F496331
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2060 | 765 | 4120 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0115469|Ga0373934_0115469_291_1049 |
| Length | 252 |
| Sequence | MRRKPQRRKRVVEGRSARMLELRSVDAGYGTFQALFGVSLEVKAGEAVGVIGPNGAGKTTLMRVISGLIRPRAGTISMEGVDVLKTPEHRIVSLGIAHVPENRRLFPRLTVEDNLKMGAFMPEARARFAERLAFVFDLFPRMKERRHQMAGTMSGGEQQMCAIGRALMSDPKLLLLDEPSAGLAPVIVQQVFELVKRIRANGLTVLIVEQNVQQVLRVVDRAYLLEAGTIRASGKSSEMLADDQIRQAYLGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 130 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 131 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 132 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 133 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 167 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 168 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 169 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 170 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 252 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 253 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 260 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 264 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 265 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 267 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 272 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 280 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 283 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 284 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 286 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 287 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 288 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 291 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 297 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 301 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 302 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 303 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 305 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 309 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 318 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 319 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 320 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 321 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 327 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 328 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 329 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 333 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 334 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 335 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 336 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 337 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 338 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 339 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 340 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 341 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 342 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 343 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 344 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 345 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 346 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 347 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 439 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 440 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 441 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 442 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 443 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 444 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 447 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 448 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 449 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 450 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 451 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 455 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 460 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 496 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 498 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 499 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 500 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 510 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 514 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 517 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 518 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 520 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 522 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 523 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 524 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 525 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 530 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 531 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 532 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 534 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 535 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 536 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 539 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 541 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 543 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 544 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 546 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 548 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 549 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 550 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 551 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 552 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 553 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 554 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 555 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 556 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 557 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 558 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 559 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 560 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 561 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 562 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 563 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 564 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 565 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 566 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 567 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 568 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 569 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 570 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 571 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 572 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 573 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 574 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 575 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 576 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 577 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 578 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 579 | 2791355199 | |||
| 580 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 581 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 582 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 583 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 584 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 585 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 586 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 587 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 588 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 589 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 590 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 591 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 592 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 593 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 594 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 595 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 596 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 597 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 598 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 599 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 600 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 601 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 602 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 603 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 604 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 605 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 606 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 607 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 608 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 609 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 610 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 611 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 612 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 613 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 614 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 615 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 616 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 617 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 618 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 619 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 620 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 621 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 622 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 623 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 624 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 625 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 626 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 627 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 628 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 629 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 630 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 631 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 632 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 633 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 634 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 635 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 636 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 637 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 638 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 639 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 640 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 641 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 642 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 643 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 644 | 2904699407 | |||
| 645 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 646 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 647 | 2906610324 | |||
| 648 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 649 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 650 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 651 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 652 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 653 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 654 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 655 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 656 | 2922368715 | |||
| 657 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 658 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 659 | 2922425934 | |||
| 660 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 661 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 662 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 663 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 664 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 665 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 666 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 667 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 668 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 669 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 670 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 671 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 672 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 673 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 674 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 675 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 676 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 677 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 678 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 679 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 680 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 681 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 682 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 683 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 684 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 685 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 686 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 687 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 688 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 689 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 690 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 691 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 692 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 693 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 694 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 695 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 696 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 697 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 698 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 699 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 700 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 701 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 702 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 703 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 704 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 705 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 706 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 707 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 708 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 709 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 710 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 711 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 712 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 713 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 714 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 715 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 716 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 717 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 718 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 719 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 720 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 721 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 722 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 723 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 724 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 725 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 726 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 727 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 728 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 729 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 730 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 731 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 732 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 733 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 734 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 735 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 736 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 737 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 738 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 739 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 740 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 741 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 742 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 743 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 744 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 745 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 746 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 747 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 748 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 749 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 750 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 751 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 752 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 753 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 754 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 755 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 756 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 757 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 758 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 759 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 760 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 761 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 762 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 763 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 764 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 765 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.64 |
| Metatranscriptomes | 0 |
| Isolates | 10.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 8.5 |
| Rhizoplane | 4.71 |
| Rhizosphere | 74.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373934_0115469 | 3300035086 | Bacteria | 1091 |
| 2 | JGI24032J14994_101455 | 3300001430 | Bacteria | 986 |
| 3 | JGI24752J21851_1008532 | 3300001976 | Bacteria | 1337 |
| 4 | JGI24739J22299_10002831 | 3300001989 | Bacteria | 6664 |
| 5 | JGI24737J22298_10001577 | 3300001990 | Bacteria | 8110 |
| 6 | JGI24750J21931_1000865 | 3300002070 | Bacteria | 4151 |
| 7 | JGI24745J21846_1002353 | 3300002073 | Bacteria | 1925 |
| 8 | JGI24748J21848_1001206 | 3300002074 | Bacteria | 2823 |
| 9 | JGI24749J21850_1011129 | 3300002076 | Bacteria | 1262 |
| 10 | JGI24744J21845_10003221 | 3300002077 | Bacteria | 3347 |
| 11 | JGI24035J26624_1003600 | 3300002126 | Bacteria | 1461 |
| 12 | JGI24034J26672_10004016 | 3300002239 | Bacteria | 2073 |
| 13 | JGI24742J22300_10001206 | 3300002244 | Bacteria | 4038 |
| 14 | JGI24751J29686_10002679 | 3300002459 | Bacteria | 3584 |
| 15 | JGI25406J46586_10000021 | 3300003203 | Bacteria | 84514 |
| 16 | JGI25153J46596_10001764 | 3300003215 | Bacteria | 12825 |
| 17 | JGI25153J46596_10002778 | 3300003215 | Bacteria | 9952 |
| 18 | JGI25153J46596_10007736 | 3300003215 | Bacteria | 5231 |
| 19 | JGI25153J46596_10008618 | 3300003215 | Bacteria | 4853 |
| 20 | JGI25160J50197_1000533 | 3300003354 | Bacteria | 21926 |
| 21 | JGI25160J50197_1027443 | 3300003354 | Bacteria | 1549 |
| 22 | JGI25404J52841_10021647 | 3300003659 | Bacteria | 1391 |
| 23 | Ga0055539_1012039 | 3300003752 | Bacteria | 1064 |
| 24 | Ga0055542_1023720 | 3300003762 | Bacteria | 857 |
| 25 | Ga0055531_10010491 | 3300003794 | Bacteria | 4596 |
| 26 | JGI25405J52794_10004566 | 3300003911 | Bacteria | 2470 |
| 27 | JGI25405J52794_10060051 | 3300003911 | Bacteria | 821 |
| 28 | Ga0065165_1000437 | 3300005262 | Bacteria | 65503 |
| 29 | Ga0065165_1001951 | 3300005262 | Bacteria | 19574 |
| 30 | Ga0065165_1005934 | 3300005262 | Bacteria | 6618 |
| 31 | Ga0065712_10102380 | 3300005290 | Bacteria | 2007 |
| 32 | Ga0065715_10114787 | 3300005293 | Bacteria | 2434 |
| 33 | Ga0065715_10261091 | 3300005293 | Bacteria | 1138 |
| 34 | Ga0070658_10006285 | 3300005327 | Bacteria | 9622 |
| 35 | Ga0070658_10218087 | 3300005327 | Bacteria | 1613 |
| 36 | Ga0070676_10001629 | 3300005328 | Bacteria | 11410 |
| 37 | Ga0070676_10026881 | 3300005328 | Bacteria | 3259 |
| 38 | Ga0070676_10034437 | 3300005328 | Bacteria | 2908 |
| 39 | Ga0070683_100007819 | 3300005329 | Bacteria | 9055 |
| 40 | Ga0070683_100014236 | 3300005329 | Bacteria | 6953 |
| 41 | Ga0070683_100020043 | 3300005329 | Bacteria | 5947 |
| 42 | Ga0070683_100486229 | 3300005329 | Bacteria | 1179 |
| 43 | Ga0070690_100022028 | 3300005330 | Bacteria | 3896 |
| 44 | Ga0070690_100033117 | 3300005330 | Bacteria | 3232 |
| 45 | Ga0070690_100151901 | 3300005330 | Bacteria | 1581 |
| 46 | Ga0070690_100390243 | 3300005330 | Bacteria | 1020 |
| 47 | Ga0070670_100112665 | 3300005331 | Bacteria | 2345 |
| 48 | Ga0070677_10000481 | 3300005333 | Bacteria | 13662 |
| 49 | Ga0068869_100000216 | 3300005334 | Bacteria | 29999 |
| 50 | Ga0068869_100087109 | 3300005334 | Bacteria | 2342 |
| 51 | Ga0070666_10005440 | 3300005335 | Bacteria | 7806 |
| 52 | Ga0070666_10023836 | 3300005335 | Bacteria | 3984 |
| 53 | Ga0070666_10287891 | 3300005335 | Bacteria | 1169 |
| 54 | Ga0070680_100002486 | 3300005336 | Bacteria | 13654 |
| 55 | Ga0070680_100006251 | 3300005336 | Bacteria | 9034 |
| 56 | Ga0070680_100032424 | 3300005336 | Bacteria | 4205 |
| 57 | Ga0070680_100070553 | 3300005336 | Bacteria | 2869 |
| 58 | Ga0070680_100194678 | 3300005336 | Bacteria | 1709 |
| 59 | Ga0070680_100575707 | 3300005336 | Bacteria | 966 |
| 60 | Ga0070682_100000853 | 3300005337 | Bacteria | 17853 |
| 61 | Ga0070682_100022761 | 3300005337 | Bacteria | 3715 |
| 62 | Ga0070682_100221253 | 3300005337 | Bacteria | 1348 |
| 63 | Ga0070682_100468508 | 3300005337 | Bacteria | 969 |
| 64 | Ga0068868_100000474 | 3300005338 | Bacteria | 26674 |
| 65 | Ga0068868_100071341 | 3300005338 | Bacteria | 2770 |
| 66 | Ga0068868_100250174 | 3300005338 | Bacteria | 1491 |
| 67 | Ga0070660_100001322 | 3300005339 | Bacteria | 16832 |
| 68 | Ga0070660_100009076 | 3300005339 | Bacteria | 6981 |
| 69 | Ga0070660_100051630 | 3300005339 | Bacteria | 3167 |
| 70 | Ga0070689_100000240 | 3300005340 | Bacteria | 32170 |
| 71 | Ga0070689_100223665 | 3300005340 | Bacteria | 1545 |
| 72 | Ga0070689_100490729 | 3300005340 | Bacteria | 1051 |
| 73 | Ga0070691_10020949 | 3300005341 | Bacteria | 3023 |
| 74 | Ga0070691_10189075 | 3300005341 | Bacteria | 1076 |
| 75 | Ga0070687_100000302 | 3300005343 | Bacteria | 16674 |
| 76 | Ga0070661_100003117 | 3300005344 | Bacteria | 11411 |
| 77 | Ga0070661_100068426 | 3300005344 | Bacteria | 2609 |
| 78 | Ga0070661_100131740 | 3300005344 | Bacteria | 1878 |
| 79 | Ga0070661_100156278 | 3300005344 | Bacteria | 1726 |
| 80 | Ga0070692_10027705 | 3300005345 | Bacteria | 2811 |
| 81 | Ga0070668_100003449 | 3300005347 | Bacteria | 11674 |
| 82 | Ga0070668_100076646 | 3300005347 | Bacteria | 2612 |
| 83 | Ga0070668_100103710 | 3300005347 | Bacteria | 2256 |
| 84 | Ga0070668_100272139 | 3300005347 | Bacteria | 1412 |
| 85 | Ga0070669_100009578 | 3300005353 | Bacteria | 6899 |
| 86 | Ga0070669_100302641 | 3300005353 | Bacteria | 1286 |
| 87 | Ga0070675_100001762 | 3300005354 | Bacteria | 15958 |
| 88 | Ga0070675_100125583 | 3300005354 | Bacteria | 2182 |
| 89 | Ga0070675_100208241 | 3300005354 | Bacteria | 1699 |
| 90 | Ga0070675_100651086 | 3300005354 | Bacteria | 957 |
| 91 | Ga0070675_100750101 | 3300005354 | Bacteria | 891 |
| 92 | Ga0070671_100002861 | 3300005355 | Bacteria | 13424 |
| 93 | Ga0070671_100117771 | 3300005355 | Bacteria | 2233 |
| 94 | Ga0070671_100499273 | 3300005355 | Bacteria | 1047 |
| 95 | Ga0070671_100519094 | 3300005355 | Bacteria | 1026 |
| 96 | Ga0070674_100002865 | 3300005356 | Bacteria | 9536 |
| 97 | Ga0070674_100625549 | 3300005356 | Bacteria | 912 |
| 98 | Ga0070673_100001019 | 3300005364 | Bacteria | 15855 |
| 99 | Ga0070673_100034773 | 3300005364 | Bacteria | 3816 |
| 100 | Ga0070673_100227232 | 3300005364 | Bacteria | 1618 |
| 101 | Ga0070673_100318795 | 3300005364 | Bacteria | 1373 |
| 102 | Ga0070688_100010793 | 3300005365 | Bacteria | 5049 |
| 103 | Ga0070688_100022950 | 3300005365 | Bacteria | 3663 |
| 104 | Ga0070659_100005117 | 3300005366 | Bacteria | 9406 |
| 105 | Ga0070659_100131998 | 3300005366 | Bacteria | 2029 |
| 106 | Ga0070659_100342439 | 3300005366 | Bacteria | 1253 |
| 107 | Ga0070659_100393710 | 3300005366 | Bacteria | 1168 |
| 108 | Ga0070667_100001650 | 3300005367 | Bacteria | 19960 |
| 109 | Ga0070667_100053374 | 3300005367 | Bacteria | 3411 |
| 110 | Ga0070667_100068279 | 3300005367 | Bacteria | 3024 |
| 111 | Ga0070667_100547268 | 3300005367 | Bacteria | 1064 |
| 112 | Ga0070703_10002778 | 3300005406 | Bacteria | 5016 |
| 113 | Ga0070709_10001960 | 3300005434 | Bacteria | 11217 |
| 114 | Ga0070709_10002079 | 3300005434 | Bacteria | 10849 |
| 115 | Ga0070709_10008334 | 3300005434 | Bacteria | 5691 |
| 116 | Ga0070709_10017458 | 3300005434 | Bacteria | 4117 |
| 117 | Ga0070709_10030167 | 3300005434 | Bacteria | 3251 |
| 118 | Ga0070709_10166061 | 3300005434 | Bacteria | 1539 |
| 119 | Ga0070709_10173191 | 3300005434 | Bacteria | 1510 |
| 120 | Ga0070709_10461647 | 3300005434 | Bacteria | 958 |
| 121 | Ga0070714_100003380 | 3300005435 | Bacteria | 11890 |
| 122 | Ga0070714_100004982 | 3300005435 | Bacteria | 10093 |
| 123 | Ga0070714_100050541 | 3300005435 | Bacteria | 3542 |
| 124 | Ga0070714_100054993 | 3300005435 | Bacteria | 3402 |
| 125 | Ga0070714_100287789 | 3300005435 | Bacteria | 1528 |
| 126 | Ga0070714_100320733 | 3300005435 | Bacteria | 1449 |
| 127 | Ga0070713_100005503 | 3300005436 | Bacteria | 8672 |
| 128 | Ga0070713_100035581 | 3300005436 | Bacteria | 4010 |
| 129 | Ga0070713_100035837 | 3300005436 | Bacteria | 3998 |
| 130 | Ga0070713_100175737 | 3300005436 | Bacteria | 1921 |
| 131 | Ga0070713_100196071 | 3300005436 | Bacteria | 1822 |
| 132 | Ga0070713_100957551 | 3300005436 | Bacteria | 825 |
| 133 | Ga0070710_10005443 | 3300005437 | Bacteria | 6048 |
| 134 | Ga0070701_10000281 | 3300005438 | Bacteria | 16629 |
| 135 | Ga0070711_100003146 | 3300005439 | Bacteria | 9574 |
