704
3506 Ga0495602_0024014
3507 Ga0495602_0087538
3508 Ga0495602_0430429
3509 Ga0495602_0649444
3510 Ga0495614_0036953
3511 Ga0495615_0014600
3512 Ga0496100_0005319
3513 Ga0496100_0153339
3514 Ga0496100_0226189
3515 Ga0496100_0274498
3516 Ga0496101_0001907
3517 Ga0496101_0057214
3518 Ga0496101_0094499
3519 Ga0496101_0292434
3520 Ga0496101_0315057
3521 Ga0496101_0329958
3522 Ga0496101_0378703
3523 Ga0496101_0430554
3524 Ga0496102_0010809
3525 Ga0496102_0017860
3526 Ga0496102_0019492
3527 Ga0496102_0324782
3528 Ga0496102_0611337
3529 Ga0496103_0001565
3530 Ga0496103_0047327
3531 Ga0496103_0080656
3532 Ga0496103_0112794
3533 Ga0496103_0237458
3534 Ga0496104_0002128
3535 Ga0496104_0049007
3536 Ga0496104_0083814
3537 Ga0496104_0106223
3538 Ga0496104_0178751
3539 Ga0496104_0264469
3540 Ga0496105_0022082
3541 Ga0496105_0219624
3542 Ga0496105_0321217
3543 Ga0496106_0019749
3544 Ga0496106_0020041
3545 Ga0496106_0217121
3546 Ga0496106_0251050
3547 Ga0496106_0452910
3548 Ga0496106_0507082
3549 Ga0496107_0001840
3550 Ga0496107_0057813
3551 Ga0496107_0086918
3552 Ga0496107_0304359
3553 Ga0496107_0328796
3554 Ga0496107_0423238
3555 Ga0496107_0551691
3556 Ga0496108_0052175
3557 Ga0496108_0134651
3558 Ga0496108_0207421
3559 Ga0496108_0470939
3560 Ga0496109_0000150
3561 Ga0496109_0016079
3562 Ga0496109_0027717
3563 Ga0496109_0052091
3564 Ga0496109_0052472
3565 Ga0496109_0056795
3566 Ga0496109_0521510
3567 Ga0496110_0028124
3568 Ga0496110_0053806
3569 Ga0496110_0123850
3570 Ga0496110_0640976
3571 Ga0496111_0016595
3572 Ga0496111_0024135
3573 Ga0496111_0143132
3574 Ga0496111_0149377
3575 Ga0496111_0163513
3576 Ga0496111_0181744
3577 Ga0496111_0290760
3578 Ga0496111_0401403
3579 Ga0496112_0000004
3580 Ga0496112_0017832
3581 Ga0496112_0019008
3582 Ga0496112_0020263
3583 Ga0496112_0044369
3584 Ga0496112_0079630
3585 Ga0496112_0213500
3586 Ga0496112_0256251
3587 Ga0496112_0259874
3588 Ga0496112_0294237
3589 Ga0496112_0748508
3590 Ga0496113_0035814
3591 Ga0496113_0054096
3592 Ga0496113_0148147
3593 Ga0496113_0259726
3594 Ga0496114_0008932
3595 Ga0496114_0025141
3596 Ga0496114_0028221
3597 Ga0496114_0029850
3598 Ga0496114_0650014
3599 Ga0496114_0859466
3600 Ga0496115_0001528
3601 Ga0496115_0014005
3602 Ga0496115_0024954
3603 Ga0496115_0394046
3604 Ga0496115_0521791
3605 Ga0496117_0148086
3606 Ga0496118_0056637
3607 Ga0496118_0271058
3608 Ga0496119_0051978
3609 Ga0496120_0009415
3610 Ga0496120_0104879
3611 Ga0496121_0109905
3612 Ga0496121_0141220
3613 Ga0496121_0170687
3614 Ga0496121_0188737
3615 Ga0496121_0212880
3616 Ga0496124_0016688
3617 Ga0496124_0453357
3618 Ga0496125_0150162
3619 Ga0496125_0160175
3620 Ga0496125_0350792
3621 Ga0496126_0057994
3622 Ga0496126_0180399
3623 Ga0496126_0199725
3624 Ga0496126_0367099
3625 Ga0495682_0064921
3626 Ga0501031_0043171
3627 Ga0501032_0051419
3628 Ga0501032_0340751
3629 Ga0501033_0149871
3630 Ga0501033_0179414