| 136 | Ga0070711_100022144 | 3300005439 | Bacteria | 4115 |
| 137 | Ga0070711_100039401 | 3300005439 | Bacteria | 3183 |
| 138 | Ga0070711_100046760 | 3300005439 | Bacteria | 2950 |
| 139 | Ga0070711_100454980 | 3300005439 | Bacteria | 1048 |
| 140 | Ga0070705_100001659 | 3300005440 | Bacteria | 11660 |
| 141 | Ga0070705_100025036 | 3300005440 | Bacteria | 3230 |
| 142 | Ga0070700_100001804 | 3300005441 | Bacteria | 10802 |
| 143 | Ga0070700_100041536 | 3300005441 | Bacteria | 2820 |
| 144 | Ga0070700_100216528 | 3300005441 | Bacteria | 1354 |
| 145 | Ga0070700_100498094 | 3300005441 | Bacteria | 936 |
| 146 | Ga0070694_100000576 | 3300005444 | Bacteria | 20334 |
| 147 | Ga0070694_100267427 | 3300005444 | Bacteria | 1299 |
| 148 | Ga0070694_100326738 | 3300005444 | Bacteria | 1182 |
| 149 | Ga0070708_100006158 | 3300005445 | Bacteria | 9543 |
| 150 | Ga0070708_100021331 | 3300005445 | Bacteria | 5476 |
| 151 | Ga0070708_100028554 | 3300005445 | Bacteria | 4802 |
| 152 | Ga0070708_100070172 | 3300005445 | Bacteria | 3151 |
| 153 | Ga0070708_100085640 | 3300005445 | Bacteria | 2861 |
| 154 | Ga0070708_100510048 | 3300005445 | Bacteria | 1134 |
| 155 | Ga0070663_100003664 | 3300005455 | Bacteria | 8901 |
| 156 | Ga0070663_100070816 | 3300005455 | Bacteria | 2536 |
| 157 | Ga0070663_100080851 | 3300005455 | Bacteria | 2387 |
| 158 | Ga0070663_100434989 | 3300005455 | Bacteria | 1078 |
| 159 | Ga0070663_100651899 | 3300005455 | Bacteria | 890 |
| 160 | Ga0070678_100006300 | 3300005456 | Bacteria | 6953 |
| 161 | Ga0070678_100456821 | 3300005456 | Bacteria | 1120 |
| 162 | Ga0070678_100659165 | 3300005456 | Bacteria | 939 |
| 163 | Ga0070662_100194302 | 3300005457 | Bacteria | 1607 |
| 164 | Ga0070681_10010247 | 3300005458 | Bacteria | 9248 |
| 165 | Ga0070681_10020913 | 3300005458 | Bacteria | 6554 |
| 166 | Ga0070681_10150329 | 3300005458 | Bacteria | 2255 |
| 167 | Ga0070681_10150518 | 3300005458 | Bacteria | 2254 |
| 168 | Ga0070681_10167923 | 3300005458 | Bacteria | 2116 |
| 169 | Ga0070681_10191007 | 3300005458 | Bacteria | 1967 |
| 170 | Ga0068867_100002151 | 3300005459 | Bacteria | 13821 |
| 171 | Ga0068867_100064551 | 3300005459 | Bacteria | 2723 |
| 172 | Ga0068867_100198087 | 3300005459 | Bacteria | 1606 |
| 173 | Ga0070685_10049333 | 3300005466 | Bacteria | 2428 |
| 174 | Ga0070706_100084513 | 3300005467 | Bacteria | 2940 |
| 175 | Ga0070706_100107179 | 3300005467 | Bacteria | 2599 |
| 176 | Ga0070706_100238540 | 3300005467 | Bacteria | 1698 |
| 177 | Ga0070706_100261696 | 3300005467 | Bacteria | 1615 |
| 178 | Ga0070706_100609066 | 3300005467 | Bacteria | 1015 |
| 179 | Ga0070706_100722283 | 3300005467 | Bacteria | 923 |
| 180 | Ga0070707_100018938 | 3300005468 | Bacteria | 6483 |
| 181 | Ga0070707_100040622 | 3300005468 | Bacteria | 4451 |
| 182 | Ga0070707_100082900 | 3300005468 | Bacteria | 3097 |
| 183 | Ga0070707_100290348 | 3300005468 | Bacteria | 1589 |
| 184 | Ga0070707_100415591 | 3300005468 | Bacteria | 1305 |
| 185 | Ga0070698_100001171 | 3300005471 | Bacteria | 29108 |
| 186 | Ga0070698_100005791 | 3300005471 | Bacteria | 13518 |
| 187 | Ga0070698_100170211 | 3300005471 | Bacteria | 2120 |
| 188 | Ga0070698_100182392 | 3300005471 | Bacteria | 2037 |
| 189 | Ga0070698_100189075 | 3300005471 | Bacteria | 1997 |
| 190 | Ga0070698_100340811 | 3300005471 | Bacteria | 1430 |
| 191 | Ga0070698_100420205 | 3300005471 | Bacteria | 1271 |
| 192 | Ga0070698_100690413 | 3300005471 | Bacteria | 962 |
| 193 | Ga0070698_100699625 | 3300005471 | Bacteria | 955 |
| 194 | Ga0070699_100006362 | 3300005518 | Bacteria | 10297 |
| 195 | Ga0070699_100006895 | 3300005518 | Bacteria | 9881 |
| 196 | Ga0070699_100022064 | 3300005518 | Bacteria | 5484 |
| 197 | Ga0070699_100162407 | 3300005518 | Bacteria | 1977 |
| 198 | Ga0070699_100299951 | 3300005518 | Bacteria | 1441 |
| 199 | Ga0070679_100003426 | 3300005530 | Bacteria | 14521 |
| 200 | Ga0070679_100005687 | 3300005530 | Bacteria | 11562 |
| 201 | Ga0070679_100027474 | 3300005530 | Bacteria | 5601 |
| 202 | Ga0070679_100215944 | 3300005530 | Bacteria | 1880 |
| 203 | Ga0070679_100239003 | 3300005530 | Bacteria | 1774 |
| 204 | Ga0070679_100326452 | 3300005530 | Bacteria | 1483 |
| 205 | Ga0070679_100358734 | 3300005530 | Bacteria | 1405 |
| 206 | Ga0070679_100379825 | 3300005530 | Bacteria | 1360 |
| 207 | Ga0070684_100011854 | 3300005535 | Bacteria | 6960 |
| 208 | Ga0070684_100012047 | 3300005535 | Bacteria | 6912 |
| 209 | Ga0070684_100033680 | 3300005535 | Bacteria | 4376 |
| 210 | Ga0070684_100086741 | 3300005535 | Bacteria | 2778 |
| 211 | Ga0070697_100019057 | 3300005536 | Bacteria | 5415 |
| 212 | Ga0070697_100023652 | 3300005536 | Bacteria | 4887 |
| 213 | Ga0070697_100191407 | 3300005536 | Bacteria | 1736 |
| 214 | Ga0070697_100302720 | 3300005536 | Bacteria | 1374 |
| 215 | Ga0070697_100444829 | 3300005536 | Bacteria | 1128 |
| 216 | Ga0068853_100004149 | 3300005539 | Bacteria | 11169 |
| 217 | Ga0068853_100007962 | 3300005539 | Bacteria | 8498 |
| 218 | Ga0068853_100084860 | 3300005539 | Bacteria | 2775 |
| 219 | Ga0068853_100266376 | 3300005539 | Bacteria | 1577 |
| 220 | Ga0068853_100498279 | 3300005539 | Bacteria | 1150 |
| 221 | Ga0068853_100518389 | 3300005539 | Bacteria | 1127 |
| 222 | Ga0068853_100602340 | 3300005539 | Bacteria | 1043 |
| 223 | Ga0068853_100731975 | 3300005539 | Bacteria | 945 |
| 224 | Ga0070672_100004101 | 3300005543 | Bacteria | 9511 |
| 225 | Ga0070672_100083906 | 3300005543 | Bacteria | 2558 |
| 226 | Ga0070672_100190388 | 3300005543 | Bacteria | 1713 |
| 227 | Ga0070672_100342323 | 3300005543 | Bacteria | 1274 |
| 228 | Ga0070672_100439458 | 3300005543 | Bacteria | 1122 |
| 229 | Ga0070686_100002850 | 3300005544 | Bacteria | 9524 |
| 230 | Ga0070686_100371033 | 3300005544 | Bacteria | 1081 |
| 231 | Ga0070695_100009940 | 3300005545 | Bacteria | 5671 |
| 232 | Ga0070696_100006975 | 3300005546 | Bacteria | 7539 |
| 233 | Ga0070696_100220734 | 3300005546 | Bacteria | 1422 |
| 234 | Ga0070696_100284480 | 3300005546 | Bacteria | 1262 |
| 235 | Ga0070693_100002142 | 3300005547 | Bacteria | 9050 |
| 236 | Ga0070693_100043501 | 3300005547 | Bacteria | 2536 |
| 237 | Ga0070693_100091281 | 3300005547 | Bacteria | 1836 |
| 238 | Ga0070665_100003622 | 3300005548 | Bacteria | 16361 |
| 239 | Ga0070665_100051658 | 3300005548 | Bacteria | 4122 |
| 240 | Ga0070665_100146230 | 3300005548 | Bacteria | 2366 |
| 241 | Ga0070665_100162015 | 3300005548 | Bacteria | 2238 |
| 242 | Ga0070665_100167853 | 3300005548 | Bacteria | 2196 |
| 243 | Ga0070665_100359247 | 3300005548 | Bacteria | 1462 |
| 244 | Ga0070665_100492077 | 3300005548 | Bacteria | 1237 |
| 245 | Ga0070665_100909538 | 3300005548 | Bacteria | 893 |
| 246 | Ga0070704_100000444 | 3300005549 | Bacteria | 19453 |
| 247 | Ga0070704_100077242 | 3300005549 | Bacteria | 2438 |
| 248 | Ga0070704_100088629 | 3300005549 | Bacteria | 2299 |
| 249 | Ga0068855_100035351 | 3300005563 | Bacteria | 5952 |
| 250 | Ga0068855_100038019 | 3300005563 | Bacteria | 5721 |
| 251 | Ga0068855_100073196 | 3300005563 | Bacteria | 3981 |
| 252 | Ga0068855_100084816 | 3300005563 | Bacteria | 3666 |
| 253 | Ga0068855_100131307 | 3300005563 | Bacteria | 2860 |
| 254 | Ga0068855_100224204 | 3300005563 | Bacteria | 2107 |
| 255 | Ga0068855_100238994 | 3300005563 | Bacteria | 2030 |
| 256 | Ga0068855_100262674 | 3300005563 | Bacteria | 1923 |
| 257 | Ga0068855_100389982 | 3300005563 | Bacteria | 1528 |
| 258 | Ga0068855_100424422 | 3300005563 | Bacteria | 1454 |
| 259 | Ga0068855_100607661 | 3300005563 | Bacteria | 1178 |
| 260 | Ga0070664_100012305 | 3300005564 | Bacteria | 6953 |
| 261 | Ga0070664_100193984 | 3300005564 | Bacteria | 1810 |
| 262 | Ga0070664_100204358 | 3300005564 | Bacteria | 1764 |
| 263 | Ga0070664_100232809 | 3300005564 | Bacteria | 1651 |
| 264 | Ga0070664_100653392 | 3300005564 | Bacteria | 977 |
| 265 | Ga0068857_100004239 | 3300005577 | Bacteria | 12087 |
| 266 | Ga0068857_100020977 | 3300005577 | Bacteria | 5748 |
| 267 | Ga0068857_100070627 | 3300005577 | Bacteria | 3111 |
| 268 | Ga0068857_100168502 | 3300005577 | Bacteria | 1990 |
| 269 | Ga0068857_100248392 | 3300005577 | Bacteria | 1630 |
| 270 | Ga0068857_100371190 | 3300005577 | Bacteria | 1327 |
| 271 | Ga0068854_100005104 | 3300005578 | Bacteria | 8270 |
| 272 | Ga0068854_100137220 | 3300005578 | Bacteria | 1873 |
| 273 | Ga0068856_100038973 | 3300005614 | Bacteria | 4666 |
| 274 | Ga0068856_100059548 | 3300005614 | Bacteria | 3772 |
| 275 | Ga0068856_100219306 | 3300005614 | Bacteria | 1917 |
| 276 | Ga0068856_100242268 | 3300005614 | Bacteria | 1818 |
| 277 | Ga0068856_100683695 | 3300005614 | Bacteria | 1047 |
| 278 | Ga0068856_100815379 | 3300005614 | Bacteria | 953 |
| 279 | Ga0070702_100001491 | 3300005615 | Bacteria | 9621 |
| 280 | Ga0070702_100115063 | 3300005615 | Bacteria | 1674 |
| 281 | Ga0068852_100000932 | 3300005616 | Bacteria | 19310 |
| 282 | Ga0068852_100193681 | 3300005616 | Bacteria | 1920 |
| 283 | Ga0068852_100327950 | 3300005616 | Bacteria | 1488 |
| 284 | Ga0068852_100347483 | 3300005616 | Bacteria | 1447 |
| 285 | Ga0068859_100002825 | 3300005617 | Bacteria | 17604 |
| 286 | Ga0068859_100055931 | 3300005617 | Bacteria | 3970 |
| 287 | Ga0068859_100108703 | 3300005617 | Bacteria | 2834 |
| 288 | Ga0068864_100002030 | 3300005618 | Bacteria | 16706 |
| 289 | Ga0068864_100035218 | 3300005618 | Bacteria | 4261 |
| 290 | Ga0068864_100092544 | 3300005618 | Bacteria | 2669 |
| 291 | Ga0068864_100504424 | 3300005618 | Bacteria | 1164 |
| 292 | Ga0068866_10000638 | 3300005718 | Bacteria | 15871 |
| 293 | Ga0068866_10118537 | 3300005718 | Bacteria | 1488 |
| 294 | Ga0068866_10249854 | 3300005718 | Bacteria | 1084 |
| 295 | Ga0068861_100004452 | 3300005719 | Bacteria | 9406 |
| 296 | Ga0068851_10040747 | 3300005834 | Bacteria | 2335 |
| 297 | Ga0068851_10099516 | 3300005834 | Bacteria | 1541 |
| 298 | Ga0068870_10000048 | 3300005840 | Bacteria | 37476 |
| 299 | Ga0068863_100001975 | 3300005841 | Bacteria | 20397 |
| 300 | Ga0068863_100391832 | 3300005841 | Bacteria | 1357 |
| 301 | Ga0068858_100008206 | 3300005842 | Bacteria | 10040 |
| 302 | Ga0068858_100073450 | 3300005842 | Bacteria | 3174 |
| 303 | Ga0068860_100000933 | 3300005843 | Bacteria | 32339 |
| 304 | Ga0068860_100017528 | 3300005843 | Bacteria | 6977 |
| 305 | Ga0068860_100144851 | 3300005843 | Bacteria | 2285 |
| 306 | Ga0068860_100317585 | 3300005843 | Bacteria | 1528 |
| 307 | Ga0068860_100689963 | 3300005843 | Bacteria | 1030 |
| 308 | Ga0068862_100026562 | 3300005844 | Bacteria | 4867 |
| 309 | Ga0068862_100185846 | 3300005844 | Bacteria | 1867 |
| 310 | Ga0068862_100276122 | 3300005844 | Bacteria | 1538 |
| 311 | Ga0081455_10002021 | 3300005937 | Bacteria | 24257 |
| 312 | Ga0081455_10004363 | 3300005937 | Bacteria | 15926 |
| 313 | Ga0081455_10005161 | 3300005937 | Bacteria | 14378 |
| 314 | Ga0081455_10005318 | 3300005937 | Bacteria | 14137 |
| 315 | Ga0081455_10010563 | 3300005937 | Bacteria | 9350 |
| 316 | Ga0081455_10011965 | 3300005937 | Bacteria | 8685 |
| 317 | Ga0081455_10021579 | 3300005937 | Bacteria | 6037 |
| 318 | Ga0081455_10033400 | 3300005937 | Bacteria | 4624 |
| 319 | Ga0081455_10043525 | 3300005937 | Bacteria | 3926 |
| 320 | Ga0081455_10068940 | 3300005937 | Bacteria | 2942 |
| 321 | Ga0081455_10075291 | 3300005937 | Bacteria | 2785 |
| 322 | Ga0081538_10069563 | 3300005981 | Bacteria | 1949 |
| 323 | Ga0081540_1000280 | 3300005983 | Bacteria | 53060 |
| 324 | Ga0081540_1002252 | 3300005983 | Bacteria | 15882 |
| 325 | Ga0081540_1005512 | 3300005983 | Bacteria | 9439 |
| 326 | Ga0081540_1011141 | 3300005983 | Bacteria | 6035 |
| 327 | Ga0081540_1011980 | 3300005983 | Bacteria | 5748 |
| 328 | Ga0081540_1036034 | 3300005983 | Bacteria | 2644 |
| 329 | Ga0081540_1038641 | 3300005983 | Bacteria | 2514 |
| 330 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 331 | Ga0081539_10000486 | 3300005985 | Bacteria | 84009 |
| 332 | Ga0081539_10003351 | 3300005985 | Bacteria | 19892 |
| 333 | Ga0081539_10031311 | 3300005985 | Bacteria | 3282 |
| 334 | Ga0081539_10091328 | 3300005985 | Bacteria | 1573 |
| 335 | Ga0070717_10000150 | 3300006028 | Bacteria | 51802 |
| 336 | Ga0070717_10001555 | 3300006028 | Bacteria | 15906 |
| 337 | Ga0070717_10011942 | 3300006028 | Bacteria | 6610 |
| 338 | Ga0070717_10176264 | 3300006028 | Bacteria | 1862 |
| 339 | Ga0075365_10003263 | 3300006038 | Bacteria | 8312 |
| 340 | Ga0075365_10052047 | 3300006038 | Bacteria | 2707 |
| 341 | Ga0075365_10330084 | 3300006038 | Bacteria | 1074 |
| 342 | Ga0075365_10402045 | 3300006038 | Bacteria | 967 |
| 343 | Ga0075368_10003112 | 3300006042 | Bacteria | 5506 |
| 344 | Ga0075368_10107953 | 3300006042 | Bacteria | 1146 |
| 345 | Ga0075368_10199552 | 3300006042 | Bacteria | 846 |
| 346 | Ga0075363_100022684 | 3300006048 | Bacteria | 3175 |
| 347 | Ga0075363_100166830 | 3300006048 | Bacteria | 1249 |
| 348 | Ga0075364_10026988 | 3300006051 | Bacteria | 3666 |
| 349 | Ga0075364_10085514 | 3300006051 | Bacteria | 2089 |
| 350 | Ga0075364_10368366 | 3300006051 | Bacteria | 980 |
| 351 | Ga0075364_10402808 | 3300006051 | Bacteria | 934 |
| 352 | Ga0070715_10000321 | 3300006163 | Bacteria | 11851 |
| 353 | Ga0070715_10030468 | 3300006163 | Bacteria | 2182 |
| 354 | Ga0070715_10039547 | 3300006163 | Bacteria | 1965 |
| 355 | Ga0070715_10173242 | 3300006163 | Bacteria | 1076 |
| 356 | Ga0070716_100001200 | 3300006173 | Bacteria | 11402 |
| 357 | Ga0070716_100018951 | 3300006173 | Bacteria | 3591 |
| 358 | Ga0070716_100105020 | 3300006173 | Bacteria | 1740 |
| 359 | Ga0070716_100125734 | 3300006173 | Bacteria | 1612 |
| 360 | Ga0070716_100277372 | 3300006173 | Bacteria | 1155 |
| 361 | Ga0070712_100004740 | 3300006175 | Bacteria | 8407 |
| 362 | Ga0070712_100057102 | 3300006175 | Bacteria | 2741 |
| 363 | Ga0070712_100063106 | 3300006175 | Bacteria | 2621 |
| 364 | Ga0070712_100072856 | 3300006175 | Bacteria | 2462 |
| 365 | Ga0070712_100073747 | 3300006175 | Bacteria | 2449 |
| 366 | Ga0070712_100118722 | 3300006175 | Bacteria | 1987 |
| 367 | Ga0070712_100126287 | 3300006175 | Bacteria | 1932 |
| 368 | Ga0070712_100379754 | 3300006175 | Bacteria | 1163 |
| 369 | Ga0075362_10001695 | 3300006177 | Bacteria | 7145 |
| 370 | Ga0075362_10107617 | 3300006177 | Bacteria | 1310 |
| 371 | Ga0075362_10138886 | 3300006177 | Bacteria | 1160 |
| 372 | Ga0075362_10168066 | 3300006177 | Bacteria | 1058 |
| 373 | Ga0075362_10190697 | 3300006177 | Bacteria | 995 |
| 374 | Ga0075367_10018878 | 3300006178 | Bacteria | 3812 |
| 375 | Ga0075367_10022791 | 3300006178 | Bacteria | 3516 |
| 376 | Ga0075367_10170445 | 3300006178 | Bacteria | 1356 |
| 377 | Ga0075367_10247511 | 3300006178 | Bacteria | 1117 |
| 378 | Ga0075367_10413578 | 3300006178 | Bacteria | 853 |
| 379 | Ga0075369_10002166 | 3300006186 | Bacteria | 6941 |
| 380 | Ga0075369_10045606 | 3300006186 | Bacteria | 1885 |
| 381 | Ga0075369_10196443 | 3300006186 | Bacteria | 930 |
| 382 | Ga0075366_10007150 | 3300006195 | Bacteria | 6148 |
| 383 | Ga0075366_10025959 | 3300006195 | Bacteria | 3427 |
| 384 | Ga0075366_10073201 | 3300006195 | Bacteria | 2042 |
| 385 | Ga0097621_100002984 | 3300006237 | Bacteria | 11619 |
| 386 | Ga0097621_100222730 | 3300006237 | Bacteria | 1644 |
| 387 | Ga0097621_100871030 | 3300006237 | Bacteria | 837 |
| 388 | Ga0075370_10101745 | 3300006353 | Bacteria | 1663 |
| 389 | Ga0075370_10104514 | 3300006353 | Bacteria | 1641 |
| 390 | Ga0075370_10110461 | 3300006353 | Bacteria | 1597 |
| 391 | Ga0075370_10162316 | 3300006353 | Bacteria | 1312 |
| 392 | Ga0068871_100000555 | 3300006358 | Bacteria | 25466 |
| 393 | Ga0068871_100004433 | 3300006358 | Bacteria | 9765 |
| 394 | Ga0068871_100447185 | 3300006358 | Bacteria | 1158 |
| 395 | Ga0068871_100624562 | 3300006358 | Bacteria | 982 |
| 396 | Ga0075428_100052861 | 3300006844 | Bacteria | 4451 |
| 397 | Ga0075428_100058497 | 3300006844 | Bacteria | 4220 |
| 398 | Ga0075430_100000042 | 3300006846 | Bacteria | 66464 |
| 399 | Ga0075430_100000534 | 3300006846 | Bacteria | 28676 |
| 400 | Ga0075430_100000826 | 3300006846 | Bacteria | 24185 |
| 401 | Ga0075431_100086521 | 3300006847 | Bacteria | 3234 |
| 402 | Ga0075431_100091253 | 3300006847 | Bacteria | 3144 |
| 403 | Ga0075431_100447718 | 3300006847 | Bacteria | 1287 |
| 404 | Ga0075431_100663262 | 3300006847 | Bacteria | 1023 |
| 405 | Ga0075433_10006248 | 3300006852 | Bacteria | 9402 |
| 406 | Ga0075433_10011316 | 3300006852 | Bacteria | 7181 |
| 407 | Ga0075433_10012151 | 3300006852 | Bacteria | 6942 |
| 408 | Ga0075433_10022378 | 3300006852 | Bacteria | 5306 |
| 409 | Ga0075433_10207998 | 3300006852 | Bacteria | 1739 |
| 410 | Ga0075433_10404271 | 3300006852 | Bacteria | 1205 |
| 411 | Ga0075434_100012903 | 3300006871 | Bacteria | 7936 |
| 412 | Ga0075434_100016644 | 3300006871 | Bacteria | 7071 |
| 413 | Ga0075434_100017132 | 3300006871 | Bacteria | 6973 |
| 414 | Ga0075434_100019982 | 3300006871 | Bacteria | 6487 |
| 415 | Ga0075434_100027752 | 3300006871 | Bacteria | 5559 |
| 416 | Ga0075434_100147528 | 3300006871 | Bacteria | 2373 |
| 417 | Ga0075434_100163062 | 3300006871 | Bacteria | 2249 |
| 418 | Ga0075434_100267252 | 3300006871 | Bacteria | 1729 |
| 419 | Ga0075434_100304674 | 3300006871 | Bacteria | 1613 |
| 420 | Ga0075434_100346490 | 3300006871 | Bacteria | 1507 |
| 421 | Ga0075434_100368028 | 3300006871 | Bacteria | 1458 |
| 422 | Ga0075429_100003563 | 3300006880 | Bacteria | 13263 |
| 423 | Ga0075429_100017797 | 3300006880 | Bacteria | 6146 |
| 424 | Ga0075429_100042041 | 3300006880 | Bacteria | 3979 |
| 425 | Ga0075429_100062288 | 3300006880 | Bacteria | 3250 |
| 426 | Ga0068865_100049753 | 3300006881 | Bacteria | 2891 |
| 427 | Ga0068865_100135239 | 3300006881 | Bacteria | 1851 |
| 428 | Ga0075436_100021433 | 3300006914 | Bacteria | 4437 |
| 429 | Ga0075436_100051974 | 3300006914 | Bacteria | 2828 |
| 430 | Ga0075436_100057781 | 3300006914 | Bacteria | 2679 |
| 431 | Ga0075436_100127649 | 3300006914 | Bacteria | 1782 |
| 432 | Ga0075436_100430729 | 3300006914 | Bacteria | 959 |
| 433 | Ga0097620_100002825 | 3300006931 | Bacteria | 17604 |
| 434 | Ga0097620_100055932 | 3300006931 | Bacteria | 3970 |
| 435 | Ga0097620_100108696 | 3300006931 | Bacteria | 2834 |
| 436 | Ga0099824_1004900 | 3300006942 | Bacteria | 19056 |
| 437 | Ga0099824_1029293 | 3300006942 | Bacteria | 2370 |
| 438 | Ga0099822_1000677 | 3300006943 | Bacteria | 34391 |
| 439 | Ga0075435_100018059 | 3300007076 | Bacteria | 5352 |
| 440 | Ga0075435_100045774 | 3300007076 | Bacteria | 3509 |
| 441 | Ga0075435_100057475 | 3300007076 | Bacteria | 3147 |
| 442 | Ga0075435_100062982 | 3300007076 | Bacteria | 3011 |
| 443 | Ga0075435_100068323 | 3300007076 | Bacteria | 2894 |
| 444 | Ga0075435_100084879 | 3300007076 | Bacteria | 2606 |
| 445 | Ga0075435_100218901 | 3300007076 | Bacteria | 1617 |
| 446 | Ga0075435_100273373 | 3300007076 | Bacteria | 1441 |
| 447 | Ga0075435_100293565 | 3300007076 | Bacteria | 1389 |
| 448 | Ga0075435_100307271 | 3300007076 | Bacteria | 1357 |
| 449 | Ga0099794_10016964 | 3300007265 | Bacteria | 3238 |
| 450 | Ga0099794_10047778 | 3300007265 | Bacteria | 2053 |
| 451 | Ga0099794_10181752 | 3300007265 | Bacteria | 1074 |
| 452 | Ga0099795_10058807 | 3300007788 | Bacteria | 1420 |
| 453 | Ga0099795_10120237 | 3300007788 | Bacteria | 1049 |
| 454 | Ga0105240_10008025 | 3300009093 | Bacteria | 15195 |
| 455 | Ga0105240_10027519 | 3300009093 | Bacteria | 7441 |
| 456 | Ga0105240_10033952 | 3300009093 | Bacteria | 6587 |
| 457 | Ga0105240_10086994 | 3300009093 | Bacteria | 3827 |
| 458 | Ga0105240_10129550 | 3300009093 | Bacteria | 3028 |
| 459 | Ga0105240_10174326 | 3300009093 | Bacteria | 2544 |
| 460 | Ga0105240_10191853 | 3300009093 | Bacteria | 2402 |
| 461 | Ga0111539_10002792 | 3300009094 | Bacteria | 23179 |
| 462 | Ga0111539_10004409 | 3300009094 | Bacteria | 18396 |
| 463 | Ga0111539_10004721 | 3300009094 | Bacteria | 17807 |
| 464 | Ga0111539_10016484 | 3300009094 | Bacteria | 9162 |
| 465 | Ga0111539_10115084 | 3300009094 | Bacteria | 3154 |
| 466 | Ga0111539_10157494 | 3300009094 | Bacteria | 2657 |
| 467 | Ga0111539_10533202 | 3300009094 | Bacteria | 1368 |
| 468 | Ga0111539_10754634 | 3300009094 | Bacteria | 1132 |
| 469 | Ga0105245_10000370 | 3300009098 | Bacteria | 41982 |
| 470 | Ga0105245_10009595 | 3300009098 | Bacteria | 8440 |
| 471 | Ga0105245_10019672 | 3300009098 | Bacteria | 5916 |
| 472 | Ga0105245_10313762 | 3300009098 | Bacteria | 1543 |
| 473 | Ga0105245_10317008 | 3300009098 | Bacteria | 1535 |
| 474 | Ga0105245_10398638 | 3300009098 | Bacteria | 1374 |
| 475 | Ga0105245_10569306 | 3300009098 | Bacteria | 1156 |
| 476 | Ga0105245_10706223 | 3300009098 | Bacteria | 1042 |
| 477 | Ga0105247_10002042 | 3300009101 | Bacteria | 13972 |
| 478 | Ga0114129_10024612 | 3300009147 | Bacteria | 8531 |
| 479 | Ga0114129_10035072 | 3300009147 | Bacteria | 7087 |
| 480 | Ga0114129_10057279 | 3300009147 | Bacteria | 5455 |
| 481 | Ga0114129_10062807 | 3300009147 | Bacteria | 5187 |
| 482 | Ga0114129_10095997 | 3300009147 | Bacteria | 4105 |
| 483 | Ga0114129_10241848 | 3300009147 | Bacteria | 2426 |
| 484 | Ga0114129_10685163 | 3300009147 | Bacteria | 1319 |
| 485 | Ga0114129_10741655 | 3300009147 | Bacteria | 1258 |
| 486 | Ga0114129_10770015 | 3300009147 | Bacteria | 1230 |
| 487 | Ga0114129_11650956 | 3300009147 | Bacteria | 783 |
| 488 | Ga0105243_10003045 | 3300009148 | Bacteria | 13818 |
| 489 | Ga0105243_10009792 | 3300009148 | Bacteria | 7296 |
| 490 | Ga0105243_10174023 | 3300009148 | Bacteria | 1867 |
| 491 | Ga0105243_10632848 | 3300009148 | Bacteria | 1034 |
| 492 | Ga0105243_10646984 | 3300009148 | Bacteria | 1024 |
| 493 | Ga0105243_10736654 | 3300009148 | Bacteria | 965 |
| 494 | Ga0105241_10001352 | 3300009174 | Bacteria | 18650 |
| 495 | Ga0105241_10092438 | 3300009174 | Bacteria | 2389 |
| 496 | Ga0105241_10591021 | 3300009174 | Bacteria | 1002 |
| 497 | Ga0105242_10001245 | 3300009176 | Bacteria | 20067 |
| 498 | Ga0105242_10234816 | 3300009176 | Bacteria | 1645 |
| 499 | Ga0105242_10292772 | 3300009176 | Bacteria | 1483 |
| 500 | Ga0105242_10475396 | 3300009176 | Bacteria | 1183 |
| 501 | Ga0105242_10891089 | 3300009176 | Bacteria | 889 |
| 502 | Ga0105248_10001324 | 3300009177 | Bacteria | 27565 |
| 503 | Ga0105248_10016609 | 3300009177 | Bacteria | 8105 |
| 504 | Ga0105248_10027404 | 3300009177 | Bacteria | 6343 |
| 505 | Ga0105248_10137102 | 3300009177 | Bacteria | 2760 |
| 506 | Ga0105248_10142505 | 3300009177 | Bacteria | 2704 |
| 507 | Ga0105248_10236177 | 3300009177 | Bacteria | 2058 |
| 508 | Ga0105237_10002060 | 3300009545 | Bacteria | 25535 |
| 509 | Ga0105237_10051893 | 3300009545 | Bacteria | 4119 |
| 510 | Ga0105237_10502841 | 3300009545 | Bacteria | 1219 |
| 511 | Ga0105238_10168915 | 3300009551 | Bacteria | 2163 |
| 512 | Ga0105238_10519124 | 3300009551 | Bacteria | 1194 |
| 513 | Ga0105249_10011280 | 3300009553 | Bacteria | 7845 |
| 514 | Ga0105249_10044003 | 3300009553 | Bacteria | 4061 |
| 515 | Ga0105249_10243921 | 3300009553 | Bacteria | 1778 |
| 516 | Ga0105239_10018332 | 3300010375 | Bacteria | 7738 |
| 517 | Ga0105239_10046768 | 3300010375 | Bacteria | 4743 |
| 518 | Ga0105239_10063519 | 3300010375 | Bacteria | 4054 |
| 519 | Ga0105239_10132942 | 3300010375 | Bacteria | 2768 |
| 520 | Ga0105239_10240473 | 3300010375 | Bacteria | 2032 |
| 521 | Ga0105239_10326261 | 3300010375 | Bacteria | 1731 |
| 522 | Ga0105239_10390965 | 3300010375 | Bacteria | 1573 |
| 523 | Ga0105239_10524366 | 3300010375 | Bacteria | 1348 |
| 524 | Ga0105239_10642095 | 3300010375 | Bacteria | 1212 |
| 525 | Ga0105246_10000510 | 3300011119 | Bacteria | 21126 |
| 526 | Ga0105246_10070617 | 3300011119 | Bacteria | 2457 |
| 527 | Ga0105246_10169126 | 3300011119 | Bacteria | 1672 |
| 528 | Ga0157315_1005559 | 3300012508 | Bacteria | 950 |
| 529 | Ga0157373_10002949 | 3300013100 | Bacteria | 12892 |
| 530 | Ga0157371_10032190 | 3300013102 | Bacteria | 3774 |
| 531 | Ga0157370_10022603 | 3300013104 | Bacteria | 6257 |
| 532 | Ga0157370_10042139 | 3300013104 | Bacteria | 4401 |
| 533 | Ga0157370_10115657 | 3300013104 | Bacteria | 2505 |
| 534 | Ga0157370_10280866 | 3300013104 | Bacteria | 1538 |
| 535 | Ga0157369_10034680 | 3300013105 | Bacteria | 5535 |
| 536 | Ga0157369_10045599 | 3300013105 | Bacteria | 4766 |
| 537 | Ga0157369_10305824 | 3300013105 | Bacteria | 1654 |
| 538 | Ga0157374_10001994 | 3300013296 | Bacteria | 17142 |
| 539 | Ga0157374_10964442 | 3300013296 | Bacteria | 871 |
| 540 | Ga0157378_10005283 | 3300013297 | Bacteria | 11342 |
| 541 | Ga0157378_10177813 | 3300013297 | Bacteria | 2000 |
| 542 | Ga0157378_10326744 | 3300013297 | Bacteria | 1492 |
| 543 | Ga0163162_10018668 | 3300013306 | Bacteria | 6794 |
| 544 | Ga0163162_10129762 | 3300013306 | Bacteria | 2629 |
| 545 | Ga0163162_10775572 | 3300013306 | Bacteria | 1077 |
| 546 | Ga0157372_10214993 | 3300013307 | Bacteria | 2228 |
| 547 | Ga0157372_10676412 | 3300013307 | Bacteria | 1201 |
| 548 | Ga0157375_10038248 | 3300013308 | Bacteria | 4606 |
| 549 | Ga0157375_10245534 | 3300013308 | Bacteria | 1950 |
| 550 | Ga0157375_10259770 | 3300013308 | Bacteria | 1898 |
| 551 | Ga0157375_10299558 | 3300013308 | Bacteria | 1771 |
| 552 | Ga0163163_10017133 | 3300014325 | Bacteria | 6749 |
| 553 | Ga0163163_10063041 | 3300014325 | Bacteria | 3675 |
| 554 | Ga0163163_10126958 | 3300014325 | Bacteria | 2589 |
| 555 | Ga0163163_10393886 | 3300014325 | Bacteria | 1443 |
| 556 | Ga0163163_10541197 | 3300014325 | Bacteria | 1227 |
| 557 | Ga0163163_10893255 | 3300014325 | Bacteria | 952 |
| 558 | Ga0163163_11035903 | 3300014325 | Bacteria | 884 |
| 559 | Ga0157380_10010558 | 3300014326 | Bacteria | 6642 |
| 560 | Ga0157380_10044784 | 3300014326 | Bacteria | 3469 |
| 561 | Ga0157380_10278226 | 3300014326 | Bacteria | 1530 |
| 562 | Ga0157380_10785985 | 3300014326 | Bacteria | 967 |
| 563 | Ga0182008_10165678 | 3300014497 | Bacteria | 1114 |
| 564 | Ga0182008_10242838 | 3300014497 | Bacteria | 927 |
| 565 | Ga0157377_10001228 | 3300014745 | Bacteria | 10949 |
| 566 | Ga0157379_10001959 | 3300014968 | Bacteria | 17038 |
| 567 | Ga0157379_10133256 | 3300014968 | Bacteria | 2238 |
| 568 | Ga0157379_10206894 | 3300014968 | Bacteria | 1775 |
| 569 | Ga0157376_10017127 | 3300014969 | Bacteria | 5520 |
| 570 | Ga0157376_10066771 | 3300014969 | Bacteria | 3041 |
| 571 | Ga0157376_10739305 | 3300014969 | Bacteria | 992 |
| 572 | Ga0157376_10922161 | 3300014969 | Bacteria | 892 |
| 573 | Ga0182005_1039485 | 3300015265 | Bacteria | 1284 |
| 574 | Ga0163161_10017343 | 3300017792 | Bacteria | 5039 |
| 575 | Ga0163161_10038485 | 3300017792 | Bacteria | 3430 |
| 576 | Ga0163161_10131788 | 3300017792 | Bacteria | 1886 |
| 577 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 578 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 579 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 580 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 581 | Ga0213873_10006937 | 3300021358 | Bacteria | 2249 |
| 582 | Ga0213876_10058129 | 3300021384 | Bacteria | 2041 |
| 583 | Ga0213876_10084092 | 3300021384 | Bacteria | 1684 |
| 584 | Ga0213876_10130132 | 3300021384 | Bacteria | 1337 |
| 585 | Ga0213875_10093331 | 3300021388 | Bacteria | 1404 |
| 586 | Ga0213871_10004587 | 3300021441 | Bacteria | 2777 |
| 587 | Ga0213871_10054108 | 3300021441 | Bacteria | 1106 |
| 588 | Ga0213871_10085835 | 3300021441 | Bacteria | 907 |
| 589 | Ga0209677_103618 | 3300025253 | Bacteria | 4887 |
| 590 | Ga0209148_1000376 | 3300025254 | Bacteria | 54217 |
| 591 | Ga0209233_1009577 | 3300025261 | Bacteria | 2942 |
| 592 | Ga0207666_1000081 | 3300025271 | Bacteria | 15694 |
| 593 | Ga0209455_1000714 | 3300025272 | Bacteria | 19245 |
| 594 | Ga0207673_1001727 | 3300025290 | Bacteria | 2419 |
| 595 | Ga0209564_1011304 | 3300025295 | Bacteria | 4012 |
| 596 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 597 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 598 | Ga0209758_1001019 | 3300025297 | Bacteria | 37066 |
| 599 | Ga0209758_1002338 | 3300025297 | Bacteria | 19567 |
| 600 | Ga0209758_1002921 | 3300025297 | Bacteria | 16464 |
| 601 | Ga0209758_1003483 | 3300025297 | Bacteria | 14255 |
| 602 | Ga0209758_1041951 | 3300025297 | Bacteria | 1703 |
| 603 | Ga0209758_1081463 | 3300025297 | Bacteria | 977 |
| 604 | Ga0209256_1002956 | 3300025299 | Bacteria | 12733 |
| 605 | Ga0209256_1047199 | 3300025299 | Bacteria | 1061 |
| 606 | Ga0207426_1000437 | 3300025302 | Bacteria | 67439 |
| 607 | Ga0207426_1001139 | 3300025302 | Bacteria | 24022 |
| 608 | Ga0207426_1012626 | 3300025302 | Bacteria | 3166 |
| 609 | Ga0207426_1018791 | 3300025302 | Bacteria | 2429 |
| 610 | Ga0207426_1021983 | 3300025302 | Bacteria | 2196 |
| 611 | Ga0209257_1003859 | 3300025304 | Bacteria | 12250 |
| 612 | Ga0209257_1011469 | 3300025304 | Bacteria | 4263 |
| 613 | Ga0209257_1040537 | 3300025304 | Bacteria | 1388 |
| 614 | Ga0207697_10000051 | 3300025315 | Bacteria | 47188 |
| 615 | Ga0207697_10086702 | 3300025315 | Bacteria | 1324 |
| 616 | Ga0207697_10113018 | 3300025315 | Bacteria | 1164 |
| 617 | Ga0207682_10000661 | 3300025893 | Bacteria | 16103 |
| 618 | Ga0207692_10002517 | 3300025898 | Bacteria | 7042 |
| 619 | Ga0207692_10177558 | 3300025898 | Bacteria | 1239 |
| 620 | Ga0207692_10214027 | 3300025898 | Bacteria | 1139 |
| 621 | Ga0207692_10350439 | 3300025898 | Bacteria | 910 |
| 622 | Ga0207642_10001892 | 3300025899 | Bacteria | 6454 |
| 623 | Ga0207710_10016916 | 3300025900 | Bacteria | 3088 |
| 624 | Ga0207710_10038841 | 3300025900 | Bacteria | 2105 |
| 625 | Ga0207710_10079983 | 3300025900 | Bacteria | 1515 |
| 626 | Ga0207688_10000702 | 3300025901 | Bacteria | 16518 |
| 627 | Ga0207688_10114944 | 3300025901 | Bacteria | 1565 |
| 628 | Ga0207688_10167168 | 3300025901 | Bacteria | 1306 |
| 629 | Ga0207688_10411062 | 3300025901 | Bacteria | 840 |
| 630 | Ga0207688_10477369 | 3300025901 | Bacteria | 779 |
| 631 | Ga0207680_10009478 | 3300025903 | Bacteria | 4831 |
| 632 | Ga0207680_10044806 | 3300025903 | Bacteria | 2604 |
| 633 | Ga0207647_10002441 | 3300025904 | Bacteria | 14092 |
| 634 | Ga0207647_10040227 | 3300025904 | Bacteria | 2946 |
| 635 | Ga0207685_10010399 | 3300025905 | Bacteria | 2747 |
| 636 | Ga0207685_10056738 | 3300025905 | Bacteria | 1534 |
| 637 | Ga0207699_10000344 | 3300025906 | Bacteria | 24676 |
| 638 | Ga0207699_10000434 | 3300025906 | Bacteria | 21301 |
| 639 | Ga0207699_10035971 | 3300025906 | Bacteria | 2820 |
| 640 | Ga0207699_10101229 | 3300025906 | Bacteria | 1829 |
| 641 | Ga0207699_10154439 | 3300025906 | Bacteria | 1522 |
| 642 | Ga0207645_10000218 | 3300025907 | Bacteria | 47372 |
| 643 | Ga0207645_10027565 | 3300025907 | Bacteria | 3667 |
| 644 | Ga0207645_10045314 | 3300025907 | Bacteria | 2811 |
| 645 | Ga0207643_10000400 | 3300025908 | Bacteria | 28899 |
| 646 | Ga0207643_10234976 | 3300025908 | Bacteria | 1125 |
| 647 | Ga0207705_10358320 | 3300025909 | Bacteria | 1125 |
| 648 | Ga0207705_10392607 | 3300025909 | Bacteria | 1073 |
| 649 | Ga0207684_10004496 | 3300025910 | Bacteria | 13113 |
| 650 | Ga0207684_10004520 | 3300025910 | Bacteria | 13068 |
| 651 | Ga0207684_10012329 | 3300025910 | Bacteria | 7440 |
| 652 | Ga0207684_10015203 | 3300025910 | Bacteria | 6630 |
| 653 | Ga0207684_10087821 | 3300025910 | Bacteria | 2649 |
| 654 | Ga0207684_10282202 | 3300025910 | Bacteria | 1432 |
| 655 | Ga0207684_10292934 | 3300025910 | Bacteria | 1403 |
| 656 | Ga0207654_10002726 | 3300025911 | Bacteria | 8969 |
| 657 | Ga0207654_10194687 | 3300025911 | Bacteria | 1331 |
| 658 | Ga0207707_10002658 | 3300025912 | Bacteria | 15980 |
| 659 | Ga0207707_10011843 | 3300025912 | Bacteria | 7585 |
| 660 | Ga0207707_10023997 | 3300025912 | Bacteria | 5332 |
| 661 | Ga0207707_10043382 | 3300025912 | Bacteria | 3923 |
| 662 | Ga0207707_10056384 | 3300025912 | Bacteria | 3418 |
| 663 | Ga0207707_10063500 | 3300025912 | Bacteria | 3214 |
| 664 | Ga0207707_10410557 | 3300025912 | Bacteria | 1162 |
| 665 | Ga0207695_10036649 | 3300025913 | Bacteria | 5300 |
| 666 | Ga0207695_10050434 | 3300025913 | Bacteria | 4378 |
| 667 | Ga0207695_10085924 | 3300025913 | Bacteria | 3174 |
| 668 | Ga0207695_10115522 | 3300025913 | Bacteria | 2658 |
| 669 | Ga0207695_10212050 | 3300025913 | Bacteria | 1847 |
| 670 | Ga0207695_10236470 | 3300025913 | Bacteria | 1729 |
| 671 | Ga0207671_10131265 | 3300025914 | Bacteria | 1923 |
| 672 | Ga0207671_10143288 | 3300025914 | Bacteria | 1842 |
| 673 | Ga0207671_10521032 | 3300025914 | Bacteria | 948 |
| 674 | Ga0207671_10529112 | 3300025914 | Bacteria | 940 |
| 675 | Ga0207693_10001161 | 3300025915 | Bacteria | 23500 |
| 676 | Ga0207693_10003608 | 3300025915 | Bacteria | 13212 |
| 677 | Ga0207693_10035323 | 3300025915 | Bacteria | 3941 |
| 678 | Ga0207693_10042279 | 3300025915 | Bacteria | 3588 |
| 679 | Ga0207693_10085481 | 3300025915 | Bacteria | 2471 |
| 680 | Ga0207693_10132528 | 3300025915 | Bacteria | 1959 |
| 681 | Ga0207693_10206011 | 3300025915 | Bacteria | 1546 |
| 682 | Ga0207693_10269282 | 3300025915 | Bacteria | 1335 |
| 683 | Ga0207693_10321843 | 3300025915 | Bacteria | 1210 |
| 684 | Ga0207693_10365645 | 3300025915 | Bacteria | 1129 |
| 685 | Ga0207663_10000926 | 3300025916 | Bacteria | 13406 |
| 686 | Ga0207663_10012457 | 3300025916 | Bacteria | 4599 |
| 687 | Ga0207660_10002897 | 3300025917 | Bacteria | 11208 |
| 688 | Ga0207660_10010384 | 3300025917 | Bacteria | 6041 |
| 689 | Ga0207660_10013462 | 3300025917 | Bacteria | 5361 |
| 690 | Ga0207660_10495516 | 3300025917 | Bacteria | 991 |
| 691 | Ga0207660_10651928 | 3300025917 | Bacteria | 858 |
| 692 | Ga0207662_10000678 | 3300025918 | Bacteria | 15500 |
| 693 | Ga0207657_10003448 | 3300025919 | Bacteria | 16876 |
| 694 | Ga0207657_10075202 | 3300025919 | Bacteria | 2851 |
| 695 | Ga0207657_10095681 | 3300025919 | Bacteria | 2471 |
| 696 | Ga0207657_10138003 | 3300025919 | Bacteria | 1994 |
| 697 | Ga0207657_10166205 | 3300025919 | Bacteria | 1789 |
| 698 | Ga0207657_10560607 | 3300025919 | Bacteria | 893 |
| 699 | Ga0207649_10001450 | 3300025920 | Bacteria | 13956 |
| 700 | Ga0207652_10005840 | 3300025921 | Bacteria | 9970 |
| 701 | Ga0207652_10006902 | 3300025921 | Bacteria | 9146 |
| 702 | Ga0207652_10008077 | 3300025921 | Bacteria | 8447 |
| 703 | Ga0207652_10016789 | 3300025921 | Bacteria | 5982 |
| 704 | Ga0207652_10211430 | 3300025921 | Bacteria | 1746 |
| 705 | Ga0207652_10346504 | 3300025921 | Bacteria | 1341 |
| 706 | Ga0207646_10003037 | 3300025922 | Bacteria | 19308 |
| 707 | Ga0207646_10078591 | 3300025922 | Bacteria | 2949 |
| 708 | Ga0207646_10159870 | 3300025922 | Bacteria | 2032 |
| 709 | Ga0207646_10244434 | 3300025922 | Bacteria | 1621 |
| 710 | Ga0207646_10525802 | 3300025922 | Bacteria | 1065 |
| 711 | Ga0207681_10001264 | 3300025923 | Bacteria | 16325 |
| 712 | Ga0207681_10203390 | 3300025923 | Bacteria | 1522 |
| 713 | Ga0207681_10259340 | 3300025923 | Bacteria | 1360 |
| 714 | Ga0207694_10113941 | 3300025924 | Bacteria | 2153 |
| 715 | Ga0207694_10125399 | 3300025924 | Bacteria | 2054 |
| 716 | Ga0207694_10153373 | 3300025924 | Bacteria | 1857 |
| 717 | Ga0207694_10296268 | 3300025924 | Bacteria | 1331 |
| 718 | Ga0207694_10464238 | 3300025924 | Bacteria | 1058 |
| 719 | Ga0207650_10043914 | 3300025925 | Bacteria | 3283 |
| 720 | Ga0207650_10085722 | 3300025925 | Bacteria | 2397 |
| 721 | Ga0207650_10219732 | 3300025925 | Bacteria | 1529 |
| 722 | Ga0207659_10004045 | 3300025926 | Bacteria | 8850 |
| 723 | Ga0207659_10248312 | 3300025926 | Bacteria | 1443 |
| 724 | Ga0207659_10421962 | 3300025926 | Bacteria | 1119 |
| 725 | Ga0207687_10007913 | 3300025927 | Bacteria | 6965 |
| 726 | Ga0207687_10040438 | 3300025927 | Bacteria | 3196 |
| 727 | Ga0207687_10427047 | 3300025927 | Bacteria | 1095 |
| 728 | Ga0207700_10001395 | 3300025928 | Bacteria | 13709 |
| 729 | Ga0207700_10015437 | 3300025928 | Bacteria | 5039 |
| 730 | Ga0207700_10015756 | 3300025928 | Bacteria | 4998 |
| 731 | Ga0207700_10090002 | 3300025928 | Bacteria | 2420 |
| 732 | Ga0207700_10096610 | 3300025928 | Bacteria | 2346 |
| 733 | Ga0207700_10101360 | 3300025928 | Bacteria | 2297 |
| 734 | Ga0207700_10524626 | 3300025928 | Bacteria | 1050 |
| 735 | Ga0207664_10023034 | 3300025929 | Bacteria | 4661 |
| 736 | Ga0207664_10064254 | 3300025929 | Bacteria | 2935 |
| 737 | Ga0207664_10145777 | 3300025929 | Bacteria | 2007 |
| 738 | Ga0207664_10726649 | 3300025929 | Bacteria | 893 |
| 739 | Ga0207644_10044060 | 3300025931 | Bacteria | 3168 |
| 740 | Ga0207644_10091325 | 3300025931 | Bacteria | 2270 |
| 741 | Ga0207644_10114849 | 3300025931 | Bacteria | 2041 |
| 742 | Ga0207690_10003720 | 3300025932 | Bacteria | 9064 |
| 743 | Ga0207690_10103954 | 3300025932 | Bacteria | 2034 |
| 744 | Ga0207706_10016490 | 3300025933 | Bacteria | 6667 |
| 745 | Ga0207706_10168370 | 3300025933 | Bacteria | 1925 |
| 746 | Ga0207706_10176636 | 3300025933 | Bacteria | 1876 |
| 747 | Ga0207706_10199102 | 3300025933 | Bacteria | 1757 |
| 748 | Ga0207706_10297489 | 3300025933 | Bacteria | 1406 |
| 749 | Ga0207706_10518744 | 3300025933 | Bacteria | 1027 |
| 750 | Ga0207686_10012733 | 3300025934 | Bacteria | 4631 |
| 751 | Ga0207686_10017495 | 3300025934 | Bacteria | 4040 |
| 752 | Ga0207709_10001798 | 3300025935 | Bacteria | 14367 |
| 753 | Ga0207709_10056378 | 3300025935 | Bacteria | 2432 |
| 754 | Ga0207709_10081552 | 3300025935 | Bacteria | 2086 |
| 755 | Ga0207670_10003328 | 3300025936 | Bacteria | 8522 |
| 756 | Ga0207670_10046656 | 3300025936 | Bacteria | 2880 |
| 757 | Ga0207670_10073089 | 3300025936 | Bacteria | 2377 |
| 758 | Ga0207669_10002357 | 3300025937 | Bacteria | 8031 |
| 759 | Ga0207669_10047148 | 3300025937 | Bacteria | 2550 |
| 760 | Ga0207704_10000896 | 3300025938 | Bacteria | 13231 |
| 761 | Ga0207704_10047543 | 3300025938 | Bacteria | 2565 |
| 762 | Ga0207665_10000228 | 3300025939 | Bacteria | 38348 |
| 763 | Ga0207665_10000715 | 3300025939 | Bacteria | 22506 |
| 764 | Ga0207665_10002595 | 3300025939 | Bacteria | 12150 |
| 765 | Ga0207665_10019118 | 3300025939 | Bacteria | 4501 |
| 766 | Ga0207665_10023485 | 3300025939 | Bacteria | 4063 |
| 767 | Ga0207665_10149363 | 3300025939 | Bacteria | 1673 |
| 768 | Ga0207665_10327372 | 3300025939 | Bacteria | 1151 |
| 769 | Ga0207691_10000940 | 3300025940 | Bacteria | 28841 |
| 770 | Ga0207691_10059780 | 3300025940 | Bacteria | 3464 |
| 771 | Ga0207691_10063675 | 3300025940 | Bacteria | 3344 |
| 772 | Ga0207691_10146323 | 3300025940 | Bacteria | 2080 |
| 773 | Ga0207691_10373640 | 3300025940 | Bacteria | 1217 |
| 774 | Ga0207711_10032480 | 3300025941 | Bacteria | 4413 |
| 775 | Ga0207711_10034481 | 3300025941 | Bacteria | 4286 |
| 776 | Ga0207711_10041197 | 3300025941 | Bacteria | 3932 |
| 777 | Ga0207711_10041697 | 3300025941 | Bacteria | 3909 |
| 778 | Ga0207711_10095313 | 3300025941 | Bacteria | 2624 |
| 779 | Ga0207711_10115517 | 3300025941 | Bacteria | 2392 |
| 780 | Ga0207711_10339338 | 3300025941 | Bacteria | 1390 |
| 781 | Ga0207711_10486060 | 3300025941 | Bacteria | 1150 |
| 782 | Ga0207689_10000514 | 3300025942 | Bacteria | 36737 |
| 783 | Ga0207689_10069377 | 3300025942 | Bacteria | 2896 |
| 784 | Ga0207689_10145972 | 3300025942 | Bacteria | 1949 |
| 785 | Ga0207689_10435858 | 3300025942 | Bacteria | 1094 |
| 786 | Ga0207689_10881434 | 3300025942 | Bacteria | 755 |
| 787 | Ga0207661_10001969 | 3300025944 | Bacteria | 14136 |
| 788 | Ga0207661_10012879 | 3300025944 | Bacteria | 6097 |
| 789 | Ga0207661_10029500 | 3300025944 | Bacteria | 4214 |
| 790 | Ga0207661_10125062 | 3300025944 | Bacteria | 2195 |
| 791 | Ga0207661_10208332 | 3300025944 | Bacteria | 1722 |
| 792 | Ga0207661_10297372 | 3300025944 | Bacteria | 1446 |
| 793 | Ga0207679_10000099 | 3300025945 | Bacteria | 74047 |
| 794 | Ga0207679_10224032 | 3300025945 | Bacteria | 1584 |
| 795 | Ga0207679_10598458 | 3300025945 | Bacteria | 993 |
| 796 | Ga0207667_10019759 | 3300025949 | Bacteria | 7509 |
| 797 | Ga0207667_10040667 | 3300025949 | Bacteria | 4950 |
| 798 | Ga0207667_10042644 | 3300025949 | Bacteria | 4821 |
| 799 | Ga0207667_10098778 | 3300025949 | Bacteria | 3012 |
| 800 | Ga0207667_10209760 | 3300025949 | Bacteria | 1997 |
| 801 | Ga0207667_10399499 | 3300025949 | Bacteria | 1399 |
| 802 | Ga0207667_10410416 | 3300025949 | Bacteria | 1379 |
| 803 | Ga0207667_10482505 | 3300025949 | Bacteria | 1258 |
| 804 | Ga0207667_10648856 | 3300025949 | Bacteria | 1061 |
| 805 | Ga0207651_10000609 | 3300025960 | Bacteria | 15073 |
| 806 | Ga0207712_10001402 | 3300025961 | Bacteria | 16444 |
| 807 | Ga0207712_10164503 | 3300025961 | Bacteria | 1727 |
| 808 | Ga0207712_10402077 | 3300025961 | Bacteria | 1151 |
| 809 | Ga0207668_10008221 | 3300025972 | Bacteria | 6215 |
| 810 | Ga0207668_10069987 | 3300025972 | Bacteria | 2500 |
| 811 | Ga0207668_10075220 | 3300025972 | Bacteria | 2427 |
| 812 | Ga0207668_10438243 | 3300025972 | Bacteria | 1112 |
| 813 | Ga0207640_10001310 | 3300025981 | Bacteria | 13493 |
| 814 | Ga0207640_10083988 | 3300025981 | Bacteria | 2185 |
| 815 | Ga0207658_10021213 | 3300025986 | Bacteria | 4506 |
| 816 | Ga0207658_10329427 | 3300025986 | Bacteria | 1324 |
| 817 | Ga0207658_10444865 | 3300025986 | Bacteria | 1146 |
| 818 | Ga0207677_10000495 | 3300026023 | Bacteria | 25594 |
| 819 | Ga0207677_10020041 | 3300026023 | Bacteria | 4052 |
| 820 | Ga0207703_10005812 | 3300026035 | Bacteria | 9883 |
| 821 | Ga0207703_10250211 | 3300026035 | Bacteria | 1597 |
| 822 | Ga0207703_10254113 | 3300026035 | Bacteria | 1585 |
| 823 | Ga0207703_10393259 | 3300026035 | Bacteria | 1285 |
| 824 | Ga0207703_10404414 | 3300026035 | Bacteria | 1267 |
| 825 | Ga0207703_10760488 | 3300026035 | Bacteria | 924 |
| 826 | Ga0207639_10006228 | 3300026041 | Bacteria | 8104 |
| 827 | Ga0207639_10058222 | 3300026041 | Bacteria | 2971 |
| 828 | Ga0207639_10062266 | 3300026041 | Bacteria | 2884 |
| 829 | Ga0207639_10132413 | 3300026041 | Bacteria | 2066 |
| 830 | Ga0207639_10456287 | 3300026041 | Bacteria | 1161 |
| 831 | Ga0207678_10004568 | 3300026067 | Bacteria | 12452 |
| 832 | Ga0207678_10015651 | 3300026067 | Bacteria | 6667 |
| 833 | Ga0207678_10076090 | 3300026067 | Bacteria | 2875 |
| 834 | Ga0207678_10083060 | 3300026067 | Bacteria | 2740 |
| 835 | Ga0207678_10095571 | 3300026067 | Bacteria | 2539 |
| 836 | Ga0207678_10313045 | 3300026067 | Bacteria | 1350 |
| 837 | Ga0207678_10473513 | 3300026067 | Bacteria | 1090 |
| 838 | Ga0207708_10016215 | 3300026075 | Bacteria | 5598 |
| 839 | Ga0207708_10059563 | 3300026075 | Bacteria | 2915 |
| 840 | Ga0207702_10012301 | 3300026078 | Bacteria | 7123 |
| 841 | Ga0207702_10018427 | 3300026078 | Bacteria | 5775 |
| 842 | Ga0207702_10067051 | 3300026078 | Bacteria | 3079 |
| 843 | Ga0207702_10473207 | 3300026078 | Bacteria | 1218 |
| 844 | Ga0207702_10782605 | 3300026078 | Bacteria | 943 |
| 845 | Ga0207641_10021071 | 3300026088 | Bacteria | 5357 |
| 846 | Ga0207641_10204516 | 3300026088 | Bacteria | 1823 |
| 847 | Ga0207648_10000575 | 3300026089 | Bacteria | 41197 |
| 848 | Ga0207648_10179928 | 3300026089 | Bacteria | 1871 |
| 849 | Ga0207676_10006987 | 3300026095 | Bacteria | 8001 |
| 850 | Ga0207676_10011122 | 3300026095 | Bacteria | 6424 |
| 851 | Ga0207676_10263449 | 3300026095 | Bacteria | 1557 |
| 852 | Ga0207676_10551129 | 3300026095 | Bacteria | 1101 |
| 853 | Ga0207676_10797397 | 3300026095 | Bacteria | 921 |
| 854 | Ga0207674_10002439 | 3300026116 | Bacteria | 23481 |
| 855 | Ga0207674_10008791 | 3300026116 | Bacteria | 11628 |
| 856 | Ga0207674_10053695 | 3300026116 | Bacteria | 4106 |
| 857 | Ga0207674_10088944 | 3300026116 | Bacteria | 3081 |
| 858 | Ga0207674_10097261 | 3300026116 | Bacteria | 2927 |
| 859 | Ga0207674_10109561 | 3300026116 | Bacteria | 2737 |
| 860 | Ga0207674_10239446 | 3300026116 | Bacteria | 1762 |
| 861 | Ga0207674_10632272 | 3300026116 | Bacteria | 1034 |
| 862 | Ga0207674_10678099 | 3300026116 | Bacteria | 995 |
| 863 | Ga0207675_100002824 | 3300026118 | Bacteria | 17080 |
| 864 | Ga0207675_100184205 | 3300026118 | Bacteria | 2001 |
| 865 | Ga0207675_100185079 | 3300026118 | Bacteria | 1996 |
| 866 | Ga0207675_100843026 | 3300026118 | Bacteria | 931 |
| 867 | Ga0207683_10093675 | 3300026121 | Bacteria | 2677 |
| 868 | Ga0207683_10107125 | 3300026121 | Bacteria | 2500 |
| 869 | Ga0207683_10159116 | 3300026121 | Bacteria | 2041 |
| 870 | Ga0207683_10484988 | 3300026121 | Bacteria | 1141 |
| 871 | Ga0207698_10002620 | 3300026142 | Bacteria | 10693 |
| 872 | Ga0207698_10083446 | 3300026142 | Bacteria | 2586 |
| 873 | Ga0207698_10178948 | 3300026142 | Bacteria | 1876 |
| 874 | Ga0207698_10435391 | 3300026142 | Bacteria | 1262 |
| 875 | Ga0207698_10536270 | 3300026142 | Bacteria | 1144 |
| 876 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 877 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 878 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 879 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 880 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 881 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 882 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 883 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 884 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 885 | Ga0209179_1002360 | 3300027512 | Bacteria | 2538 |
| 886 | Ga0209998_10001529 | 3300027717 | Bacteria | 5563 |
| 887 | Ga0209813_10097234 | 3300027866 | Bacteria | 997 |
| 888 | Ga0209974_10007886 | 3300027876 | Bacteria | 3654 |
| 889 | Ga0207428_10000033 | 3300027907 | Bacteria | 232081 |
| 890 | Ga0207428_10000094 | 3300027907 | Bacteria | 123649 |
| 891 | Ga0207428_10000736 | 3300027907 | Bacteria | 37641 |
| 892 | Ga0207428_10034078 | 3300027907 | Bacteria | 4176 |
| 893 | Ga0207428_10318688 | 3300027907 | Bacteria | 1148 |
| 894 | Ga0268266_10007855 | 3300028379 | Bacteria | 9556 |
| 895 | Ga0268266_10060020 | 3300028379 | Bacteria | 3277 |
| 896 | Ga0268266_10150629 | 3300028379 | Bacteria | 2096 |
| 897 | Ga0268266_10203391 | 3300028379 | Bacteria | 1813 |
| 898 | Ga0268266_10205402 | 3300028379 | Bacteria | 1804 |
| 899 | Ga0268266_10588732 | 3300028379 | Bacteria | 1068 |
| 900 | Ga0268266_10734807 | 3300028379 | Bacteria | 952 |
| 901 | Ga0268266_10747995 | 3300028379 | Bacteria | 943 |
| 902 | Ga0268265_10002253 | 3300028380 | Bacteria | 14759 |
| 903 | Ga0268265_10072751 | 3300028380 | Bacteria | 2682 |
| 904 | Ga0268265_10255958 | 3300028380 | Bacteria | 1553 |
| 905 | Ga0268264_10004708 | 3300028381 | Bacteria | 11595 |
| 906 | Ga0268264_10016894 | 3300028381 | Bacteria | 5974 |
| 907 | Ga0268264_10032913 | 3300028381 | Bacteria | 4254 |
| 908 | Ga0268264_10510910 | 3300028381 | Bacteria | 1173 |
| 909 | Ga0307517_10000102 | 3300028786 | Bacteria | 123775 |
| 910 | Ga0307511_10000269 | 3300030521 | Bacteria | 54080 |
| 911 | Ga0265332_10118070 | 3300031238 | Bacteria | 1115 |
| 912 | Ga0265328_10071118 | 3300031239 | Bacteria | 1279 |
| 913 | Ga0265340_10030010 | 3300031247 | Bacteria | 2728 |
| 914 | Ga0265339_10110557 | 3300031249 | Bacteria | 1422 |
| 915 | Ga0265316_10028234 | 3300031344 | Bacteria | 4631 |
| 916 | Ga0265316_10158346 | 3300031344 | Bacteria | 1694 |
| 917 | Ga0307509_10139585 | 3300031507 | Bacteria | 2362 |
| 918 | Ga0307408_100261023 | 3300031548 | Bacteria | 1434 |
| 919 | Ga0307508_10215758 | 3300031616 | Bacteria | 1519 |
| 920 | Ga0307516_10036663 | 3300031730 | Bacteria | 4907 |
| 921 | Ga0307405_10306430 | 3300031731 | Bacteria | 1207 |
| 922 | Ga0307413_10121182 | 3300031824 | Bacteria | 1772 |
| 923 | Ga0307410_10233390 | 3300031852 | Bacteria | 1422 |
| 924 | Ga0307407_10187867 | 3300031903 | Bacteria | 1375 |
| 925 | Ga0307412_10289483 | 3300031911 | Bacteria | 1290 |
| 926 | Ga0307412_10753256 | 3300031911 | Bacteria | 841 |
| 927 | Ga0307409_100448725 | 3300031995 | Bacteria | 1244 |
| 928 | Ga0307409_100952146 | 3300031995 | Bacteria | 874 |
| 929 | Ga0307411_10065049 | 3300032005 | Bacteria | 2444 |
| 930 | Ga0307411_10118477 | 3300032005 | Bacteria | 1910 |
| 931 | Ga0307411_10168777 | 3300032005 | Bacteria | 1648 |
| 932 | Ga0307415_100428961 | 3300032126 | Bacteria | 1137 |
| 933 | Ga0307415_100657546 | 3300032126 | Bacteria | 940 |
| 934 | Ga0307510_10027691 | 3300033180 | Bacteria | 6487 |
| 935 | Ga0307510_10069562 | 3300033180 | Bacteria | 3524 |
| 936 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 937 | Ga0373950_0001102 | 3300034818 | Bacteria | 3453 |
| 938 | Ga0373958_0002389 | 3300034819 | Bacteria | 2622 |
| 939 | Ga0373938_0001160 | 3300034957 | Bacteria | 4244 |
| 940 | Ga0373926_0002880 | 3300035083 | Bacteria | 5512 |
| 941 | Ga0373928_0014131 | 3300035084 | Bacteria | 1610 |
| 942 | Ga0373934_0054354 | 3300035086 | Bacteria | 1590 |
| 943 | Ga0373934_0056776 | 3300035086 | Bacteria | 1557 |
| 944 | Ga0373940_0011418 | 3300035088 | Bacteria | 2109 |
| 945 | Ga0373944_0019486 | 3300035089 | Bacteria | 1947 |
| 946 | Ga0373949_0000927 | 3300035090 | Bacteria | 9141 |
| 947 | Ga0373951_0002101 | 3300035091 | Bacteria | 5104 |
| 948 | Ga0373951_0073904 | 3300035091 | Bacteria | 873 |
| 949 | Ga0373923_0002326 | 3300035111 | Bacteria | 5821 |
| 950 | Ga0373923_0040341 | 3300035111 | Bacteria | 1921 |
| 951 | Ga0373932_0006222 | 3300035112 | Bacteria | 2820 |
| 952 | Ga0373932_0014847 | 3300035112 | Bacteria | 1965 |
| 953 | Ga0373932_0058549 | 3300035112 | Bacteria | 1164 |
| 954 | Ga0373936_0005468 | 3300035113 | Bacteria | 4793 |
| 955 | Ga0373936_0018584 | 3300035113 | Bacteria | 2686 |
| 956 | Ga0373936_0150221 | 3300035113 | Bacteria | 1010 |
| 957 | Ga0373939_0001513 | 3300035114 | Bacteria | 5637 |
| 958 | Ga0373939_0029562 | 3300035114 | Bacteria | 1569 |
| 959 | Ga0373939_0041635 | 3300035114 | Bacteria | 1385 |
| 960 | Ga0373941_0000449 | 3300035115 | Bacteria | 8206 |
| 961 | Ga0373941_0002582 | 3300035115 | Bacteria | 4010 |
| 962 | Ga0373941_0004659 | 3300035115 | Bacteria | 3181 |
| 963 | Ga0373941_0105772 | 3300035115 | Bacteria | 986 |
| 964 | Ga0373945_0010695 | 3300035116 | Bacteria | 3026 |
| 965 | Ga0373953_0000420 | 3300035117 | Bacteria | 11547 |
| 966 | Ga0373953_0014626 | 3300035117 | Bacteria | 2827 |
| 967 | Ga0373953_0021876 | 3300035117 | Bacteria | 2405 |
| 968 | Ga0373953_0076725 | 3300035117 | Bacteria | 1385 |
| 969 | Ga0373953_0164912 | 3300035117 | Bacteria | 953 |
| 970 | Ga0373954_0000663 | 3300035118 | Bacteria | 13181 |
| 971 | Ga0373954_0056577 | 3300035118 | Bacteria | 1846 |
| 972 | Ga0373954_0062480 | 3300035118 | Bacteria | 1759 |
| 973 | Ga0373956_0000275 | 3300035119 | Bacteria | 20650 |
| 974 | Ga0373956_0103162 | 3300035119 | Bacteria | 1324 |
| 975 | Ga0373957_0000426 | 3300035120 | Bacteria | 10649 |
| 976 | Ga0373957_0049589 | 3300035120 | Bacteria | 1603 |
| 977 | Ga0373957_0050517 | 3300035120 | Bacteria | 1589 |
| 978 | Ga0373957_0126366 | 3300035120 | Bacteria | 1038 |
| 979 | Ga0373957_0139518 | 3300035120 | Bacteria | 990 |
| 980 | Ga0373957_0151219 | 3300035120 | Bacteria | 953 |
| 981 | Ga0373960_0003445 | 3300035121 | Bacteria | 3583 |
| 982 | Ga0373960_0080636 | 3300035121 | Bacteria | 1024 |
| 983 | Ga0373943_0000424 | 3300035170 | Bacteria | 17836 |
| 984 | Ga0373943_0006136 | 3300035170 | Bacteria | 5399 |
| 985 | Ga0373943_0028636 | 3300035170 | Bacteria | 2626 |
| 986 | Ga0373943_0046732 | 3300035170 | Bacteria | 2113 |
| 987 | Ga0373943_0118531 | 3300035170 | Bacteria | 1404 |
| 988 | Ga0373946_0003275 | 3300035171 | Bacteria | 5751 |
| 989 | Ga0373946_0031028 | 3300035171 | Bacteria | 2137 |
| 990 | Ga0373955_0000510 | 3300035172 | Bacteria | 16513 |
| 991 | Ga0373955_0016347 | 3300035172 | Bacteria | 3650 |
| 992 | Ga0373955_0056665 | 3300035172 | Bacteria | 2150 |
| 993 | Ga0373942_0027753 | 3300035207 | Bacteria | 1475 |
| 994 | Ga0373962_0003492 | 3300035242 | Bacteria | 3777 |
| 995 | Ga0373924_0004208 | 3300035410 | Bacteria | 5014 |
| 996 | Ga0373924_0066506 | 3300035410 | Bacteria | 1515 |
| 997 | Ga0373931_0001672 | 3300035691 | Bacteria | 9597 |
| 998 | Ga0373931_0006356 | 3300035691 | Bacteria | 5516 |
| 999 | Ga0373931_0008479 | 3300035691 | Bacteria | 4878 |
| 1000 | Ga0373931_0066158 | 3300035691 | Bacteria | 1960 |
| 1001 | Ga0373931_0089514 | 3300035691 | Bacteria | 1712 |
| 1002 | Ga0373931_0313329 | 3300035691 | Bacteria | 972 |
| 1003 | Ga0373931_0325217 | 3300035691 | Bacteria | 956 |
| 1004 | Ga0373935_0000229 | 3300035692 | Bacteria | 27393 |
| 1005 | Ga0373935_0000882 | 3300035692 | Bacteria | 16207 |
| 1006 | Ga0373935_0019969 | 3300035692 | Bacteria | 4089 |
| 1007 | Ga0373935_0218091 | 3300035692 | Bacteria | 1324 |
| 1008 | Ga0373935_0286870 | 3300035692 | Bacteria | 1160 |
| 1009 | Ga0373927_0000071 | 3300035695 | Bacteria | 73794 |
| 1010 | Ga0373927_0000414 | 3300035695 | Bacteria | 32784 |
| 1011 | Ga0373927_0007062 | 3300035695 | Bacteria | 7614 |
| 1012 | Ga0373927_0011507 | 3300035695 | Bacteria | 5895 |