3631 Ga0501034_0000516
3632 Ga0501034_0001552
3633 Ga0501034_0003894
3634 Ga0501034_0050571
3635 Ga0501034_0078997
3636 Ga0501034_0586588
3637 Ga0501036_0001269
3638 Ga0501036_0020963
3639 Ga0501036_0043623
3640 Ga0501036_0047889
3641 Ga0501037_0003480
3642 Ga0501037_0045797
3643 Ga0501037_0093001
3644 Ga0501037_0346723
3645 Ga0501038_0028938
3646 Ga0501038_0041063
3647 Ga0501038_0073051
3648 Ga0501039_0021697
3649 Ga0501039_0094523
3650 Ga0501039_0562619
3651 Ga0501040_0007018
3652 Ga0501041_0016019
3653 Ga0501041_0116157
3654 Ga0501042_0148565
3655 Ga0501043_0000487
3656 Ga0501043_0029788
3657 Ga0501043_0030237
3658 Ga0501046_0087631
3659 Ga0501046_0205932
3660 Ga0501046_0259680
3661 Ga0501046_0281340
3662 Ga0501047_0000100
3663 Ga0501047_0028382
3664 Ga0501047_0083315
3665 Ga0501047_0085392
3666 Ga0501047_0212292
3667 Ga0501047_0304858
3668 Ga0501048_0000473
3669 Ga0501048_0033115
3670 Ga0501048_0035259
3671 Ga0501048_0181363
3672 Ga0501067_0115028
3673 Ga0501067_0178284
3674 Ga0501068_0010393
3675 Ga0501068_0011379
3676 Ga0501068_0252815
3677 Ga0501069_0066639
3678 Ga0501069_0207053
3679 Ga0501069_0287193
3680 Ga0501070_0011913
3681 Ga0501070_0025193
3682 Ga0501070_0029112
3683 Ga0501070_0075293
3684 Ga0501070_0076780
3685 Ga0501070_0542075
3686 Ga0501071_0011457
3687 Ga0501071_0166155
3688 Ga0501072_0011074
3689 Ga0501072_0085609
3690 Ga0501073_0132390
3691 Ga0501073_0220771
3692 Ga0501073_0330382
3693 Ga0501074_0022003
3694 Ga0501074_0039132
3695 Ga0501074_0093316
3696 Ga0501074_0184153
3697 Ga0501075_0173499
3698 Ga0501075_0177078
3699 Ga0501075_0215794
3700 Ga0501075_0397268
3701 Ga0501076_0005575
3702 Ga0501076_0082122
3703 Ga0501076_0159112
3704 Ga0501077_0046434
3705 Ga0501079_0063486
3706 Ga0501079_0075956
3707 Ga0501079_0143903
3708 Ga0501079_0173111
3709 Ga0501080_0000030
3710 Ga0501080_0015129
3711 Ga0501080_0092344
3712 Ga0501080_0163888
3713 Ga0501080_0164174
3714 Ga0501080_0476801
3715 Ga0501083_0010799
3716 Ga0501083_0053257
3717 Ga0501083_0097668
3718 Ga0501083_0168596
3719 Ga0501035_0031108
3720 Ga0501035_0091654
3721 Ga0501035_0233349
3722 Ga0501035_0299506
3723 Ga0501044_0004101
3724 Ga0501044_0068340
3725 Ga0501044_0103293
3726 Ga0501044_0127841
3727 Ga0501045_0005395
3728 Ga0501045_0285430
3729 Ga0501045_0290739
3730 nmdc:mga03683_2720_c1
3731 nmdc:mga03683_8320_c1
3732 nmdc:mga03683_86334_c1
3733 nmdc:mga03683_96266_c1
3734 nmdc:mga03n38_137830_c1
3735 nmdc:mga03n38_156905_c1
3736 nmdc:mga03n38_28451_c1
3737 nmdc:mga03n38_97492_c1
3738 nmdc:mga00v17_307382_c1
3739 nmdc:mga00v17_346397_c1
3740 nmdc:mga00v17_9842_c1
3741 nmdc:mga0yw44_227931_c1
3742 nmdc:mga0yw44_242352_c1
3743 nmdc:mga0yw44_39189_c1
3744 nmdc:mga0yw44_432270_c1
3745 nmdc:mga0yw44_6189_c1
3746 nmdc:mga0yw44_86569_c1
3747 nmdc:mga0yw44_98283_c1
3748 nmdc:mga0k408_10484_c1
3749 nmdc:mga0k408_160651_c1
3750 nmdc:mga0k408_212834_c1
3751 nmdc:mga06z11_112858_c1