| 1013 | Ga0373927_0025829 | 3300035695 | Bacteria | 3839 |
| 1014 | Ga0373927_0030092 | 3300035695 | Bacteria | 3542 |
| 1015 | Ga0373927_0099124 | 3300035695 | Bacteria | 1895 |
| 1016 | Ga0373927_0103253 | 3300035695 | Bacteria | 1855 |
| 1017 | Ga0373927_0284219 | 3300035695 | Bacteria | 1088 |
| 1018 | Ga0373927_0332372 | 3300035695 | Bacteria | 1001 |
| 1019 | Ga0373927_0528331 | 3300035695 | Bacteria | 780 |
| 1020 | Ga0373933_0004204 | 3300035724 | Bacteria | 7938 |
| 1021 | Ga0373933_0029183 | 3300035724 | Bacteria | 3187 |
| 1022 | Ga0373933_0034112 | 3300035724 | Bacteria | 2964 |
| 1023 | Ga0373933_0239607 | 3300035724 | Bacteria | 1166 |
| 1024 | Ga0373933_0286839 | 3300035724 | Bacteria | 1064 |
| 1025 | Ga0373947_0000275 | 3300035725 | Bacteria | 29242 |
| 1026 | Ga0373947_0000540 | 3300035725 | Bacteria | 22139 |
| 1027 | Ga0373947_0003876 | 3300035725 | Bacteria | 8805 |
| 1028 | Ga0373947_0004993 | 3300035725 | Bacteria | 7766 |
| 1029 | Ga0373947_0017419 | 3300035725 | Bacteria | 4132 |
| 1030 | Ga0373947_0036936 | 3300035725 | Bacteria | 2897 |
| 1031 | Ga0373947_0147132 | 3300035725 | Bacteria | 1515 |
| 1032 | Ga0373947_0258951 | 3300035725 | Bacteria | 1152 |
| 1033 | Ga0373937_0031431 | 3300036401 | Bacteria | 4811 |
| 1034 | Ga0373937_0039136 | 3300036401 | Bacteria | 4322 |
| 1035 | Ga0373937_0045462 | 3300036401 | Bacteria | 4012 |
| 1036 | Ga0373937_0045643 | 3300036401 | Bacteria | 4004 |
| 1037 | Ga0373937_0070190 | 3300036401 | Bacteria | 3231 |
| 1038 | Ga0373937_0193491 | 3300036401 | Bacteria | 1911 |
| 1039 | Ga0373937_0212345 | 3300036401 | Bacteria | 1821 |
| 1040 | Ga0373937_0261930 | 3300036401 | Bacteria | 1630 |
| 1041 | Ga0373937_0389320 | 3300036401 | Bacteria | 1322 |
| 1042 | Ga0373925_0002725 | 3300037068 | Bacteria | 13982 |
| 1043 | Ga0373925_0030853 | 3300037068 | Bacteria | 3936 |
| 1044 | Ga0373925_0040457 | 3300037068 | Bacteria | 3451 |
| 1045 | Ga0373925_0054967 | 3300037068 | Bacteria | 2979 |
| 1046 | Ga0373925_0087640 | 3300037068 | Bacteria | 2376 |
| 1047 | Ga0373925_0100456 | 3300037068 | Bacteria | 2223 |
| 1048 | Ga0373925_0120831 | 3300037068 | Bacteria | 2033 |
| 1049 | Ga0373925_0206794 | 3300037068 | Bacteria | 1563 |
| 1050 | Ga0373925_0391554 | 3300037068 | Bacteria | 1132 |
| 1051 | Ga0373925_0457061 | 3300037068 | Bacteria | 1046 |
| 1052 | Ga0373925_0471153 | 3300037068 | Bacteria | 1030 |
| 1053 | Ga0395899_0008599 | 3300037312 | Bacteria | 7860 |
| 1054 | Ga0395899_0171700 | 3300037312 | Bacteria | 1527 |
| 1055 | Ga0395900_0013738 | 3300037418 | Bacteria | 8266 |
| 1056 | Ga0395900_0021345 | 3300037418 | Bacteria | 6619 |
| 1057 | Ga0395900_0054470 | 3300037418 | Bacteria | 4119 |
| 1058 | Ga0395900_0259612 | 3300037418 | Bacteria | 1736 |
| 1059 | Ga0395900_0796875 | 3300037418 | Bacteria | 873 |
| 1060 | Ga0395898_0006919 | 3300037466 | Bacteria | 12054 |
| 1061 | Ga0395898_0024139 | 3300037466 | Bacteria | 6136 |
| 1062 | Ga0395898_0065456 | 3300037466 | Bacteria | 3524 |
| 1063 | Ga0395898_0140754 | 3300037466 | Bacteria | 2310 |
| 1064 | Ga0395905_0030266 | 3300037471 | Bacteria | 5102 |
| 1065 | Ga0395905_0176477 | 3300037471 | Bacteria | 2006 |
| 1066 | Ga0395905_0284582 | 3300037471 | Bacteria | 1540 |
| 1067 | Ga0395905_0577770 | 3300037471 | Bacteria | 1025 |
| 1068 | Ga0436364_0066511 | 3300037853 | Bacteria | 1328 |
| 1069 | Ga0436364_0680312 | 3300037853 | Bacteria | 1567 |
| 1070 | Ga0395901_0005295 | 3300038443 | Bacteria | 13040 |
| 1071 | Ga0395901_0025268 | 3300038443 | Bacteria | 6097 |
| 1072 | Ga0395901_0157594 | 3300038443 | Bacteria | 2384 |
| 1073 | Ga0395901_0222005 | 3300038443 | Bacteria | 1975 |
| 1074 | Ga0395901_0566758 | 3300038443 | Bacteria | 1149 |
| 1075 | Ga0395901_0896520 | 3300038443 | Bacteria | 869 |
| 1076 | Ga0436365_0290905 | 3300039437 | Bacteria | 1072 |
| 1077 | Ga0436365_0643464 | 3300039437 | Bacteria | 2985 |
| 1078 | Ga0436365_0906128 | 3300039437 | Bacteria | 7419 |
| 1079 | Ga0436365_1318098 | 3300039437 | Bacteria | 1012 |
| 1080 | Ga0436365_1835535 | 3300039437 | Bacteria | 1691 |
| 1081 | Ga0436365_1883031 | 3300039437 | Bacteria | 10380 |
| 1082 | Ga0436360_0160052 | 3300039438 | Bacteria | 1084 |
| 1083 | Ga0436360_0336915 | 3300039438 | Bacteria | 1525 |
| 1084 | Ga0436360_0347139 | 3300039438 | Bacteria | 1440 |
| 1085 | Ga0436360_0372244 | 3300039438 | Bacteria | 1021 |
| 1086 | Ga0436360_0467044 | 3300039438 | Bacteria | 14377 |
| 1087 | Ga0436361_0486257 | 3300039447 | Bacteria | 2823 |
| 1088 | Ga0436361_0927272 | 3300039447 | Bacteria | 4436 |
| 1089 | Ga0436361_1221223 | 3300039447 | Bacteria | 2181 |
| 1090 | Ga0436363_1356934 | 3300039450 | Bacteria | 848 |
| 1091 | Ga0436363_1697326 | 3300039450 | Bacteria | 1541 |
| 1092 | Ga0436362_0313826 | 3300039453 | Bacteria | 1179 |
| 1093 | Ga0436362_0755152 | 3300039453 | Bacteria | 1378 |
| 1094 | Ga0436362_0815359 | 3300039453 | Bacteria | 2728 |
| 1095 | Ga0439465_0041847 | 3300041413 | Bacteria | 1484 |
| 1096 | Ga0451793_0668962 | 3300041452 | Bacteria | 892 |
| 1097 | Ga0451795_0064442 | 3300041456 | Bacteria | 1167 |
| 1098 | Ga0451800_0438865 | 3300041459 | Bacteria | 1622 |
| 1099 | Ga0451835_1226713 | 3300041492 | Bacteria | 790 |
| 1100 | Ga0451847_0960825 | 3300041503 | Bacteria | 972 |
| 1101 | Ga0451577_0047462 | 3300042876 | Bacteria | 3840 |
| 1102 | Ga0466969_0016988 | 3300044656 | Bacteria | 3802 |
| 1103 | Ga0466972_0000193 | 3300044658 | Bacteria | 46863 |
| 1104 | Ga0466972_0014447 | 3300044658 | Bacteria | 3954 |
| 1105 | Ga0453683_0025310 | 3300044673 | Bacteria | 3772 |
| 1106 | Ga0466965_0176727 | 3300044683 | Bacteria | 1125 |
| 1107 | Ga0466966_0000551 | 3300044684 | Bacteria | 23873 |
| 1108 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 1109 | Ga0466963_0014002 | 3300044694 | Bacteria | 4939 |
| 1110 | Ga0466963_0119916 | 3300044694 | Bacteria | 1809 |
| 1111 | Ga0466963_0231314 | 3300044694 | Bacteria | 1295 |
| 1112 | Ga0453684_0024772 | 3300044712 | Bacteria | 8747 |
| 1113 | Ga0466968_0009179 | 3300044735 | Bacteria | 3803 |
| 1114 | Ga0466957_0076196 | 3300044842 | Bacteria | 2082 |
| 1115 | Ga0466960_0039543 | 3300044901 | Bacteria | 2225 |
| 1116 | Ga0466959_0037674 | 3300045049 | Bacteria | 3574 |
| 1117 | Ga0451576_0030558 | 3300045051 | Bacteria | 5756 |
| 1118 | Ga0451576_0034448 | 3300045051 | Bacteria | 5378 |
| 1119 | Ga0451576_0054640 | 3300045051 | Bacteria | 4181 |
| 1120 | Ga0451576_0076080 | 3300045051 | Bacteria | 3494 |
| 1121 | Ga0451576_0274464 | 3300045051 | Bacteria | 1762 |
| 1122 | Ga0466967_0002756 | 3300045976 | Bacteria | 11112 |
| 1123 | Ga0466967_0014710 | 3300045976 | Bacteria | 6109 |
| 1124 | Ga0466967_0070110 | 3300045976 | Bacteria | 3135 |
| 1125 | Ga0466967_0100278 | 3300045976 | Bacteria | 2646 |
| 1126 | Ga0495617_026442 | 3300046452 | Bacteria | 1954 |
| 1127 | Ga0495592_0003051 | 3300046454 | Bacteria | 11938 |
| 1128 | Ga0495592_0003383 | 3300046454 | Bacteria | 11439 |
| 1129 | Ga0495592_0036322 | 3300046454 | Bacteria | 3711 |
| 1130 | Ga0495592_0049426 | 3300046454 | Bacteria | 3126 |
| 1131 | Ga0495592_0058136 | 3300046454 | Bacteria | 2852 |
| 1132 | Ga0495592_0160159 | 3300046454 | Bacteria | 1549 |
| 1133 | Ga0495603_0000035 | 3300046455 | Bacteria | 57510 |
| 1134 | Ga0495603_0001059 | 3300046455 | Bacteria | 15931 |
| 1135 | Ga0495603_0006718 | 3300046455 | Bacteria | 6905 |
| 1136 | Ga0495603_0007225 | 3300046455 | Bacteria | 6667 |
| 1137 | Ga0495603_0021313 | 3300046455 | Bacteria | 3925 |
| 1138 | Ga0495603_0048434 | 3300046455 | Bacteria | 2530 |
| 1139 | Ga0495603_0132535 | 3300046455 | Bacteria | 1451 |
| 1140 | Ga0495603_0386525 | 3300046455 | Bacteria | 802 |
| 1141 | Ga0495590_0039422 | 3300046457 | Bacteria | 1648 |
| 1142 | Ga0495590_0103306 | 3300046457 | Bacteria | 1013 |
| 1143 | Ga0495590_0172169 | 3300046457 | Bacteria | 789 |
| 1144 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 1145 | Ga0495629_0000269 | 3300046459 | Bacteria | 45206 |
| 1146 | Ga0495629_0000612 | 3300046459 | Bacteria | 29083 |
| 1147 | Ga0495629_0011200 | 3300046459 | Bacteria | 6512 |
| 1148 | Ga0495629_0058439 | 3300046459 | Bacteria | 2696 |
| 1149 | Ga0495629_0090143 | 3300046459 | Bacteria | 2139 |
| 1150 | Ga0495629_0129759 | 3300046459 | Bacteria | 1756 |
| 1151 | Ga0495629_0312568 | 3300046459 | Bacteria | 1075 |
| 1152 | Ga0495638_0004483 | 3300046460 | Bacteria | 10577 |
| 1153 | Ga0495638_0105267 | 3300046460 | Bacteria | 1681 |
| 1154 | Ga0495641_0005556 | 3300046461 | Bacteria | 8464 |
| 1155 | Ga0495641_0008400 | 3300046461 | Bacteria | 6307 |
| 1156 | Ga0495641_0019447 | 3300046461 | Bacteria | 3473 |
| 1157 | Ga0495651_0005350 | 3300046462 | Bacteria | 9794 |
| 1158 | Ga0495651_0009999 | 3300046462 | Bacteria | 7292 |
| 1159 | Ga0495651_0030088 | 3300046462 | Bacteria | 4234 |
| 1160 | Ga0495651_0031301 | 3300046462 | Bacteria | 4149 |
| 1161 | Ga0495651_0031832 | 3300046462 | Bacteria | 4112 |
| 1162 | Ga0495651_0113904 | 3300046462 | Bacteria | 1996 |
| 1163 | Ga0495651_0148779 | 3300046462 | Bacteria | 1690 |
| 1164 | Ga0495653_0000399 | 3300046463 | Bacteria | 34847 |
| 1165 | Ga0495653_0036295 | 3300046463 | Bacteria | 3883 |
| 1166 | Ga0495653_0057546 | 3300046463 | Bacteria | 2958 |
| 1167 | Ga0495653_0070117 | 3300046463 | Bacteria | 2624 |
| 1168 | Ga0495653_0153653 | 3300046463 | Bacteria | 1605 |
| 1169 | Ga0495650_0036071 | 3300046471 | Bacteria | 2169 |
| 1170 | Ga0495650_0064595 | 3300046471 | Bacteria | 1455 |
| 1171 | Ga0495580_0000449 | 3300046472 | Bacteria | 34081 |
| 1172 | Ga0495580_0005664 | 3300046472 | Bacteria | 10275 |
| 1173 | Ga0495580_0058049 | 3300046472 | Bacteria | 2723 |
| 1174 | Ga0495580_0058144 | 3300046472 | Bacteria | 2721 |
| 1175 | Ga0495580_0100922 | 3300046472 | Bacteria | 2007 |
| 1176 | Ga0495580_0405326 | 3300046472 | Bacteria | 919 |
| 1177 | Ga0495582_0000021 | 3300046473 | Bacteria | 88264 |
| 1178 | Ga0495582_0024180 | 3300046473 | Bacteria | 3322 |
| 1179 | Ga0495582_0030917 | 3300046473 | Bacteria | 2941 |
| 1180 | Ga0495582_0258821 | 3300046473 | Bacteria | 998 |
| 1181 | Ga0495582_0354229 | 3300046473 | Bacteria | 845 |
| 1182 | Ga0495605_0144926 | 3300046474 | Bacteria | 1063 |
| 1183 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 1184 | Ga0495639_0009316 | 3300046475 | Bacteria | 4210 |
| 1185 | Ga0495639_0162912 | 3300046475 | Bacteria | 1080 |
| 1186 | Ga0495639_0196875 | 3300046475 | Bacteria | 985 |
| 1187 | Ga0495662_0000261 | 3300046476 | Bacteria | 22323 |
| 1188 | Ga0495662_0008429 | 3300046476 | Bacteria | 5070 |
| 1189 | Ga0495662_0016950 | 3300046476 | Bacteria | 3525 |
| 1190 | Ga0495662_0025894 | 3300046476 | Bacteria | 2833 |
| 1191 | Ga0495662_0034302 | 3300046476 | Bacteria | 2450 |
| 1192 | Ga0495662_0088131 | 3300046476 | Bacteria | 1512 |
| 1193 | Ga0495664_0000736 | 3300046477 | Bacteria | 16729 |
| 1194 | Ga0495664_0004738 | 3300046477 | Bacteria | 7434 |
| 1195 | Ga0495664_0007307 | 3300046477 | Bacteria | 6129 |
| 1196 | Ga0495664_0007928 | 3300046477 | Bacteria | 5912 |
| 1197 | Ga0495664_0028294 | 3300046477 | Bacteria | 3273 |
| 1198 | Ga0495664_0092367 | 3300046477 | Bacteria | 1820 |
| 1199 | Ga0495664_0238942 | 3300046477 | Bacteria | 1099 |
| 1200 | Ga0495584_0025120 | 3300046491 | Bacteria | 3020 |
| 1201 | Ga0495585_0001696 | 3300046492 | Bacteria | 16820 |
| 1202 | Ga0495585_0189940 | 3300046492 | Bacteria | 1051 |
| 1203 | Ga0495585_0278597 | 3300046492 | Bacteria | 827 |
| 1204 | Ga0495594_0000979 | 3300046499 | Bacteria | 14837 |
| 1205 | Ga0495594_0021023 | 3300046499 | Bacteria | 3481 |
| 1206 | Ga0495594_0292065 | 3300046499 | Bacteria | 929 |
| 1207 | Ga0495607_0014000 | 3300046501 | Bacteria | 5238 |
| 1208 | Ga0495583_0138614 | 3300046506 | Bacteria | 1014 |
| 1209 | Ga0495606_0001170 | 3300046507 | Bacteria | 37016 |
| 1210 | Ga0495606_0146458 | 3300046507 | Bacteria | 1390 |
| 1211 | Ga0495608_0001226 | 3300046511 | Bacteria | 18178 |
| 1212 | Ga0495608_0016478 | 3300046511 | Bacteria | 5114 |
| 1213 | Ga0495608_0021826 | 3300046511 | Bacteria | 4391 |
| 1214 | Ga0495608_0031182 | 3300046511 | Bacteria | 3605 |
| 1215 | Ga0495608_0034772 | 3300046511 | Bacteria | 3401 |
| 1216 | Ga0495608_0069160 | 3300046511 | Bacteria | 2307 |
| 1217 | Ga0495608_0089598 | 3300046511 | Bacteria | 1991 |
| 1218 | Ga0495618_0014879 | 3300046514 | Bacteria | 4746 |
| 1219 | Ga0495618_0014997 | 3300046514 | Bacteria | 4726 |
| 1220 | Ga0495618_0026734 | 3300046514 | Bacteria | 3590 |
| 1221 | Ga0495618_0059293 | 3300046514 | Bacteria | 2425 |
| 1222 | Ga0495618_0078648 | 3300046514 | Bacteria | 2102 |
| 1223 | Ga0495618_0293219 | 3300046514 | Bacteria | 1012 |
| 1224 | Ga0495628_0009019 | 3300046516 | Bacteria | 8533 |
| 1225 | Ga0495628_0012048 | 3300046516 | Bacteria | 7293 |
| 1226 | Ga0495628_0029893 | 3300046516 | Bacteria | 4415 |
| 1227 | Ga0495628_0069679 | 3300046516 | Bacteria | 2743 |
| 1228 | Ga0495628_0106266 | 3300046516 | Bacteria | 2162 |
| 1229 | Ga0495628_0435079 | 3300046516 | Bacteria | 954 |
| 1230 | Ga0495628_0533755 | 3300046516 | Bacteria | 844 |
| 1231 | Ga0495630_0002218 | 3300046517 | Bacteria | 13534 |
| 1232 | Ga0495630_0021361 | 3300046517 | Bacteria | 4780 |
| 1233 | Ga0495630_0280144 | 3300046517 | Bacteria | 1274 |
| 1234 | Ga0495630_0283650 | 3300046517 | Bacteria | 1265 |
| 1235 | Ga0495630_0464862 | 3300046517 | Bacteria | 969 |
| 1236 | Ga0495630_0619573 | 3300046517 | Bacteria | 829 |
| 1237 | Ga0495632_0166000 | 3300046519 | Bacteria | 1015 |
| 1238 | Ga0495637_0067395 | 3300046520 | Bacteria | 1453 |
| 1239 | Ga0495637_0099910 | 3300046520 | Bacteria | 1135 |
| 1240 | Ga0495643_0006750 | 3300046522 | Bacteria | 7506 |
| 1241 | Ga0495644_0003755 | 3300046523 | Bacteria | 5977 |
| 1242 | Ga0495648_0212507 | 3300046524 | Bacteria | 960 |
| 1243 | Ga0495663_0032939 | 3300046525 | Bacteria | 1545 |
| 1244 | Ga0495666_0031225 | 3300046526 | Bacteria | 2610 |
| 1245 | Ga0495666_0108952 | 3300046526 | Bacteria | 1302 |
| 1246 | Ga0495652_0006874 | 3300046529 | Bacteria | 10531 |
| 1247 | Ga0495652_0008672 | 3300046529 | Bacteria | 9267 |
| 1248 | Ga0495652_0019786 | 3300046529 | Bacteria | 5990 |
| 1249 | Ga0495652_0079863 | 3300046529 | Bacteria | 2703 |
| 1250 | Ga0495665_0002966 | 3300046531 | Bacteria | 9167 |
| 1251 | Ga0495665_0009534 | 3300046531 | Bacteria | 5259 |
| 1252 | Ga0495665_0024212 | 3300046531 | Bacteria | 3261 |
| 1253 | Ga0495665_0031922 | 3300046531 | Bacteria | 2818 |
| 1254 | Ga0495640_0002964 | 3300046533 | Bacteria | 13677 |
| 1255 | Ga0495640_0013343 | 3300046533 | Bacteria | 6244 |
| 1256 | Ga0495640_0018374 | 3300046533 | Bacteria | 5189 |
| 1257 | Ga0495640_0027630 | 3300046533 | Bacteria | 4090 |
| 1258 | Ga0495640_0032420 | 3300046533 | Bacteria | 3722 |
| 1259 | Ga0495586_0001814 | 3300046535 | Bacteria | 11645 |
| 1260 | Ga0495586_0034389 | 3300046535 | Bacteria | 2722 |
| 1261 | Ga0495586_0248171 | 3300046535 | Bacteria | 1015 |
| 1262 | Ga0495587_0001432 | 3300046536 | Bacteria | 15878 |
| 1263 | Ga0495587_0006986 | 3300046536 | Bacteria | 7331 |
| 1264 | Ga0495587_0015759 | 3300046536 | Bacteria | 4713 |
| 1265 | Ga0495587_0022963 | 3300046536 | Bacteria | 3836 |
| 1266 | Ga0495587_0034748 | 3300046536 | Bacteria | 3039 |
| 1267 | Ga0495587_0059702 | 3300046536 | Bacteria | 2237 |
| 1268 | Ga0495587_0202228 | 3300046536 | Bacteria | 1123 |
| 1269 | Ga0495587_0347696 | 3300046536 | Bacteria | 827 |
| 1270 | Ga0495598_0085697 | 3300046537 | Bacteria | 1018 |
| 1271 | Ga0495598_0108743 | 3300046537 | Bacteria | 927 |
| 1272 | Ga0495598_0122732 | 3300046537 | Bacteria | 882 |
| 1273 | Ga0495621_0082598 | 3300046539 | Bacteria | 1200 |
| 1274 | Ga0495621_0102940 | 3300046539 | Bacteria | 1088 |
| 1275 | Ga0495597_0067621 | 3300046542 | Bacteria | 1545 |
| 1276 | Ga0495645_0001776 | 3300046543 | Bacteria | 14687 |
| 1277 | Ga0495645_0001836 | 3300046543 | Bacteria | 14435 |
| 1278 | Ga0495645_0002109 | 3300046543 | Bacteria | 13497 |
| 1279 | Ga0495645_0008749 | 3300046543 | Bacteria | 7070 |
| 1280 | Ga0495645_0019408 | 3300046543 | Bacteria | 4895 |
| 1281 | Ga0495645_0148712 | 3300046543 | Bacteria | 1629 |
| 1282 | Ga0495645_0466439 | 3300046543 | Bacteria | 794 |
| 1283 | Ga0495622_0008049 | 3300046557 | Bacteria | 4887 |
| 1284 | Ga0495622_0010565 | 3300046557 | Bacteria | 4261 |
| 1285 | Ga0495622_0127322 | 3300046557 | Bacteria | 1161 |
| 1286 | Ga0495633_0056982 | 3300046558 | Bacteria | 1836 |
| 1287 | Ga0495633_0118360 | 3300046558 | Bacteria | 1227 |
| 1288 | Ga0495633_0262006 | 3300046558 | Bacteria | 788 |
| 1289 | Ga0495667_0001452 | 3300046559 | Bacteria | 15607 |
| 1290 | Ga0495667_0008441 | 3300046559 | Bacteria | 6992 |
| 1291 | Ga0495667_0020781 | 3300046559 | Bacteria | 4430 |
| 1292 | Ga0495667_0021237 | 3300046559 | Bacteria | 4380 |
| 1293 | Ga0495667_0023177 | 3300046559 | Bacteria | 4183 |
| 1294 | Ga0495667_0042971 | 3300046559 | Bacteria | 2996 |
| 1295 | Ga0495667_0044112 | 3300046559 | Bacteria | 2953 |
| 1296 | Ga0495667_0206978 | 3300046559 | Bacteria | 1254 |
| 1297 | Ga0495656_0004963 | 3300046615 | Bacteria | 4583 |
| 1298 | Ga0495656_0012418 | 3300046615 | Bacteria | 3142 |
| 1299 | Ga0495668_0025425 | 3300046616 | Bacteria | 3364 |
| 1300 | Ga0495668_0081519 | 3300046616 | Bacteria | 1775 |
| 1301 | Ga0495668_0196923 | 3300046616 | Bacteria | 1103 |
| 1302 | Ga0495634_0000261 | 3300046642 | Bacteria | 49735 |
| 1303 | Ga0495634_0006321 | 3300046642 | Bacteria | 9017 |
| 1304 | Ga0495634_0011593 | 3300046642 | Bacteria | 6413 |
| 1305 | Ga0495634_0017261 | 3300046642 | Bacteria | 5153 |
| 1306 | Ga0495634_0039498 | 3300046642 | Bacteria | 3213 |
| 1307 | Ga0495634_0072933 | 3300046642 | Bacteria | 2257 |
| 1308 | Ga0495634_0096210 | 3300046642 | Bacteria | 1917 |
| 1309 | Ga0495611_0004521 | 3300046648 | Bacteria | 6000 |
| 1310 | Ga0495611_0054665 | 3300046648 | Bacteria | 1805 |
| 1311 | Ga0495611_0163640 | 3300046648 | Bacteria | 1040 |
| 1312 | Ga0495625_0049301 | 3300046660 | Bacteria | 3028 |
| 1313 | Ga0495625_0256375 | 3300046660 | Bacteria | 1133 |
| 1314 | Ga0495635_0000088 | 3300046663 | Bacteria | 54355 |
| 1315 | Ga0495635_0000438 | 3300046663 | Bacteria | 26330 |
| 1316 | Ga0495635_0001380 | 3300046663 | Bacteria | 16199 |
| 1317 | Ga0495635_0003521 | 3300046663 | Bacteria | 10832 |
| 1318 | Ga0495635_0006545 | 3300046663 | Bacteria | 8131 |
| 1319 | Ga0495635_0017940 | 3300046663 | Bacteria | 4943 |
| 1320 | Ga0495635_0049932 | 3300046663 | Bacteria | 2884 |
| 1321 | Ga0495659_0001977 | 3300046664 | Bacteria | 6744 |
| 1322 | Ga0495661_0054082 | 3300046665 | Bacteria | 2412 |
| 1323 | Ga0495661_0176969 | 3300046665 | Bacteria | 1133 |
| 1324 | Ga0495588_0019653 | 3300046674 | Bacteria | 3311 |
| 1325 | Ga0495588_0051556 | 3300046674 | Bacteria | 2119 |
| 1326 | Ga0495588_0088287 | 3300046674 | Bacteria | 1622 |
| 1327 | Ga0495588_0213546 | 3300046674 | Bacteria | 1019 |
| 1328 | Ga0495657_0008178 | 3300046675 | Bacteria | 8016 |
| 1329 | Ga0495657_0010455 | 3300046675 | Bacteria | 6983 |
| 1330 | Ga0495657_0012948 | 3300046675 | Bacteria | 6176 |
| 1331 | Ga0495657_0041171 | 3300046675 | Bacteria | 3164 |
| 1332 | Ga0495657_0061813 | 3300046675 | Bacteria | 2477 |
| 1333 | Ga0495657_0242498 | 3300046675 | Bacteria | 1087 |
| 1334 | Ga0495657_0319519 | 3300046675 | Bacteria | 923 |
| 1335 | Ga0495599_0001137 | 3300046678 | Bacteria | 15035 |
| 1336 | Ga0495599_0010283 | 3300046678 | Bacteria | 5726 |
| 1337 | Ga0495599_0035710 | 3300046678 | Bacteria | 3121 |
| 1338 | Ga0495599_0082276 | 3300046678 | Bacteria | 2011 |
| 1339 | Ga0495599_0231136 | 3300046678 | Bacteria | 1129 |
| 1340 | Ga0495623_0006628 | 3300046679 | Bacteria | 7538 |
| 1341 | Ga0495623_0010588 | 3300046679 | Bacteria | 5969 |
| 1342 | Ga0495623_0012243 | 3300046679 | Bacteria | 5556 |
| 1343 | Ga0495646_0002433 | 3300046680 | Bacteria | 11422 |
| 1344 | Ga0495646_0022684 | 3300046680 | Bacteria | 3957 |
| 1345 | Ga0495646_0026635 | 3300046680 | Bacteria | 3629 |
| 1346 | Ga0495646_0048965 | 3300046680 | Bacteria | 2566 |
| 1347 | Ga0495646_0057288 | 3300046680 | Bacteria | 2333 |
| 1348 | Ga0495646_0088987 | 3300046680 | Bacteria | 1787 |
| 1349 | Ga0495647_0003550 | 3300046681 | Bacteria | 4998 |
| 1350 | Ga0495647_0054257 | 3300046681 | Bacteria | 1565 |
| 1351 | Ga0495658_0000771 | 3300046683 | Bacteria | 17323 |
| 1352 | Ga0495658_0000892 | 3300046683 | Bacteria | 16047 |
| 1353 | Ga0495613_0027628 | 3300046689 | Bacteria | 4223 |
| 1354 | Ga0495613_0040776 | 3300046689 | Bacteria | 3439 |
| 1355 | Ga0495613_0045342 | 3300046689 | Bacteria | 3252 |
| 1356 | Ga0495613_0053833 | 3300046689 | Bacteria | 2960 |
| 1357 | Ga0495613_0100556 | 3300046689 | Bacteria | 2088 |
| 1358 | Ga0495613_0111521 | 3300046689 | Bacteria | 1970 |
| 1359 | Ga0495613_0181685 | 3300046689 | Bacteria | 1489 |
| 1360 | Ga0495613_0273999 | 3300046689 | Bacteria | 1173 |
| 1361 | Ga0495613_0508572 | 3300046689 | Bacteria | 810 |
| 1362 | Ga0495624_0000682 | 3300046690 | Bacteria | 26624 |
| 1363 | Ga0495624_0001570 | 3300046690 | Bacteria | 17622 |
| 1364 | Ga0495624_0099630 | 3300046690 | Bacteria | 1789 |
| 1365 | Ga0495624_0115349 | 3300046690 | Bacteria | 1651 |
| 1366 | Ga0495624_0120586 | 3300046690 | Bacteria | 1610 |
| 1367 | Ga0495624_0217723 | 3300046690 | Bacteria | 1158 |
| 1368 | Ga0495624_0222201 | 3300046690 | Bacteria | 1145 |
| 1369 | Ga0495624_0236040 | 3300046690 | Bacteria | 1107 |
| 1370 | Ga0495624_0368895 | 3300046690 | Bacteria | 863 |
| 1371 | Ga0495670_0011391 | 3300046691 | Bacteria | 4373 |
| 1372 | Ga0495671_0078355 | 3300046692 | Bacteria | 1620 |
| 1373 | Ga0495671_0320799 | 3300046692 | Bacteria | 744 |
| 1374 | Ga0495649_0119141 | 3300046694 | Bacteria | 1396 |
| 1375 | Ga0495589_0033211 | 3300046794 | Bacteria | 2593 |
| 1376 | Ga0495600_0000484 | 3300046809 | Bacteria | 20528 |
| 1377 | Ga0495600_0010662 | 3300046809 | Bacteria | 5709 |
| 1378 | Ga0495600_0018989 | 3300046809 | Bacteria | 4387 |
| 1379 | Ga0495600_0023629 | 3300046809 | Bacteria | 3955 |
| 1380 | Ga0495600_0041250 | 3300046809 | Bacteria | 3007 |
| 1381 | Ga0495600_0072934 | 3300046809 | Bacteria | 2242 |
| 1382 | Ga0495660_0150270 | 3300046810 | Bacteria | 1151 |
| 1383 | Ga0495581_0000018 | 3300047315 | Bacteria | 58791 |
| 1384 | Ga0495581_0012302 | 3300047315 | Bacteria | 4958 |
| 1385 | Ga0495581_0025033 | 3300047315 | Bacteria | 3459 |
| 1386 | Ga0495581_0077638 | 3300047315 | Bacteria | 1922 |
| 1387 | Ga0495581_0114277 | 3300047315 | Bacteria | 1570 |
| 1388 | Ga0495604_0002253 | 3300047317 | Bacteria | 15447 |
| 1389 | Ga0495604_0005171 | 3300047317 | Bacteria | 10334 |
| 1390 | Ga0495604_0007540 | 3300047317 | Bacteria | 8607 |
| 1391 | Ga0495604_0027161 | 3300047317 | Bacteria | 4554 |
| 1392 | Ga0495604_0048968 | 3300047317 | Bacteria | 3285 |
| 1393 | Ga0495604_0052328 | 3300047317 | Bacteria | 3163 |
| 1394 | Ga0495604_0159461 | 3300047317 | Bacteria | 1595 |
| 1395 | Ga0495604_0223755 | 3300047317 | Bacteria | 1294 |
| 1396 | Ga0495604_0532106 | 3300047317 | Bacteria | 759 |
| 1397 | Ga0495636_0177866 | 3300047318 | Bacteria | 964 |
| 1398 | Ga0495674_0000209 | 3300047319 | Bacteria | 48240 |
| 1399 | Ga0495674_0001257 | 3300047319 | Bacteria | 24613 |
| 1400 | Ga0495674_0006731 | 3300047319 | Bacteria | 11003 |
| 1401 | Ga0495674_0021689 | 3300047319 | Bacteria | 5939 |
| 1402 | Ga0495674_0024470 | 3300047319 | Bacteria | 5548 |
| 1403 | Ga0495674_0074686 | 3300047319 | Bacteria | 2918 |
| 1404 | Ga0495674_0120810 | 3300047319 | Bacteria | 2213 |
| 1405 | Ga0495674_0237631 | 3300047319 | Bacteria | 1502 |
| 1406 | Ga0495674_0708636 | 3300047319 | Bacteria | 789 |
| 1407 | Ga0495672_0039117 | 3300047320 | Bacteria | 2886 |
| 1408 | Ga0495676_0033822 | 3300047321 | Bacteria | 4297 |
| 1409 | Ga0495676_0067018 | 3300047321 | Bacteria | 2779 |
| 1410 | Ga0495676_0086311 | 3300047321 | Bacteria | 2362 |
| 1411 | Ga0495676_0104485 | 3300047321 | Bacteria | 2090 |
| 1412 | Ga0495676_0153223 | 3300047321 | Bacteria | 1638 |
| 1413 | Ga0495676_0244022 | 3300047321 | Bacteria | 1228 |
| 1414 | Ga0495680_0004231 | 3300047322 | Bacteria | 13778 |
| 1415 | Ga0495680_0006139 | 3300047322 | Bacteria | 11212 |
| 1416 | Ga0495680_0013803 | 3300047322 | Bacteria | 7030 |
| 1417 | Ga0495680_0024657 | 3300047322 | Bacteria | 4987 |
| 1418 | Ga0495680_0046879 | 3300047322 | Bacteria | 3405 |
| 1419 | Ga0495680_0064241 | 3300047322 | Bacteria | 2815 |
| 1420 | Ga0495680_0123588 | 3300047322 | Bacteria | 1909 |
| 1421 | Ga0495687_046397 | 3300047443 | Bacteria | 1876 |
| 1422 | Ga0495675_0000977 | 3300047444 | Bacteria | 17351 |
| 1423 | Ga0495675_0006091 | 3300047444 | Bacteria | 7382 |
| 1424 | Ga0495675_0010571 | 3300047444 | Bacteria | 5769 |
| 1425 | Ga0495675_0060191 | 3300047444 | Bacteria | 2407 |
| 1426 | Ga0495675_0069346 | 3300047444 | Bacteria | 2226 |
| 1427 | Ga0495677_0029191 | 3300047445 | Bacteria | 2005 |
| 1428 | Ga0495679_029497 | 3300047446 | Bacteria | 1789 |
| 1429 | Ga0495673_0051765 | 3300047469 | Bacteria | 1797 |
| 1430 | Ga0495681_0038580 | 3300047470 | Bacteria | 2340 |
| 1431 | Ga0495684_0001326 | 3300047471 | Bacteria | 19921 |
| 1432 | Ga0495684_0001766 | 3300047471 | Bacteria | 17346 |
| 1433 | Ga0495684_0003044 | 3300047471 | Bacteria | 13189 |
| 1434 | Ga0495684_0003129 | 3300047471 | Bacteria | 12980 |
| 1435 | Ga0495684_0049314 | 3300047471 | Bacteria | 3217 |
| 1436 | Ga0495684_0052451 | 3300047471 | Bacteria | 3112 |
| 1437 | Ga0495684_0052531 | 3300047471 | Bacteria | 3110 |
| 1438 | Ga0495686_0224797 | 3300047472 | Bacteria | 1066 |
| 1439 | Ga0495593_0000072 | 3300047673 | Bacteria | 43039 |
| 1440 | Ga0495593_0000566 | 3300047673 | Bacteria | 21032 |
| 1441 | Ga0495593_0002269 | 3300047673 | Bacteria | 11530 |
| 1442 | Ga0495593_0015862 | 3300047673 | Bacteria | 4257 |
| 1443 | Ga0495593_0185378 | 3300047673 | Bacteria | 1048 |
| 1444 | Ga0495602_0001719 | 3300048088 | Bacteria | 21809 |
| 1445 | Ga0495602_0004704 | 3300048088 | Bacteria | 14269 |
| 1446 | Ga0495602_0024014 | 3300048088 | Bacteria | 5922 |
| 1447 | Ga0495602_0087538 | 3300048088 | Bacteria | 2596 |
| 1448 | Ga0495602_0430429 | 3300048088 | Bacteria | 935 |
| 1449 | Ga0495602_0649444 | 3300048088 | Bacteria | 721 |
| 1450 | Ga0495614_0036953 | 3300048089 | Bacteria | 2096 |
| 1451 | Ga0495615_0014600 | 3300048090 | Bacteria | 1664 |
| 1452 | Ga0496100_0005319 | 3300048903 | Bacteria | 6918 |
| 1453 | Ga0496100_0153339 | 3300048903 | Bacteria | 1646 |
| 1454 | Ga0496100_0226189 | 3300048903 | Bacteria | 1375 |
| 1455 | Ga0496100_0274498 | 3300048903 | Bacteria | 1255 |
| 1456 | Ga0496101_0001907 | 3300048904 | Bacteria | 12604 |
| 1457 | Ga0496101_0057214 | 3300048904 | Bacteria | 2819 |
| 1458 | Ga0496101_0094499 | 3300048904 | Bacteria | 2228 |
| 1459 | Ga0496101_0292434 | 3300048904 | Bacteria | 1275 |
| 1460 | Ga0496101_0315057 | 3300048904 | Bacteria | 1227 |
| 1461 | Ga0496101_0329958 | 3300048904 | Bacteria | 1197 |
| 1462 | Ga0496101_0378703 | 3300048904 | Bacteria | 1113 |
| 1463 | Ga0496101_0430554 | 3300048904 | Bacteria | 1040 |
| 1464 | Ga0496102_0010809 | 3300048905 | Bacteria | 7862 |
| 1465 | Ga0496102_0017860 | 3300048905 | Bacteria | 6220 |
| 1466 | Ga0496102_0019492 | 3300048905 | Bacteria | 5974 |
| 1467 | Ga0496102_0324782 | 3300048905 | Bacteria | 1449 |
| 1468 | Ga0496102_0611337 | 3300048905 | Bacteria | 1013 |
| 1469 | Ga0496103_0001565 | 3300048906 | Bacteria | 15132 |
| 1470 | Ga0496103_0047327 | 3300048906 | Bacteria | 2657 |
| 1471 | Ga0496103_0080656 | 3300048906 | Bacteria | 2046 |
| 1472 | Ga0496103_0112794 | 3300048906 | Bacteria | 1728 |
| 1473 | Ga0496103_0237458 | 3300048906 | Bacteria | 1172 |
| 1474 | Ga0496104_0002128 | 3300048907 | Bacteria | 17188 |
| 1475 | Ga0496104_0049007 | 3300048907 | Bacteria | 3983 |
| 1476 | Ga0496104_0083814 | 3300048907 | Bacteria | 3041 |
| 1477 | Ga0496104_0106223 | 3300048907 | Bacteria | 2690 |
| 1478 | Ga0496104_0178751 | 3300048907 | Bacteria | 2032 |
| 1479 | Ga0496104_0264469 | 3300048907 | Bacteria | 1632 |
| 1480 | Ga0496105_0022082 | 3300048908 | Bacteria | 5153 |
| 1481 | Ga0496105_0219624 | 3300048908 | Bacteria | 1547 |
| 1482 | Ga0496105_0321217 | 3300048908 | Bacteria | 1241 |
| 1483 | Ga0496106_0019749 | 3300048909 | Bacteria | 4997 |
| 1484 | Ga0496106_0020041 | 3300048909 | Bacteria | 4960 |
| 1485 | Ga0496106_0217121 | 3300048909 | Bacteria | 1524 |
| 1486 | Ga0496106_0251050 | 3300048909 | Bacteria | 1414 |
| 1487 | Ga0496106_0452910 | 3300048909 | Bacteria | 1031 |
| 1488 | Ga0496106_0507082 | 3300048909 | Bacteria | 969 |
| 1489 | Ga0496107_0001840 | 3300048910 | Bacteria | 13399 |
| 1490 | Ga0496107_0057813 | 3300048910 | Bacteria | 2803 |
| 1491 | Ga0496107_0086918 | 3300048910 | Bacteria | 2282 |
| 1492 | Ga0496107_0304359 | 3300048910 | Bacteria | 1186 |
| 1493 | Ga0496107_0328796 | 3300048910 | Bacteria | 1137 |
| 1494 | Ga0496107_0423238 | 3300048910 | Bacteria | 990 |
| 1495 | Ga0496107_0551691 | 3300048910 | Bacteria | 853 |
| 1496 | Ga0496108_0052175 | 3300048911 | Bacteria | 3426 |
| 1497 | Ga0496108_0134651 | 3300048911 | Bacteria | 2125 |
| 1498 | Ga0496108_0207421 | 3300048911 | Bacteria | 1701 |
| 1499 | Ga0496108_0470939 | 3300048911 | Bacteria | 1097 |
| 1500 | Ga0496109_0000150 | 3300048912 | Bacteria | 68777 |
| 1501 | Ga0496109_0016079 | 3300048912 | Bacteria | 6538 |
| 1502 | Ga0496109_0027717 | 3300048912 | Bacteria | 5061 |
| 1503 | Ga0496109_0052091 | 3300048912 | Bacteria | 3730 |
| 1504 | Ga0496109_0052472 | 3300048912 | Bacteria | 3716 |
| 1505 | Ga0496109_0056795 | 3300048912 | Bacteria | 3571 |
| 1506 | Ga0496109_0521510 | 3300048912 | Bacteria | 1121 |
| 1507 | Ga0496110_0028124 | 3300048913 | Bacteria | 4825 |
| 1508 | Ga0496110_0053806 | 3300048913 | Bacteria | 3540 |
| 1509 | Ga0496110_0123850 | 3300048913 | Bacteria | 2331 |
| 1510 | Ga0496110_0640976 | 3300048913 | Bacteria | 962 |
| 1511 | Ga0496111_0016595 | 3300048914 | Bacteria | 5078 |
| 1512 | Ga0496111_0024135 | 3300048914 | Bacteria | 4278 |
| 1513 | Ga0496111_0143132 | 3300048914 | Bacteria | 1772 |
| 1514 | Ga0496111_0149377 | 3300048914 | Bacteria | 1733 |
| 1515 | Ga0496111_0163513 | 3300048914 | Bacteria | 1653 |
| 1516 | Ga0496111_0181744 | 3300048914 | Bacteria | 1563 |
| 1517 | Ga0496111_0290760 | 3300048914 | Bacteria | 1212 |
| 1518 | Ga0496111_0401403 | 3300048914 | Bacteria | 1013 |
| 1519 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1520 | Ga0496112_0017832 | 3300048915 | Bacteria | 6681 |
| 1521 | Ga0496112_0019008 | 3300048915 | Bacteria | 6477 |
| 1522 | Ga0496112_0020263 | 3300048915 | Bacteria | 6300 |
| 1523 | Ga0496112_0044369 | 3300048915 | Bacteria | 4355 |
| 1524 | Ga0496112_0079630 | 3300048915 | Bacteria | 3241 |
| 1525 | Ga0496112_0213500 | 3300048915 | Bacteria | 1886 |
| 1526 | Ga0496112_0256251 | 3300048915 | Bacteria | 1700 |
| 1527 | Ga0496112_0259874 | 3300048915 | Bacteria | 1686 |
| 1528 | Ga0496112_0294237 | 3300048915 | Bacteria | 1569 |
| 1529 | Ga0496112_0748508 | 3300048915 | Bacteria | 903 |
| 1530 | Ga0496113_0035814 | 3300048916 | Bacteria | 3632 |
| 1531 | Ga0496113_0054096 | 3300048916 | Bacteria | 3004 |
| 1532 | Ga0496113_0148147 | 3300048916 | Bacteria | 1850 |
| 1533 | Ga0496113_0259726 | 3300048916 | Bacteria | 1387 |
| 1534 | Ga0496114_0008932 | 3300048917 | Bacteria | 7944 |
| 1535 | Ga0496114_0025141 | 3300048917 | Bacteria | 4865 |
| 1536 | Ga0496114_0028221 | 3300048917 | Bacteria | 4604 |
| 1537 | Ga0496114_0029850 | 3300048917 | Bacteria | 4483 |
| 1538 | Ga0496114_0650014 | 3300048917 | Bacteria | 927 |
| 1539 | Ga0496114_0859466 | 3300048917 | Bacteria | 787 |
| 1540 | Ga0496115_0001528 | 3300048918 | Bacteria | 16623 |
| 1541 | Ga0496115_0014005 | 3300048918 | Bacteria | 6071 |
| 1542 | Ga0496115_0024954 | 3300048918 | Bacteria | 4651 |
| 1543 | Ga0496115_0394046 | 3300048918 | Bacteria | 1124 |
| 1544 | Ga0496115_0521791 | 3300048918 | Bacteria | 952 |
| 1545 | Ga0496117_0148086 | 3300048920 | Bacteria | 1394 |
| 1546 | Ga0496118_0056637 | 3300048921 | Bacteria | 2945 |
| 1547 | Ga0496118_0271058 | 3300048921 | Bacteria | 951 |
| 1548 | Ga0496119_0051978 | 3300048922 | Bacteria | 2513 |
| 1549 | Ga0496120_0009415 | 3300048923 | Bacteria | 6938 |
| 1550 | Ga0496120_0104879 | 3300048923 | Bacteria | 1487 |
| 1551 | Ga0496121_0109905 | 3300048924 | Bacteria | 2105 |
| 1552 | Ga0496121_0141220 | 3300048924 | Bacteria | 1786 |
| 1553 | Ga0496121_0170687 | 3300048924 | Bacteria | 1580 |
| 1554 | Ga0496121_0188737 | 3300048924 | Bacteria | 1480 |
| 1555 | Ga0496121_0212880 | 3300048924 | Bacteria | 1368 |
| 1556 | Ga0496124_0016688 | 3300048927 | Bacteria | 6967 |
| 1557 | Ga0496124_0453357 | 3300048927 | Bacteria | 874 |
| 1558 | Ga0496125_0150162 | 3300048928 | Bacteria | 1602 |
| 1559 | Ga0496125_0160175 | 3300048928 | Bacteria | 1530 |
| 1560 | Ga0496125_0350792 | 3300048928 | Bacteria | 881 |
| 1561 | Ga0496126_0057994 | 3300048929 | Bacteria | 3492 |
| 1562 | Ga0496126_0180399 | 3300048929 | Bacteria | 1794 |
| 1563 | Ga0496126_0199725 | 3300048929 | Bacteria | 1689 |
| 1564 | Ga0496126_0367099 | 3300048929 | Bacteria | 1174 |
| 1565 | Ga0495682_0064921 | 3300049460 | Bacteria | 1316 |
| 1566 | Ga0501031_0043171 | 3300049568 | Bacteria | 2943 |
| 1567 | Ga0501032_0051419 | 3300049569 | Bacteria | 2778 |
| 1568 | Ga0501032_0340751 | 3300049569 | Bacteria | 966 |
| 1569 | Ga0501033_0149871 | 3300049570 | Bacteria | 1683 |
| 1570 | Ga0501033_0179414 | 3300049570 | Bacteria | 1518 |
| 1571 | Ga0501034_0000516 | 3300049571 | Bacteria | 62005 |
| 1572 | Ga0501034_0001552 | 3300049571 | Bacteria | 30135 |
| 1573 | Ga0501034_0003894 | 3300049571 | Bacteria | 16794 |
| 1574 | Ga0501034_0050571 | 3300049571 | Bacteria | 4191 |
| 1575 | Ga0501034_0078997 | 3300049571 | Bacteria | 3293 |
| 1576 | Ga0501034_0586588 | 3300049571 | Bacteria | 1021 |
| 1577 | Ga0501036_0001269 | 3300049572 | Bacteria | 19346 |
| 1578 | Ga0501036_0020963 | 3300049572 | Bacteria | 5489 |
| 1579 | Ga0501036_0043623 | 3300049572 | Bacteria | 3798 |
| 1580 | Ga0501036_0047889 | 3300049572 | Bacteria | 3619 |
| 1581 | Ga0501037_0003480 | 3300049573 | Bacteria | 11423 |
| 1582 | Ga0501037_0045797 | 3300049573 | Bacteria | 3209 |
| 1583 | Ga0501037_0093001 | 3300049573 | Bacteria | 2180 |
| 1584 | Ga0501037_0346723 | 3300049573 | Bacteria | 1025 |
| 1585 | Ga0501038_0028938 | 3300049574 | Bacteria | 4915 |
| 1586 | Ga0501038_0041063 | 3300049574 | Bacteria | 4035 |
| 1587 | Ga0501038_0073051 | 3300049574 | Bacteria | 2905 |
| 1588 | Ga0501039_0021697 | 3300049575 | Bacteria | 4927 |
| 1589 | Ga0501039_0094523 | 3300049575 | Bacteria | 2330 |
| 1590 | Ga0501039_0562619 | 3300049575 | Bacteria | 894 |
| 1591 | Ga0501040_0007018 | 3300049576 | Bacteria | 7299 |
| 1592 | Ga0501041_0016019 | 3300049577 | Bacteria | 4455 |
| 1593 | Ga0501041_0116157 | 3300049577 | Bacteria | 1661 |
| 1594 | Ga0501042_0148565 | 3300049578 | Bacteria | 1690 |
| 1595 | Ga0501043_0000487 | 3300049579 | Bacteria | 35542 |
| 1596 | Ga0501043_0029788 | 3300049579 | Bacteria | 4288 |
| 1597 | Ga0501043_0030237 | 3300049579 | Bacteria | 4255 |
| 1598 | Ga0501046_0087631 | 3300049580 | Bacteria | 2398 |
| 1599 | Ga0501046_0205932 | 3300049580 | Bacteria | 1462 |
| 1600 | Ga0501046_0259680 | 3300049580 | Bacteria | 1276 |
| 1601 | Ga0501046_0281340 | 3300049580 | Bacteria | 1218 |
| 1602 | Ga0501047_0000100 | 3300049581 | Bacteria | 105717 |
| 1603 | Ga0501047_0028382 | 3300049581 | Bacteria | 5394 |
| 1604 | Ga0501047_0083315 | 3300049581 | Bacteria | 3073 |
| 1605 | Ga0501047_0085392 | 3300049581 | Bacteria | 3032 |
| 1606 | Ga0501047_0212292 | 3300049581 | Bacteria | 1793 |
| 1607 | Ga0501047_0304858 | 3300049581 | Bacteria | 1434 |
| 1608 | Ga0501048_0000473 | 3300049582 | Bacteria | 28132 |
| 1609 | Ga0501048_0033115 | 3300049582 | Bacteria | 3735 |
| 1610 | Ga0501048_0035259 | 3300049582 | Bacteria | 3602 |
| 1611 | Ga0501048_0181363 | 3300049582 | Bacteria | 1492 |
| 1612 | Ga0501067_0115028 | 3300049583 | Bacteria | 1496 |
| 1613 | Ga0501067_0178284 | 3300049583 | Bacteria | 1183 |
| 1614 | Ga0501068_0010393 | 3300049584 | Bacteria | 5228 |
| 1615 | Ga0501068_0011379 | 3300049584 | Bacteria | 5023 |
| 1616 | Ga0501068_0252815 | 3300049584 | Bacteria | 1123 |
| 1617 | Ga0501069_0066639 | 3300049585 | Bacteria | 2013 |
| 1618 | Ga0501069_0207053 | 3300049585 | Bacteria | 1138 |
| 1619 | Ga0501069_0287193 | 3300049585 | Bacteria | 963 |
| 1620 | Ga0501070_0011913 | 3300049586 | Bacteria | 7345 |
| 1621 | Ga0501070_0025193 | 3300049586 | Bacteria | 4988 |
| 1622 | Ga0501070_0029112 | 3300049586 | Bacteria | 4632 |
| 1623 | Ga0501070_0075293 | 3300049586 | Bacteria | 2794 |
| 1624 | Ga0501070_0076780 | 3300049586 | Bacteria | 2765 |
| 1625 | Ga0501070_0542075 | 3300049586 | Bacteria | 932 |
| 1626 | Ga0501071_0011457 | 3300049587 | Bacteria | 5975 |
| 1627 | Ga0501071_0166155 | 3300049587 | Bacteria | 1651 |
| 1628 | Ga0501072_0011074 | 3300049588 | Bacteria | 6882 |
| 1629 | Ga0501072_0085609 | 3300049588 | Bacteria | 2500 |
| 1630 | Ga0501073_0132390 | 3300049589 | Bacteria | 1728 |
| 1631 | Ga0501073_0220771 | 3300049589 | Bacteria | 1309 |
| 1632 | Ga0501073_0330382 | 3300049589 | Bacteria | 1052 |
| 1633 | Ga0501074_0022003 | 3300049590 | Bacteria | 4631 |
| 1634 | Ga0501074_0039132 | 3300049590 | Bacteria | 3434 |
| 1635 | Ga0501074_0093316 | 3300049590 | Bacteria | 2155 |
| 1636 | Ga0501074_0184153 | 3300049590 | Bacteria | 1489 |
| 1637 | Ga0501075_0173499 | 3300049591 | Bacteria | 1645 |
| 1638 | Ga0501075_0177078 | 3300049591 | Bacteria | 1627 |
| 1639 | Ga0501075_0215794 | 3300049591 | Bacteria | 1463 |
| 1640 | Ga0501075_0397268 | 3300049591 | Bacteria | 1051 |
| 1641 | Ga0501076_0005575 | 3300049592 | Bacteria | 9066 |
| 1642 | Ga0501076_0082122 | 3300049592 | Bacteria | 2587 |
| 1643 | Ga0501076_0159112 | 3300049592 | Bacteria | 1839 |
| 1644 | Ga0501077_0046434 | 3300049593 | Bacteria | 2759 |
| 1645 | Ga0501079_0063486 | 3300049741 | Bacteria | 2849 |
| 1646 | Ga0501079_0075956 | 3300049741 | Bacteria | 2598 |
| 1647 | Ga0501079_0143903 | 3300049741 | Bacteria | 1857 |
| 1648 | Ga0501079_0173111 | 3300049741 | Bacteria | 1683 |
| 1649 | Ga0501080_0000030 | 3300049742 | Bacteria | 87736 |
| 1650 | Ga0501080_0015129 | 3300049742 | Bacteria | 7109 |
| 1651 | Ga0501080_0092344 | 3300049742 | Bacteria | 2811 |
| 1652 | Ga0501080_0163888 | 3300049742 | Bacteria | 2052 |
| 1653 | Ga0501080_0164174 | 3300049742 | Bacteria | 2050 |
| 1654 | Ga0501080_0476801 | 3300049742 | Bacteria | 1117 |
| 1655 | Ga0501083_0010799 | 3300049744 | Bacteria | 6423 |
| 1656 | Ga0501083_0053257 | 3300049744 | Bacteria | 2717 |
| 1657 | Ga0501083_0097668 | 3300049744 | Bacteria | 1938 |
| 1658 | Ga0501083_0168596 | 3300049744 | Bacteria | 1431 |
| 1659 | Ga0501035_0031108 | 3300049822 | Bacteria | 4861 |
| 1660 | Ga0501035_0091654 | 3300049822 | Bacteria | 2674 |
| 1661 | Ga0501035_0233349 | 3300049822 | Bacteria | 1567 |
| 1662 | Ga0501035_0299506 | 3300049822 | Bacteria | 1355 |
| 1663 | Ga0501044_0004101 | 3300049823 | Bacteria | 16333 |
| 1664 | Ga0501044_0068340 | 3300049823 | Bacteria | 3619 |
| 1665 | Ga0501044_0103293 | 3300049823 | Bacteria | 2865 |
| 1666 | Ga0501044_0127841 | 3300049823 | Bacteria | 2537 |
| 1667 | Ga0501045_0005395 | 3300049824 | Bacteria | 8854 |
| 1668 | Ga0501045_0285430 | 3300049824 | Bacteria | 1229 |
| 1669 | Ga0501045_0290739 | 3300049824 | Bacteria | 1216 |
| 1670 | nmdc:mga03683_2720_c1 | 3300050489 | Bacteria | 5547 |
| 1671 | nmdc:mga03683_8320_c1 | 3300050489 | Bacteria | 3642 |
| 1672 | nmdc:mga03683_86334_c1 | 3300050489 | Bacteria | 1362 |
| 1673 | nmdc:mga03683_96266_c1 | 3300050489 | Bacteria | 1296 |
| 1674 | nmdc:mga03n38_137830_c1 | 3300050490 | Bacteria | 1216 |
| 1675 | nmdc:mga03n38_156905_c1 | 3300050490 | Bacteria | 1149 |
| 1676 | nmdc:mga03n38_28451_c1 | 3300050490 | Bacteria | 2330 |
| 1677 | nmdc:mga03n38_97492_c1 | 3300050490 | Bacteria | 1412 |
| 1678 | nmdc:mga00v17_307382_c1 | 3300050491 | Bacteria | 1030 |
| 1679 | nmdc:mga00v17_346397_c1 | 3300050491 | Bacteria | 966 |
| 1680 | nmdc:mga00v17_9842_c1 | 3300050491 | Bacteria | 5195 |
| 1681 | nmdc:mga0yw44_227931_c1 | 3300050492 | Bacteria | 1236 |
| 1682 | nmdc:mga0yw44_242352_c1 | 3300050492 | Bacteria | 1199 |
| 1683 | nmdc:mga0yw44_39189_c1 | 3300050492 | Bacteria | 2808 |
| 1684 | nmdc:mga0yw44_432270_c1 | 3300050492 | Bacteria | 892 |
| 1685 | nmdc:mga0yw44_6189_c1 | 3300050492 | Bacteria | 5755 |
| 1686 | nmdc:mga0yw44_86569_c1 | 3300050492 | Bacteria | 1974 |
| 1687 | nmdc:mga0yw44_98283_c1 | 3300050492 | Bacteria | 1861 |
| 1688 | nmdc:mga0k408_10484_c1 | 3300050493 | Bacteria | 5013 |
| 1689 | nmdc:mga0k408_160651_c1 | 3300050493 | Bacteria | 1338 |
| 1690 | nmdc:mga0k408_212834_c1 | 3300050493 | Bacteria | 1154 |
| 1691 | nmdc:mga06z11_112858_c1 | 3300050494 | Bacteria | 1507 |
| 1692 | nmdc:mga06z11_131565_c1 | 3300050494 | Bacteria | 1406 |
| 1693 | nmdc:mga06z11_41063_c1 | 3300050494 | Bacteria | 2313 |
| 1694 | nmdc:mga06z11_45012_c1 | 3300050494 | Bacteria | 2229 |
| 1695 | nmdc:mga06z11_9486_c1 | 3300050494 | Bacteria | 4103 |
| 1696 | nmdc:mga07m45_122738_c1 | 3300050496 | Bacteria | 1501 |
| 1697 | nmdc:mga07m45_14653_c2 | 3300050496 | Bacteria | 3672 |
| 1698 | nmdc:mga07m45_259827_c1 | 3300050496 | Bacteria | 1010 |
| 1699 | nmdc:mga07m45_296730_c1 | 3300050496 | Bacteria | 940 |
| 1700 | nmdc:mga07m45_355731_c1 | 3300050496 | Bacteria | 851 |
| 1701 | nmdc:mga07m45_43458_c1 | 3300050496 | Bacteria | 2519 |
| 1702 | nmdc:mga07m45_46368_c1 | 3300050496 | Bacteria | 2442 |
| 1703 | nmdc:mga05p37_135935_c1 | 3300050507 | Bacteria | 3014 |
| 1704 | nmdc:mga05p37_13694_c1 | 3300050507 | Bacteria | 9720 |
| 1705 | nmdc:mga05p37_26731_c1 | 3300050507 | Bacteria | 7018 |
| 1706 | nmdc:mga05p37_33096_c1 | 3300050507 | Bacteria | 6331 |
| 1707 | nmdc:mga05p37_719155_c1 | 3300050507 | Bacteria | 1106 |
| 1708 | nmdc:mga05p37_7310_c1 | 3300050507 | Bacteria | 13031 |
| 1709 | nmdc:mga05p37_76550_c1 | 3300050507 | Bacteria | 4119 |
| 1710 | nmdc:mga09592_22873_c1 | 3300050508 | Bacteria | 5157 |
| 1711 | nmdc:mga09592_42022_c1 | 3300050508 | Bacteria | 3846 |
| 1712 | nmdc:mga09592_59060_c1 | 3300050508 | Bacteria | 3243 |
| 1713 | nmdc:mga0qj67_15559_c1 | 3300050509 | Bacteria | 5760 |
| 1714 | nmdc:mga0qj67_21501_c1 | 3300050509 | Bacteria | 4950 |
| 1715 | nmdc:mga0qj67_4674_c1 | 3300050509 | Bacteria | 9939 |
| 1716 | nmdc:mga06r32_4896_c1 | 3300050510 | Bacteria | 12062 |
| 1717 | nmdc:mga06r32_8384_c1 | 3300050510 | Bacteria | 9308 |
| 1718 | nmdc:mga08y16_12186_c1 | 3300050511 | Bacteria | 9038 |
| 1719 | nmdc:mga08y16_170800_c1 | 3300050511 | Bacteria | 2258 |
| 1720 | nmdc:mga08y16_22091_c1 | 3300050511 | Bacteria | 6718 |
| 1721 | nmdc:mga08y16_243008_c1 | 3300050511 | Bacteria | 1861 |
| 1722 | nmdc:mga08y16_47150_c1 | 3300050511 | Bacteria | 4511 |
| 1723 | nmdc:mga08y16_518_c1 | 3300050511 | Bacteria | 35625 |
| 1724 | nmdc:mga08y16_549471_c1 | 3300050511 | Bacteria | 1169 |
| 1725 | nmdc:mga08y16_6788_c1 | 3300050511 | Bacteria | 12011 |
| 1726 | nmdc:mga0n895_1010768_c1 | 3300050512 | Bacteria | 812 |
| 1727 | nmdc:mga0n895_102857_c1 | 3300050512 | Bacteria | 2868 |
| 1728 | nmdc:mga0n895_121567_c1 | 3300050512 | Bacteria | 2632 |
| 1729 | nmdc:mga0n895_180064_c1 | 3300050512 | Bacteria | 2145 |
| 1730 | nmdc:mga0n895_2094_c1 | 3300050512 | Bacteria | 15379 |
| 1731 | nmdc:mga0n895_22338_c1 | 3300050512 | Bacteria | 5932 |
| 1732 | nmdc:mga0n895_24114_c1 | 3300050512 | Bacteria | 5729 |
| 1733 | nmdc:mga0n895_255905_c1 | 3300050512 | Bacteria | 1777 |
| 1734 | nmdc:mga0n895_27310_c1 | 3300050512 | Bacteria | 5421 |
| 1735 | nmdc:mga0n895_338465_c1 | 3300050512 | Bacteria | 1524 |
| 1736 | nmdc:mga0n895_43907_c1 | 3300050512 | Bacteria | 4359 |
| 1737 | nmdc:mga0n895_460921_c1 | 3300050512 | Bacteria | 1283 |
| 1738 | nmdc:mga0n895_513772_c1 | 3300050512 | Bacteria | 1206 |
| 1739 | nmdc:mga0n895_77721_c1 | 3300050512 | Bacteria | 3302 |
| 1740 | nmdc:mga0rr50_175981_c1 | 3300050513 | Bacteria | 1746 |
| 1741 | nmdc:mga0rr50_260119_c1 | 3300050513 | Bacteria | 1444 |
| 1742 | nmdc:mga0rr50_439470_c1 | 3300050513 | Bacteria | 1105 |
| 1743 | nmdc:mga0rr50_540865_c1 | 3300050513 | Bacteria | 992 |
| 1744 | nmdc:mga0rr50_55745_c1 | 3300050513 | Bacteria | 2950 |
| 1745 | nmdc:mga0rr50_5686_c1 | 3300050513 | Bacteria | 7468 |
| 1746 | nmdc:mga0rr50_64444_c1 | 3300050513 | Bacteria | 2772 |
| 1747 | nmdc:mga0rr50_74118_c1 | 3300050513 | Bacteria | 2604 |
| 1748 | nmdc:mga08x19_102299_c1 | 3300050514 | Bacteria | 1902 |
| 1749 | nmdc:mga08x19_16318_c1 | 3300050514 | Bacteria | 4528 |
| 1750 | nmdc:mga0a205_10809_c1 | 3300050515 | Bacteria | 8399 |
| 1751 | nmdc:mga0a205_13485_c1 | 3300050515 | Bacteria | 7610 |
| 1752 | nmdc:mga0a205_14827_c1 | 3300050515 | Bacteria | 7273 |
| 1753 | nmdc:mga0a205_156394_c1 | 3300050515 | Bacteria | 2178 |
| 1754 | nmdc:mga0a205_218030_c1 | 3300050515 | Bacteria | 1795 |
| 1755 | nmdc:mga0a205_278891_c1 | 3300050515 | Bacteria | 1547 |
| 1756 | nmdc:mga0a205_32169_c1 | 3300050515 | Bacteria | 5030 |
| 1757 | nmdc:mga0a205_401749_c1 | 3300050515 | Bacteria | 1234 |
| 1758 | nmdc:mga0a205_42582_c1 | 3300050515 | Bacteria | 4376 |
| 1759 | nmdc:mga0a205_439879_c1 | 3300050515 | Bacteria | 1165 |
| 1760 | nmdc:mga0a205_830_c1 | 3300050515 | Bacteria | 25159 |
| 1761 | nmdc:mga0sz30_156896_c1 | 3300050516 | Bacteria | 1008 |
| 1762 | nmdc:mga0sz30_16015_c1 | 3300050516 | Bacteria | 2970 |
| 1763 | nmdc:mga0sz30_445_c1 | 3300050516 | Bacteria | 15645 |
| 1764 | Ga0495601_0001195 | 3300053077 | Bacteria | 14210 |
| 1765 | Ga0495601_0001471 | 3300053077 | Bacteria | 12982 |
| 1766 | Ga0495601_0017967 | 3300053077 | Bacteria | 4299 |
| 1767 | Ga0495601_0051327 | 3300053077 | Bacteria | 2603 |
| 1768 | Ga0495601_0144129 | 3300053077 | Bacteria | 1554 |
| 1769 | Ga0495601_0380192 | 3300053077 | Bacteria | 916 |
| 1770 | Ga0495612_0000353 | 3300053078 | Bacteria | 18580 |
| 1771 | Ga0495612_0008637 | 3300053078 | Bacteria | 4129 |
| 1772 | Ga0495612_0009709 | 3300053078 | Bacteria | 3897 |
| 1773 | Ga0495612_0012593 | 3300053078 | Bacteria | 3409 |
| 1774 | Ga0495612_0191469 | 3300053078 | Bacteria | 900 |
| 1775 | Ga0500610_0189819 | 3300053079 | Bacteria | 999 |
| 1776 | Ga0500610_0207161 | 3300053079 | Bacteria | 940 |
| 1777 | Ga0500635_0033796 | 3300053080 | Bacteria | 1671 |
| 1778 | Ga0495595_0000480 | 3300053084 | Bacteria | 15215 |
| 1779 | Ga0495595_0010420 | 3300053084 | Bacteria | 3863 |
| 1780 | Ga0495595_0018087 | 3300053084 | Bacteria | 3041 |
| 1781 | Ga0495595_0018501 | 3300053084 | Bacteria | 3011 |
| 1782 | Ga0495595_0029627 | 3300053084 | Bacteria | 2451 |
| 1783 | Ga0495595_0036616 | 3300053084 | Bacteria | 2228 |
| 1784 | Ga0495595_0088199 | 3300053084 | Bacteria | 1485 |
| 1785 | Ga0495619_0000289 | 3300053085 | Bacteria | 35778 |
| 1786 | Ga0495619_0000332 | 3300053085 | Bacteria | 33066 |
| 1787 | Ga0495619_0001043 | 3300053085 | Bacteria | 18161 |
| 1788 | Ga0495619_0009100 | 3300053085 | Bacteria | 6268 |
| 1789 | Ga0495619_0010184 | 3300053085 | Bacteria | 5922 |
| 1790 | Ga0495619_0028628 | 3300053085 | Bacteria | 3595 |
| 1791 | Ga0495619_0166402 | 3300053085 | Bacteria | 1524 |
| 1792 | Ga0495619_0206487 | 3300053085 | Bacteria | 1360 |
| 1793 | Ga0495619_0219870 | 3300053085 | Bacteria | 1316 |
| 1794 | Ga0495619_0299895 | 3300053085 | Bacteria | 1113 |
| 1795 | Ga0495619_0303757 | 3300053085 | Bacteria | 1105 |
| 1796 | Ga0495619_0315886 | 3300053085 | Bacteria | 1082 |
| 1797 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 1798 | Ga0500651_0314768 | 3300053093 | Bacteria | 895 |
| 1799 | Ga0500566_0006255 | 3300053094 | Bacteria | 7073 |
| 1800 | Ga0500641_0005072 | 3300053096 | Bacteria | 4667 |
| 1801 | Ga0500641_0119136 | 3300053096 | Bacteria | 1137 |
| 1802 | Ga0500556_0071241 | 3300053104 | Bacteria | 1298 |
| 1803 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 1804 | Ga0500569_021584 | 3300053109 | Bacteria | 1704 |
| 1805 | Ga0500595_000232 | 3300053119 | Bacteria | 37646 |
| 1806 | Ga0500595_006829 | 3300053119 | Bacteria | 4804 |
| 1807 | Ga0500595_031382 | 3300053119 | Bacteria | 1783 |
| 1808 | Ga0500608_090211 | 3300053122 | Bacteria | 1434 |
| 1809 | Ga0500642_0000067 | 3300053130 | Bacteria | 56324 |
| 1810 | Ga0500642_0210912 | 3300053130 | Bacteria | 901 |
| 1811 | Ga0500655_030900 | 3300053133 | Bacteria | 1032 |
| 1812 | Ga0500559_0014503 | 3300053136 | Bacteria | 3330 |
| 1813 | Ga0500568_0002596 | 3300053139 | Bacteria | 10496 |
| 1814 | Ga0500568_0040908 | 3300053139 | Bacteria | 1864 |
| 1815 | Ga0500568_0042033 | 3300053139 | Bacteria | 1833 |
| 1816 | Ga0500577_0163473 | 3300053142 | Bacteria | 949 |
| 1817 | Ga0500603_005284 | 3300053150 | Bacteria | 2772 |
| 1818 | Ga0500603_048434 | 3300053150 | Bacteria | 1156 |
| 1819 | Ga0500604_0095341 | 3300053151 | Bacteria | 976 |
| 1820 | Ga0500604_0123838 | 3300053151 | Bacteria | 866 |
| 1821 | Ga0500616_0002167 | 3300053153 | Bacteria | 16975 |
| 1822 | Ga0500620_043958 | 3300053155 | Bacteria | 1476 |
| 1823 | Ga0500622_0006295 | 3300053156 | Bacteria | 6929 |
| 1824 | Ga0500638_005675 | 3300053162 | Bacteria | 5010 |
| 1825 | Ga0500639_206626 | 3300053163 | Bacteria | 837 |
| 1826 | Ga0500636_0000847 | 3300053177 | Bacteria | 16470 |
| 1827 | Ga0500637_0000260 | 3300053178 | Bacteria | 19731 |
| 1828 | Ga0500637_0000405 | 3300053178 | Bacteria | 16453 |
| 1829 | Ga0500649_094163 | 3300053722 | Bacteria | 1196 |
| 1830 | Ga0500625_012504 | 3300053729 | Bacteria | 3881 |
| 1831 | Ga0500645_026262 | 3300053730 | Bacteria | 1771 |
| 1832 | Ga0500645_031912 | 3300053730 | Bacteria | 1582 |
| 1833 | Ga0500599_000323 | 3300053736 | Bacteria | 4694 |
| 1834 | Ga0500601_000062 | 3300053737 | Bacteria | 22260 |
| 1835 | Ga0501084_0002367 | 3300054114 | Bacteria | 15172 |
| 1836 | Ga0501084_0197701 | 3300054114 | Bacteria | 1696 |
| 1837 | Ga0501084_0214409 | 3300054114 | Bacteria | 1624 |
| 1838 | Ga0500661_000357 | 3300055283 | Bacteria | 8385 |
| 1839 | Ga0501082_0041592 | 3300060353 | Bacteria | 3962 |
| 1840 | Ga0466962_0261961 | 3300061719 | Bacteria | 851 |
| 1841 | Ga0530510_0002069 | 3300061734 | Bacteria | 13788 |
| 1842 | Ga0530510_0291292 | 3300061734 | Bacteria | 1220 |
| 1843 | 2507510892 | 2507262055 | Bacteria | 8048963 |
| 1844 | 2508544705 | 2508501009 | Bacteria | 7784016 |
| 1845 | 2508697067 | 2508501042 | Bacteria | 8719808 |
| 1846 | 2511394421 | 2511231028 | Bacteria | 8046582 |
| 1847 | 2513629156 | 2513237092 | Bacteria | 8341956 |
| 1848 | 2513637597 | 2513237094 | Bacteria | 8789602 |
| 1849 | 2513649553 | 2513237095 | Bacteria | 8976980 |
| 1850 | 2513654906 | 2513237096 | Bacteria | 8722461 |
| 1851 | 2513697329 | 2513237101 | Bacteria | 7952346 |
| 1852 | 2513700057 | 2513237102 | Bacteria | 7703324 |
| 1853 | 2513719256 | 2513237104 | Bacteria | 10034502 |
| 1854 | 2513861296 | 2513237137 | Bacteria | 9558895 |
| 1855 | 2513874543 | 2513237139 | Bacteria | 8737671 |
| 1856 | 2513891331 | 2513237141 | Bacteria | 8496279 |
| 1857 | 2513916071 | 2513237145 | Bacteria | 8979722 |
| 1858 | 2514015555 | 2513237161 | Bacteria | 8871253 |
| 1859 | 2515625564 | 2515154112 | Bacteria | 8294334 |
| 1860 | 2517100471 | 2517093001 | Bacteria | 9002274 |
| 1861 | 2517894626 | 2517572143 | Bacteria | 9484767 |
| 1862 | 2524437332 | 2524023205 | Bacteria | 8918781 |
| 1863 | 2524534357 | 2524023228 | Bacteria | 10118060 |
| 1864 | 2528853218 | 2528768022 | Bacteria | 10457665 |
| 1865 | 2617350649 | 2617270735 | Bacteria | 9163226 |
| 1866 | 2617377940 | 2617270741 | Bacteria | 8201522 |
| 1867 | 2671119053 | 2667528175 | Bacteria | 7532676 |
| 1868 | 2723843177 | 2721755755 | Bacteria | 8322773 |
| 1869 | 2728747713 | 2728368998 | Bacteria | 8720350 |
| 1870 | 2745076807 | 2744054633 | Bacteria | 8678936 |
| 1871 | 2793065175 | 2791355196 | Bacteria | 7323613 |
| 1872 | 2793072306 | 2791355197 | Bacteria | 8420563 |
| 1873 | 2793083114 | |||
| 1874 | 2805916538 | 2802429603 | Bacteria | 8777136 |
| 1875 | 2818238023 | 2816332527 | Bacteria | 8933356 |
| 1876 | 2824606125 | 2824600985 | Bacteria | 8488197 |
| 1877 | 2824616047 | 2824609381 | Bacteria | 8672835 |
| 1878 | 2824618973 | 2824617872 | Bacteria | 8814715 |
| 1879 | 2824627507 | 2824626560 | Bacteria | 8813858 |
| 1880 | 2824638832 | 2824635225 | Bacteria | 8785348 |
| 1881 | 2824649011 | 2824644064 | Bacteria | 8743947 |
| 1882 | 2824657345 | 2824653114 | Bacteria | 8493680 |
| 1883 | 2824663086 | 2824661429 | Bacteria | 9877870 |
| 1884 | 2824676953 | 2824671348 | Bacteria | 8369588 |
| 1885 | 2824682052 | 2824679649 | Bacteria | 8248951 |
| 1886 | 2824693642 | 2824687955 | Bacteria | 8360029 |
| 1887 | 2824698723 | 2824696289 | Bacteria | 8335049 |