3752 nmdc:mga06z11_131565_c1
3753 nmdc:mga06z11_41063_c1
3754 nmdc:mga06z11_45012_c1
3755 nmdc:mga06z11_9486_c1
3756 nmdc:mga07m45_122738_c1
3757 nmdc:mga07m45_14653_c2
3758 nmdc:mga07m45_259827_c1
3759 nmdc:mga07m45_296730_c1
3760 nmdc:mga07m45_355731_c1
3761 nmdc:mga07m45_43458_c1
3762 nmdc:mga07m45_46368_c1
3763 nmdc:mga05p37_135935_c1
3764 nmdc:mga05p37_13694_c1
3765 nmdc:mga05p37_26731_c1
3766 nmdc:mga05p37_33096_c1
3767 nmdc:mga05p37_719155_c1
3768 nmdc:mga05p37_7310_c1
3769 nmdc:mga05p37_76550_c1
3770 nmdc:mga09592_22873_c1
3771 nmdc:mga09592_42022_c1
3772 nmdc:mga09592_59060_c1
3773 nmdc:mga0qj67_15559_c1
3774 nmdc:mga0qj67_21501_c1
3775 nmdc:mga0qj67_4674_c1
3776 nmdc:mga06r32_4896_c1
3777 nmdc:mga06r32_8384_c1
3778 nmdc:mga08y16_12186_c1
3779 nmdc:mga08y16_170800_c1
3780 nmdc:mga08y16_22091_c1
3781 nmdc:mga08y16_243008_c1
3782 nmdc:mga08y16_47150_c1
3783 nmdc:mga08y16_518_c1
3784 nmdc:mga08y16_549471_c1
3785 nmdc:mga08y16_6788_c1
3786 nmdc:mga0n895_1010768_c1
3787 nmdc:mga0n895_102857_c1
3788 nmdc:mga0n895_121567_c1
3789 nmdc:mga0n895_180064_c1
3790 nmdc:mga0n895_2094_c1
3791 nmdc:mga0n895_22338_c1
3792 nmdc:mga0n895_24114_c1
3793 nmdc:mga0n895_255905_c1
3794 nmdc:mga0n895_27310_c1
3795 nmdc:mga0n895_338465_c1
3796 nmdc:mga0n895_43907_c1
3797 nmdc:mga0n895_460921_c1
3798 nmdc:mga0n895_513772_c1
3799 nmdc:mga0n895_77721_c1
3800 nmdc:mga0rr50_175981_c1
3801 nmdc:mga0rr50_260119_c1
3802 nmdc:mga0rr50_439470_c1
3803 nmdc:mga0rr50_540865_c1
3804 nmdc:mga0rr50_55745_c1
3805 nmdc:mga0rr50_5686_c1
3806 nmdc:mga0rr50_64444_c1
3807 nmdc:mga0rr50_74118_c1
3808 nmdc:mga08x19_102299_c1
3809 nmdc:mga08x19_16318_c1
3810 nmdc:mga0a205_10809_c1
3811 nmdc:mga0a205_13485_c1
3812 nmdc:mga0a205_14827_c1
3813 nmdc:mga0a205_156394_c1
3814 nmdc:mga0a205_218030_c1
3815 nmdc:mga0a205_278891_c1
3816 nmdc:mga0a205_32169_c1
3817 nmdc:mga0a205_401749_c1
3818 nmdc:mga0a205_42582_c1
3819 nmdc:mga0a205_439879_c1
3820 nmdc:mga0a205_830_c1
3821 nmdc:mga0sz30_156896_c1
3822 nmdc:mga0sz30_16015_c1
3823 nmdc:mga0sz30_445_c1
3824 Ga0495601_0001195
3825 Ga0495601_0001471
3826 Ga0495601_0017967
3827 Ga0495601_0051327
3828 Ga0495601_0144129
3829 Ga0495601_0380192
3830 Ga0495612_0000353
3831 Ga0495612_0008637
3832 Ga0495612_0009709
3833 Ga0495612_0012593
3834 Ga0495612_0191469
3835 Ga0500610_0189819
3836 Ga0500610_0207161
3837 Ga0500635_0033796
3838 Ga0495595_0000480
3839 Ga0495595_0010420
3840 Ga0495595_0018087
3841 Ga0495595_0018501
3842 Ga0495595_0029627
3843 Ga0495595_0036616
3844 Ga0495595_0088199
3845 Ga0495619_0000289
3846 Ga0495619_0000332
3847 Ga0495619_0001043
3848 Ga0495619_0009100
3849 Ga0495619_0010184
3850 Ga0495619_0028628
3851 Ga0495619_0166402
3852 Ga0495619_0206487
3853 Ga0495619_0219870
3854 Ga0495619_0299895
3855 Ga0495619_0303757
3856 Ga0495619_0315886
3857 Ga0500643_000018
3858 Ga0500651_0314768
3859 Ga0500566_0006255
3860 Ga0500641_0005072