| 1888 | 2824706497 | 2824704595 | Bacteria | 9667483 |
| 1889 | 2824716477 | 2824714736 | Bacteria | 8717648 |
| 1890 | 2824726423 | 2824723954 | Bacteria | 8758240 |
| 1891 | 2824737952 | 2824732956 | Bacteria | 7810675 |
| 1892 | 2824753004 | 2824746037 | Bacteria | 7911610 |
| 1893 | 2824756955 | 2824753945 | Bacteria | 9787441 |
| 1894 | 2824769751 | 2824763712 | Bacteria | 9792355 |
| 1895 | 2838127781 | 2838122688 | Bacteria | 8803140 |
| 1896 | 2841943074 | 2841941048 | Bacteria | 8688029 |
| 1897 | 2841956095 | 2841949485 | Bacteria | 8680857 |
| 1898 | 2841960333 | 2841957949 | Bacteria | 8652217 |
| 1899 | 2841968284 | 2841966195 | Bacteria | 8673214 |
| 1900 | 2841970328 | 2841966195 | Bacteria | 8673214 |
| 1901 | 2841976502 | 2841974524 | Bacteria | 8931498 |
| 1902 | 2841987878 | 2841983080 | Bacteria | 8395090 |
| 1903 | 2842042823 | 2842038055 | Bacteria | 8002051 |
| 1904 | 2842050864 | 2842045827 | Bacteria | 8006841 |
| 1905 | 2844317039 | 2844315083 | Bacteria | 8138177 |
| 1906 | 2847938455 | 2847930680 | Bacteria | 9342022 |
| 1907 | 2847944347 | 2847939898 | Bacteria | 8606328 |
| 1908 | 2849081410 | 2849076700 | Bacteria | 7039503 |
| 1909 | 2857512072 | 2857509624 | Bacteria | 7472071 |
| 1910 | 2874597617 | 2874590934 | Bacteria | 8299676 |
| 1911 | 2874612487 | 2874604998 | Bacteria | 7834745 |
| 1912 | 2874618412 | 2874612657 | Bacteria | 8252029 |
| 1913 | 2874623542 | 2874620515 | Bacteria | 8290088 |
| 1914 | 2874630521 | 2874628541 | Bacteria | 8630250 |
| 1915 | 2874649181 | 2874645413 | Bacteria | 8214782 |
| 1916 | 2876767783 | 2876761206 | Bacteria | 10111113 |
| 1917 | 2876774910 | 2876771140 | Bacteria | 8287509 |
| 1918 | 2876810636 | 2876808645 | Bacteria | 8824342 |
| 1919 | 2876822338 | 2876818435 | Bacteria | 8274608 |
| 1920 | 2879077998 | 2879074833 | Bacteria | 8279565 |
| 1921 | 2879088694 | 2879083081 | Bacteria | 8587928 |
| 1922 | 2879103945 | 2879099564 | Bacteria | 10442239 |
| 1923 | 2879117931 | 2879110137 | Bacteria | 8907982 |
| 1924 | 2879132451 | 2879127579 | Bacteria | 8294491 |
| 1925 | 2879145250 | 2879142872 | Bacteria | 8267021 |
| 1926 | 2881370569 | 2881364244 | Bacteria | 7710352 |
| 1927 | 2881667334 | 2881665667 | Bacteria | 8175609 |
| 1928 | 2885367041 | 2885366525 | Bacteria | 8326213 |
| 1929 | 2885378084 | 2885374607 | Bacteria | 8927485 |
| 1930 | 2885416537 | 2885409591 | Bacteria | 9235467 |
| 1931 | 2888381660 | 2888378607 | Bacteria | 9652610 |
| 1932 | 2888388973 | 2888388044 | Bacteria | 7304136 |
| 1933 | 2888422050 | 2888419890 | Bacteria | 7857137 |
| 1934 | 2889033516 | 2889033259 | Bacteria | 9099371 |
| 1935 | 2903735005 | 2903727486 | Bacteria | 8281579 |
| 1936 | 2903754861 | 2903748898 | Bacteria | 9972761 |
| 1937 | 2904667654 | 2904666416 | Bacteria | 8226587 |
| 1938 | 2904697036 | 2904690495 | Bacteria | 9412302 |
| 1939 | 2904705653 | |||
| 1940 | 2904719081 | 2904711408 | Bacteria | 9771557 |
| 1941 | 2906604122 | 2906602504 | Bacteria | 8295279 |
| 1942 | 2906611360 | |||
| 1943 | 2906633019 | 2906626472 | Bacteria | 8826946 |
| 1944 | 2906643464 | 2906635258 | Bacteria | 8601019 |
| 1945 | 2906648246 | 2906643746 | Bacteria | 8722424 |
| 1946 | 2906661312 | 2906660503 | Bacteria | 8595048 |
| 1947 | 2908744942 | 2908739725 | Bacteria | 8628932 |
| 1948 | 2908762695 | 2908756301 | Bacteria | 8864324 |
| 1949 | 2908782010 | 2908775508 | Bacteria | 8092255 |
| 1950 | 2922362693 | 2922361189 | Bacteria | 7436256 |
| 1951 | 2922371330 | |||
| 1952 | 2922390322 | 2922386360 | Bacteria | 7017218 |
| 1953 | 2922393766 | 2922393267 | Bacteria | 8285685 |
| 1954 | 2922428014 | |||
| 1955 | 2929619708 | 2929615660 | Bacteria | 9193770 |
| 1956 | 2929627821 | 2929624759 | Bacteria | 9339455 |
| 1957 | 2932786040 | 2932784394 | Bacteria | 9704911 |
| 1958 | 2932798193 | 2932794094 | Bacteria | 7915132 |
| 1959 | 2932803986 | 2932801729 | Bacteria | 7987968 |
| 1960 | 2932817012 | 2932809354 | Bacteria | 9135765 |
| 1961 | 2932822497 | 2932818245 | Bacteria | 9955613 |
| 1962 | 2932831084 | 2932828146 | Bacteria | 9745859 |
| 1963 | 2933581627 | 2933577622 | Bacteria | 9116884 |
| 1964 | 2935612890 | 2935608549 | Bacteria | 8203142 |
| 1965 | 2935624129 | 2935616580 | Bacteria | 9032984 |
| 1966 | 2935632061 | 2935630451 | Bacteria | 8169952 |
| 1967 | 2935640225 | 2935638405 | Bacteria | 10015038 |
| 1968 | 2935655015 | 2935648319 | Bacteria | 8801166 |
| 1969 | 2935663895 | 2935656913 | Bacteria | 8965014 |
| 1970 | 2935666937 | 2935665750 | Bacteria | 9571747 |
| 1971 | 2935680424 | 2935675223 | Bacteria | 9928132 |
| 1972 | 2935690068 | 2935684952 | Bacteria | 9590419 |
| 1973 | 2935699850 | 2935694250 | Bacteria | 9291695 |
| 1974 | 2935704692 | 2935703347 | Bacteria | 10242284 |
| 1975 | 2935722220 | 2935713505 | Bacteria | 9608509 |
| 1976 | 2935731529 | 2935722832 | Bacteria | 9608746 |
| 1977 | 2935735383 | 2935732158 | Bacteria | 9706831 |
| 1978 | 2935745346 | 2935741537 | Bacteria | 9707219 |
| 1979 | 2935755079 | 2935750917 | Bacteria | 9590372 |
| 1980 | 2935762407 | 2935760218 | Bacteria | 9817913 |
| 1981 | 2935775442 | 2935769743 | Bacteria | 7878163 |
| 1982 | 2935780344 | 2935777560 | Bacteria | 8077691 |
| 1983 | 2935790691 | 2935785616 | Bacteria | 7962367 |
| 1984 | 2935799126 | 2935793552 | Bacteria | 8012592 |
| 1985 | 2935803905 | 2935801545 | Bacteria | 9301974 |
| 1986 | 2935811823 | 2935810662 | Bacteria | 9401221 |
| 1987 | 2935824378 | 2935819856 | Bacteria | 8261050 |
| 1988 | 2935829708 | 2935827899 | Bacteria | 10038562 |
| 1989 | 2935842960 | 2935837841 | Bacteria | 9454360 |
| 1990 | 2935852477 | 2935847175 | Bacteria | 8228321 |
| 1991 | 2935862371 | 2935855204 | Bacteria | 9035059 |
| 1992 | 2935870506 | 2935864058 | Bacteria | 9784707 |
| 1993 | 2935881088 | 2935873716 | Bacteria | 9632195 |
| 1994 | 2935884208 | 2935883170 | Bacteria | 7964738 |
| 1995 | 2935912368 | 2935908558 | Bacteria | 8568796 |
| 1996 | 2935923958 | 2935916978 | Bacteria | 9113783 |
| 1997 | 2935929397 | 2935926038 | Bacteria | 8601059 |
| 1998 | 2935936028 | 2935934488 | Bacteria | 8602579 |
| 1999 | 2935949928 | 2935942939 | Bacteria | 8599779 |
| 2000 | 2935957306 | 2935951376 | Bacteria | 8602333 |
| 2001 | 2935962175 | 2935959822 | Bacteria | 7869783 |
| 2002 | 2935968337 | 2935967501 | Bacteria | 8603075 |
| 2003 | 2935976523 | 2935975950 | Bacteria | 8347125 |
| 2004 | 2935988031 | 2935984226 | Bacteria | 8302647 |
| 2005 | 2935993585 | 2935992306 | Bacteria | 9802711 |
| 2006 | 2936004481 | 2936002035 | Bacteria | 9362176 |
| 2007 | 2936018036 | 2936011229 | Bacteria | 8801034 |
| 2008 | 2936026554 | 2936019824 | Bacteria | 8804134 |
| 2009 | 2936035297 | 2936028420 | Bacteria | 8965941 |
| 2010 | 2936038406 | 2936037263 | Bacteria | 9446081 |
| 2011 | 2936053431 | 2936046547 | Bacteria | 8903709 |
| 2012 | 2936059412 | 2936055302 | Bacteria | 8785755 |
| 2013 | 2940561641 | 2940556831 | Bacteria | 9590747 |
| 2014 | 2941508009 | 2941507105 | Bacteria | 8166816 |
| 2015 | 2941515486 | 2941515067 | Bacteria | 8166720 |
| 2016 | 2941523939 | 2941523033 | Bacteria | 8169134 |
| 2017 | 2941533820 | 2941531003 | Bacteria | 7653939 |
| 2018 | 2941544184 | 2941538514 | Bacteria | 9402094 |
| 2019 | 3005477713 | 3005474847 | Bacteria | 9259049 |
| 2020 | 3005485386 | 3005483717 | Bacteria | 7877331 |
| 2021 | 3005507242 | 3005506211 | Bacteria | 6943378 |
| 2022 | 3005594602 | 3005587118 | Bacteria | 7794411 |
| 2023 | 3005596681 | 3005594810 | Bacteria | 8716512 |
| 2024 | 3005712749 | 3005710791 | Bacteria | 7622528 |
| 2025 | 8006933140 | 8006926726 | Bacteria | 6749210 |
| 2026 | 8006933500 | 8006933436 | Bacteria | 10410654 |
| 2027 | 8006971306 | 8006964411 | Bacteria | 8966052 |
| 2028 | 8006983173 | 8006973647 | Bacteria | 10679141 |
| 2029 | 8006989256 | 8006984368 | Bacteria | 9651211 |
| 2030 | 8006997731 | 8006994254 | Bacteria | 8309700 |
| 2031 | 8016516297 | 8016511872 | Bacteria | 9921665 |
| 2032 | 8016523692 | 8016522445 | Bacteria | 8156687 |
| 2033 | 8016541474 | 8016539877 | Bacteria | 8155419 |
| 2034 | 8016551781 | 8016548790 | Bacteria | 8155074 |
| 2035 | 8016560168 | 8016557553 | Bacteria | 8154380 |
| 2036 | 8016566866 | 8016566248 | Bacteria | 8158151 |
| 2037 | 8016579598 | 8016575299 | Bacteria | 8154085 |
| 2038 | 8016589270 | 8016583857 | Bacteria | 10421953 |
| 2039 | 8016598085 | 8016595262 | Bacteria | 8149947 |
| 2040 | 8016604225 | 8016603502 | Bacteria | 8731218 |
| 2041 | 8016620808 | 8016613128 | Bacteria | 8794220 |
| 2042 | 8016629181 | 8016622563 | Bacteria | 7999408 |
| 2043 | 8016633707 | 8016630954 | Bacteria | 9217207 |
| 2044 | 8017060237 | 8017057580 | Bacteria | 10023680 |
| 2045 | 8019536904 | 8019530166 | Bacteria | 8155624 |
| 2046 | 8019542627 | 8019538911 | Bacteria | 7872763 |
| 2047 | 8019559416 | 8019555841 | Bacteria | 9642137 |
| 2048 | 8019579759 | 8019576017 | Bacteria | 10049540 |
| 2049 | 8019587469 | 8019586578 | Bacteria | 10212056 |
| 2050 | 8019603873 | 8019597564 | Bacteria | 10041141 |
| 2051 | 8019614665 | 8019608314 | Bacteria | 10042931 |
| 2052 | 8019636906 | 8019629233 | Bacteria | 8687553 |
| 2053 | 8019642702 | 8019638758 | Bacteria | 9062356 |
| 2054 | 8019649883 | 8019648815 | Bacteria | 10014479 |
| 2055 | 8019664725 | 8019659431 | Bacteria | 8577854 |
| 2056 | 8019674311 | 8019668869 | Bacteria | 8791617 |
| 2057 | 8055749036 | 8055742211 | Bacteria | 9226248 |
| 2058 | 8056674772 | 8056673599 | Bacteria | 7871253 |
| 2059 | 8056695058 | 8056689827 | Bacteria | 6712655 |
| 2060 | 8056969885 | 8056967851 | Bacteria | 9038162 |
| 2061 | Ga0373934_0115469 | |||
| 2062 | JGI24032J14994_101455 | |||
| 2063 | JGI24752J21851_1008532 | |||
| 2064 | JGI24739J22299_10002831 | |||
| 2065 | JGI24737J22298_10001577 | |||
| 2066 | JGI24750J21931_1000865 | |||
| 2067 | JGI24745J21846_1002353 | |||
| 2068 | JGI24748J21848_1001206 | |||
| 2069 | JGI24749J21850_1011129 | |||
| 2070 | JGI24744J21845_10003221 | |||
| 2071 | JGI24035J26624_1003600 | |||
| 2072 | JGI24034J26672_10004016 | |||
| 2073 | JGI24742J22300_10001206 | |||
| 2074 | JGI24751J29686_10002679 | |||
| 2075 | JGI25406J46586_10000021 | |||
| 2076 | JGI25153J46596_10001764 | |||
| 2077 | JGI25153J46596_10002778 | |||
| 2078 | JGI25153J46596_10007736 | |||
| 2079 | JGI25153J46596_10008618 | |||
| 2080 | JGI25160J50197_1000533 | |||
| 2081 | JGI25160J50197_1027443 | |||
| 2082 | JGI25404J52841_10021647 | |||
| 2083 | Ga0055539_1012039 | |||
| 2084 | Ga0055542_1023720 | |||
| 2085 | Ga0055531_10010491 | |||
| 2086 | JGI25405J52794_10004566 | |||
| 2087 | JGI25405J52794_10060051 | |||
| 2088 | Ga0065165_1000437 | |||
| 2089 | Ga0065165_1001951 | |||
| 2090 | Ga0065165_1005934 | |||
| 2091 | Ga0065712_10102380 | |||
| 2092 | Ga0065715_10114787 | |||
| 2093 | Ga0065715_10261091 | |||
| 2094 | Ga0070658_10006285 | |||
| 2095 | Ga0070658_10218087 | |||
| 2096 | Ga0070676_10001629 | |||
| 2097 | Ga0070676_10026881 | |||
| 2098 | Ga0070676_10034437 | |||
| 2099 | Ga0070683_100007819 | |||
| 2100 | Ga0070683_100014236 | |||
| 2101 | Ga0070683_100020043 | |||
| 2102 | Ga0070683_100486229 | |||
| 2103 | Ga0070690_100022028 | |||
| 2104 | Ga0070690_100033117 | |||
| 2105 | Ga0070690_100151901 | |||
| 2106 | Ga0070690_100390243 | |||
| 2107 | Ga0070670_100112665 | |||
| 2108 | Ga0070677_10000481 | |||
| 2109 | Ga0068869_100000216 | |||
| 2110 | Ga0068869_100087109 | |||
| 2111 | Ga0070666_10005440 | |||
| 2112 | Ga0070666_10023836 | |||
| 2113 | Ga0070666_10287891 | |||
| 2114 | Ga0070680_100002486 | |||
| 2115 | Ga0070680_100006251 | |||
| 2116 | Ga0070680_100032424 | |||
| 2117 | Ga0070680_100070553 | |||
| 2118 | Ga0070680_100194678 | |||
| 2119 | Ga0070680_100575707 | |||
| 2120 | Ga0070682_100000853 | |||
| 2121 | Ga0070682_100022761 | |||
| 2122 | Ga0070682_100221253 | |||
| 2123 | Ga0070682_100468508 | |||
| 2124 | Ga0068868_100000474 | |||
| 2125 | Ga0068868_100071341 | |||
| 2126 | Ga0068868_100250174 | |||
| 2127 | Ga0070660_100001322 | |||
| 2128 | Ga0070660_100009076 | |||
| 2129 | Ga0070660_100051630 | |||
| 2130 | Ga0070689_100000240 | |||
| 2131 | Ga0070689_100223665 | |||
| 2132 | Ga0070689_100490729 | |||
| 2133 | Ga0070691_10020949 | |||
| 2134 | Ga0070691_10189075 | |||
| 2135 | Ga0070687_100000302 | |||
| 2136 | Ga0070661_100003117 | |||
| 2137 | Ga0070661_100068426 | |||
| 2138 | Ga0070661_100131740 | |||
| 2139 | Ga0070661_100156278 | |||
| 2140 | Ga0070692_10027705 | |||
| 2141 | Ga0070668_100003449 | |||
| 2142 | Ga0070668_100076646 | |||
| 2143 | Ga0070668_100103710 | |||
| 2144 | Ga0070668_100272139 | |||
| 2145 | Ga0070669_100009578 | |||
| 2146 | Ga0070669_100302641 | |||
| 2147 | Ga0070675_100001762 | |||
| 2148 | Ga0070675_100125583 | |||
| 2149 | Ga0070675_100208241 | |||
| 2150 | Ga0070675_100651086 | |||
| 2151 | Ga0070675_100750101 | |||
| 2152 | Ga0070671_100002861 | |||
| 2153 | Ga0070671_100117771 | |||
| 2154 | Ga0070671_100499273 | |||
| 2155 | Ga0070671_100519094 | |||
| 2156 | Ga0070674_100002865 | |||
| 2157 | Ga0070674_100625549 | |||
| 2158 | Ga0070673_100001019 | |||
| 2159 | Ga0070673_100034773 | |||
| 2160 | Ga0070673_100227232 | |||
| 2161 | Ga0070673_100318795 | |||
| 2162 | Ga0070688_100010793 | |||
| 2163 | Ga0070688_100022950 | |||
| 2164 | Ga0070659_100005117 | |||
| 2165 | Ga0070659_100131998 | |||
| 2166 | Ga0070659_100342439 | |||
| 2167 | Ga0070659_100393710 | |||
| 2168 | Ga0070667_100001650 | |||
| 2169 | Ga0070667_100053374 | |||
| 2170 | Ga0070667_100068279 | |||
| 2171 | Ga0070667_100547268 | |||
| 2172 | Ga0070703_10002778 | |||
| 2173 | Ga0070709_10001960 | |||
| 2174 | Ga0070709_10002079 | |||
| 2175 | Ga0070709_10008334 | |||
| 2176 | Ga0070709_10017458 | |||
| 2177 | Ga0070709_10030167 | |||
| 2178 | Ga0070709_10166061 | |||
| 2179 | Ga0070709_10173191 | |||
| 2180 | Ga0070709_10461647 | |||
| 2181 | Ga0070714_100003380 | |||
| 2182 | Ga0070714_100004982 | |||
| 2183 | Ga0070714_100050541 | |||
| 2184 | Ga0070714_100054993 | |||
| 2185 | Ga0070714_100287789 | |||
| 2186 | Ga0070714_100320733 | |||
| 2187 | Ga0070713_100005503 | |||
| 2188 | Ga0070713_100035581 | |||
| 2189 | Ga0070713_100035837 | |||
| 2190 | Ga0070713_100175737 | |||
| 2191 | Ga0070713_100196071 | |||
| 2192 | Ga0070713_100957551 | |||
| 2193 | Ga0070710_10005443 | |||
| 2194 | Ga0070701_10000281 | |||
| 2195 | Ga0070711_100003146 | |||
| 2196 | Ga0070711_100022144 | |||
| 2197 | Ga0070711_100039401 | |||
| 2198 | Ga0070711_100046760 | |||
| 2199 | Ga0070711_100454980 | |||
| 2200 | Ga0070705_100001659 | |||
| 2201 | Ga0070705_100025036 | |||
| 2202 | Ga0070700_100001804 | |||
| 2203 | Ga0070700_100041536 | |||
| 2204 | Ga0070700_100216528 | |||
| 2205 | Ga0070700_100498094 | |||
| 2206 | Ga0070694_100000576 | |||
| 2207 | Ga0070694_100267427 | |||
| 2208 | Ga0070694_100326738 | |||
| 2209 | Ga0070708_100006158 | |||
| 2210 | Ga0070708_100021331 | |||
| 2211 | Ga0070708_100028554 | |||
| 2212 | Ga0070708_100070172 | |||
| 2213 | Ga0070708_100085640 | |||
| 2214 | Ga0070708_100510048 | |||
| 2215 | Ga0070663_100003664 | |||
| 2216 | Ga0070663_100070816 | |||
| 2217 | Ga0070663_100080851 | |||
| 2218 | Ga0070663_100434989 | |||
| 2219 | Ga0070663_100651899 | |||
| 2220 | Ga0070678_100006300 | |||
| 2221 | Ga0070678_100456821 | |||
| 2222 | Ga0070678_100659165 | |||
| 2223 | Ga0070662_100194302 | |||
| 2224 | Ga0070681_10010247 | |||
| 2225 | Ga0070681_10020913 | |||
| 2226 | Ga0070681_10150329 | |||
| 2227 | Ga0070681_10150518 | |||
| 2228 | Ga0070681_10167923 | |||
| 2229 | Ga0070681_10191007 | |||
| 2230 | Ga0068867_100002151 | |||
| 2231 | Ga0068867_100064551 | |||
| 2232 | Ga0068867_100198087 | |||
| 2233 | Ga0070685_10049333 | |||
| 2234 | Ga0070706_100084513 | |||
| 2235 | Ga0070706_100107179 | |||
| 2236 | Ga0070706_100238540 | |||
| 2237 | Ga0070706_100261696 | |||
| 2238 | Ga0070706_100609066 | |||
| 2239 | Ga0070706_100722283 | |||
| 2240 | Ga0070707_100018938 | |||
| 2241 | Ga0070707_100040622 | |||
| 2242 | Ga0070707_100082900 | |||
| 2243 | Ga0070707_100290348 | |||
| 2244 | Ga0070707_100415591 | |||
| 2245 | Ga0070698_100001171 | |||
| 2246 | Ga0070698_100005791 | |||
| 2247 | Ga0070698_100170211 | |||
| 2248 | Ga0070698_100182392 | |||
| 2249 | Ga0070698_100189075 | |||
| 2250 | Ga0070698_100340811 | |||
| 2251 | Ga0070698_100420205 | |||
| 2252 | Ga0070698_100690413 | |||
| 2253 | Ga0070698_100699625 | |||
| 2254 | Ga0070699_100006362 | |||
| 2255 | Ga0070699_100006895 | |||
| 2256 | Ga0070699_100022064 | |||
| 2257 | Ga0070699_100162407 | |||
| 2258 | Ga0070699_100299951 | |||
| 2259 | Ga0070679_100003426 | |||
| 2260 | Ga0070679_100005687 | |||
| 2261 | Ga0070679_100027474 | |||
| 2262 | Ga0070679_100215944 | |||
| 2263 | Ga0070679_100239003 | |||
| 2264 | Ga0070679_100326452 | |||
| 2265 | Ga0070679_100358734 | |||
| 2266 | Ga0070679_100379825 | |||
| 2267 | Ga0070684_100011854 | |||
| 2268 | Ga0070684_100012047 | |||
| 2269 | Ga0070684_100033680 | |||
| 2270 | Ga0070684_100086741 | |||
| 2271 | Ga0070697_100019057 | |||
| 2272 | Ga0070697_100023652 | |||
| 2273 | Ga0070697_100191407 | |||
| 2274 | Ga0070697_100302720 | |||
| 2275 | Ga0070697_100444829 | |||
| 2276 | Ga0068853_100004149 | |||
| 2277 | Ga0068853_100007962 | |||
| 2278 | Ga0068853_100084860 | |||
| 2279 | Ga0068853_100266376 | |||
| 2280 | Ga0068853_100498279 | |||
| 2281 | Ga0068853_100518389 | |||
| 2282 | Ga0068853_100602340 | |||
| 2283 | Ga0068853_100731975 | |||
| 2284 | Ga0070672_100004101 | |||
| 2285 | Ga0070672_100083906 | |||
| 2286 | Ga0070672_100190388 | |||
| 2287 | Ga0070672_100342323 | |||
| 2288 | Ga0070672_100439458 | |||
| 2289 | Ga0070686_100002850 | |||
| 2290 | Ga0070686_100371033 | |||
| 2291 | Ga0070695_100009940 | |||
| 2292 | Ga0070696_100006975 | |||
| 2293 | Ga0070696_100220734 | |||
| 2294 | Ga0070696_100284480 | |||
| 2295 | Ga0070693_100002142 | |||
| 2296 | Ga0070693_100043501 | |||
| 2297 | Ga0070693_100091281 | |||
| 2298 | Ga0070665_100003622 | |||
| 2299 | Ga0070665_100051658 | |||
| 2300 | Ga0070665_100146230 | |||
| 2301 | Ga0070665_100162015 | |||
| 2302 | Ga0070665_100167853 | |||
| 2303 | Ga0070665_100359247 | |||
| 2304 | Ga0070665_100492077 | |||
| 2305 | Ga0070665_100909538 | |||
| 2306 | Ga0070704_100000444 | |||
| 2307 | Ga0070704_100077242 | |||
| 2308 | Ga0070704_100088629 | |||
| 2309 | Ga0068855_100035351 | |||
| 2310 | Ga0068855_100038019 | |||
| 2311 | Ga0068855_100073196 | |||
| 2312 | Ga0068855_100084816 | |||
| 2313 | Ga0068855_100131307 | |||
| 2314 | Ga0068855_100224204 | |||
| 2315 | Ga0068855_100238994 | |||
| 2316 | Ga0068855_100262674 | |||
| 2317 | Ga0068855_100389982 | |||
| 2318 | Ga0068855_100424422 | |||
| 2319 | Ga0068855_100607661 | |||
| 2320 | Ga0070664_100012305 | |||
| 2321 | Ga0070664_100193984 | |||
| 2322 | Ga0070664_100204358 | |||
| 2323 | Ga0070664_100232809 | |||
| 2324 | Ga0070664_100653392 | |||
| 2325 | Ga0068857_100004239 | |||
| 2326 | Ga0068857_100020977 | |||
| 2327 | Ga0068857_100070627 | |||
| 2328 | Ga0068857_100168502 | |||
| 2329 | Ga0068857_100248392 | |||
| 2330 | Ga0068857_100371190 | |||
| 2331 | Ga0068854_100005104 | |||
| 2332 | Ga0068854_100137220 | |||
| 2333 | Ga0068856_100038973 | |||
| 2334 | Ga0068856_100059548 | |||
| 2335 | Ga0068856_100219306 | |||
| 2336 | Ga0068856_100242268 | |||
| 2337 | Ga0068856_100683695 | |||
| 2338 | Ga0068856_100815379 | |||
| 2339 | Ga0070702_100001491 | |||
| 2340 | Ga0070702_100115063 | |||
| 2341 | Ga0068852_100000932 | |||
| 2342 | Ga0068852_100193681 | |||
| 2343 | Ga0068852_100327950 | |||
| 2344 | Ga0068852_100347483 | |||
| 2345 | Ga0068859_100002825 | |||
| 2346 | Ga0068859_100055931 | |||
| 2347 | Ga0068859_100108703 | |||
| 2348 | Ga0068864_100002030 | |||
| 2349 | Ga0068864_100035218 | |||
| 2350 | Ga0068864_100092544 | |||
| 2351 | Ga0068864_100504424 | |||
| 2352 | Ga0068866_10000638 | |||
| 2353 | Ga0068866_10118537 | |||
| 2354 | Ga0068866_10249854 | |||
| 2355 | Ga0068861_100004452 | |||
| 2356 | Ga0068851_10040747 | |||
| 2357 | Ga0068851_10099516 | |||
| 2358 | Ga0068870_10000048 | |||
| 2359 | Ga0068863_100001975 | |||
| 2360 | Ga0068863_100391832 | |||
| 2361 | Ga0068858_100008206 | |||
| 2362 | Ga0068858_100073450 | |||
| 2363 | Ga0068860_100000933 | |||
| 2364 | Ga0068860_100017528 | |||
| 2365 | Ga0068860_100144851 | |||
| 2366 | Ga0068860_100317585 | |||
| 2367 | Ga0068860_100689963 | |||
| 2368 | Ga0068862_100026562 | |||
| 2369 | Ga0068862_100185846 | |||
| 2370 | Ga0068862_100276122 | |||
| 2371 | Ga0081455_10002021 | |||
| 2372 | Ga0081455_10004363 | |||
| 2373 | Ga0081455_10005161 | |||
| 2374 | Ga0081455_10005318 | |||
| 2375 | Ga0081455_10010563 | |||
| 2376 | Ga0081455_10011965 | |||
| 2377 | Ga0081455_10021579 | |||
| 2378 | Ga0081455_10033400 | |||
| 2379 | Ga0081455_10043525 | |||
| 2380 | Ga0081455_10068940 | |||
| 2381 | Ga0081455_10075291 | |||
| 2382 | Ga0081538_10069563 | |||
| 2383 | Ga0081540_1000280 | |||
| 2384 | Ga0081540_1002252 | |||
| 2385 | Ga0081540_1005512 | |||
| 2386 | Ga0081540_1011141 | |||
| 2387 | Ga0081540_1011980 | |||
| 2388 | Ga0081540_1036034 | |||
| 2389 | Ga0081540_1038641 | |||
| 2390 | Ga0081539_10000051 | |||
| 2391 | Ga0081539_10000486 | |||
| 2392 | Ga0081539_10003351 | |||
| 2393 | Ga0081539_10031311 | |||
| 2394 | Ga0081539_10091328 | |||
| 2395 | Ga0070717_10000150 | |||
| 2396 | Ga0070717_10001555 | |||
| 2397 | Ga0070717_10011942 | |||
| 2398 | Ga0070717_10176264 | |||
| 2399 | Ga0075365_10003263 | |||
| 2400 | Ga0075365_10052047 | |||
| 2401 | Ga0075365_10330084 | |||
| 2402 | Ga0075365_10402045 | |||
| 2403 | Ga0075368_10003112 | |||
| 2404 | Ga0075368_10107953 | |||
| 2405 | Ga0075368_10199552 | |||
| 2406 | Ga0075363_100022684 | |||
| 2407 | Ga0075363_100166830 | |||
| 2408 | Ga0075364_10026988 | |||
| 2409 | Ga0075364_10085514 | |||
| 2410 | Ga0075364_10368366 | |||
| 2411 | Ga0075364_10402808 | |||
| 2412 | Ga0070715_10000321 | |||
| 2413 | Ga0070715_10030468 | |||
| 2414 | Ga0070715_10039547 | |||
| 2415 | Ga0070715_10173242 | |||
| 2416 | Ga0070716_100001200 | |||
| 2417 | Ga0070716_100018951 | |||
| 2418 | Ga0070716_100105020 | |||
| 2419 | Ga0070716_100125734 | |||
| 2420 | Ga0070716_100277372 | |||
| 2421 | Ga0070712_100004740 | |||
| 2422 | Ga0070712_100057102 | |||
| 2423 | Ga0070712_100063106 | |||
| 2424 | Ga0070712_100072856 | |||
| 2425 | Ga0070712_100073747 | |||
| 2426 | Ga0070712_100118722 | |||
| 2427 | Ga0070712_100126287 | |||
| 2428 | Ga0070712_100379754 | |||
| 2429 | Ga0075362_10001695 | |||
| 2430 | Ga0075362_10107617 | |||
| 2431 | Ga0075362_10138886 | |||
| 2432 | Ga0075362_10168066 | |||
| 2433 | Ga0075362_10190697 | |||
| 2434 | Ga0075367_10018878 | |||
| 2435 | Ga0075367_10022791 | |||
| 2436 | Ga0075367_10170445 | |||
| 2437 | Ga0075367_10247511 | |||
| 2438 | Ga0075367_10413578 | |||
| 2439 | Ga0075369_10002166 | |||
| 2440 | Ga0075369_10045606 | |||
| 2441 | Ga0075369_10196443 | |||
| 2442 | Ga0075366_10007150 | |||
| 2443 | Ga0075366_10025959 | |||
| 2444 | Ga0075366_10073201 | |||
| 2445 | Ga0097621_100002984 | |||
| 2446 | Ga0097621_100222730 | |||
| 2447 | Ga0097621_100871030 | |||
| 2448 | Ga0075370_10101745 | |||
| 2449 | Ga0075370_10104514 | |||
| 2450 | Ga0075370_10110461 | |||
| 2451 | Ga0075370_10162316 | |||
| 2452 | Ga0068871_100000555 | |||
| 2453 | Ga0068871_100004433 | |||
| 2454 | Ga0068871_100447185 | |||
| 2455 | Ga0068871_100624562 | |||
| 2456 | Ga0075428_100052861 | |||
| 2457 | Ga0075428_100058497 | |||
| 2458 | Ga0075430_100000042 | |||
| 2459 | Ga0075430_100000534 | |||
| 2460 | Ga0075430_100000826 | |||
| 2461 | Ga0075431_100086521 | |||
| 2462 | Ga0075431_100091253 | |||
| 2463 | Ga0075431_100447718 | |||
| 2464 | Ga0075431_100663262 | |||
| 2465 | Ga0075433_10006248 | |||
| 2466 | Ga0075433_10011316 | |||
| 2467 | Ga0075433_10012151 | |||
| 2468 | Ga0075433_10022378 | |||
| 2469 | Ga0075433_10207998 | |||
| 2470 | Ga0075433_10404271 | |||
| 2471 | Ga0075434_100012903 | |||
| 2472 | Ga0075434_100016644 | |||
| 2473 | Ga0075434_100017132 | |||
| 2474 | Ga0075434_100019982 | |||
| 2475 | Ga0075434_100027752 | |||
| 2476 | Ga0075434_100147528 | |||
| 2477 | Ga0075434_100163062 | |||
| 2478 | Ga0075434_100267252 | |||
| 2479 | Ga0075434_100304674 | |||
| 2480 | Ga0075434_100346490 | |||
| 2481 | Ga0075434_100368028 | |||
| 2482 | Ga0075429_100003563 | |||
| 2483 | Ga0075429_100017797 | |||
| 2484 | Ga0075429_100042041 | |||
| 2485 | Ga0075429_100062288 | |||
| 2486 | Ga0068865_100049753 | |||
| 2487 | Ga0068865_100135239 | |||
| 2488 | Ga0075436_100021433 | |||
| 2489 | Ga0075436_100051974 | |||
| 2490 | Ga0075436_100057781 | |||
| 2491 | Ga0075436_100127649 | |||
| 2492 | Ga0075436_100430729 | |||
| 2493 | Ga0097620_100002825 | |||
| 2494 | Ga0097620_100055932 | |||
| 2495 | Ga0097620_100108696 | |||
| 2496 | Ga0099824_1004900 | |||
| 2497 | Ga0099824_1029293 | |||
| 2498 | Ga0099822_1000677 | |||
| 2499 | Ga0075435_100018059 | |||
| 2500 | Ga0075435_100045774 | |||
| 2501 | Ga0075435_100057475 | |||
| 2502 | Ga0075435_100062982 | |||
| 2503 | Ga0075435_100068323 | |||
| 2504 | Ga0075435_100084879 | |||
| 2505 | Ga0075435_100218901 | |||
| 2506 | Ga0075435_100273373 | |||
| 2507 | Ga0075435_100293565 | |||
| 2508 | Ga0075435_100307271 | |||
| 2509 | Ga0099794_10016964 | |||
| 2510 | Ga0099794_10047778 | |||
| 2511 | Ga0099794_10181752 | |||
| 2512 | Ga0099795_10058807 | |||
| 2513 | Ga0099795_10120237 | |||
| 2514 | Ga0105240_10008025 | |||
| 2515 | Ga0105240_10027519 | |||
| 2516 | Ga0105240_10033952 | |||
| 2517 | Ga0105240_10086994 | |||
| 2518 | Ga0105240_10129550 | |||
| 2519 | Ga0105240_10174326 | |||
| 2520 | Ga0105240_10191853 | |||
| 2521 | Ga0111539_10002792 | |||
| 2522 | Ga0111539_10004409 | |||
| 2523 | Ga0111539_10004721 | |||
| 2524 | Ga0111539_10016484 | |||
| 2525 | Ga0111539_10115084 | |||
| 2526 | Ga0111539_10157494 | |||
| 2527 | Ga0111539_10533202 | |||
| 2528 | Ga0111539_10754634 | |||
| 2529 | Ga0105245_10000370 | |||
| 2530 | Ga0105245_10009595 | |||
| 2531 | Ga0105245_10019672 | |||
| 2532 | Ga0105245_10313762 | |||
| 2533 | Ga0105245_10317008 | |||
| 2534 | Ga0105245_10398638 | |||
| 2535 | Ga0105245_10569306 | |||
| 2536 | Ga0105245_10706223 | |||
| 2537 | Ga0105247_10002042 | |||
| 2538 | Ga0114129_10024612 | |||
| 2539 | Ga0114129_10035072 | |||
| 2540 | Ga0114129_10057279 | |||
| 2541 | Ga0114129_10062807 | |||
| 2542 | Ga0114129_10095997 | |||
| 2543 | Ga0114129_10241848 | |||
| 2544 | Ga0114129_10685163 | |||
| 2545 | Ga0114129_10741655 | |||
| 2546 | Ga0114129_10770015 | |||
| 2547 | Ga0114129_11650956 | |||
| 2548 | Ga0105243_10003045 | |||
| 2549 | Ga0105243_10009792 | |||
| 2550 | Ga0105243_10174023 | |||
| 2551 | Ga0105243_10632848 | |||
| 2552 | Ga0105243_10646984 | |||
| 2553 | Ga0105243_10736654 | |||
| 2554 | Ga0105241_10001352 | |||
| 2555 | Ga0105241_10092438 | |||
| 2556 | Ga0105241_10591021 | |||
| 2557 | Ga0105242_10001245 | |||
| 2558 | Ga0105242_10234816 | |||
| 2559 | Ga0105242_10292772 | |||
| 2560 | Ga0105242_10475396 | |||
| 2561 | Ga0105242_10891089 | |||
| 2562 | Ga0105248_10001324 | |||
| 2563 | Ga0105248_10016609 | |||
| 2564 | Ga0105248_10027404 | |||
| 2565 | Ga0105248_10137102 | |||
| 2566 | Ga0105248_10142505 | |||
| 2567 | Ga0105248_10236177 | |||
| 2568 | Ga0105237_10002060 | |||
| 2569 | Ga0105237_10051893 | |||
| 2570 | Ga0105237_10502841 | |||
| 2571 | Ga0105238_10168915 | |||
| 2572 | Ga0105238_10519124 | |||
| 2573 | Ga0105249_10011280 | |||
| 2574 | Ga0105249_10044003 | |||
| 2575 | Ga0105249_10243921 | |||
| 2576 | Ga0105239_10018332 | |||
| 2577 | Ga0105239_10046768 | |||
| 2578 | Ga0105239_10063519 | |||
| 2579 | Ga0105239_10132942 | |||
| 2580 | Ga0105239_10240473 | |||
| 2581 | Ga0105239_10326261 | |||
| 2582 | Ga0105239_10390965 | |||
| 2583 | Ga0105239_10524366 | |||
| 2584 | Ga0105239_10642095 | |||
| 2585 | Ga0105246_10000510 | |||
| 2586 | Ga0105246_10070617 | |||
| 2587 | Ga0105246_10169126 | |||
| 2588 | Ga0157315_1005559 | |||
| 2589 | Ga0157373_10002949 | |||
| 2590 | Ga0157371_10032190 | |||
| 2591 | Ga0157370_10022603 | |||
| 2592 | Ga0157370_10042139 | |||
| 2593 | Ga0157370_10115657 | |||
| 2594 | Ga0157370_10280866 | |||
| 2595 | Ga0157369_10034680 | |||
| 2596 | Ga0157369_10045599 | |||
| 2597 | Ga0157369_10305824 | |||
| 2598 | Ga0157374_10001994 | |||
| 2599 | Ga0157374_10964442 | |||
| 2600 | Ga0157378_10005283 | |||
| 2601 | Ga0157378_10177813 | |||
| 2602 | Ga0157378_10326744 | |||
| 2603 | Ga0163162_10018668 | |||
| 2604 | Ga0163162_10129762 | |||
| 2605 | Ga0163162_10775572 | |||
| 2606 | Ga0157372_10214993 | |||
| 2607 | Ga0157372_10676412 | |||
| 2608 | Ga0157375_10038248 | |||
| 2609 | Ga0157375_10245534 | |||
| 2610 | Ga0157375_10259770 | |||
| 2611 | Ga0157375_10299558 | |||
| 2612 | Ga0163163_10017133 | |||
| 2613 | Ga0163163_10063041 | |||
| 2614 | Ga0163163_10126958 | |||
| 2615 | Ga0163163_10393886 | |||
| 2616 | Ga0163163_10541197 | |||
| 2617 | Ga0163163_10893255 | |||
| 2618 | Ga0163163_11035903 | |||
| 2619 | Ga0157380_10010558 | |||
| 2620 | Ga0157380_10044784 | |||
| 2621 | Ga0157380_10278226 | |||
| 2622 | Ga0157380_10785985 | |||
| 2623 | Ga0182008_10165678 | |||
| 2624 | Ga0182008_10242838 | |||
| 2625 | Ga0157377_10001228 | |||
| 2626 | Ga0157379_10001959 | |||
| 2627 | Ga0157379_10133256 | |||
| 2628 | Ga0157379_10206894 | |||
| 2629 | Ga0157376_10017127 | |||
| 2630 | Ga0157376_10066771 | |||
| 2631 | Ga0157376_10739305 | |||
| 2632 | Ga0157376_10922161 | |||
| 2633 | Ga0182005_1039485 | |||
| 2634 | Ga0163161_10017343 | |||
| 2635 | Ga0163161_10038485 | |||
| 2636 | Ga0163161_10131788 | |||
| 2637 | Ga0214544_1000026 | |||
| 2638 | Ga0214542_1000025 | |||
| 2639 | Ga0214545_1000014 | |||
| 2640 | Ga0214543_1000034 | |||
| 2641 | Ga0213873_10006937 | |||
| 2642 | Ga0213876_10058129 | |||
| 2643 | Ga0213876_10084092 | |||
| 2644 | Ga0213876_10130132 | |||
| 2645 | Ga0213875_10093331 | |||
| 2646 | Ga0213871_10004587 | |||
| 2647 | Ga0213871_10054108 | |||
| 2648 | Ga0213871_10085835 | |||
| 2649 | Ga0209677_103618 | |||
| 2650 | Ga0209148_1000376 | |||
| 2651 | Ga0209233_1009577 | |||
| 2652 | Ga0207666_1000081 | |||
| 2653 | Ga0209455_1000714 | |||
| 2654 | Ga0207673_1001727 | |||
| 2655 | Ga0209564_1011304 | |||
| 2656 | Ga0209758_1000141 | |||
| 2657 | Ga0209758_1000324 | |||
| 2658 | Ga0209758_1001019 | |||
| 2659 | Ga0209758_1002338 | |||
| 2660 | Ga0209758_1002921 | |||
| 2661 | Ga0209758_1003483 | |||
| 2662 | Ga0209758_1041951 | |||
| 2663 | Ga0209758_1081463 | |||
| 2664 | Ga0209256_1002956 | |||
| 2665 | Ga0209256_1047199 | |||
| 2666 | Ga0207426_1000437 | |||
| 2667 | Ga0207426_1001139 | |||
| 2668 | Ga0207426_1012626 | |||
| 2669 | Ga0207426_1018791 | |||
| 2670 | Ga0207426_1021983 | |||
| 2671 | Ga0209257_1003859 | |||
| 2672 | Ga0209257_1011469 | |||
| 2673 | Ga0209257_1040537 | |||
| 2674 | Ga0207697_10000051 | |||
| 2675 | Ga0207697_10086702 | |||
| 2676 | Ga0207697_10113018 | |||
| 2677 | Ga0207682_10000661 | |||
| 2678 | Ga0207692_10002517 | |||
| 2679 | Ga0207692_10177558 | |||
| 2680 | Ga0207692_10214027 | |||
| 2681 | Ga0207692_10350439 | |||
| 2682 | Ga0207642_10001892 | |||
| 2683 | Ga0207710_10016916 | |||
| 2684 | Ga0207710_10038841 | |||
| 2685 | Ga0207710_10079983 | |||
| 2686 | Ga0207688_10000702 | |||
| 2687 | Ga0207688_10114944 | |||
| 2688 | Ga0207688_10167168 | |||
| 2689 | Ga0207688_10411062 | |||
| 2690 | Ga0207688_10477369 | |||
| 2691 | Ga0207680_10009478 | |||
| 2692 | Ga0207680_10044806 | |||
| 2693 | Ga0207647_10002441 | |||
| 2694 | Ga0207647_10040227 | |||
| 2695 | Ga0207685_10010399 | |||
| 2696 | Ga0207685_10056738 | |||
| 2697 | Ga0207699_10000344 | |||
| 2698 | Ga0207699_10000434 | |||
| 2699 | Ga0207699_10035971 | |||
| 2700 | Ga0207699_10101229 | |||
| 2701 | Ga0207699_10154439 | |||
| 2702 | Ga0207645_10000218 | |||
| 2703 | Ga0207645_10027565 | |||
| 2704 | Ga0207645_10045314 | |||
| 2705 | Ga0207643_10000400 | |||
| 2706 | Ga0207643_10234976 | |||
| 2707 | Ga0207705_10358320 | |||
| 2708 | Ga0207705_10392607 | |||
| 2709 | Ga0207684_10004496 | |||
| 2710 | Ga0207684_10004520 | |||
| 2711 | Ga0207684_10012329 | |||
| 2712 | Ga0207684_10015203 | |||
| 2713 | Ga0207684_10087821 | |||
| 2714 | Ga0207684_10282202 | |||
| 2715 | Ga0207684_10292934 | |||
| 2716 | Ga0207654_10002726 | |||
| 2717 | Ga0207654_10194687 | |||
| 2718 | Ga0207707_10002658 | |||
| 2719 | Ga0207707_10011843 | |||
| 2720 | Ga0207707_10023997 | |||
| 2721 | Ga0207707_10043382 | |||
| 2722 | Ga0207707_10056384 | |||
| 2723 | Ga0207707_10063500 | |||
| 2724 | Ga0207707_10410557 | |||
| 2725 | Ga0207695_10036649 | |||
| 2726 | Ga0207695_10050434 | |||
| 2727 | Ga0207695_10085924 | |||
| 2728 | Ga0207695_10115522 | |||
| 2729 | Ga0207695_10212050 | |||
| 2730 | Ga0207695_10236470 | |||
| 2731 | Ga0207671_10131265 | |||
| 2732 | Ga0207671_10143288 | |||
| 2733 | Ga0207671_10521032 | |||
| 2734 | Ga0207671_10529112 | |||
| 2735 | Ga0207693_10001161 | |||
| 2736 | Ga0207693_10003608 | |||
| 2737 | Ga0207693_10035323 | |||
| 2738 | Ga0207693_10042279 | |||
| 2739 | Ga0207693_10085481 | |||
| 2740 | Ga0207693_10132528 | |||
| 2741 | Ga0207693_10206011 | |||
| 2742 | Ga0207693_10269282 | |||
| 2743 | Ga0207693_10321843 | |||
| 2744 | Ga0207693_10365645 | |||
| 2745 | Ga0207663_10000926 | |||
| 2746 | Ga0207663_10012457 | |||
| 2747 | Ga0207660_10002897 | |||
| 2748 | Ga0207660_10010384 | |||
| 2749 | Ga0207660_10013462 | |||
| 2750 | Ga0207660_10495516 | |||
| 2751 | Ga0207660_10651928 | |||
| 2752 | Ga0207662_10000678 | |||
| 2753 | Ga0207657_10003448 | |||
| 2754 | Ga0207657_10075202 | |||
| 2755 | Ga0207657_10095681 | |||
| 2756 | Ga0207657_10138003 | |||
| 2757 | Ga0207657_10166205 | |||
| 2758 | Ga0207657_10560607 | |||
| 2759 | Ga0207649_10001450 | |||
| 2760 | Ga0207652_10005840 | |||
| 2761 | Ga0207652_10006902 | |||
| 2762 | Ga0207652_10008077 | |||
| 2763 | Ga0207652_10016789 | |||
| 2764 | Ga0207652_10211430 | |||
| 2765 | Ga0207652_10346504 | |||
| 2766 | Ga0207646_10003037 | |||
| 2767 | Ga0207646_10078591 | |||
| 2768 | Ga0207646_10159870 | |||
| 2769 | Ga0207646_10244434 | |||
| 2770 | Ga0207646_10525802 | |||
| 2771 | Ga0207681_10001264 | |||
| 2772 | Ga0207681_10203390 | |||
| 2773 | Ga0207681_10259340 | |||
| 2774 | Ga0207694_10113941 | |||
| 2775 | Ga0207694_10125399 | |||
| 2776 | Ga0207694_10153373 | |||
| 2777 | Ga0207694_10296268 | |||
| 2778 | Ga0207694_10464238 | |||
| 2779 | Ga0207650_10043914 | |||
| 2780 | Ga0207650_10085722 | |||
| 2781 | Ga0207650_10219732 | |||
| 2782 | Ga0207659_10004045 | |||
| 2783 | Ga0207659_10248312 | |||
| 2784 | Ga0207659_10421962 | |||
| 2785 | Ga0207687_10007913 | |||
| 2786 | Ga0207687_10040438 | |||
| 2787 | Ga0207687_10427047 | |||
| 2788 | Ga0207700_10001395 | |||
| 2789 | Ga0207700_10015437 | |||
| 2790 | Ga0207700_10015756 | |||
| 2791 | Ga0207700_10090002 | |||
| 2792 | Ga0207700_10096610 | |||
| 2793 | Ga0207700_10101360 | |||
| 2794 | Ga0207700_10524626 | |||
| 2795 | Ga0207664_10023034 | |||
| 2796 | Ga0207664_10064254 | |||
| 2797 | Ga0207664_10145777 | |||
| 2798 | Ga0207664_10726649 | |||
| 2799 | Ga0207644_10044060 | |||
| 2800 | Ga0207644_10091325 | |||
| 2801 | Ga0207644_10114849 | |||
| 2802 | Ga0207690_10003720 | |||
| 2803 | Ga0207690_10103954 | |||
| 2804 | Ga0207706_10016490 | |||
| 2805 | Ga0207706_10168370 | |||
| 2806 | Ga0207706_10176636 | |||
| 2807 | Ga0207706_10199102 | |||
| 2808 | Ga0207706_10297489 | |||
| 2809 | Ga0207706_10518744 | |||
| 2810 | Ga0207686_10012733 | |||
| 2811 | Ga0207686_10017495 | |||
| 2812 | Ga0207709_10001798 | |||
| 2813 | Ga0207709_10056378 | |||
| 2814 | Ga0207709_10081552 | |||
| 2815 | Ga0207670_10003328 | |||
| 2816 | Ga0207670_10046656 | |||
| 2817 | Ga0207670_10073089 | |||
| 2818 | Ga0207669_10002357 | |||
| 2819 | Ga0207669_10047148 | |||
| 2820 | Ga0207704_10000896 | |||
| 2821 | Ga0207704_10047543 | |||
| 2822 | Ga0207665_10000228 | |||
| 2823 | Ga0207665_10000715 | |||
| 2824 | Ga0207665_10002595 | |||
| 2825 | Ga0207665_10019118 | |||
| 2826 | Ga0207665_10023485 | |||
| 2827 | Ga0207665_10149363 | |||
| 2828 | Ga0207665_10327372 | |||
| 2829 | Ga0207691_10000940 | |||
| 2830 | Ga0207691_10059780 | |||
| 2831 | Ga0207691_10063675 | |||
| 2832 | Ga0207691_10146323 | |||
| 2833 | Ga0207691_10373640 | |||
| 2834 | Ga0207711_10032480 | |||
| 2835 | Ga0207711_10034481 | |||
| 2836 | Ga0207711_10041197 | |||
| 2837 | Ga0207711_10041697 | |||
| 2838 | Ga0207711_10095313 | |||
| 2839 | Ga0207711_10115517 | |||
| 2840 | Ga0207711_10339338 | |||
| 2841 | Ga0207711_10486060 | |||
| 2842 | Ga0207689_10000514 | |||
| 2843 | Ga0207689_10069377 | |||
| 2844 | Ga0207689_10145972 | |||
| 2845 | Ga0207689_10435858 | |||
| 2846 | Ga0207689_10881434 | |||
| 2847 | Ga0207661_10001969 | |||
| 2848 | Ga0207661_10012879 | |||
| 2849 | Ga0207661_10029500 | |||
| 2850 | Ga0207661_10125062 | |||
| 2851 | Ga0207661_10208332 | |||
| 2852 | Ga0207661_10297372 | |||
| 2853 | Ga0207679_10000099 | |||
| 2854 | Ga0207679_10224032 | |||
| 2855 | Ga0207679_10598458 | |||
| 2856 | Ga0207667_10019759 | |||
| 2857 | Ga0207667_10040667 | |||
| 2858 | Ga0207667_10042644 | |||
| 2859 | Ga0207667_10098778 | |||
| 2860 | Ga0207667_10209760 | |||
| 2861 | Ga0207667_10399499 | |||
| 2862 | Ga0207667_10410416 | |||
| 2863 | Ga0207667_10482505 | |||
| 2864 | Ga0207667_10648856 | |||
| 2865 | Ga0207651_10000609 | |||
| 2866 | Ga0207712_10001402 | |||
| 2867 | Ga0207712_10164503 | |||
| 2868 | Ga0207712_10402077 | |||
| 2869 | Ga0207668_10008221 | |||
| 2870 | Ga0207668_10069987 | |||
| 2871 | Ga0207668_10075220 | |||
| 2872 | Ga0207668_10438243 | |||
| 2873 | Ga0207640_10001310 | |||
| 2874 | Ga0207640_10083988 | |||
| 2875 | Ga0207658_10021213 | |||
| 2876 | Ga0207658_10329427 | |||
| 2877 | Ga0207658_10444865 | |||
| 2878 | Ga0207677_10000495 | |||
| 2879 | Ga0207677_10020041 | |||
| 2880 | Ga0207703_10005812 | |||
| 2881 | Ga0207703_10250211 | |||
| 2882 | Ga0207703_10254113 | |||
| 2883 | Ga0207703_10393259 | |||
| 2884 | Ga0207703_10404414 | |||
| 2885 | Ga0207703_10760488 | |||
| 2886 | Ga0207639_10006228 | |||
| 2887 | Ga0207639_10058222 | |||
| 2888 | Ga0207639_10062266 | |||
| 2889 | Ga0207639_10132413 | |||
| 2890 | Ga0207639_10456287 | |||
| 2891 | Ga0207678_10004568 | |||
| 2892 | Ga0207678_10015651 | |||
| 2893 | Ga0207678_10076090 | |||
| 2894 | Ga0207678_10083060 | |||
| 2895 | Ga0207678_10095571 | |||
| 2896 | Ga0207678_10313045 | |||
| 2897 | Ga0207678_10473513 | |||
| 2898 | Ga0207708_10016215 | |||
| 2899 | Ga0207708_10059563 | |||
| 2900 | Ga0207702_10012301 | |||
| 2901 | Ga0207702_10018427 | |||
| 2902 | Ga0207702_10067051 | |||
| 2903 | Ga0207702_10473207 | |||
| 2904 | Ga0207702_10782605 | |||
| 2905 | Ga0207641_10021071 | |||
| 2906 | Ga0207641_10204516 | |||
| 2907 | Ga0207648_10000575 | |||
| 2908 | Ga0207648_10179928 | |||
| 2909 | Ga0207676_10006987 | |||
| 2910 | Ga0207676_10011122 | |||
| 2911 | Ga0207676_10263449 | |||
| 2912 | Ga0207676_10551129 | |||
| 2913 | Ga0207676_10797397 | |||
| 2914 | Ga0207674_10002439 | |||
| 2915 | Ga0207674_10008791 | |||
| 2916 | Ga0207674_10053695 | |||
| 2917 | Ga0207674_10088944 | |||
| 2918 | Ga0207674_10097261 | |||
| 2919 | Ga0207674_10109561 | |||
| 2920 | Ga0207674_10239446 | |||
| 2921 | Ga0207674_10632272 | |||
| 2922 | Ga0207674_10678099 | |||
| 2923 | Ga0207675_100002824 | |||
| 2924 | Ga0207675_100184205 | |||
| 2925 | Ga0207675_100185079 | |||
| 2926 | Ga0207675_100843026 | |||
| 2927 | Ga0207683_10093675 | |||
| 2928 | Ga0207683_10107125 | |||
| 2929 | Ga0207683_10159116 | |||
| 2930 | Ga0207683_10484988 | |||
| 2931 | Ga0207698_10002620 | |||
| 2932 | Ga0207698_10083446 | |||
| 2933 | Ga0207698_10178948 | |||
| 2934 | Ga0207698_10435391 | |||
| 2935 | Ga0207698_10536270 | |||
| 2936 | Ga0209389_1000004 | |||
| 2937 | Ga0209389_1000023 | |||
| 2938 | Ga0209589_1000006 | |||
| 2939 | Ga0209589_1000010 | |||
| 2940 | Ga0209489_100007 | |||
| 2941 | Ga0209489_100011 | |||
| 2942 | Ga0209489_100777 | |||
| 2943 | Ga0209700_100008 | |||
| 2944 | Ga0209700_100013 | |||
| 2945 | Ga0209179_1002360 | |||
| 2946 | Ga0209998_10001529 | |||
| 2947 | Ga0209813_10097234 | |||
| 2948 | Ga0209974_10007886 | |||
| 2949 | Ga0207428_10000033 | |||
| 2950 | Ga0207428_10000094 | |||
| 2951 | Ga0207428_10000736 | |||
| 2952 | Ga0207428_10034078 | |||
| 2953 | Ga0207428_10318688 | |||
| 2954 | Ga0268266_10007855 | |||
| 2955 | Ga0268266_10060020 | |||
| 2956 | Ga0268266_10150629 | |||
| 2957 | Ga0268266_10203391 | |||
| 2958 | Ga0268266_10205402 | |||
| 2959 | Ga0268266_10588732 | |||
| 2960 | Ga0268266_10734807 | |||
| 2961 | Ga0268266_10747995 | |||
| 2962 | Ga0268265_10002253 | |||
| 2963 | Ga0268265_10072751 | |||
| 2964 | Ga0268265_10255958 | |||
| 2965 | Ga0268264_10004708 | |||
| 2966 | Ga0268264_10016894 | |||
| 2967 | Ga0268264_10032913 | |||
| 2968 | Ga0268264_10510910 | |||
| 2969 | Ga0307517_10000102 | |||
| 2970 | Ga0307511_10000269 | |||
| 2971 | Ga0265332_10118070 | |||
| 2972 | Ga0265328_10071118 | |||
| 2973 | Ga0265340_10030010 | |||
| 2974 | Ga0265339_10110557 | |||
| 2975 | Ga0265316_10028234 | |||
| 2976 | Ga0265316_10158346 | |||
| 2977 | Ga0307509_10139585 | |||
| 2978 | Ga0307408_100261023 | |||
| 2979 | Ga0307508_10215758 | |||
| 2980 | Ga0307516_10036663 | |||
| 2981 | Ga0307405_10306430 | |||
| 2982 | Ga0307413_10121182 | |||
| 2983 | Ga0307410_10233390 | |||
| 2984 | Ga0307407_10187867 | |||
| 2985 | Ga0307412_10289483 | |||
| 2986 | Ga0307412_10753256 | |||
| 2987 | Ga0307409_100448725 | |||
| 2988 | Ga0307409_100952146 | |||
| 2989 | Ga0307411_10065049 | |||
| 2990 | Ga0307411_10118477 | |||
| 2991 | Ga0307411_10168777 | |||
| 2992 | Ga0307415_100428961 | |||
| 2993 | Ga0307415_100657546 | |||
| 2994 | Ga0307510_10027691 | |||
| 2995 | Ga0307510_10069562 | |||
| 2996 | Ga0315911_1000010 | |||
| 2997 | Ga0373950_0001102 | |||
| 2998 | Ga0373958_0002389 | |||
| 2999 | Ga0373938_0001160 | |||
| 3000 | Ga0373926_0002880 | |||
| 3001 | Ga0373928_0014131 | |||
| 3002 | Ga0373934_0054354 | |||
| 3003 | Ga0373934_0056776 | |||
| 3004 | Ga0373940_0011418 | |||
| 3005 | Ga0373944_0019486 | |||
| 3006 | Ga0373949_0000927 | |||
| 3007 | Ga0373951_0002101 | |||
| 3008 | Ga0373951_0073904 | |||
| 3009 | Ga0373923_0002326 | |||
| 3010 | Ga0373923_0040341 | |||
| 3011 | Ga0373932_0006222 | |||
| 3012 | Ga0373932_0014847 | |||
| 3013 | Ga0373932_0058549 | |||
| 3014 | Ga0373936_0005468 | |||
| 3015 | Ga0373936_0018584 | |||
| 3016 | Ga0373936_0150221 | |||
| 3017 | Ga0373939_0001513 | |||
| 3018 | Ga0373939_0029562 | |||
| 3019 | Ga0373939_0041635 | |||
| 3020 | Ga0373941_0000449 | |||
| 3021 | Ga0373941_0002582 | |||
| 3022 | Ga0373941_0004659 | |||
| 3023 | Ga0373941_0105772 | |||
| 3024 | Ga0373945_0010695 | |||
| 3025 | Ga0373953_0000420 | |||
| 3026 | Ga0373953_0014626 | |||
| 3027 | Ga0373953_0021876 | |||
| 3028 | Ga0373953_0076725 | |||
| 3029 | Ga0373953_0164912 | |||
| 3030 | Ga0373954_0000663 | |||
| 3031 | Ga0373954_0056577 | |||
| 3032 | Ga0373954_0062480 | |||
| 3033 | Ga0373956_0000275 | |||
| 3034 | Ga0373956_0103162 | |||
| 3035 | Ga0373957_0000426 | |||
| 3036 | Ga0373957_0049589 | |||
| 3037 | Ga0373957_0050517 | |||
| 3038 | Ga0373957_0126366 | |||
| 3039 | Ga0373957_0139518 | |||
| 3040 | Ga0373957_0151219 | |||
| 3041 | Ga0373960_0003445 | |||
| 3042 | Ga0373960_0080636 | |||
| 3043 | Ga0373943_0000424 | |||
| 3044 | Ga0373943_0006136 | |||
| 3045 | Ga0373943_0028636 | |||
| 3046 | Ga0373943_0046732 | |||
| 3047 | Ga0373943_0118531 | |||
| 3048 | Ga0373946_0003275 | |||
| 3049 | Ga0373946_0031028 | |||
| 3050 | Ga0373955_0000510 | |||
| 3051 | Ga0373955_0016347 | |||
| 3052 | Ga0373955_0056665 | |||
| 3053 | Ga0373942_0027753 | |||
| 3054 | Ga0373962_0003492 | |||
| 3055 | Ga0373924_0004208 | |||
| 3056 | Ga0373924_0066506 | |||
| 3057 | Ga0373931_0001672 | |||
| 3058 | Ga0373931_0006356 | |||
| 3059 | Ga0373931_0008479 | |||
| 3060 | Ga0373931_0066158 | |||
| 3061 | Ga0373931_0089514 | |||
| 3062 | Ga0373931_0313329 | |||
| 3063 | Ga0373931_0325217 | |||
| 3064 | Ga0373935_0000229 | |||
| 3065 | Ga0373935_0000882 | |||
| 3066 | Ga0373935_0019969 | |||
| 3067 | Ga0373935_0218091 | |||
| 3068 | Ga0373935_0286870 | |||
| 3069 | Ga0373927_0000071 | |||
| 3070 | Ga0373927_0000414 | |||
| 3071 | Ga0373927_0007062 | |||
| 3072 | Ga0373927_0011507 | |||
| 3073 | Ga0373927_0025829 | |||
| 3074 | Ga0373927_0030092 | |||
| 3075 | Ga0373927_0099124 | |||
| 3076 | Ga0373927_0103253 | |||
| 3077 | Ga0373927_0284219 | |||
| 3078 | Ga0373927_0332372 | |||
| 3079 | Ga0373927_0528331 | |||
| 3080 | Ga0373933_0004204 | |||
| 3081 | Ga0373933_0029183 | |||
| 3082 | Ga0373933_0034112 | |||
| 3083 | Ga0373933_0239607 | |||
| 3084 | Ga0373933_0286839 | |||
| 3085 | Ga0373947_0000275 | |||
| 3086 | Ga0373947_0000540 | |||
| 3087 | Ga0373947_0003876 | |||
| 3088 | Ga0373947_0004993 | |||
| 3089 | Ga0373947_0017419 | |||
| 3090 | Ga0373947_0036936 | |||
| 3091 | Ga0373947_0147132 | |||
| 3092 | Ga0373947_0258951 | |||
| 3093 | Ga0373937_0031431 | |||
| 3094 | Ga0373937_0039136 | |||
| 3095 | Ga0373937_0045462 | |||
| 3096 | Ga0373937_0045643 | |||
| 3097 | Ga0373937_0070190 | |||
| 3098 | Ga0373937_0193491 | |||
| 3099 | Ga0373937_0212345 | |||
| 3100 | Ga0373937_0261930 | |||
| 3101 | Ga0373937_0389320 | |||
| 3102 | Ga0373925_0002725 | |||
| 3103 | Ga0373925_0030853 | |||
| 3104 | Ga0373925_0040457 | |||
| 3105 | Ga0373925_0054967 | |||
| 3106 | Ga0373925_0087640 | |||
| 3107 | Ga0373925_0100456 | |||
| 3108 | Ga0373925_0120831 | |||
| 3109 | Ga0373925_0206794 | |||
| 3110 | Ga0373925_0391554 | |||
| 3111 | Ga0373925_0457061 | |||
| 3112 | Ga0373925_0471153 | |||
| 3113 | Ga0395899_0008599 | |||
| 3114 | Ga0395899_0171700 | |||
| 3115 | Ga0395900_0013738 | |||
| 3116 | Ga0395900_0021345 | |||
| 3117 | Ga0395900_0054470 | |||
| 3118 | Ga0395900_0259612 | |||
| 3119 | Ga0395900_0796875 | |||
| 3120 | Ga0395898_0006919 | |||
| 3121 | Ga0395898_0024139 | |||
| 3122 | Ga0395898_0065456 | |||
| 3123 | Ga0395898_0140754 | |||
| 3124 | Ga0395905_0030266 | |||
| 3125 | Ga0395905_0176477 | |||
| 3126 | Ga0395905_0284582 | |||
| 3127 | Ga0395905_0577770 | |||
| 3128 | Ga0436364_0066511 | |||
| 3129 | Ga0436364_0680312 | |||
| 3130 | Ga0395901_0005295 | |||
| 3131 | Ga0395901_0025268 | |||
| 3132 | Ga0395901_0157594 | |||
| 3133 | Ga0395901_0222005 | |||
| 3134 | Ga0395901_0566758 | |||
| 3135 | Ga0395901_0896520 | |||
| 3136 | Ga0436365_0290905 | |||
| 3137 | Ga0436365_0643464 | |||
| 3138 | Ga0436365_0906128 | |||
| 3139 | Ga0436365_1318098 | |||
| 3140 | Ga0436365_1835535 | |||
| 3141 | Ga0436365_1883031 | |||
| 3142 | Ga0436360_0160052 | |||
| 3143 | Ga0436360_0336915 | |||
| 3144 | Ga0436360_0347139 | |||
| 3145 | Ga0436360_0372244 | |||
| 3146 | Ga0436360_0467044 | |||
| 3147 | Ga0436361_0486257 | |||
| 3148 | Ga0436361_0927272 | |||
| 3149 | Ga0436361_1221223 | |||
| 3150 | Ga0436363_1356934 | |||
| 3151 | Ga0436363_1697326 | |||
| 3152 | Ga0436362_0313826 | |||
| 3153 | Ga0436362_0755152 | |||
| 3154 | Ga0436362_0815359 | |||
| 3155 | Ga0439465_0041847 | |||
| 3156 | Ga0451793_0668962 | |||
| 3157 | Ga0451795_0064442 | |||
| 3158 | Ga0451800_0438865 | |||
| 3159 | Ga0451835_1226713 | |||
| 3160 | Ga0451847_0960825 | |||
| 3161 | Ga0451577_0047462 | |||
| 3162 | Ga0466969_0016988 | |||
| 3163 | Ga0466972_0000193 | |||
| 3164 | Ga0466972_0014447 | |||
| 3165 | Ga0453683_0025310 | |||
| 3166 | Ga0466965_0176727 | |||
| 3167 | Ga0466966_0000551 | |||
| 3168 | Ga0466961_0000020 | |||
| 3169 | Ga0466963_0014002 | |||
| 3170 | Ga0466963_0119916 | |||
| 3171 | Ga0466963_0231314 | |||
| 3172 | Ga0453684_0024772 | |||
| 3173 | Ga0466968_0009179 | |||
| 3174 | Ga0466957_0076196 | |||
| 3175 | Ga0466960_0039543 | |||
| 3176 | Ga0466959_0037674 | |||
| 3177 | Ga0451576_0030558 | |||
| 3178 | Ga0451576_0034448 | |||
| 3179 | Ga0451576_0054640 | |||
| 3180 | Ga0451576_0076080 | |||
| 3181 | Ga0451576_0274464 | |||
| 3182 | Ga0466967_0002756 | |||
| 3183 | Ga0466967_0014710 | |||
| 3184 | Ga0466967_0070110 | |||
| 3185 | Ga0466967_0100278 | |||
| 3186 | Ga0495617_026442 | |||
| 3187 | Ga0495592_0003051 | |||
| 3188 | Ga0495592_0003383 | |||
| 3189 | Ga0495592_0036322 | |||
| 3190 | Ga0495592_0049426 | |||
| 3191 | Ga0495592_0058136 | |||
| 3192 | Ga0495592_0160159 | |||
| 3193 | Ga0495603_0000035 | |||
| 3194 | Ga0495603_0001059 | |||
| 3195 | Ga0495603_0006718 | |||
| 3196 | Ga0495603_0007225 | |||
| 3197 | Ga0495603_0021313 | |||
| 3198 | Ga0495603_0048434 | |||
| 3199 | Ga0495603_0132535 | |||
| 3200 | Ga0495603_0386525 | |||
| 3201 | Ga0495590_0039422 | |||
| 3202 | Ga0495590_0103306 | |||
| 3203 | Ga0495590_0172169 | |||
| 3204 | Ga0495629_0000081 | |||
| 3205 | Ga0495629_0000269 | |||
| 3206 | Ga0495629_0000612 | |||
| 3207 | Ga0495629_0011200 | |||
| 3208 | Ga0495629_0058439 | |||
| 3209 | Ga0495629_0090143 | |||
| 3210 | Ga0495629_0129759 | |||
| 3211 | Ga0495629_0312568 | |||
| 3212 | Ga0495638_0004483 | |||
| 3213 | Ga0495638_0105267 | |||
| 3214 | Ga0495641_0005556 | |||
| 3215 | Ga0495641_0008400 | |||
| 3216 | Ga0495641_0019447 | |||
| 3217 | Ga0495651_0005350 | |||
| 3218 | Ga0495651_0009999 | |||
| 3219 | Ga0495651_0030088 | |||
| 3220 | Ga0495651_0031301 | |||
| 3221 | Ga0495651_0031832 | |||
| 3222 | Ga0495651_0113904 | |||
| 3223 | Ga0495651_0148779 | |||
| 3224 | Ga0495653_0000399 | |||
| 3225 | Ga0495653_0036295 | |||
| 3226 | Ga0495653_0057546 | |||
| 3227 | Ga0495653_0070117 | |||
| 3228 | Ga0495653_0153653 | |||
| 3229 | Ga0495650_0036071 | |||
| 3230 | Ga0495650_0064595 | |||
| 3231 | Ga0495580_0000449 | |||
| 3232 | Ga0495580_0005664 | |||
| 3233 | Ga0495580_0058049 | |||
| 3234 | Ga0495580_0058144 | |||
| 3235 | Ga0495580_0100922 | |||
| 3236 | Ga0495580_0405326 | |||
| 3237 | Ga0495582_0000021 | |||
| 3238 | Ga0495582_0024180 | |||
| 3239 | Ga0495582_0030917 | |||
| 3240 | Ga0495582_0258821 | |||
| 3241 | Ga0495582_0354229 | |||
| 3242 | Ga0495605_0144926 | |||
| 3243 | Ga0495639_0000010 | |||
| 3244 | Ga0495639_0009316 | |||
| 3245 | Ga0495639_0162912 | |||
| 3246 | Ga0495639_0196875 | |||
| 3247 | Ga0495662_0000261 | |||
| 3248 | Ga0495662_0008429 | |||
| 3249 | Ga0495662_0016950 | |||
| 3250 | Ga0495662_0025894 | |||
| 3251 | Ga0495662_0034302 | |||
| 3252 | Ga0495662_0088131 | |||
| 3253 | Ga0495664_0000736 | |||
| 3254 | Ga0495664_0004738 | |||
| 3255 | Ga0495664_0007307 | |||
| 3256 | Ga0495664_0007928 | |||
| 3257 | Ga0495664_0028294 | |||
| 3258 | Ga0495664_0092367 | |||
| 3259 | Ga0495664_0238942 | |||
| 3260 | Ga0495584_0025120 | |||
| 3261 | Ga0495585_0001696 | |||
| 3262 | Ga0495585_0189940 | |||
| 3263 | Ga0495585_0278597 | |||
| 3264 | Ga0495594_0000979 | |||
| 3265 | Ga0495594_0021023 | |||
| 3266 | Ga0495594_0292065 | |||
| 3267 | Ga0495607_0014000 | |||
| 3268 | Ga0495583_0138614 | |||
| 3269 | Ga0495606_0001170 | |||
| 3270 | Ga0495606_0146458 | |||
| 3271 | Ga0495608_0001226 | |||
| 3272 | Ga0495608_0016478 | |||
| 3273 | Ga0495608_0021826 | |||
| 3274 | Ga0495608_0031182 | |||
| 3275 | Ga0495608_0034772 | |||
| 3276 | Ga0495608_0069160 | |||
| 3277 | Ga0495608_0089598 | |||
| 3278 | Ga0495618_0014879 | |||
| 3279 | Ga0495618_0014997 | |||
| 3280 | Ga0495618_0026734 | |||
| 3281 | Ga0495618_0059293 | |||
| 3282 | Ga0495618_0078648 | |||
| 3283 | Ga0495618_0293219 | |||
| 3284 | Ga0495628_0009019 | |||
| 3285 | Ga0495628_0012048 | |||
| 3286 | Ga0495628_0029893 | |||
| 3287 | Ga0495628_0069679 | |||
| 3288 | Ga0495628_0106266 | |||
| 3289 | Ga0495628_0435079 | |||
| 3290 | Ga0495628_0533755 | |||
| 3291 | Ga0495630_0002218 | |||
| 3292 | Ga0495630_0021361 | |||
| 3293 | Ga0495630_0280144 | |||
| 3294 | Ga0495630_0283650 | |||
| 3295 | Ga0495630_0464862 | |||
| 3296 | Ga0495630_0619573 | |||
| 3297 | Ga0495632_0166000 | |||
| 3298 | Ga0495637_0067395 | |||
| 3299 | Ga0495637_0099910 | |||
| 3300 | Ga0495643_0006750 | |||
| 3301 | Ga0495644_0003755 | |||
| 3302 | Ga0495648_0212507 | |||
| 3303 | Ga0495663_0032939 | |||
| 3304 | Ga0495666_0031225 | |||
| 3305 | Ga0495666_0108952 | |||
| 3306 | Ga0495652_0006874 | |||
| 3307 | Ga0495652_0008672 | |||
| 3308 | Ga0495652_0019786 | |||
| 3309 | Ga0495652_0079863 | |||
| 3310 | Ga0495665_0002966 | |||
| 3311 | Ga0495665_0009534 | |||
| 3312 | Ga0495665_0024212 | |||
| 3313 | Ga0495665_0031922 | |||
| 3314 | Ga0495640_0002964 | |||
| 3315 | Ga0495640_0013343 | |||
| 3316 | Ga0495640_0018374 | |||
| 3317 | Ga0495640_0027630 | |||
| 3318 | Ga0495640_0032420 | |||
| 3319 | Ga0495586_0001814 | |||
| 3320 | Ga0495586_0034389 | |||
| 3321 | Ga0495586_0248171 | |||
| 3322 | Ga0495587_0001432 | |||
| 3323 | Ga0495587_0006986 | |||
| 3324 | Ga0495587_0015759 | |||
| 3325 | Ga0495587_0022963 | |||
| 3326 | Ga0495587_0034748 | |||
| 3327 | Ga0495587_0059702 | |||
| 3328 | Ga0495587_0202228 | |||
| 3329 | Ga0495587_0347696 | |||
| 3330 | Ga0495598_0085697 | |||