3861 Ga0500641_0119136
3862 Ga0500556_0071241
3863 Ga0500557_000008
3864 Ga0500569_021584
3865 Ga0500595_000232
3866 Ga0500595_006829
3867 Ga0500595_031382
3868 Ga0500608_090211
3869 Ga0500642_0000067
3870 Ga0500642_0210912
3871 Ga0500655_030900
3872 Ga0500559_0014503
3873 Ga0500568_0002596
3874 Ga0500568_0040908
3875 Ga0500568_0042033
3876 Ga0500577_0163473
3877 Ga0500603_005284
3878 Ga0500603_048434
3879 Ga0500604_0095341
3880 Ga0500604_0123838
3881 Ga0500616_0002167
3882 Ga0500620_043958
3883 Ga0500622_0006295
3884 Ga0500638_005675
3885 Ga0500639_206626
3886 Ga0500636_0000847
3887 Ga0500637_0000260
3888 Ga0500637_0000405
3889 Ga0500649_094163
3890 Ga0500625_012504
3891 Ga0500645_026262
3892 Ga0500645_031912
3893 Ga0500599_000323
3894 Ga0500601_000062
3895 Ga0501084_0002367
3896 Ga0501084_0197701
3897 Ga0501084_0214409
3898 Ga0500661_000357
3899 Ga0501082_0041592
3900 Ga0466962_0261961
3901 Ga0530510_0002069
3902 Ga0530510_0291292
3903 2507510892
3904 2508544705
3905 2508697067
3906 2511394421
3907 2513629156
3908 2513637597
3909 2513649553
3910 2513654906
3911 2513697329
3912 2513700057
3913 2513719256
3914 2513861296
3915 2513874543
3916 2513891331
3917 2513916071
3918 2514015555
3919 2515625564
3920 2517100471
3921 2517894626
3922 2524437332
3923 2524534357
3924 2528853218
3925 2617350649
3926 2617377940
3927 2671119053
3928 2723843177
3929 2728747713
3930 2745076807
3931 2793065175
3932 2793072306
3933 2793083114
3934 2805916538
3935 2818238023
3936 2824606125
3937 2824616047
3938 2824618973
3939 2824627507
3940 2824638832
3941 2824649011
3942 2824657345
3943 2824663086
3944 2824676953
3945 2824682052
3946 2824693642
3947 2824698723
3948 2824706497
3949 2824716477
3950 2824726423
3951 2824737952
3952 2824753004
3953 2824756955
3954 2824769751
3955 2838127781
3956 2841943074
3957 2841956095
3958 2841960333
3959 2841968284
3960 2841970328
3961 2841976502
3962 2841987878
3963 2842042823
3964 2842050864
3965 2844317039
3966 2847938455
3967 2847944347
3968 2849081410
3969 2857512072
3970 2874597617
3971 2874612487
3972 2874618412
3973 2874623542
3974 2874630521
3975 2874649181
3976 2876767783
3977 2876774910
3978 2876810636
3979 2876822338
3980 2879077998
3981 2879088694
3982 2879103945
3983 2879117931
3984 2879132451
3985 2879145250
3986 2881370569
3987 2881667334
3988 2885367041
3989 2885378084
3990 2885416537
3991 2888381660
3992 2888388973
3993 2888422050
3994 2889033516
3995 2903735005
3996 2903754861
3997 2904667654
3998 2904697036
3999 2904705653
4000 2904719081
4001 2906604122
4002 2906611360
4003 2906633019
4004 2906643464
4005 2906648246
4006 2906661312
4007 2908744942
4008 2908762695
4009 2908782010
4010 2922362693
4011 2922371330
4012 2922390322
4013 2922393766
4014 2922428014
4015 2929619708
4016 2929627821
4017 2932786040
4018 2932798193
4019 2932803986
4020 2932817012
4021 2932822497
4022 2932831084
4023 2933581627
4024 2935612890
4025 2935624129
4026 2935632061
4027 2935640225
4028 2935655015
4029 2935663895
4030 2935666937
4031 2935680424
4032 2935690068
4033 2935699850
4034 2935704692
4035 2935722220
4036 2935731529
4037 2935735383
4038 2935745346
4039 2935755079
4040 2935762407
4041 2935775442
4042 2935780344
4043 2935790691
4044 2935799126
4045 2935803905
4046 2935811823
4047 2935824378
4048 2935829708
4049 2935842960
4050 2935852477
4051 2935862371
4052 2935870506
4053 2935881088
4054 2935884208
4055 2935912368
4056 2935923958
4057 2935929397
4058 2935936028
4059 2935949928
4060 2935957306
4061 2935962175
4062 2935968337
4063 2935976523
4064 2935988031
4065 2935993585
4066 2936004481
4067 2936018036
4068 2936026554
4069 2936035297
4070 2936038406
4071 2936053431
4072 2936059412
4073 2940561641
4074 2941508009
4075 2941515486
4076 2941523939
4077 2941533820
4078 2941544184
4079 3005477713
4080 3005485386
4081 3005507242
4082 3005594602
4083 3005596681
4084 3005712749
4085 8006933140
4086 8006933500
4087 8006971306
4088 8006983173
4089 8006989256
4090 8006997731
4091 8016516297
4092 8016523692
4093 8016541474
4094 8016551781
4095 8016560168
4096 8016566866
4097 8016579598
4098 8016589270
4099 8016598085
4100 8016604225
4101 8016620808
4102 8016629181
4103 8016633707
4104 8017060237
4105 8019536904
4106 8019542627
4107 8019559416
4108 8019579759
4109 8019587469
4110 8019603873
4111 8019614665
4112 8019636906
4113 8019642702
4114 8019649883
4115 8019664725
4116 8019674311
4117 8055749036
4118 8056674772
4119 8056695058
4120 8056969885

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

181

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9525 2 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9446 2 234
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9302 2 221
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9191 2 221
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9136 2 221
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.979 1 234 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9708 1 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 1 233 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9448 2 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 1 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q3SXW4-F1-model_v4 ABC transporter ATP-binding protein 0.9891 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1V4MHS7-F1-model_v4 ABC transporter ATP-binding protein 0.9851 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2N9MLZ7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.9832 2 234 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A2E7F6C8-F1-model_v4 ABC transporter ATP-binding protein 0.9818 1 233 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A417Z7G5-F1-model_v4 ABC transporter ATP-binding protein 0.981 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map