| 3331 | Ga0495598_0108743 | |||
| 3332 | Ga0495598_0122732 | |||
| 3333 | Ga0495621_0082598 | |||
| 3334 | Ga0495621_0102940 | |||
| 3335 | Ga0495597_0067621 | |||
| 3336 | Ga0495645_0001776 | |||
| 3337 | Ga0495645_0001836 | |||
| 3338 | Ga0495645_0002109 | |||
| 3339 | Ga0495645_0008749 | |||
| 3340 | Ga0495645_0019408 | |||
| 3341 | Ga0495645_0148712 | |||
| 3342 | Ga0495645_0466439 | |||
| 3343 | Ga0495622_0008049 | |||
| 3344 | Ga0495622_0010565 | |||
| 3345 | Ga0495622_0127322 | |||
| 3346 | Ga0495633_0056982 | |||
| 3347 | Ga0495633_0118360 | |||
| 3348 | Ga0495633_0262006 | |||
| 3349 | Ga0495667_0001452 | |||
| 3350 | Ga0495667_0008441 | |||
| 3351 | Ga0495667_0020781 | |||
| 3352 | Ga0495667_0021237 | |||
| 3353 | Ga0495667_0023177 | |||
| 3354 | Ga0495667_0042971 | |||
| 3355 | Ga0495667_0044112 | |||
| 3356 | Ga0495667_0206978 | |||
| 3357 | Ga0495656_0004963 | |||
| 3358 | Ga0495656_0012418 | |||
| 3359 | Ga0495668_0025425 | |||
| 3360 | Ga0495668_0081519 | |||
| 3361 | Ga0495668_0196923 | |||
| 3362 | Ga0495634_0000261 | |||
| 3363 | Ga0495634_0006321 | |||
| 3364 | Ga0495634_0011593 | |||
| 3365 | Ga0495634_0017261 | |||
| 3366 | Ga0495634_0039498 | |||
| 3367 | Ga0495634_0072933 | |||
| 3368 | Ga0495634_0096210 | |||
| 3369 | Ga0495611_0004521 | |||
| 3370 | Ga0495611_0054665 | |||
| 3371 | Ga0495611_0163640 | |||
| 3372 | Ga0495625_0049301 | |||
| 3373 | Ga0495625_0256375 | |||
| 3374 | Ga0495635_0000088 | |||
| 3375 | Ga0495635_0000438 | |||
| 3376 | Ga0495635_0001380 | |||
| 3377 | Ga0495635_0003521 | |||
| 3378 | Ga0495635_0006545 | |||
| 3379 | Ga0495635_0017940 | |||
| 3380 | Ga0495635_0049932 | |||
| 3381 | Ga0495659_0001977 | |||
| 3382 | Ga0495661_0054082 | |||
| 3383 | Ga0495661_0176969 | |||
| 3384 | Ga0495588_0019653 | |||
| 3385 | Ga0495588_0051556 | |||
| 3386 | Ga0495588_0088287 | |||
| 3387 | Ga0495588_0213546 | |||
| 3388 | Ga0495657_0008178 | |||
| 3389 | Ga0495657_0010455 | |||
| 3390 | Ga0495657_0012948 | |||
| 3391 | Ga0495657_0041171 | |||
| 3392 | Ga0495657_0061813 | |||
| 3393 | Ga0495657_0242498 | |||
| 3394 | Ga0495657_0319519 | |||
| 3395 | Ga0495599_0001137 | |||
| 3396 | Ga0495599_0010283 | |||
| 3397 | Ga0495599_0035710 | |||
| 3398 | Ga0495599_0082276 | |||
| 3399 | Ga0495599_0231136 | |||
| 3400 | Ga0495623_0006628 | |||
| 3401 | Ga0495623_0010588 | |||
| 3402 | Ga0495623_0012243 | |||
| 3403 | Ga0495646_0002433 | |||
| 3404 | Ga0495646_0022684 | |||
| 3405 | Ga0495646_0026635 | |||
| 3406 | Ga0495646_0048965 | |||
| 3407 | Ga0495646_0057288 | |||
| 3408 | Ga0495646_0088987 | |||
| 3409 | Ga0495647_0003550 | |||
| 3410 | Ga0495647_0054257 | |||
| 3411 | Ga0495658_0000771 | |||
| 3412 | Ga0495658_0000892 | |||
| 3413 | Ga0495613_0027628 | |||
| 3414 | Ga0495613_0040776 | |||
| 3415 | Ga0495613_0045342 | |||
| 3416 | Ga0495613_0053833 | |||
| 3417 | Ga0495613_0100556 | |||
| 3418 | Ga0495613_0111521 | |||
| 3419 | Ga0495613_0181685 | |||
| 3420 | Ga0495613_0273999 | |||
| 3421 | Ga0495613_0508572 | |||
| 3422 | Ga0495624_0000682 | |||
| 3423 | Ga0495624_0001570 | |||
| 3424 | Ga0495624_0099630 | |||
| 3425 | Ga0495624_0115349 | |||
| 3426 | Ga0495624_0120586 | |||
| 3427 | Ga0495624_0217723 | |||
| 3428 | Ga0495624_0222201 | |||
| 3429 | Ga0495624_0236040 | |||
| 3430 | Ga0495624_0368895 | |||
| 3431 | Ga0495670_0011391 | |||
| 3432 | Ga0495671_0078355 | |||
| 3433 | Ga0495671_0320799 | |||
| 3434 | Ga0495649_0119141 | |||
| 3435 | Ga0495589_0033211 | |||
| 3436 | Ga0495600_0000484 | |||
| 3437 | Ga0495600_0010662 | |||
| 3438 | Ga0495600_0018989 | |||
| 3439 | Ga0495600_0023629 | |||
| 3440 | Ga0495600_0041250 | |||
| 3441 | Ga0495600_0072934 | |||
| 3442 | Ga0495660_0150270 | |||
| 3443 | Ga0495581_0000018 | |||
| 3444 | Ga0495581_0012302 | |||
| 3445 | Ga0495581_0025033 | |||
| 3446 | Ga0495581_0077638 | |||
| 3447 | Ga0495581_0114277 | |||
| 3448 | Ga0495604_0002253 | |||
| 3449 | Ga0495604_0005171 | |||
| 3450 | Ga0495604_0007540 | |||
| 3451 | Ga0495604_0027161 | |||
| 3452 | Ga0495604_0048968 | |||
| 3453 | Ga0495604_0052328 | |||
| 3454 | Ga0495604_0159461 | |||
| 3455 | Ga0495604_0223755 | |||
| 3456 | Ga0495604_0532106 | |||
| 3457 | Ga0495636_0177866 | |||
| 3458 | Ga0495674_0000209 | |||
| 3459 | Ga0495674_0001257 | |||
| 3460 | Ga0495674_0006731 | |||
| 3461 | Ga0495674_0021689 | |||
| 3462 | Ga0495674_0024470 | |||
| 3463 | Ga0495674_0074686 | |||
| 3464 | Ga0495674_0120810 | |||
| 3465 | Ga0495674_0237631 | |||
| 3466 | Ga0495674_0708636 | |||
| 3467 | Ga0495672_0039117 | |||
| 3468 | Ga0495676_0033822 | |||
| 3469 | Ga0495676_0067018 | |||
| 3470 | Ga0495676_0086311 | |||
| 3471 | Ga0495676_0104485 | |||
| 3472 | Ga0495676_0153223 | |||
| 3473 | Ga0495676_0244022 | |||
| 3474 | Ga0495680_0004231 | |||
| 3475 | Ga0495680_0006139 | |||
| 3476 | Ga0495680_0013803 | |||
| 3477 | Ga0495680_0024657 | |||
| 3478 | Ga0495680_0046879 | |||
| 3479 | Ga0495680_0064241 | |||
| 3480 | Ga0495680_0123588 | |||
| 3481 | Ga0495687_046397 | |||
| 3482 | Ga0495675_0000977 | |||
| 3483 | Ga0495675_0006091 | |||
| 3484 | Ga0495675_0010571 | |||
| 3485 | Ga0495675_0060191 | |||
| 3486 | Ga0495675_0069346 | |||
| 3487 | Ga0495677_0029191 | |||
| 3488 | Ga0495679_029497 | |||
| 3489 | Ga0495673_0051765 | |||
| 3490 | Ga0495681_0038580 | |||
| 3491 | Ga0495684_0001326 | |||
| 3492 | Ga0495684_0001766 | |||
| 3493 | Ga0495684_0003044 | |||
| 3494 | Ga0495684_0003129 | |||
| 3495 | Ga0495684_0049314 | |||
| 3496 | Ga0495684_0052451 | |||
| 3497 | Ga0495684_0052531 | |||
| 3498 | Ga0495686_0224797 | |||
| 3499 | Ga0495593_0000072 | |||
| 3500 | Ga0495593_0000566 | |||
| 3501 | Ga0495593_0002269 | |||
| 3502 | Ga0495593_0015862 | |||
| 3503 | Ga0495593_0185378 | |||
| 3504 | Ga0495602_0001719 | |||
| 3505 | Ga0495602_0004704 | |||
| 3506 | Ga0495602_0024014 | |||
| 3507 | Ga0495602_0087538 | |||
| 3508 | Ga0495602_0430429 | |||
| 3509 | Ga0495602_0649444 | |||
| 3510 | Ga0495614_0036953 | |||
| 3511 | Ga0495615_0014600 | |||
| 3512 | Ga0496100_0005319 | |||
| 3513 | Ga0496100_0153339 | |||
| 3514 | Ga0496100_0226189 | |||
| 3515 | Ga0496100_0274498 | |||
| 3516 | Ga0496101_0001907 | |||
| 3517 | Ga0496101_0057214 | |||
| 3518 | Ga0496101_0094499 | |||
| 3519 | Ga0496101_0292434 | |||
| 3520 | Ga0496101_0315057 | |||
| 3521 | Ga0496101_0329958 | |||
| 3522 | Ga0496101_0378703 | |||
| 3523 | Ga0496101_0430554 | |||
| 3524 | Ga0496102_0010809 | |||
| 3525 | Ga0496102_0017860 | |||
| 3526 | Ga0496102_0019492 | |||
| 3527 | Ga0496102_0324782 | |||
| 3528 | Ga0496102_0611337 | |||
| 3529 | Ga0496103_0001565 | |||
| 3530 | Ga0496103_0047327 | |||
| 3531 | Ga0496103_0080656 | |||
| 3532 | Ga0496103_0112794 | |||
| 3533 | Ga0496103_0237458 | |||
| 3534 | Ga0496104_0002128 | |||
| 3535 | Ga0496104_0049007 | |||
| 3536 | Ga0496104_0083814 | |||
| 3537 | Ga0496104_0106223 | |||
| 3538 | Ga0496104_0178751 | |||
| 3539 | Ga0496104_0264469 | |||
| 3540 | Ga0496105_0022082 | |||
| 3541 | Ga0496105_0219624 | |||
| 3542 | Ga0496105_0321217 | |||
| 3543 | Ga0496106_0019749 | |||
| 3544 | Ga0496106_0020041 | |||
| 3545 | Ga0496106_0217121 | |||
| 3546 | Ga0496106_0251050 | |||
| 3547 | Ga0496106_0452910 | |||
| 3548 | Ga0496106_0507082 | |||
| 3549 | Ga0496107_0001840 | |||
| 3550 | Ga0496107_0057813 | |||
| 3551 | Ga0496107_0086918 | |||
| 3552 | Ga0496107_0304359 | |||
| 3553 | Ga0496107_0328796 | |||
| 3554 | Ga0496107_0423238 | |||
| 3555 | Ga0496107_0551691 | |||
| 3556 | Ga0496108_0052175 | |||
| 3557 | Ga0496108_0134651 | |||
| 3558 | Ga0496108_0207421 | |||
| 3559 | Ga0496108_0470939 | |||
| 3560 | Ga0496109_0000150 | |||
| 3561 | Ga0496109_0016079 | |||
| 3562 | Ga0496109_0027717 | |||
| 3563 | Ga0496109_0052091 | |||
| 3564 | Ga0496109_0052472 | |||
| 3565 | Ga0496109_0056795 | |||
| 3566 | Ga0496109_0521510 | |||
| 3567 | Ga0496110_0028124 | |||
| 3568 | Ga0496110_0053806 | |||
| 3569 | Ga0496110_0123850 | |||
| 3570 | Ga0496110_0640976 | |||
| 3571 | Ga0496111_0016595 | |||
| 3572 | Ga0496111_0024135 | |||
| 3573 | Ga0496111_0143132 | |||
| 3574 | Ga0496111_0149377 | |||
| 3575 | Ga0496111_0163513 | |||
| 3576 | Ga0496111_0181744 | |||
| 3577 | Ga0496111_0290760 | |||
| 3578 | Ga0496111_0401403 | |||
| 3579 | Ga0496112_0000004 | |||
| 3580 | Ga0496112_0017832 | |||
| 3581 | Ga0496112_0019008 | |||
| 3582 | Ga0496112_0020263 | |||
| 3583 | Ga0496112_0044369 | |||
| 3584 | Ga0496112_0079630 | |||
| 3585 | Ga0496112_0213500 | |||
| 3586 | Ga0496112_0256251 | |||
| 3587 | Ga0496112_0259874 | |||
| 3588 | Ga0496112_0294237 | |||
| 3589 | Ga0496112_0748508 | |||
| 3590 | Ga0496113_0035814 | |||
| 3591 | Ga0496113_0054096 | |||
| 3592 | Ga0496113_0148147 | |||
| 3593 | Ga0496113_0259726 | |||
| 3594 | Ga0496114_0008932 | |||
| 3595 | Ga0496114_0025141 | |||
| 3596 | Ga0496114_0028221 | |||
| 3597 | Ga0496114_0029850 | |||
| 3598 | Ga0496114_0650014 | |||
| 3599 | Ga0496114_0859466 | |||
| 3600 | Ga0496115_0001528 | |||
| 3601 | Ga0496115_0014005 | |||
| 3602 | Ga0496115_0024954 | |||
| 3603 | Ga0496115_0394046 | |||
| 3604 | Ga0496115_0521791 | |||
| 3605 | Ga0496117_0148086 | |||
| 3606 | Ga0496118_0056637 | |||
| 3607 | Ga0496118_0271058 | |||
| 3608 | Ga0496119_0051978 | |||
| 3609 | Ga0496120_0009415 | |||
| 3610 | Ga0496120_0104879 | |||
| 3611 | Ga0496121_0109905 | |||
| 3612 | Ga0496121_0141220 | |||
| 3613 | Ga0496121_0170687 | |||
| 3614 | Ga0496121_0188737 | |||
| 3615 | Ga0496121_0212880 | |||
| 3616 | Ga0496124_0016688 | |||
| 3617 | Ga0496124_0453357 | |||
| 3618 | Ga0496125_0150162 | |||
| 3619 | Ga0496125_0160175 | |||
| 3620 | Ga0496125_0350792 | |||
| 3621 | Ga0496126_0057994 | |||
| 3622 | Ga0496126_0180399 | |||
| 3623 | Ga0496126_0199725 | |||
| 3624 | Ga0496126_0367099 | |||
| 3625 | Ga0495682_0064921 | |||
| 3626 | Ga0501031_0043171 | |||
| 3627 | Ga0501032_0051419 | |||
| 3628 | Ga0501032_0340751 | |||
| 3629 | Ga0501033_0149871 | |||
| 3630 | Ga0501033_0179414 | |||
| 3631 | Ga0501034_0000516 | |||
| 3632 | Ga0501034_0001552 | |||
| 3633 | Ga0501034_0003894 | |||
| 3634 | Ga0501034_0050571 | |||
| 3635 | Ga0501034_0078997 | |||
| 3636 | Ga0501034_0586588 | |||
| 3637 | Ga0501036_0001269 | |||
| 3638 | Ga0501036_0020963 | |||
| 3639 | Ga0501036_0043623 | |||
| 3640 | Ga0501036_0047889 | |||
| 3641 | Ga0501037_0003480 | |||
| 3642 | Ga0501037_0045797 | |||
| 3643 | Ga0501037_0093001 | |||
| 3644 | Ga0501037_0346723 | |||
| 3645 | Ga0501038_0028938 | |||
| 3646 | Ga0501038_0041063 | |||
| 3647 | Ga0501038_0073051 | |||
| 3648 | Ga0501039_0021697 | |||
| 3649 | Ga0501039_0094523 | |||
| 3650 | Ga0501039_0562619 | |||
| 3651 | Ga0501040_0007018 | |||
| 3652 | Ga0501041_0016019 | |||
| 3653 | Ga0501041_0116157 | |||
| 3654 | Ga0501042_0148565 | |||
| 3655 | Ga0501043_0000487 | |||
| 3656 | Ga0501043_0029788 | |||
| 3657 | Ga0501043_0030237 | |||
| 3658 | Ga0501046_0087631 | |||
| 3659 | Ga0501046_0205932 | |||
| 3660 | Ga0501046_0259680 | |||
| 3661 | Ga0501046_0281340 | |||
| 3662 | Ga0501047_0000100 | |||
| 3663 | Ga0501047_0028382 | |||
| 3664 | Ga0501047_0083315 | |||
| 3665 | Ga0501047_0085392 | |||
| 3666 | Ga0501047_0212292 | |||
| 3667 | Ga0501047_0304858 | |||
| 3668 | Ga0501048_0000473 | |||
| 3669 | Ga0501048_0033115 | |||
| 3670 | Ga0501048_0035259 | |||
| 3671 | Ga0501048_0181363 | |||
| 3672 | Ga0501067_0115028 | |||
| 3673 | Ga0501067_0178284 | |||
| 3674 | Ga0501068_0010393 | |||
| 3675 | Ga0501068_0011379 | |||
| 3676 | Ga0501068_0252815 | |||
| 3677 | Ga0501069_0066639 | |||
| 3678 | Ga0501069_0207053 | |||
| 3679 | Ga0501069_0287193 | |||
| 3680 | Ga0501070_0011913 | |||
| 3681 | Ga0501070_0025193 | |||
| 3682 | Ga0501070_0029112 | |||
| 3683 | Ga0501070_0075293 | |||
| 3684 | Ga0501070_0076780 | |||
| 3685 | Ga0501070_0542075 | |||
| 3686 | Ga0501071_0011457 | |||
| 3687 | Ga0501071_0166155 | |||
| 3688 | Ga0501072_0011074 | |||
| 3689 | Ga0501072_0085609 | |||
| 3690 | Ga0501073_0132390 | |||
| 3691 | Ga0501073_0220771 | |||
| 3692 | Ga0501073_0330382 | |||
| 3693 | Ga0501074_0022003 | |||
| 3694 | Ga0501074_0039132 | |||
| 3695 | Ga0501074_0093316 | |||
| 3696 | Ga0501074_0184153 | |||
| 3697 | Ga0501075_0173499 | |||
| 3698 | Ga0501075_0177078 | |||
| 3699 | Ga0501075_0215794 | |||
| 3700 | Ga0501075_0397268 | |||
| 3701 | Ga0501076_0005575 | |||
| 3702 | Ga0501076_0082122 | |||
| 3703 | Ga0501076_0159112 | |||
| 3704 | Ga0501077_0046434 | |||
| 3705 | Ga0501079_0063486 | |||
| 3706 | Ga0501079_0075956 | |||
| 3707 | Ga0501079_0143903 | |||
| 3708 | Ga0501079_0173111 | |||
| 3709 | Ga0501080_0000030 | |||
| 3710 | Ga0501080_0015129 | |||
| 3711 | Ga0501080_0092344 | |||
| 3712 | Ga0501080_0163888 | |||
| 3713 | Ga0501080_0164174 | |||
| 3714 | Ga0501080_0476801 | |||
| 3715 | Ga0501083_0010799 | |||
| 3716 | Ga0501083_0053257 | |||
| 3717 | Ga0501083_0097668 | |||
| 3718 | Ga0501083_0168596 | |||
| 3719 | Ga0501035_0031108 | |||
| 3720 | Ga0501035_0091654 | |||
| 3721 | Ga0501035_0233349 | |||
| 3722 | Ga0501035_0299506 | |||
| 3723 | Ga0501044_0004101 | |||
| 3724 | Ga0501044_0068340 | |||
| 3725 | Ga0501044_0103293 | |||
| 3726 | Ga0501044_0127841 | |||
| 3727 | Ga0501045_0005395 | |||
| 3728 | Ga0501045_0285430 | |||
| 3729 | Ga0501045_0290739 | |||
| 3730 | nmdc:mga03683_2720_c1 | |||
| 3731 | nmdc:mga03683_8320_c1 | |||
| 3732 | nmdc:mga03683_86334_c1 | |||
| 3733 | nmdc:mga03683_96266_c1 | |||
| 3734 | nmdc:mga03n38_137830_c1 | |||
| 3735 | nmdc:mga03n38_156905_c1 | |||
| 3736 | nmdc:mga03n38_28451_c1 | |||
| 3737 | nmdc:mga03n38_97492_c1 | |||
| 3738 | nmdc:mga00v17_307382_c1 | |||
| 3739 | nmdc:mga00v17_346397_c1 | |||
| 3740 | nmdc:mga00v17_9842_c1 | |||
| 3741 | nmdc:mga0yw44_227931_c1 | |||
| 3742 | nmdc:mga0yw44_242352_c1 | |||
| 3743 | nmdc:mga0yw44_39189_c1 | |||
| 3744 | nmdc:mga0yw44_432270_c1 | |||
| 3745 | nmdc:mga0yw44_6189_c1 | |||
| 3746 | nmdc:mga0yw44_86569_c1 | |||
| 3747 | nmdc:mga0yw44_98283_c1 | |||
| 3748 | nmdc:mga0k408_10484_c1 | |||
| 3749 | nmdc:mga0k408_160651_c1 | |||
| 3750 | nmdc:mga0k408_212834_c1 | |||
| 3751 | nmdc:mga06z11_112858_c1 | |||
| 3752 | nmdc:mga06z11_131565_c1 | |||
| 3753 | nmdc:mga06z11_41063_c1 | |||
| 3754 | nmdc:mga06z11_45012_c1 | |||
| 3755 | nmdc:mga06z11_9486_c1 | |||
| 3756 | nmdc:mga07m45_122738_c1 | |||
| 3757 | nmdc:mga07m45_14653_c2 | |||
| 3758 | nmdc:mga07m45_259827_c1 | |||
| 3759 | nmdc:mga07m45_296730_c1 | |||
| 3760 | nmdc:mga07m45_355731_c1 | |||
| 3761 | nmdc:mga07m45_43458_c1 | |||
| 3762 | nmdc:mga07m45_46368_c1 | |||
| 3763 | nmdc:mga05p37_135935_c1 | |||
| 3764 | nmdc:mga05p37_13694_c1 | |||
| 3765 | nmdc:mga05p37_26731_c1 | |||
| 3766 | nmdc:mga05p37_33096_c1 | |||
| 3767 | nmdc:mga05p37_719155_c1 | |||
| 3768 | nmdc:mga05p37_7310_c1 | |||
| 3769 | nmdc:mga05p37_76550_c1 | |||
| 3770 | nmdc:mga09592_22873_c1 | |||
| 3771 | nmdc:mga09592_42022_c1 | |||
| 3772 | nmdc:mga09592_59060_c1 | |||
| 3773 | nmdc:mga0qj67_15559_c1 | |||
| 3774 | nmdc:mga0qj67_21501_c1 | |||
| 3775 | nmdc:mga0qj67_4674_c1 | |||
| 3776 | nmdc:mga06r32_4896_c1 | |||
| 3777 | nmdc:mga06r32_8384_c1 | |||
| 3778 | nmdc:mga08y16_12186_c1 | |||
| 3779 | nmdc:mga08y16_170800_c1 | |||
| 3780 | nmdc:mga08y16_22091_c1 | |||
| 3781 | nmdc:mga08y16_243008_c1 | |||
| 3782 | nmdc:mga08y16_47150_c1 | |||
| 3783 | nmdc:mga08y16_518_c1 | |||
| 3784 | nmdc:mga08y16_549471_c1 | |||
| 3785 | nmdc:mga08y16_6788_c1 | |||
| 3786 | nmdc:mga0n895_1010768_c1 | |||
| 3787 | nmdc:mga0n895_102857_c1 | |||
| 3788 | nmdc:mga0n895_121567_c1 | |||
| 3789 | nmdc:mga0n895_180064_c1 | |||
| 3790 | nmdc:mga0n895_2094_c1 | |||
| 3791 | nmdc:mga0n895_22338_c1 | |||
| 3792 | nmdc:mga0n895_24114_c1 | |||
| 3793 | nmdc:mga0n895_255905_c1 | |||
| 3794 | nmdc:mga0n895_27310_c1 | |||
| 3795 | nmdc:mga0n895_338465_c1 | |||
| 3796 | nmdc:mga0n895_43907_c1 | |||
| 3797 | nmdc:mga0n895_460921_c1 | |||
| 3798 | nmdc:mga0n895_513772_c1 | |||
| 3799 | nmdc:mga0n895_77721_c1 | |||
| 3800 | nmdc:mga0rr50_175981_c1 | |||
| 3801 | nmdc:mga0rr50_260119_c1 | |||
| 3802 | nmdc:mga0rr50_439470_c1 | |||
| 3803 | nmdc:mga0rr50_540865_c1 | |||
| 3804 | nmdc:mga0rr50_55745_c1 | |||
| 3805 | nmdc:mga0rr50_5686_c1 | |||
| 3806 | nmdc:mga0rr50_64444_c1 | |||
| 3807 | nmdc:mga0rr50_74118_c1 | |||
| 3808 | nmdc:mga08x19_102299_c1 | |||
| 3809 | nmdc:mga08x19_16318_c1 | |||
| 3810 | nmdc:mga0a205_10809_c1 | |||
| 3811 | nmdc:mga0a205_13485_c1 | |||
| 3812 | nmdc:mga0a205_14827_c1 | |||
| 3813 | nmdc:mga0a205_156394_c1 | |||
| 3814 | nmdc:mga0a205_218030_c1 | |||
| 3815 | nmdc:mga0a205_278891_c1 | |||
| 3816 | nmdc:mga0a205_32169_c1 | |||
| 3817 | nmdc:mga0a205_401749_c1 | |||
| 3818 | nmdc:mga0a205_42582_c1 | |||
| 3819 | nmdc:mga0a205_439879_c1 | |||
| 3820 | nmdc:mga0a205_830_c1 | |||
| 3821 | nmdc:mga0sz30_156896_c1 | |||
| 3822 | nmdc:mga0sz30_16015_c1 | |||
| 3823 | nmdc:mga0sz30_445_c1 | |||
| 3824 | Ga0495601_0001195 | |||
| 3825 | Ga0495601_0001471 | |||
| 3826 | Ga0495601_0017967 | |||
| 3827 | Ga0495601_0051327 | |||
| 3828 | Ga0495601_0144129 | |||
| 3829 | Ga0495601_0380192 | |||
| 3830 | Ga0495612_0000353 | |||
| 3831 | Ga0495612_0008637 | |||
| 3832 | Ga0495612_0009709 | |||
| 3833 | Ga0495612_0012593 | |||
| 3834 | Ga0495612_0191469 | |||
| 3835 | Ga0500610_0189819 | |||
| 3836 | Ga0500610_0207161 | |||
| 3837 | Ga0500635_0033796 | |||
| 3838 | Ga0495595_0000480 | |||
| 3839 | Ga0495595_0010420 | |||
| 3840 | Ga0495595_0018087 | |||
| 3841 | Ga0495595_0018501 | |||
| 3842 | Ga0495595_0029627 | |||
| 3843 | Ga0495595_0036616 | |||
| 3844 | Ga0495595_0088199 | |||
| 3845 | Ga0495619_0000289 | |||
| 3846 | Ga0495619_0000332 | |||
| 3847 | Ga0495619_0001043 | |||
| 3848 | Ga0495619_0009100 | |||
| 3849 | Ga0495619_0010184 | |||
| 3850 | Ga0495619_0028628 | |||
| 3851 | Ga0495619_0166402 | |||
| 3852 | Ga0495619_0206487 | |||
| 3853 | Ga0495619_0219870 | |||
| 3854 | Ga0495619_0299895 | |||
| 3855 | Ga0495619_0303757 | |||
| 3856 | Ga0495619_0315886 | |||
| 3857 | Ga0500643_000018 | |||
| 3858 | Ga0500651_0314768 | |||
| 3859 | Ga0500566_0006255 | |||
| 3860 | Ga0500641_0005072 | |||
| 3861 | Ga0500641_0119136 | |||
| 3862 | Ga0500556_0071241 | |||
| 3863 | Ga0500557_000008 | |||
| 3864 | Ga0500569_021584 | |||
| 3865 | Ga0500595_000232 | |||
| 3866 | Ga0500595_006829 | |||
| 3867 | Ga0500595_031382 | |||
| 3868 | Ga0500608_090211 | |||
| 3869 | Ga0500642_0000067 | |||
| 3870 | Ga0500642_0210912 | |||
| 3871 | Ga0500655_030900 | |||
| 3872 | Ga0500559_0014503 | |||
| 3873 | Ga0500568_0002596 | |||
| 3874 | Ga0500568_0040908 | |||
| 3875 | Ga0500568_0042033 | |||
| 3876 | Ga0500577_0163473 | |||
| 3877 | Ga0500603_005284 | |||
| 3878 | Ga0500603_048434 | |||
| 3879 | Ga0500604_0095341 | |||
| 3880 | Ga0500604_0123838 | |||
| 3881 | Ga0500616_0002167 | |||
| 3882 | Ga0500620_043958 | |||
| 3883 | Ga0500622_0006295 | |||
| 3884 | Ga0500638_005675 | |||
| 3885 | Ga0500639_206626 | |||
| 3886 | Ga0500636_0000847 | |||
| 3887 | Ga0500637_0000260 | |||
| 3888 | Ga0500637_0000405 | |||
| 3889 | Ga0500649_094163 | |||
| 3890 | Ga0500625_012504 | |||
| 3891 | Ga0500645_026262 | |||
| 3892 | Ga0500645_031912 | |||
| 3893 | Ga0500599_000323 | |||
| 3894 | Ga0500601_000062 | |||
| 3895 | Ga0501084_0002367 | |||
| 3896 | Ga0501084_0197701 | |||
| 3897 | Ga0501084_0214409 | |||
| 3898 | Ga0500661_000357 | |||
| 3899 | Ga0501082_0041592 | |||
| 3900 | Ga0466962_0261961 | |||
| 3901 | Ga0530510_0002069 | |||
| 3902 | Ga0530510_0291292 | |||
| 3903 | 2507510892 | |||
| 3904 | 2508544705 | |||
| 3905 | 2508697067 | |||
| 3906 | 2511394421 | |||
| 3907 | 2513629156 | |||
| 3908 | 2513637597 | |||
| 3909 | 2513649553 | |||
| 3910 | 2513654906 | |||
| 3911 | 2513697329 | |||
| 3912 | 2513700057 | |||
| 3913 | 2513719256 | |||
| 3914 | 2513861296 | |||
| 3915 | 2513874543 | |||
| 3916 | 2513891331 | |||
| 3917 | 2513916071 | |||
| 3918 | 2514015555 | |||
| 3919 | 2515625564 | |||
| 3920 | 2517100471 | |||
| 3921 | 2517894626 | |||
| 3922 | 2524437332 | |||
| 3923 | 2524534357 | |||
| 3924 | 2528853218 | |||
| 3925 | 2617350649 | |||
| 3926 | 2617377940 | |||
| 3927 | 2671119053 | |||
| 3928 | 2723843177 | |||
| 3929 | 2728747713 | |||
| 3930 | 2745076807 | |||
| 3931 | 2793065175 | |||
| 3932 | 2793072306 | |||
| 3933 | 2793083114 | |||
| 3934 | 2805916538 | |||
| 3935 | 2818238023 | |||
| 3936 | 2824606125 | |||
| 3937 | 2824616047 | |||
| 3938 | 2824618973 | |||
| 3939 | 2824627507 | |||
| 3940 | 2824638832 | |||
| 3941 | 2824649011 | |||
| 3942 | 2824657345 | |||
| 3943 | 2824663086 | |||
| 3944 | 2824676953 | |||
| 3945 | 2824682052 | |||
| 3946 | 2824693642 | |||
| 3947 | 2824698723 | |||
| 3948 | 2824706497 | |||
| 3949 | 2824716477 | |||
| 3950 | 2824726423 | |||
| 3951 | 2824737952 | |||
| 3952 | 2824753004 | |||
| 3953 | 2824756955 | |||
| 3954 | 2824769751 | |||
| 3955 | 2838127781 | |||
| 3956 | 2841943074 | |||
| 3957 | 2841956095 | |||
| 3958 | 2841960333 | |||
| 3959 | 2841968284 | |||
| 3960 | 2841970328 | |||
| 3961 | 2841976502 | |||
| 3962 | 2841987878 | |||
| 3963 | 2842042823 | |||
| 3964 | 2842050864 | |||
| 3965 | 2844317039 | |||
| 3966 | 2847938455 | |||
| 3967 | 2847944347 | |||
| 3968 | 2849081410 | |||
| 3969 | 2857512072 | |||
| 3970 | 2874597617 | |||
| 3971 | 2874612487 | |||
| 3972 | 2874618412 | |||
| 3973 | 2874623542 | |||
| 3974 | 2874630521 | |||
| 3975 | 2874649181 | |||
| 3976 | 2876767783 | |||
| 3977 | 2876774910 | |||
| 3978 | 2876810636 | |||
| 3979 | 2876822338 | |||
| 3980 | 2879077998 | |||
| 3981 | 2879088694 | |||
| 3982 | 2879103945 | |||
| 3983 | 2879117931 | |||
| 3984 | 2879132451 | |||
| 3985 | 2879145250 | |||
| 3986 | 2881370569 | |||
| 3987 | 2881667334 | |||
| 3988 | 2885367041 | |||
| 3989 | 2885378084 | |||
| 3990 | 2885416537 | |||
| 3991 | 2888381660 | |||
| 3992 | 2888388973 | |||
| 3993 | 2888422050 | |||
| 3994 | 2889033516 | |||
| 3995 | 2903735005 | |||
| 3996 | 2903754861 | |||
| 3997 | 2904667654 | |||
| 3998 | 2904697036 | |||
| 3999 | 2904705653 | |||
| 4000 | 2904719081 | |||
| 4001 | 2906604122 | |||
| 4002 | 2906611360 | |||
| 4003 | 2906633019 | |||
| 4004 | 2906643464 | |||
| 4005 | 2906648246 | |||
| 4006 | 2906661312 | |||
| 4007 | 2908744942 | |||
| 4008 | 2908762695 | |||
| 4009 | 2908782010 | |||
| 4010 | 2922362693 | |||
| 4011 | 2922371330 | |||
| 4012 | 2922390322 | |||
| 4013 | 2922393766 | |||
| 4014 | 2922428014 | |||
| 4015 | 2929619708 | |||
| 4016 | 2929627821 | |||
| 4017 | 2932786040 | |||
| 4018 | 2932798193 | |||
| 4019 | 2932803986 | |||
| 4020 | 2932817012 | |||
| 4021 | 2932822497 | |||
| 4022 | 2932831084 | |||
| 4023 | 2933581627 | |||
| 4024 | 2935612890 | |||
| 4025 | 2935624129 | |||
| 4026 | 2935632061 | |||
| 4027 | 2935640225 | |||
| 4028 | 2935655015 | |||
| 4029 | 2935663895 | |||
| 4030 | 2935666937 | |||
| 4031 | 2935680424 | |||
| 4032 | 2935690068 | |||
| 4033 | 2935699850 | |||
| 4034 | 2935704692 | |||
| 4035 | 2935722220 | |||
| 4036 | 2935731529 | |||
| 4037 | 2935735383 | |||
| 4038 | 2935745346 | |||
| 4039 | 2935755079 | |||
| 4040 | 2935762407 | |||
| 4041 | 2935775442 | |||
| 4042 | 2935780344 | |||
| 4043 | 2935790691 | |||
| 4044 | 2935799126 | |||
| 4045 | 2935803905 | |||
| 4046 | 2935811823 | |||
| 4047 | 2935824378 | |||
| 4048 | 2935829708 | |||
| 4049 | 2935842960 | |||
| 4050 | 2935852477 | |||
| 4051 | 2935862371 | |||
| 4052 | 2935870506 | |||
| 4053 | 2935881088 | |||
| 4054 | 2935884208 | |||
| 4055 | 2935912368 | |||
| 4056 | 2935923958 | |||
| 4057 | 2935929397 | |||
| 4058 | 2935936028 | |||
| 4059 | 2935949928 | |||
| 4060 | 2935957306 | |||
| 4061 | 2935962175 | |||
| 4062 | 2935968337 | |||
| 4063 | 2935976523 | |||
| 4064 | 2935988031 | |||
| 4065 | 2935993585 | |||
| 4066 | 2936004481 | |||
| 4067 | 2936018036 | |||
| 4068 | 2936026554 | |||
| 4069 | 2936035297 | |||
| 4070 | 2936038406 | |||
| 4071 | 2936053431 | |||
| 4072 | 2936059412 | |||
| 4073 | 2940561641 | |||
| 4074 | 2941508009 | |||
| 4075 | 2941515486 | |||
| 4076 | 2941523939 | |||
| 4077 | 2941533820 | |||
| 4078 | 2941544184 | |||
| 4079 | 3005477713 | |||
| 4080 | 3005485386 | |||
| 4081 | 3005507242 | |||
| 4082 | 3005594602 | |||
| 4083 | 3005596681 | |||
| 4084 | 3005712749 | |||
| 4085 | 8006933140 | |||
| 4086 | 8006933500 | |||
| 4087 | 8006971306 | |||
| 4088 | 8006983173 | |||
| 4089 | 8006989256 | |||
| 4090 | 8006997731 | |||
| 4091 | 8016516297 | |||
| 4092 | 8016523692 | |||
| 4093 | 8016541474 | |||
| 4094 | 8016551781 | |||
| 4095 | 8016560168 | |||
| 4096 | 8016566866 | |||
| 4097 | 8016579598 | |||
| 4098 | 8016589270 | |||
| 4099 | 8016598085 | |||
| 4100 | 8016604225 | |||
| 4101 | 8016620808 | |||
| 4102 | 8016629181 | |||
| 4103 | 8016633707 | |||
| 4104 | 8017060237 | |||
| 4105 | 8019536904 | |||
| 4106 | 8019542627 | |||
| 4107 | 8019559416 | |||
| 4108 | 8019579759 | |||
| 4109 | 8019587469 | |||
| 4110 | 8019603873 | |||
| 4111 | 8019614665 | |||
| 4112 | 8019636906 | |||
| 4113 | 8019642702 | |||
| 4114 | 8019649883 | |||
| 4115 | 8019664725 | |||
| 4116 | 8019674311 | |||
| 4117 | 8055749036 | |||
| 4118 | 8056674772 | |||
| 4119 | 8056695058 | |||
| 4120 | 8056969885 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9525 | 2 | 234 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9446 | 2 | 234 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9302 | 2 | 221 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9191 | 2 | 221 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9136 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.979 | 1 | 234 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9708 | 1 | 234 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9524 | 1 | 233 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9448 | 2 | 234 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9444 | 1 | 233 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q3SXW4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9891 | 2 | 234 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1V4MHS7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9851 | 1 | 234 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A2N9MLZ7-F1-model_v4 | Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family | 0.9832 | 2 | 234 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A2E7F6C8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9818 | 1 | 233 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A417Z7G5-F1-model_v4 | ABC transporter ATP-binding protein | 0.981 | 2 | 234 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |