F496347

General Info

Members Datasets Scaffolds Average Seq Length
2071 772 4142 250

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100004306|Ga0070659_1000043064
Length 293
Sequence VLHPVASLAVLYWWLAVQPNPSFNAKRLAKIKDLRSKTKSNMRKPVIAGNWKMYKTLGEAVDTALSLKPLVANANHCEVVIAPVFTALKTVADRLEGSNIHVAGQDCATQNEEGAHTGEIAPFMLRDVGARYVIIGHSERRQFYGETDKTVNQKTKAALAAGLTAIVCVGESLEQRDQGNAQNVVGNQVTGGLVELTASDLDRIILAYEPVWAIGTGRTATPEQAQEMHAFIRRVFADRHSTEAAASVRVLYGGSVKPDNIAGLMGQGDIDGALVGGASLKAESFAEIVNFKR

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
161 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
164 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
165 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
167 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
253 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
254 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
255 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
256 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
257 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
258 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
259 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
260 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
264 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
265 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
266 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
267 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
268 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
272 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
273 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
274 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
275 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
276 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
277 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
278 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
279 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
280 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
290 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
291 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
298 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
299 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
315 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
316 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
317 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
318 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
319 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
320 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
321 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
322 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
323 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
324 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
325 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
326 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
327 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
328 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
329 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
330 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
331 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
332 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
335 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
336 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
337 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
338 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
348 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
349 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
350 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
351 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
352 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
353 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
354 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
355 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
356 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
360 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
376 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
377 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
378 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
379 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
385 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
386 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
387 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
388 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
389 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
390 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
401 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
402 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
405 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
406 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
407 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
408 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
409 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
410 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
411 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
429 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
430 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
431 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
436 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
437 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
438 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
439 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
440 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
441 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
442 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
443 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
444 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
445 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
446 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
447 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
448 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
449 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
450 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
451 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
452 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
457 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
458 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
459 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
473 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
474 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
475 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
482 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
485 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
486 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
487 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
488 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
489 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
490 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
491 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
492 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
493 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
496 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
497 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
498 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
499 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
500 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
501 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
502 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
503 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
504 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
508 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
509 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
510 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
511 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
512 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
513 2512875024
514 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
515 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
516 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
517 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
518 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
519 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
520 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
521 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
522 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
523 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
524 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
525 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
526 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
527 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
528 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
529 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
530 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
531 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
532 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
533 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
534 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
535 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
536 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
537 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
538 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
539 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
540 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
541 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
542 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
543 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
544 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
545 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
546 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
547 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
548 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
549 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
550 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
551 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
552 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
553 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
554 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
555 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
556 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
557 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
558 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
559 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
560 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
561 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
562 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
563 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
564 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
565 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
566 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
567 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
568 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
569 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
570 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
571 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
572 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
573 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
574 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
575 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
576 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
577 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
578 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
579 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
580 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
581 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
582 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
583 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
584 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
585 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
586 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
587 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
588 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
589 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
590 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
591 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
592 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
593 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
594 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
595 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
596 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
597 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
598 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
599 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
600 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
601 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
602 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
603 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
604 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
605 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
606 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
607 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
608 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
609 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
610 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
611 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
612 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
613 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
614 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
615 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
616 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
617 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
618 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
619 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
620 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
621 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
622 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
623 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
624 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
625 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
626 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
627 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
628 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
629 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
630 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
631 2904504865 Serratia marcescens 1822 Isolate Unclassified
632 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
633 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
634 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
635 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
636 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
637 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
638 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
639 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
640 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
641 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
642 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
643 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
644 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
645 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
646 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
647 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
648 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
649 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
650 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
651 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
652 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
653 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
654 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
655 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
656 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
657 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
658 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
659 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
660 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
661 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
662 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
663 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
664 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
665 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
666 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
667 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
668 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
669 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
670 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
671 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
672 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
673 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
674 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
675 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
676 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
677 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
678 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
679 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
680 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
681 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
682 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
683 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
684 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
685 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
686 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
687 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
688 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
689 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
690 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
691 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
692 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
693 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
694 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
695 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
696 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
697 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
698 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
699 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
700 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
701 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
702 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
703 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
704 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
705 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
706 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
707 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
708 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
709 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
710 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
711 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
712 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
713 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
714 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
715 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
716 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
717 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
718 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
719 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
720 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
721 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
722 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
723 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
724 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
725 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
726 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
727 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
728 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
729 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
730 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
731 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
732 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
733 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
734 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
735 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
736 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
737 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
738 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
739 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
740 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
741 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
742 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
743 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
744 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
745 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
746 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
747 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
748 3004167301 Mesorhizobium loti 582 Isolate Unclassified
749 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
750 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
751 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
752 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
753 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
754 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
755 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
756 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
757 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
758 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
759 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
760 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
761 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
762 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
763 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
764 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
765 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
766 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
767 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
768 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
769 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
770 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
771 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
772 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.62
Metatranscriptomes 0.63
Isolates 12.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 9.85
Rhizoplane 3.77
Rhizosphere 75.42
Stem 0
Stem Tuber 0.29
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100004306 3300005366 Bacteria 10162
2 CNAas_1000040 3300000532 Bacteria 8742
3 JGI24740J21852_10006921 3300001979 Bacteria 4655
4 JGI24739J22299_10049812 3300001989 Bacteria 1357
5 JGI24737J22298_10040690 3300001990 Bacteria 1426
6 JGI24735J21928_10015514 3300002067 Bacteria 2376
7 JGI24735J21928_10021675 3300002067 Bacteria 1960
8 JGI24750J21931_1014682 3300002070 Bacteria 1055
9 JGI24034J26672_10000026 3300002239 Bacteria 109498
10 JGI24751J29686_10000030 3300002459 Bacteria 92588
11 JGI25162J39368_1000075 3300002737 Bacteria 120760
12 JGI25157J39369_1000694 3300002741 Bacteria 18206
13 JGI25406J46586_10003840 3300003203 Bacteria 7021
14 JGI25406J46586_10059736 3300003203 Bacteria 1237
15 JGI25406J46586_10077736 3300003203 Bacteria 1025
16 JGI25165J46597_1000033 3300003214 Bacteria 293030
17 JGI25165J46597_1010963 3300003214 Bacteria 1307
18 rootH2_10077725 3300003320 Bacteria 4265
19 rootH2_10078133 3300003320 Bacteria 1155
20 rootH2_10198277 3300003320 Bacteria 4919
21 rootL2_10259676 3300003322 Bacteria 2900
22 rootH1_10005877 3300003323 Bacteria 4516
23 rootH1_10012091 3300003323 Bacteria 4371
24 JGI25160J50197_1002193 3300003354 Bacteria 9182
25 JGI25404J52841_10010830 3300003659 Bacteria 1962
26 Ga0055529_1001715 3300003763 Bacteria 5611
27 Ga0065165_1004344 3300005262 Bacteria 8892
28 Ga0065714_10064504 3300005288 Bacteria 46817
29 Ga0065704_10128089 3300005289 Bacteria 1667
30 Ga0065704_10139293 3300005289 Unclassified 1535
31 Ga0065704_10209631 3300005289 Bacteria 1114
32 Ga0065712_10067766 3300005290 Bacteria 46828
33 Ga0065712_10079152 3300005290 Bacteria 3253
34 Ga0065712_10120433 3300005290 Bacteria 1678
35 Ga0065712_10122253 3300005290 Unclassified 1654
36 Ga0065712_10182341 3300005290 Bacteria 1186
37 Ga0065715_10001956 3300005293 Bacteria 5504
38 Ga0065715_10022986 3300005293 Bacteria 1475
39 Ga0065715_10041779 3300005293 Bacteria 1617
40 Ga0065715_10089158 3300005293 Bacteria 13366
41 Ga0065715_10152536 3300005293 Bacteria 1712
42 Ga0065715_10188464 3300005293 Bacteria 1430
43 Ga0065715_10301965 3300005293 Bacteria 1039
44 Ga0065707_10195597 3300005295 Unclassified 1336
45 Ga0065707_10199019 3300005295 Bacteria 1320
46 Ga0065707_10237340 3300005295 Bacteria 1168
47 Ga0065707_10288125 3300005295 Bacteria 1031
48 Ga0070658_10001208 3300005327 Bacteria 22135
49 Ga0070658_10014417 3300005327 Bacteria 6343
50 Ga0070658_10056805 3300005327 Bacteria 3182
51 Ga0070676_10002075 3300005328 Bacteria 10197
52 Ga0070683_100001378 3300005329 Bacteria 18632
53 Ga0070683_100073796 3300005329 Bacteria 3185
54 Ga0070690_100000812 3300005330 Bacteria 15800
55 Ga0070690_100001011 3300005330 Bacteria 14383
56 Ga0070690_100001334 3300005330 Bacteria 12820
57 Ga0070690_100236242 3300005330 Bacteria 1287
58 Ga0070670_100002791 3300005331 Bacteria 14445
59 Ga0070670_100033283 3300005331 Bacteria 4440
60 Ga0070670_100133728 3300005331 Bacteria 2142
61 Ga0070670_100604021 3300005331 Bacteria 982
62 Ga0070677_10000526 3300005333 Bacteria 13130
63 Ga0070677_10152901 3300005333 Bacteria 1076
64 Ga0068869_100103722 3300005334 Unclassified 2155
65 Ga0068869_100143427 3300005334 Bacteria 1846
66 Ga0068869_100168917 3300005334 Bacteria 1708
67 Ga0068869_100250304 3300005334 Bacteria 1415
68 Ga0070666_10001337 3300005335 Bacteria 14951
69 Ga0070666_10018053 3300005335 Bacteria 4530
70 Ga0070666_10051188 3300005335 Bacteria 2780
71 Ga0070666_10088334 3300005335 Bacteria 2126
72 Ga0070680_100001985 3300005336 Bacteria 15054
73 Ga0070680_100010302 3300005336 Bacteria 7206
74 Ga0070680_100012770 3300005336 Bacteria 6531
75 Ga0070680_100326609 3300005336 Unclassified 1303
76 Ga0070682_100023706 3300005337 Bacteria 3645
77 Ga0070682_100029208 3300005337 Bacteria 3319
78 Ga0070682_100034027 3300005337 Bacteria 3100
79 Ga0068868_100001472 3300005338 Bacteria 16253
80 Ga0068868_100035781 3300005338 Bacteria 3840
81 Ga0068868_100039981 3300005338 Bacteria 3647
82 Ga0070660_100001829 3300005339 Bacteria 14621
83 Ga0070660_100005970 3300005339 Bacteria 8417
84 Ga0070660_100018548 3300005339 Bacteria 5086
85 Ga0070660_100042990 3300005339 Bacteria 3451
86 Ga0070660_100071913 3300005339 Bacteria 2701
87 Ga0070660_100111006 3300005339 Bacteria 2181
88 Ga0070689_100003426 3300005340 Bacteria 10550
89 Ga0070689_100040778 3300005340 Bacteria 3560
90 Ga0070689_100128362 3300005340 Bacteria 2031
91 Ga0070689_100440593 3300005340 Bacteria 1107
92 Ga0070691_10020783 3300005341 Bacteria 3034
93 Ga0070691_10041162 3300005341 Bacteria 2184
94 Ga0070691_10157322 3300005341 Bacteria 1169
95 Ga0070687_100000129 3300005343 Bacteria 26037
96 Ga0070687_100170001 3300005343 Unclassified 1297
97 Ga0070687_100271253 3300005343 Bacteria 1063
98 Ga0070661_100001499 3300005344 Bacteria 16227
99 Ga0070661_100004800 3300005344 Bacteria 9309
100 Ga0070661_100011435 3300005344 Bacteria 6183
101 Ga0070661_100020420 3300005344 Bacteria 4723
102 Ga0070661_100113963 3300005344 Bacteria 2021
103 Ga0070661_100340548 3300005344 Bacteria 1175
104 Ga0070692_10056376 3300005345 Unclassified 2057
105 Ga0070692_10078838 3300005345 Bacteria 1769
106 Ga0070668_100001092 3300005347 Bacteria 19121
107 Ga0070668_100020391 3300005347 Bacteria 5002
108 Ga0070668_100312028 3300005347 Bacteria 1322
109 Ga0070669_100001544 3300005353 Bacteria 16649
110 Ga0070669_100047892 3300005353 Bacteria 3119
111 Ga0070669_100066581 3300005353 Unclassified 2655
112 Ga0070669_100115061 3300005353 Bacteria 2045
113 Ga0070669_100321252 3300005353 Bacteria 1250
114 Ga0070669_100520740 3300005353 Bacteria 989
115 Ga0070675_100011835 3300005354 Bacteria 6836
116 Ga0070675_100116649 3300005354 Bacteria 2265
117 Ga0070675_100469098 3300005354 Bacteria 1131
118 Ga0070671_100001853 3300005355 Bacteria 16122
119 Ga0070671_100073369 3300005355 Bacteria 2858
120 Ga0070671_100089287 3300005355 Bacteria 2580
121 Ga0070671_100155199 3300005355 Bacteria 1934
122 Ga0070671_100228293 3300005355 Bacteria 1580
123 Ga0070674_100356481 3300005356 Bacteria 1183
124 Ga0070673_100082833 3300005364 Bacteria 2605
125 Ga0070673_100172015 3300005364 Bacteria 1849
126 Ga0070673_100272870 3300005364 Bacteria 1481
127 Ga0070673_100288759 3300005364 Bacteria 1441
128 Ga0070673_100351064 3300005364 Bacteria 1309
129 Ga0070673_100525780 3300005364 Bacteria 1072
130 Ga0070688_100000657 3300005365 Bacteria 17170
131 Ga0070688_100006128 3300005365 Bacteria 6395
132 Ga0070659_100002328 3300005366 Bacteria 13511
133 Ga0070659_100013504 3300005366 Bacteria 6080
134 Ga0070659_100023287 3300005366 Bacteria 4738
135 Ga0070659_100081787 3300005366 Bacteria 2580
136 Ga0070659_100352857 3300005366 Bacteria 1234
137 Ga0070659_100608543 3300005366 Bacteria 939
138 Ga0070667_100003253 3300005367 Bacteria 13881
139 Ga0070667_100018342 3300005367 Bacteria 5803
140 Ga0070667_100134011 3300005367 Bacteria 2165
141 Ga0070667_100173995 3300005367 Bacteria 1901
142 Ga0070703_10058342 3300005406 Unclassified 1256
143 Ga0070709_10005740 3300005434 Bacteria 6730
144 Ga0070714_100380444 3300005435 Bacteria 1331
145 Ga0070710_10004618 3300005437 Bacteria 6510
146 Ga0070701_10011515 3300005438 Bacteria 3958
147 Ga0070701_10113763 3300005438 Bacteria 1515
148 Ga0070711_100078337 3300005439 Bacteria 2348
149 Ga0070711_100084992 3300005439 Bacteria 2265
150 Ga0070705_100001751 3300005440 Bacteria 11277
151 Ga0070705_100027907 3300005440 Bacteria 3086
152 Ga0070705_100067072 3300005440 Bacteria 2154
153 Ga0070705_100105070 3300005440 Bacteria 1792
154 Ga0070700_100000719 3300005441 Bacteria 16343
155 Ga0070700_100012018 3300005441 Bacteria 4812
156 Ga0070700_100020667 3300005441 Bacteria 3818
157 Ga0070700_100039705 3300005441 Bacteria 2877
158 Ga0070700_100062514 3300005441 Bacteria 2352
159 Ga0070700_100257511 3300005441 Unclassified 1255
160 Ga0070694_100006547 3300005444 Bacteria 7075
161 Ga0070694_100008855 3300005444 Bacteria 6165
162 Ga0070694_100044502 3300005444 Bacteria 2971
163 Ga0070694_100109337 3300005444 Bacteria 1967
164 Ga0070694_100201814 3300005444 Bacteria 1483
165 Ga0070694_100333469 3300005444 Bacteria 1171
166 Ga0070694_100381266 3300005444 Bacteria 1100
167 Ga0070708_100005855 3300005445 Bacteria 9764
168 Ga0070708_100137339 3300005445 Bacteria 2266
169 Ga0070708_100677381 3300005445 Bacteria 971
170 Ga0070663_100002023 3300005455 Bacteria 11326
171 Ga0070663_100005687 3300005455 Bacteria 7428
172 Ga0070663_100011762 3300005455 Bacteria 5508
173 Ga0070663_100048511 3300005455 Bacteria 3011
174 Ga0070663_100283642 3300005455 Bacteria 1320
175 Ga0070678_100001372 3300005456 Bacteria 12958
176 Ga0070678_100032969 3300005456 Bacteria 3591
177 Ga0070678_100531052 3300005456 Bacteria 1042
178 Ga0070662_100141147 3300005457 Bacteria 1867
179 Ga0070662_100180045 3300005457 Bacteria 1666
180 Ga0070681_10002315 3300005458 Bacteria 17415
181 Ga0070681_10003664 3300005458 Bacteria 14404
182 Ga0070681_10007845 3300005458 Bacteria 10437
183 Ga0070681_10010655 3300005458 Bacteria 9087
184 Ga0070681_10015116 3300005458 Bacteria 7678
185 Ga0070681_10018723 3300005458 Bacteria 6929
186 Ga0070681_10051872 3300005458 Bacteria 4091
187 Ga0070681_10166545 3300005458 Bacteria 2126
188 Ga0070681_10348936 3300005458 Bacteria 1390
189 Ga0068867_100006387 3300005459 Bacteria 8330
190 Ga0068867_100013233 3300005459 Bacteria 5844
191 Ga0068867_100074453 3300005459 Unclassified 2545
192 Ga0068867_100257362 3300005459 Bacteria 1422
193 Ga0070685_10001416 3300005466 Bacteria 12577
194 Ga0070685_10004344 3300005466 Bacteria 7153
195 Ga0070685_10082845 3300005466 Bacteria 1926
196 Ga0070706_100000125 3300005467 Bacteria 94689
197 Ga0070706_100008529 3300005467 Bacteria 9554
198 Ga0070706_100210603 3300005467 Bacteria 1815
199 Ga0070706_100565234 3300005467 Bacteria 1058
200 Ga0070707_100003600 3300005468 Bacteria 14608
201 Ga0070707_100011087 3300005468 Bacteria 8394
202 Ga0070707_100012513 3300005468 Bacteria 7925
203 Ga0070707_100260130 3300005468 Bacteria 1688
204 Ga0070707_100304531 3300005468 Unclassified 1548
205 Ga0070707_100430159 3300005468 Unclassified 1280
206 Ga0070698_100005037 3300005471 Bacteria 14476
207 Ga0070698_100006865 3300005471 Bacteria 12329
208 Ga0070698_100008229 3300005471 Bacteria 11282
209 Ga0070699_100000352 3300005518 Bacteria 44680
210 Ga0070699_100000880 3300005518 Bacteria 27937
211 Ga0070699_100004094 3300005518 Bacteria 12885
212 Ga0070699_100111738 3300005518 Bacteria 2399
213 Ga0070679_100000587 3300005530 Bacteria 30801
214 Ga0070679_100008410 3300005530 Bacteria 9712
215 Ga0070679_100011201 3300005530 Bacteria 8547
216 Ga0070679_100077077 3300005530 Bacteria 3322
217 Ga0070684_100043562 3300005535 Bacteria 3876
218 Ga0070684_100059847 3300005535 Bacteria 3331
219 Ga0070684_100533696 3300005535 Bacteria 1088
220 Ga0070697_100031128 3300005536 Bacteria 4289
221 Ga0070697_100055838 3300005536 Bacteria 3212
222 Ga0070697_100153616 3300005536 Bacteria 1941
223 Ga0068853_100003665 3300005539 Bacteria 11782
224 Ga0068853_100003943 3300005539 Bacteria 11396
225 Ga0068853_100027252 3300005539 Bacteria 4800
226 Ga0068853_100040630 3300005539 Bacteria 3969
227 Ga0068853_100051948 3300005539 Bacteria 3530
228 Ga0068853_100093101 3300005539 Bacteria 2652
229 Ga0068853_100163691 3300005539 Bacteria 2009
230 Ga0068853_100170360 3300005539 Bacteria 1969
231 Ga0070672_100000867 3300005543 Bacteria 18097
232 Ga0070672_100016594 3300005543 Bacteria 5276
233 Ga0070672_100042656 3300005543 Bacteria 3493
234 Ga0070672_100197393 3300005543 Bacteria 1682
235 Ga0070672_100560480 3300005543 Bacteria 993
236 Ga0070672_100656057 3300005543 Unclassified 917
237 Ga0070686_100004310 3300005544 Bacteria 7831
238 Ga0070686_100006195 3300005544 Bacteria 6640
239 Ga0070686_100022101 3300005544 Bacteria 3786
240 Ga0070686_100142294 3300005544 Bacteria 1671
241 Ga0070686_100221860 3300005544 Bacteria 1366
242 Ga0070695_100008518 3300005545 Bacteria 6087
243 Ga0070695_100053158 3300005545 Bacteria 2604
244 Ga0070695_100267266 3300005545 Bacteria 1251
245 Ga0070695_100510046 3300005545 Unclassified 931
246 Ga0070696_100040295 3300005546 Bacteria 3225
247 Ga0070696_100514153 3300005546 Bacteria 954
248 Ga0070696_100693071 3300005546 Bacteria 830
249 Ga0070693_100020755 3300005547 Bacteria 3470
250 Ga0070693_100030719 3300005547 Bacteria 2939
251 Ga0070693_100052530 3300005547 Bacteria 2337
252 Ga0070693_100070706 3300005547 Bacteria 2054
253 Ga0070665_100010998 3300005548 Bacteria 9149
254 Ga0070665_100018974 3300005548 Bacteria 6900
255 Ga0070665_100023145 3300005548 Bacteria 6257
256 Ga0070665_100024444 3300005548 Bacteria 6084
257 Ga0070665_100046320 3300005548 Bacteria 4369
258 Ga0070665_100263305 3300005548 Bacteria 1725
259 Ga0070665_100283231 3300005548 Bacteria 1659
260 Ga0070665_100350250 3300005548 Bacteria 1482
261 Ga0070665_100553282 3300005548 Bacteria 1163
262 Ga0070704_100000897 3300005549 Bacteria 14913
263 Ga0070704_100054755 3300005549 Bacteria 2824
264 Ga0070704_100096074 3300005549 Bacteria 2221
265 Ga0070704_100134808 3300005549 Bacteria 1919
266 Ga0070704_100161122 3300005549 Bacteria 1774
267 Ga0070704_100325872 3300005549 Bacteria 1289
268 Ga0070704_100605301 3300005549 Bacteria 963
269 Ga0068855_100003374 3300005563 Bacteria 19561
270 Ga0068855_100004501 3300005563 Bacteria 17027
271 Ga0068855_100018186 3300005563 Bacteria 8443
272 Ga0068855_100037556 3300005563 Bacteria 5759
273 Ga0068855_100089580 3300005563 Bacteria 3552
274 Ga0068855_100108358 3300005563 Bacteria 3190
275 Ga0068855_100151181 3300005563 Bacteria 2640
276 Ga0068855_100240449 3300005563 Bacteria 2023
277 Ga0068855_100250783 3300005563 Bacteria 1974
278 Ga0068855_100802958 3300005563 Bacteria 1000
279 Ga0068855_100926808 3300005563 Bacteria 919
280 Ga0070664_100000070 3300005564 Bacteria 63788
281 Ga0070664_100001934 3300005564 Bacteria 16649
282 Ga0070664_100017132 3300005564 Bacteria 5948
283 Ga0070664_100026866 3300005564 Bacteria 4780
284 Ga0070664_100047571 3300005564 Bacteria 3624
285 Ga0068857_100003654 3300005577 Bacteria 12893
286 Ga0068857_100004680 3300005577 Bacteria 11592
287 Ga0068857_100033566 3300005577 Bacteria 4539
288 Ga0068857_100037853 3300005577 Bacteria 4274
289 Ga0068857_100061463 3300005577 Bacteria 3337
290 Ga0068854_100001002 3300005578 Bacteria 17023
291 Ga0068854_100010067 3300005578 Bacteria 6124
292 Ga0068854_100046307 3300005578 Bacteria 3096
293 Ga0068854_100103155 3300005578 Bacteria 2141
294 Ga0068854_100253706 3300005578 Unclassified 1406
295 Ga0068856_100005597 3300005614 Bacteria 12362
296 Ga0068856_100021359 3300005614 Bacteria 6293
297 Ga0068856_100216883 3300005614 Bacteria 1929
298 Ga0068856_100312957 3300005614 Bacteria 1588
299 Ga0068856_100341639 3300005614 Bacteria 1515
300 Ga0068856_100526334 3300005614 Bacteria 1203
301 Ga0070702_100017673 3300005615 Bacteria 3684
302 Ga0070702_100033498 3300005615 Bacteria 2825
303 Ga0070702_100060385 3300005615 Bacteria 2204
304 Ga0070702_100252847 3300005615 Bacteria 1195
305 Ga0070702_100308007 3300005615 Bacteria 1098
306 Ga0068852_100001511 3300005616 Bacteria 15733
307 Ga0068852_100006048 3300005616 Bacteria 8718
308 Ga0068852_100065307 3300005616 Bacteria 3174
309 Ga0068852_100232089 3300005616 Bacteria 1759
310 Ga0068852_100241597 3300005616 Bacteria 1726
311 Ga0068852_100399548 3300005616 Bacteria 1352
312 Ga0068852_100662403 3300005616 Bacteria 1052
313 Ga0068852_100672893 3300005616 Bacteria 1044
314 Ga0068859_100009084 3300005617 Bacteria 10038
315 Ga0068859_100022162 3300005617 Bacteria 6369
316 Ga0068859_100027560 3300005617 Bacteria 5698
317 Ga0068859_100029327 3300005617 Bacteria 5521
318 Ga0068859_100050914 3300005617 Bacteria 4162
319 Ga0068859_100059991 3300005617 Bacteria 3833
320 Ga0068859_100102105 3300005617 Bacteria 2925
321 Ga0068859_100169710 3300005617 Bacteria 2262
322 Ga0068859_100355574 3300005617 Bacteria 1560
323 Ga0068864_100003320 3300005618 Bacteria 13297
324 Ga0068864_100014922 3300005618 Bacteria 6455
325 Ga0068864_100024719 3300005618 Bacteria 5054
326 Ga0068864_100035972 3300005618 Bacteria 4218
327 Ga0068864_100040419 3300005618 Bacteria 3990
328 Ga0068864_100178664 3300005618 Bacteria 1939
329 Ga0068864_100246022 3300005618 Bacteria 1658
330 Ga0068864_100676324 3300005618 Unclassified 1007
331 Ga0068866_10000167 3300005718 Bacteria 30374
332 Ga0068861_100001113 3300005719 Bacteria 16659
333 Ga0068861_100020275 3300005719 Bacteria 4758
334 Ga0068861_100340958 3300005719 Bacteria 1311
335 Ga0068861_100558303 3300005719 Bacteria 1044
336 Ga0068851_10000382 3300005834 Bacteria 20035
337 Ga0068851_10010828 3300005834 Bacteria 4262
338 Ga0068851_10062572 3300005834 Bacteria 1909
339 Ga0068863_100002882 3300005841 Bacteria 17031
340 Ga0068863_100080336 3300005841 Unclassified 3088
341 Ga0068863_100208714 3300005841 Bacteria 1880
342 Ga0068863_100264213 3300005841 Bacteria 1664
343 Ga0068858_100005307 3300005842 Bacteria 12636
344 Ga0068858_100006538 3300005842 Bacteria 11336
345 Ga0068858_100018581 3300005842 Bacteria 6510
346 Ga0068858_100041680 3300005842 Bacteria 4257
347 Ga0068858_100049299 3300005842 Bacteria 3900
348 Ga0068858_100059043 3300005842 Bacteria 3545
349 Ga0068858_100206719 3300005842 Unclassified 1857
350 Ga0068858_100275829 3300005842 Bacteria 1601
351 Ga0068860_100007853 3300005843 Bacteria 10650
352 Ga0068860_100011324 3300005843 Bacteria 8789
353 Ga0068860_100019352 3300005843 Bacteria 6604
354 Ga0068860_100030361 3300005843 Bacteria 5198
355 Ga0068860_100061705 3300005843 Bacteria 3561
356 Ga0068860_100243218 3300005843 Bacteria 1751
357 Ga0068862_100014640 3300005844 Bacteria 6515
358 Ga0068862_100080071 3300005844 Bacteria 2832
359 Ga0068862_100095635 3300005844 Bacteria 2592
360 Ga0068862_100156570 3300005844 Bacteria 2031
361 Ga0068862_100655808 3300005844 Bacteria 1013
362 Ga0068862_100860223 3300005844 Bacteria 889
363 Ga0081455_10017929 3300005937 Bacteria 6765
364 Ga0081540_1000138 3300005983 Bacteria 76659
365 Ga0081540_1000640 3300005983 Bacteria 33222
366 Ga0081540_1001923 3300005983 Bacteria 17413
367 Ga0081540_1003393 3300005983 Bacteria 12631
368 Ga0081540_1017951 3300005983 Bacteria 4359
369 Ga0081540_1093371 3300005983 Bacteria 1318
370 Ga0081539_10000110 3300005985 Bacteria 190555
371 Ga0081539_10001757 3300005985 Bacteria 34548
372 Ga0081539_10005290 3300005985 Bacteria 13293
373 Ga0081539_10006601 3300005985 Bacteria 11020
374 Ga0081539_10016624 3300005985 Bacteria 5235
375 Ga0070717_10038368 3300006028 Bacteria 3893
376 Ga0070717_10114601 3300006028 Bacteria 2303
377 Ga0075365_10003274 3300006038 Bacteria 8304
378 Ga0075365_10005800 3300006038 Bacteria 6706
379 Ga0075365_10009956 3300006038 Bacteria 5505
380 Ga0075368_10010236 3300006042 Bacteria 3386
381 Ga0075363_100040656 3300006048 Bacteria 2451
382 Ga0075364_10027328 3300006051 Bacteria 3644
383 Ga0070715_10000063 3300006163 Bacteria 34937
384 Ga0070716_100078021 3300006173 Bacteria 1968
385 Ga0070716_100116535 3300006173 Bacteria 1665
386 Ga0075362_10008752 3300006177 Bacteria 3888
387 Ga0075362_10018996 3300006177 Bacteria 2853
388 Ga0075367_10017171 3300006178 Bacteria 3967
389 Ga0075367_10026146 3300006178 Bacteria 3307
390 Ga0075367_10070535 3300006178 Bacteria 2101
391 Ga0075367_10090436 3300006178 Bacteria 1862
392 Ga0075369_10003352 3300006186 Bacteria 5823
393 Ga0075369_10105201 3300006186 Bacteria 1268
394 Ga0097621_100000449 3300006237 Bacteria 28814
395 Ga0097621_100259045 3300006237 Bacteria 1525
396 Ga0097621_100273719 3300006237 Bacteria 1484
397 Ga0075370_10023704 3300006353 Bacteria 3383
398 Ga0068871_100001759 3300006358 Bacteria 14597
399 Ga0068871_100064226 3300006358 Bacteria 3005
400 Ga0068871_100314906 3300006358 Bacteria 1376
401 Ga0068871_100376467 3300006358 Bacteria 1260
402 Ga0075428_100009001 3300006844 Bacteria 11076
403 Ga0075428_100047133 3300006844 Bacteria 4734
404 Ga0075428_100049375 3300006844 Bacteria 4616
405 Ga0075428_100065603 3300006844 Bacteria 3976
406 Ga0075428_100185233 3300006844 Bacteria 2253
407 Ga0075428_100287649 3300006844 Bacteria 1768
408 Ga0075430_100076170 3300006846 Bacteria 2811
409 Ga0075430_100080323 3300006846 Bacteria 2732
410 Ga0075430_100518947 3300006846 Bacteria 983
411 Ga0075431_100000392 3300006847 Bacteria 35161
412 Ga0075431_100001188 3300006847 Bacteria 23484
413 Ga0075433_10008826 3300006852 Bacteria 8041
414 Ga0075433_10044089 3300006852 Bacteria 3875
415 Ga0075433_10045889 3300006852 Unclassified 3799
416 Ga0075433_10062021 3300006852 Bacteria 3274
417 Ga0075433_10118535 3300006852 Bacteria 2349
418 Ga0075433_10176928 3300006852 Bacteria 1899
419 Ga0075434_100004782 3300006871 Bacteria 12262
420 Ga0075434_100019404 3300006871 Bacteria 6580
421 Ga0075434_100020621 3300006871 Bacteria 6397
422 Ga0075434_100035585 3300006871 Bacteria 4923
423 Ga0075434_100110623 3300006871 Bacteria 2758
424 Ga0075434_100120201 3300006871 Bacteria 2642
425 Ga0075434_100217845 3300006871 Bacteria 1929
426 Ga0075434_100240687 3300006871 Bacteria 1829
427 Ga0075434_100277852 3300006871 Bacteria 1694
428 Ga0075429_100124879 3300006880 Bacteria 2251
429 Ga0075429_100295766 3300006880 Unclassified 1417
430 Ga0075429_100395773 3300006880 Unclassified 1210
431 Ga0068865_100002359 3300006881 Bacteria 11142
432 Ga0068865_100024668 3300006881 Bacteria 3947
433 Ga0068865_100141872 3300006881 Bacteria 1812
434 Ga0068865_100365257 3300006881 Bacteria 1173
435 Ga0075436_100001175 3300006914 Bacteria 17759
436 Ga0097620_100009084 3300006931 Bacteria 10038
437 Ga0097620_100022163 3300006931 Bacteria 6369
438 Ga0097620_100027559 3300006931 Bacteria 5698
439 Ga0097620_100029326 3300006931 Bacteria 5521
440 Ga0097620_100050908 3300006931 Bacteria 4162
441 Ga0097620_100059986 3300006931 Bacteria 3833
442 Ga0097620_100102107 3300006931 Bacteria 2925
443 Ga0097620_100169714 3300006931 Bacteria 2262
444 Ga0097620_100355571 3300006931 Bacteria 1560
445 Ga0079104_1000209 3300006946 Bacteria 81844
446 Ga0075435_100009611 3300007076 Bacteria 7018
447 Ga0099794_10003880 3300007265 Bacteria 5788
448 Ga0105251_10056175 3300009011 Bacteria 1864
449 Ga0105244_10000145 3300009036 Bacteria 73760
450 Ga0105250_10000127 3300009092 Bacteria 66039
451 Ga0105240_10007255 3300009093 Bacteria 16136
452 Ga0105240_10021381 3300009093 Bacteria 8606
453 Ga0105240_10062851 3300009093 Bacteria 4621
454 Ga0105240_10094300 3300009093 Bacteria 3651
455 Ga0105240_10122464 3300009093 Bacteria 3130
456 Ga0105240_10134066 3300009093 Bacteria 2967
457 Ga0105240_10142856 3300009093 Bacteria 2860
458 Ga0105240_10158004 3300009093 Bacteria 2695
459 Ga0105240_10162374 3300009093 Bacteria 2653
460 Ga0105240_10189757 3300009093 Bacteria 2417
461 Ga0105240_10478093 3300009093 Bacteria 1389
462 Ga0105240_10769101 3300009093 Bacteria 1046
463 Ga0111539_10000358 3300009094 Bacteria 56148
464 Ga0111539_10059338 3300009094 Bacteria 4537
465 Ga0111539_10076099 3300009094 Bacteria 3952
466 Ga0111539_10112739 3300009094 Bacteria 3190
467 Ga0111539_10310035 3300009094 Bacteria 1836
468 Ga0111539_10351792 3300009094 Bacteria 1715
469 Ga0111539_10375944 3300009094 Bacteria 1654
470 Ga0105245_10003941 3300009098 Bacteria 13204
471 Ga0105245_10107745 3300009098 Bacteria 2587
472 Ga0105245_10487140 3300009098 Bacteria 1247
473 Ga0105245_10668767 3300009098 Bacteria 1070
474 Ga0105247_10000047 3300009101 Bacteria 151385
475 Ga0105247_10000680 3300009101 Bacteria 26882
476 Ga0105247_10001044 3300009101 Bacteria 20780
477 Ga0105247_10063001 3300009101 Bacteria 2301
478 Ga0105247_10093410 3300009101 Bacteria 1912
479 Ga0105247_10103760 3300009101 Bacteria 1821
480 Ga0114129_10005694 3300009147 Bacteria 17649
481 Ga0114129_10070556 3300009147 Bacteria 4872
482 Ga0114129_10281624 3300009147 Bacteria 2221
483 Ga0114129_10313848 3300009147 Bacteria 2086
484 Ga0114129_10473193 3300009147 Unclassified 1640
485 Ga0114129_10481150 3300009147 Bacteria 1624
486 Ga0114129_10514193 3300009147 Unclassified 1562
487 Ga0114129_10610367 3300009147 Bacteria 1412
488 Ga0114129_10759767 3300009147 Bacteria 1240
489 Ga0105243_10000027 3300009148 Bacteria 191224
490 Ga0105243_10000474 3300009148 Bacteria 41200
491 Ga0105243_10007357 3300009148 Bacteria 8465
492 Ga0105243_10025565 3300009148 Bacteria 4514
493 Ga0105243_10046747 3300009148 Bacteria 3406
494 Ga0105243_10147343 3300009148 Bacteria 2016
495 Ga0105243_10378635 3300009148 Bacteria 1308
496 Ga0105243_10410071 3300009148 Bacteria 1261
497 Ga0105241_10000690 3300009174 Bacteria 25453
498 Ga0105241_10050218 3300009174 Bacteria 3178
499 Ga0105241_10070341 3300009174 Bacteria 2715
500 Ga0105241_10072947 3300009174 Bacteria 2669
501 Ga0105241_10102582 3300009174 Bacteria 2277
502 Ga0105241_10294902 3300009174 Bacteria 1390
503 Ga0105241_10298249 3300009174 Bacteria 1382
504 Ga0105241_10585830 3300009174 Bacteria 1006
505 Ga0105242_10000038 3300009176 Bacteria 90379
506 Ga0105242_10000107 3300009176 Bacteria 59805
507 Ga0105242_10001950 3300009176 Bacteria 16240
508 Ga0105242_10005047 3300009176 Bacteria 10192
509 Ga0105242_10028561 3300009176 Bacteria 4443
510 Ga0105242_10123128 3300009176 Bacteria 2229
511 Ga0105242_10160011 3300009176 Bacteria 1970
512 Ga0105248_10003364 3300009177 Bacteria 17776
513 Ga0105248_10020227 3300009177 Bacteria 7373
514 Ga0105248_10028561 3300009177 Bacteria 6215
515 Ga0105248_10032857 3300009177 Bacteria 5797
516 Ga0105248_10071202 3300009177 Bacteria 3905
517 Ga0105248_10169319 3300009177 Bacteria 2462
518 Ga0105248_10250961 3300009177 Bacteria 1992
519 Ga0105248_10321545 3300009177 Bacteria 1742
520 Ga0105237_10000829 3300009545 Bacteria 42345
521 Ga0105237_10003821 3300009545 Bacteria 17702
522 Ga0105237_10033099 3300009545 Bacteria 5236
523 Ga0105237_10045544 3300009545 Bacteria 4414
524 Ga0105237_10047386 3300009545 Bacteria 4321
525 Ga0105237_10059203 3300009545 Bacteria 3832
526 Ga0105237_10099103 3300009545 Bacteria 2906
527 Ga0105237_10246404 3300009545 Bacteria 1789
528 Ga0105237_10258032 3300009545 Bacteria 1745
529 Ga0105238_10001511 3300009551 Bacteria 23281
530 Ga0105238_10021004 3300009551 Bacteria 6652
531 Ga0105238_10027120 3300009551 Bacteria 5839
532 Ga0105238_10058950 3300009551 Bacteria 3847
533 Ga0105238_10141237 3300009551 Bacteria 2385
534 Ga0105238_10240618 3300009551 Bacteria 1787
535 Ga0105238_10625288 3300009551 Bacteria 1086
536 Ga0105238_10770149 3300009551 Bacteria 977
537 Ga0105249_10000113 3300009553 Bacteria 108613
538 Ga0105249_10001390 3300009553 Bacteria 21177
539 Ga0105249_10001767 3300009553 Bacteria 18831
540 Ga0105249_10022829 3300009553 Bacteria 5609
541 Ga0105249_10490726 3300009553 Bacteria 1272
542 Ga0105239_10000857 3300010375 Bacteria 43236
543 Ga0105239_10003469 3300010375 Bacteria 19288
544 Ga0105239_10049011 3300010375 Bacteria 4631
545 Ga0105239_10060038 3300010375 Bacteria 4173
546 Ga0105239_10076176 3300010375 Bacteria 3689
547 Ga0105239_10165419 3300010375 Bacteria 2473
548 Ga0105239_10241798 3300010375 Bacteria 2026
549 Ga0105239_10887796 3300010375 Bacteria 1023
550 Ga0105246_10001442 3300011119 Bacteria 14078
551 Ga0105246_10073632 3300011119 Bacteria 2412
552 Ga0105246_10086527 3300011119 Bacteria 2247
553 Ga0105246_10280360 3300011119 Bacteria 1337
554 Ga0105246_10319732 3300011119 Unclassified 1261
555 Ga0157373_10003881 3300013100 Bacteria 11298
556 Ga0157373_10018812 3300013100 Bacteria 5027
557 Ga0157373_10044566 3300013100 Bacteria 3166
558 Ga0157373_10044616 3300013100 Bacteria 3165
559 Ga0157373_10186683 3300013100 Bacteria 1460
560 Ga0157371_10000858 3300013102 Bacteria 34677
561 Ga0157371_10310404 3300013102 Bacteria 1143
562 Ga0157371_10317708 3300013102 Bacteria 1130
563 Ga0157370_10001310 3300013104 Bacteria 31043
564 Ga0157370_10066474 3300013104 Bacteria 3410
565 Ga0157370_10084349 3300013104 Bacteria 2986
566 Ga0157370_10104065 3300013104 Bacteria 2657
567 Ga0157370_10193563 3300013104 Bacteria 1887
568 Ga0157369_10002570 3300013105 Bacteria 21720
569 Ga0157369_10007844 3300013105 Bacteria 12281
570 Ga0157369_10065636 3300013105 Bacteria 3906
571 Ga0157369_10070649 3300013105 Bacteria 3750
572 Ga0157369_10125796 3300013105 Bacteria 2718
573 Ga0157369_10196245 3300013105 Bacteria 2120
574 Ga0157374_10002021 3300013296 Bacteria 17019
575 Ga0157374_10913170 3300013296 Bacteria 896
576 Ga0157378_10000048 3300013297 Bacteria 104914
577 Ga0157378_10001435 3300013297 Bacteria 21473
578 Ga0157378_10005648 3300013297 Bacteria 10955
579 Ga0157378_10025656 3300013297 Bacteria 5189
580 Ga0157378_10113691 3300013297 Bacteria 2486
581 Ga0157378_10229130 3300013297 Bacteria 1770
582 Ga0157378_10381753 3300013297 Bacteria 1384
583 Ga0157378_10528555 3300013297 Bacteria 1182
584 Ga0157378_10645347 3300013297 Bacteria 1074
585 Ga0163162_10000023 3300013306 Bacteria 193395
586 Ga0163162_10001226 3300013306 Bacteria 23960
587 Ga0163162_10051608 3300013306 Bacteria 4127
588 Ga0163162_10053079 3300013306 Bacteria 4073
589 Ga0163162_10108278 3300013306 Bacteria 2875
590 Ga0163162_10148629 3300013306 Bacteria 2460
591 Ga0163162_10203558 3300013306 Bacteria 2109
592 Ga0163162_10208523 3300013306 Bacteria 2083
593 Ga0163162_10216899 3300013306 Bacteria 2043
594 Ga0163162_10658561 3300013306 Bacteria 1170
595 Ga0157372_10006136 3300013307 Bacteria 12772
596 Ga0157372_10068693 3300013307 Bacteria 3984
597 Ga0157372_10286185 3300013307 Unclassified 1917
598 Ga0157372_10494190 3300013307 Bacteria 1427
599 Ga0157372_11515511 3300013307 Bacteria 772
600 Ga0157375_10002065 3300013308 Bacteria 17352
601 Ga0157375_10006519 3300013308 Bacteria 10158
602 Ga0157375_10048768 3300013308 Bacteria 4145
603 Ga0157375_10124856 3300013308 Unclassified 2687
604 Ga0157375_10245995 3300013308 Bacteria 1949
605 Ga0157375_10254236 3300013308 Bacteria 1918
606 Ga0157375_10348662 3300013308 Bacteria 1646
607 Ga0163163_10000156 3300014325 Bacteria 70968
608 Ga0163163_10054400 3300014325 Bacteria 3954
609 Ga0163163_10073729 3300014325 Bacteria 3404
610 Ga0163163_10304950 3300014325 Bacteria 1645
611 Ga0163163_10377167 3300014325 Unclassified 1476
612 Ga0163163_10776315 3300014325 Bacteria 1022
613 Ga0157380_10001458 3300014326 Bacteria 15474
614 Ga0157380_10012266 3300014326 Bacteria 6210
615 Ga0157380_10029038 3300014326 Bacteria 4225
616 Ga0157380_10039177 3300014326 Bacteria 3684
617 Ga0157380_10040754 3300014326 Bacteria 3620
618 Ga0157380_10053569 3300014326 Bacteria 3199
619 Ga0157380_10284365 3300014326 Bacteria 1515
620 Ga0157380_10322233 3300014326 Bacteria 1433
621 Ga0157377_10001610 3300014745 Bacteria 9828
622 Ga0157377_10050432 3300014745 Bacteria 2344
623 Ga0157379_10056062 3300014968 Bacteria 3522
624 Ga0157379_10105838 3300014968 Bacteria 2525
625 Ga0157379_10123869 3300014968 Bacteria 2326
626 Ga0157379_10153851 3300014968 Bacteria 2074
627 Ga0157379_10162021 3300014968 Bacteria 2019
628 Ga0157376_10032402 3300014969 Bacteria 4197
629 Ga0157376_10054345 3300014969 Bacteria 3338
630 Ga0157376_10124275 3300014969 Bacteria 2292
631 Ga0157376_10147821 3300014969 Bacteria 2116
632 Ga0157376_10159828 3300014969 Bacteria 2041
633 Ga0157376_11005865 3300014969 Bacteria 856
634 Ga0182006_1023433 3300015261 Bacteria 2557
635 Ga0182007_10030676 3300015262 Bacteria 1835
636 Ga0182007_10056709 3300015262 Unclassified 1286
637 Ga0163161_10017220 3300017792 Bacteria 5055
638 Ga0163161_10025332 3300017792 Bacteria 4198
639 Ga0163161_10059173 3300017792 Bacteria 2786
640 Ga0163161_10159882 3300017792 Bacteria 1717
641 Ga0163161_10174310 3300017792 Bacteria 1646
642 Ga0163161_10231857 3300017792 Bacteria 1433
643 Ga0163161_10337928 3300017792 Bacteria 1194
644 Ga0163161_10355781 3300017792 Bacteria 1165
645 Ga0213873_10062851 3300021358 Bacteria 1008
646 Ga0213874_10021966 3300021377 Bacteria 1765
647 Ga0213874_10023511 3300021377 Bacteria 1720
648 Ga0213876_10000043 3300021384 Bacteria 162257
649 Ga0213876_10000283 3300021384 Bacteria 46166
650 Ga0213876_10000541 3300021384 Bacteria 28477
651 Ga0213876_10000580 3300021384 Bacteria 27228
652 Ga0213876_10059369 3300021384 Bacteria 2019
653 Ga0213876_10123628 3300021384 Bacteria 1374
654 Ga0213876_10297933 3300021384 Bacteria 857
655 Ga0213875_10000276 3300021388 Bacteria 50734
656 Ga0213875_10005719 3300021388 Bacteria 6623
657 Ga0213875_10007545 3300021388 Bacteria 5607
658 Ga0213875_10073977 3300021388 Bacteria 1590
659 Ga0213875_10091254 3300021388 Unclassified 1421
660 Ga0213875_10119755 3300021388 Bacteria 1230
661 Ga0213875_10165417 3300021388 Unclassified 1038
662 Ga0213871_10002403 3300021441 Bacteria 3436
663 Ga0224712_10012148 3300022467 Bacteria 2699
664 Ga0224572_1007204 3300024225 Bacteria 2032
665 Ga0207672_1000156 3300025223 Bacteria 9398
666 Ga0209646_1019801 3300025246 Bacteria 977
667 Ga0209026_1000002 3300025250 Bacteria 1136158
668 Ga0209677_100440 3300025253 Bacteria 24115
669 Ga0209148_1000072 3300025254 Bacteria 325292
670 Ga0209148_1008001 3300025254 Bacteria 2154
671 Ga0209759_1000146 3300025256 Bacteria 121497
672 Ga0209233_1000027 3300025261 Bacteria 652089
673 Ga0209233_1000297 3300025261 Bacteria 61773
674 Ga0209233_1004351 3300025261 Bacteria 4834
675 Ga0209455_1000133 3300025272 Bacteria 155670
676 Ga0209455_1009471 3300025272 Bacteria 2556
677 Ga0209675_1001307 3300025291 Bacteria 14774
678 Ga0209758_1012195 3300025297 Bacteria 4843
679 Ga0209758_1024001 3300025297 Bacteria 2734
680 Ga0209256_1002428 3300025299 Bacteria 15246
681 Ga0207697_10001372 3300025315 Bacteria 13331
682 Ga0207697_10029948 3300025315 Bacteria 2228
683 Ga0207697_10129407 3300025315 Bacteria 1090
684 Ga0207656_10000298 3300025321 Bacteria 17134
685 Ga0207656_10005843 3300025321 Bacteria 4384
686 Ga0207656_10032171 3300025321 Bacteria 2178
687 Ga0207696_1000134 3300025711 Bacteria 130099
688 Ga0207655_1000298 3300025728 Bacteria 74953
689 Ga0207653_10000400 3300025885 Bacteria 19184
690 Ga0207682_10000214 3300025893 Bacteria 26263
691 Ga0207692_10008338 3300025898 Bacteria 4285
692 Ga0207642_10000260 3300025899 Bacteria 15834
693 Ga0207710_10000001 3300025900 Bacteria 1797433
694 Ga0207710_10002316 3300025900 Bacteria 8893
695 Ga0207710_10002769 3300025900 Bacteria 8015
696 Ga0207710_10050509 3300025900 Bacteria 1866
697 Ga0207688_10000836 3300025901 Bacteria 15457
698 Ga0207688_10045664 3300025901 Bacteria 2444
699 Ga0207688_10074619 3300025901 Bacteria 1929
700 Ga0207680_10001615 3300025903 Bacteria 10655
701 Ga0207680_10004606 3300025903 Bacteria 6544
702 Ga0207680_10070356 3300025903 Bacteria 2165
703 Ga0207647_10001682 3300025904 Bacteria 17032
704 Ga0207647_10004899 3300025904 Bacteria 9879
705 Ga0207647_10009697 3300025904 Bacteria 6832
706 Ga0207647_10021671 3300025904 Bacteria 4285
707 Ga0207647_10081547 3300025904 Bacteria 1938
708 Ga0207685_10000041 3300025905 Bacteria 57491
709 Ga0207645_10000251 3300025907 Bacteria 44805
710 Ga0207645_10002159 3300025907 Bacteria 15722
711 Ga0207645_10189759 3300025907 Bacteria 1350
712 Ga0207643_10000176 3300025908 Bacteria 43543
713 Ga0207643_10067989 3300025908 Bacteria 2046
714 Ga0207705_10011075 3300025909 Bacteria 6538
715 Ga0207705_10015184 3300025909 Bacteria 5534
716 Ga0207705_10029984 3300025909 Bacteria 3880
717 Ga0207705_10043327 3300025909 Bacteria 3233
718 Ga0207705_10066183 3300025909 Bacteria 2613
719 Ga0207705_10135850 3300025909 Bacteria 1833
720 Ga0207705_10139696 3300025909 Bacteria 1808
721 Ga0207684_10000130 3300025910 Bacteria 137931
722 Ga0207684_10001792 3300025910 Bacteria 22526
723 Ga0207684_10107705 3300025910 Bacteria 2384
724 Ga0207684_10131173 3300025910 Bacteria 2151
725 Ga0207684_10165352 3300025910 Bacteria 1906
726 Ga0207654_10001318 3300025911 Bacteria 13235
727 Ga0207654_10017455 3300025911 Bacteria 3752
728 Ga0207654_10020733 3300025911 Bacteria 3489
729 Ga0207654_10115339 3300025911 Bacteria 1678
730 Ga0207654_10284014 3300025911 Bacteria 1120
731 Ga0207707_10000577 3300025912 Bacteria 37232
732 Ga0207707_10013845 3300025912 Bacteria 7034
733 Ga0207707_10027146 3300025912 Bacteria 5006
734 Ga0207707_10038041 3300025912 Bacteria 4204
735 Ga0207707_10057171 3300025912 Bacteria 3395
736 Ga0207707_10072545 3300025912 Bacteria 3001
737 Ga0207707_10135112 3300025912 Bacteria 2156
738 Ga0207707_10151696 3300025912 Bacteria 2026
739 Ga0207695_10000011 3300025913 Bacteria 910221
740 Ga0207695_10004415 3300025913 Bacteria 19212
741 Ga0207695_10011746 3300025913 Bacteria 10577
742 Ga0207695_10051889 3300025913 Bacteria 4302
743 Ga0207695_10076795 3300025913 Bacteria 3394
744 Ga0207695_10128836 3300025913 Bacteria 2489
745 Ga0207695_10205545 3300025913 Bacteria 1882
746 Ga0207695_10291348 3300025913 Bacteria 1524
747 Ga0207695_10316714 3300025913 Bacteria 1450
748 Ga0207695_10328574 3300025913 Bacteria 1418
749 Ga0207695_10411011 3300025913 Bacteria 1238
750 Ga0207695_10666506 3300025913 Bacteria 921
751 Ga0207671_10002285 3300025914 Bacteria 20737
752 Ga0207671_10009012 3300025914 Bacteria 8392
753 Ga0207671_10012933 3300025914 Bacteria 6680
754 Ga0207671_10030414 3300025914 Bacteria 4027
755 Ga0207671_10216238 3300025914 Bacteria 1500
756 Ga0207671_10256790 3300025914 Bacteria 1375
757 Ga0207671_10363776 3300025914 Bacteria 1148
758 Ga0207671_10609738 3300025914 Bacteria 870
759 Ga0207663_10082208 3300025916 Bacteria 2112
760 Ga0207660_10004634 3300025917 Bacteria 8962
761 Ga0207660_10013164 3300025917 Bacteria 5416
762 Ga0207660_10037192 3300025917 Bacteria 3390
763 Ga0207660_10118160 3300025917 Bacteria 2005
764 Ga0207660_10314999 3300025917 Unclassified 1248
765 Ga0207660_10416795 3300025917 Bacteria 1083
766 Ga0207662_10000146 3300025918 Bacteria 34142
767 Ga0207662_10043744 3300025918 Bacteria 2642
768 Ga0207662_10046470 3300025918 Bacteria 2568
769 Ga0207662_10176936 3300025918 Bacteria 1371
770 Ga0207657_10003084 3300025919 Bacteria 17826
771 Ga0207657_10012251 3300025919 Bacteria 8472
772 Ga0207657_10022391 3300025919 Bacteria 5913
773 Ga0207657_10022630 3300025919 Bacteria 5875
774 Ga0207657_10173175 3300025919 Bacteria 1748
775 Ga0207657_10273208 3300025919 Bacteria 1343
776 Ga0207649_10000907 3300025920 Bacteria 18679
777 Ga0207649_10001001 3300025920 Bacteria 17489
778 Ga0207649_10003509 3300025920 Bacteria 8570
779 Ga0207649_10053105 3300025920 Bacteria 2517
780 Ga0207652_10010606 3300025921 Bacteria 7417
781 Ga0207652_10043700 3300025921 Bacteria 3815
782 Ga0207652_10068600 3300025921 Bacteria 3077
783 Ga0207652_10075441 3300025921 Bacteria 2939
784 Ga0207652_10104189 3300025921 Bacteria 2509
785 Ga0207646_10004552 3300025922 Bacteria 15002
786 Ga0207646_10004920 3300025922 Bacteria 14288
787 Ga0207646_10149616 3300025922 Bacteria 2105
788 Ga0207646_10251620 3300025922 Bacteria 1596
789 Ga0207646_10269196 3300025922 Bacteria 1540
790 Ga0207681_10001125 3300025923 Bacteria 17320
791 Ga0207681_10009832 3300025923 Bacteria 5850
792 Ga0207681_10014548 3300025923 Bacteria 4893
793 Ga0207681_10284649 3300025923 Bacteria 1303
794 Ga0207681_10292495 3300025923 Bacteria 1286
795 Ga0207694_10001152 3300025924 Bacteria 22948
796 Ga0207694_10002336 3300025924 Bacteria 15508
797 Ga0207694_10022362 3300025924 Bacteria 4796
798 Ga0207694_10028283 3300025924 Bacteria 4274
799 Ga0207694_10071691 3300025924 Bacteria 2707
800 Ga0207694_10405997 3300025924 Bacteria 1133
801 Ga0207650_10000010 3300025925 Bacteria 454110
802 Ga0207650_10001243 3300025925 Bacteria 18523
803 Ga0207650_10603065 3300025925 Bacteria 923
804 Ga0207659_10000831 3300025926 Bacteria 18326
805 Ga0207687_10015252 3300025927 Bacteria 5035
806 Ga0207687_10268305 3300025927 Bacteria 1363
807 Ga0207687_10323474 3300025927 Bacteria 1249
808 Ga0207687_10324228 3300025927 Bacteria 1248
809 Ga0207687_10345839 3300025927 Bacteria 1210
810 Ga0207700_10014164 3300025928 Bacteria 5217
811 Ga0207644_10000285 3300025931 Bacteria 33388
812 Ga0207644_10001068 3300025931 Bacteria 17518
813 Ga0207644_10080345 3300025931 Unclassified 2408
814 Ga0207644_10109564 3300025931 Bacteria 2086
815 Ga0207644_10268626 3300025931 Bacteria 1366
816 Ga0207690_10002228 3300025932 Bacteria 11822
817 Ga0207690_10011176 3300025932 Bacteria 5358
818 Ga0207690_10036252 3300025932 Bacteria 3192
819 Ga0207690_10045184 3300025932 Bacteria 2908
820 Ga0207690_10275600 3300025932 Bacteria 1308
821 Ga0207706_10032261 3300025933 Bacteria 4665
822 Ga0207706_10166685 3300025933 Bacteria 1936
823 Ga0207706_10211548 3300025933 Bacteria 1700
824 Ga0207706_10263151 3300025933 Bacteria 1505
825 Ga0207706_10313566 3300025933 Bacteria 1365
826 Ga0207686_10000008 3300025934 Bacteria 245575
827 Ga0207686_10000463 3300025934 Bacteria 26873
828 Ga0207686_10009014 3300025934 Bacteria 5401
829 Ga0207686_10016548 3300025934 Bacteria 4139
830 Ga0207686_10053520 3300025934 Bacteria 2524
831 Ga0207686_10312709 3300025934 Bacteria 1171
832 Ga0207709_10000025 3300025935 Bacteria 364795
833 Ga0207709_10000493 3300025935 Bacteria 35663
834 Ga0207709_10001939 3300025935 Bacteria 13588
835 Ga0207709_10003815 3300025935 Bacteria 8847
836 Ga0207709_10035958 3300025935 Bacteria 2932
837 Ga0207709_10190844 3300025935 Bacteria 1455
838 Ga0207670_10000695 3300025936 Bacteria 17783
839 Ga0207670_10004103 3300025936 Bacteria 7799
840 Ga0207670_10064713 3300025936 Bacteria 2507
841 Ga0207670_10115390 3300025936 Bacteria 1942
842 Ga0207670_10152603 3300025936 Bacteria 1716
843 Ga0207669_10000390 3300025937 Bacteria 19429
844 Ga0207704_10000842 3300025938 Bacteria 13606
845 Ga0207704_10087011 3300025938 Bacteria 2040
846 Ga0207704_10094645 3300025938 Bacteria 1973
847 Ga0207704_10761095 3300025938 Bacteria 806
848 Ga0207665_10013886 3300025939 Bacteria 5296
849 Ga0207665_10253016 3300025939 Bacteria 1302
850 Ga0207691_10000371 3300025940 Bacteria 45123
851 Ga0207691_10046619 3300025940 Bacteria 3981
852 Ga0207691_10066790 3300025940 Bacteria 3253
853 Ga0207691_10272142 3300025940 Bacteria 1458
854 Ga0207691_10286898 3300025940 Bacteria 1416
855 Ga0207711_10000513 3300025941 Bacteria 39782
856 Ga0207711_10006144 3300025941 Bacteria 10148
857 Ga0207711_10008004 3300025941 Bacteria 8842
858 Ga0207711_10017397 3300025941 Bacteria 5973
859 Ga0207711_10077141 3300025941 Bacteria 2904
860 Ga0207711_10095914 3300025941 Bacteria 2617
861 Ga0207711_10195015 3300025941 Bacteria 1847
862 Ga0207689_10002310 3300025942 Bacteria 17860
863 Ga0207689_10022079 3300025942 Bacteria 5352
864 Ga0207689_10027470 3300025942 Bacteria 4763
865 Ga0207689_10047194 3300025942 Bacteria 3558
866 Ga0207689_10094886 3300025942 Bacteria 2450
867 Ga0207689_10098748 3300025942 Bacteria 2399
868 Ga0207689_10149553 3300025942 Bacteria 1925
869 Ga0207689_10226814 3300025942 Unclassified 1544
870 Ga0207689_10309475 3300025942 Bacteria 1310
871 Ga0207661_10002789 3300025944 Bacteria 12046
872 Ga0207661_10386847 3300025944 Bacteria 1267
873 Ga0207679_10000102 3300025945 Bacteria 70199
874 Ga0207679_10000425 3300025945 Bacteria 30008
875 Ga0207679_10026299 3300025945 Bacteria 4011
876 Ga0207679_10239496 3300025945 Bacteria 1537
877 Ga0207679_10311808 3300025945 Bacteria 1360
878 Ga0207679_10348756 3300025945 Bacteria 1290
879 Ga0207679_10419024 3300025945 Bacteria 1181
880 Ga0207667_10006351 3300025949 Bacteria 14330
881 Ga0207667_10010676 3300025949 Bacteria 10720
882 Ga0207667_10017409 3300025949 Bacteria 8089
883 Ga0207667_10086548 3300025949 Bacteria 3243
884 Ga0207667_10093626 3300025949 Bacteria 3103
885 Ga0207667_10133566 3300025949 Bacteria 2556
886 Ga0207667_10195728 3300025949 Bacteria 2074
887 Ga0207667_10272149 3300025949 Bacteria 1731
888 Ga0207651_10000093 3300025960 Bacteria 39865
889 Ga0207651_10001385 3300025960 Bacteria 10984
890 Ga0207651_10125775 3300025960 Bacteria 1953
891 Ga0207651_10132730 3300025960 Bacteria 1909
892 Ga0207712_10000408 3300025961 Bacteria 36889
893 Ga0207712_10001464 3300025961 Bacteria 16101
894 Ga0207712_10171804 3300025961 Bacteria 1695
895 Ga0207712_10196151 3300025961 Bacteria 1597
896 Ga0207712_10224990 3300025961 Bacteria 1502
897 Ga0207712_10287102 3300025961 Bacteria 1345
898 Ga0207668_10000060 3300025972 Bacteria 89732
899 Ga0207668_10000798 3300025972 Bacteria 19311
900 Ga0207668_10279507 3300025972 Bacteria 1368
901 Ga0207640_10000598 3300025981 Bacteria 21453
902 Ga0207640_10007397 3300025981 Bacteria 6061
903 Ga0207640_10099808 3300025981 Bacteria 2032
904 Ga0207640_10126128 3300025981 Bacteria 1843
905 Ga0207640_10139361 3300025981 Bacteria 1766
906 Ga0207640_10242125 3300025981 Bacteria 1394
907 Ga0207640_10396827 3300025981 Bacteria 1122
908 Ga0207658_10001648 3300025986 Bacteria 17064
909 Ga0207658_10016124 3300025986 Bacteria 5133
910 Ga0207658_10023732 3300025986 Bacteria 4284
911 Ga0207658_10025324 3300025986 Bacteria 4154
912 Ga0207658_10036943 3300025986 Bacteria 3505
913 Ga0207658_10577090 3300025986 Bacteria 1008
914 Ga0207677_10000456 3300026023 Bacteria 27537
915 Ga0207677_10051529 3300026023 Bacteria 2791
916 Ga0207677_10201657 3300026023 Bacteria 1582
917 Ga0207703_10000384 3300026035 Bacteria 47335
918 Ga0207703_10000867 3300026035 Bacteria 29660
919 Ga0207703_10045116 3300026035 Bacteria 3545
920 Ga0207703_10050255 3300026035 Bacteria 3374
921 Ga0207703_10285496 3300026035 Bacteria 1500
922 Ga0207703_10473076 3300026035 Bacteria 1173
923 Ga0207639_10003324 3300026041 Bacteria 10825
924 Ga0207639_10004761 3300026041 Bacteria 9144
925 Ga0207639_10012411 3300026041 Bacteria 5931
926 Ga0207639_10014309 3300026041 Bacteria 5576
927 Ga0207639_10750963 3300026041 Bacteria 907
928 Ga0207678_10000100 3300026067 Bacteria 70537
929 Ga0207678_10002390 3300026067 Bacteria 17041
930 Ga0207678_10010485 3300026067 Bacteria 8138
931 Ga0207678_10040568 3300026067 Bacteria 4037
932 Ga0207678_10047821 3300026067 Bacteria 3699
933 Ga0207678_10446371 3300026067 Bacteria 1124
934 Ga0207678_10561183 3300026067 Bacteria 999
935 Ga0207708_10001694 3300026075 Bacteria 16322
936 Ga0207708_10023885 3300026075 Bacteria 4623
937 Ga0207708_10028396 3300026075 Bacteria 4237
938 Ga0207708_10085114 3300026075 Bacteria 2432
939 Ga0207708_10102988 3300026075 Bacteria 2211
940 Ga0207708_10153194 3300026075 Bacteria 1817
941 Ga0207702_10003152 3300026078 Bacteria 15271
942 Ga0207702_10167061 3300026078 Bacteria 2014
943 Ga0207702_10181949 3300026078 Bacteria 1936
944 Ga0207702_10243222 3300026078 Bacteria 1687
945 Ga0207702_10305491 3300026078 Bacteria 1511
946 Ga0207702_10705024 3300026078 Bacteria 995
947 Ga0207641_10001449 3300026088 Bacteria 23273
948 Ga0207641_10057795 3300026088 Bacteria 3300
949 Ga0207641_10083361 3300026088 Bacteria 2780
950 Ga0207641_10115170 3300026088 Bacteria 2390
951 Ga0207641_10209104 3300026088 Bacteria 1803
952 Ga0207641_10359365 3300026088 Bacteria 1390
953 Ga0207648_10002737 3300026089 Bacteria 18733
954 Ga0207648_10008878 3300026089 Bacteria 9676
955 Ga0207648_10065955 3300026089 Bacteria 3157
956 Ga0207648_10173974 3300026089 Bacteria 1904
957 Ga0207648_10206900 3300026089 Bacteria 1741
958 Ga0207648_10303271 3300026089 Bacteria 1433
959 Ga0207648_10738430 3300026089 Bacteria 914
960 Ga0207676_10001221 3300026095 Bacteria 19155
961 Ga0207676_10019238 3300026095 Bacteria 4978
962 Ga0207676_10024955 3300026095 Bacteria 4431
963 Ga0207676_10032052 3300026095 Bacteria 3957
964 Ga0207676_10313320 3300026095 Bacteria 1437
965 Ga0207676_10725031 3300026095 Bacteria 965
966 Ga0207674_10000671 3300026116 Bacteria 44489
967 Ga0207674_10002399 3300026116 Bacteria 23688
968 Ga0207674_10029109 3300026116 Bacteria 5821
969 Ga0207674_10088526 3300026116 Bacteria 3089
970 Ga0207674_10153778 3300026116 Bacteria 2256
971 Ga0207674_10164935 3300026116 Bacteria 2169
972 Ga0207674_10174661 3300026116 Bacteria 2101
973 Ga0207674_10266209 3300026116 Bacteria 1661
974 Ga0207674_10568106 3300026116 Bacteria 1096
975 Ga0207675_100001958 3300026118 Bacteria 20583
976 Ga0207675_100002014 3300026118 Bacteria 20259
977 Ga0207675_100012425 3300026118 Bacteria 7956
978 Ga0207675_100143234 3300026118 Bacteria 2271
979 Ga0207675_100447650 3300026118 Bacteria 1279
980 Ga0207675_100637354 3300026118 Bacteria 1071
981 Ga0207683_10000375 3300026121 Bacteria 41120
982 Ga0207683_10021422 3300026121 Bacteria 5534
983 Ga0207683_10087003 3300026121 Bacteria 2779
984 Ga0207683_10130809 3300026121 Bacteria 2257
985 Ga0207683_10341395 3300026121 Bacteria 1373
986 Ga0207683_10680892 3300026121 Bacteria 953
987 Ga0207698_10000755 3300026142 Bacteria 18774
988 Ga0207698_10008764 3300026142 Bacteria 6415
989 Ga0207698_10021968 3300026142 Bacteria 4423
990 Ga0207698_10142014 3300026142 Bacteria 2070
991 Ga0207698_10400789 3300026142 Bacteria 1311
992 Ga0207698_10599607 3300026142 Bacteria 1086
993 Ga0207698_10795302 3300026142 Bacteria 948
994 Ga0209281_1000580 3300027111 Bacteria 43078
995 Ga0209588_1109662 3300027671 Unclassified 887
996 Ga0209813_10039879 3300027866 Bacteria 1425
997 Ga0207428_10013505 3300027907 Bacteria 7131
998 Ga0207428_10425070 3300027907 Bacteria 971
999 Ga0268266_10002601 3300028379 Bacteria 19127
1000 Ga0268266_10176790 3300028379 Bacteria 1941
1001 Ga0268266_10334851 3300028379 Bacteria 1419
1002 Ga0268266_10705925 3300028379 Bacteria 972
1003 Ga0268265_10001155 3300028380 Bacteria 23203
1004 Ga0268265_10041099 3300028380 Bacteria 3419
1005 Ga0268265_10087003 3300028380 Bacteria 2485
1006 Ga0268265_10132990 3300028380 Bacteria 2071
1007 Ga0268265_10837196 3300028380 Bacteria 899
1008 Ga0268264_10000938 3300028381 Bacteria 30247
1009 Ga0268264_10006852 3300028381 Bacteria 9564
1010 Ga0268264_10013722 3300028381 Bacteria 6670
1011 Ga0268264_10048036 3300028381 Bacteria 3549
1012 Ga0268264_10059751 3300028381 Unclassified 3194
1013 Ga0268264_10095284 3300028381 Bacteria 2575
1014 Ga0268264_10176763 3300028381 Bacteria 1935
1015 Ga0268264_10317674 3300028381 Bacteria 1471
1016 Ga0268264_10410677 3300028381 Bacteria 1303
1017 Ga0265337_1011859 3300028556 Bacteria 2987
1018 Ga0265337_1027974 3300028556 Bacteria 1696
1019 Ga0265326_10002848 3300028558 Bacteria 5776
1020 Ga0265319_1002530 3300028563 Bacteria 9901
1021 Ga0265319_1027664 3300028563 Bacteria 2008
1022 Ga0265334_10002924 3300028573 Bacteria 7831
1023 Ga0265334_10064086 3300028573 Bacteria 1381
1024 Ga0265318_10000015 3300028577 Bacteria 187234
1025 Ga0265318_10001067 3300028577 Bacteria 17279
1026 Ga0265318_10107796 3300028577 Bacteria 1024
1027 Ga0265322_10039179 3300028654 Unclassified 1348
1028 Ga0265336_10096874 3300028666 Bacteria 879
1029 Ga0265338_10001151 3300028800 Bacteria 43728
1030 Ga0265338_10020696 3300028800 Bacteria 6904
1031 Ga0265338_10023976 3300028800 Bacteria 6250
1032 Ga0265338_10035877 3300028800 Bacteria 4755
1033 Ga0265338_10128359 3300028800 Bacteria 2007
1034 Ga0265338_10133069 3300028800 Bacteria 1960
1035 Ga0265338_10327454 3300028800 Bacteria 1107
1036 Ga0265762_1004498 3300030760 Bacteria 2495
1037 Ga0265762_1008314 3300030760 Unclassified 1846
1038 Ga0265765_1005577 3300030879 Bacteria 1321
1039 Ga0265760_10034992 3300031090 Bacteria 1486
1040 Ga0265328_10079421 3300031239 Bacteria 1209
1041 Ga0265320_10017283 3300031240 Bacteria 4011
1042 Ga0265320_10079449 3300031240 Bacteria 1533
1043 Ga0265320_10081828 3300031240 Bacteria 1506
1044 Ga0265320_10215209 3300031240 Bacteria 856
1045 Ga0265325_10001084 3300031241 Bacteria 19604
1046 Ga0265325_10089163 3300031241 Bacteria 1523
1047 Ga0265325_10098895 3300031241 Bacteria 1430
1048 Ga0265325_10188254 3300031241 Bacteria 958
1049 Ga0265340_10003394 3300031247 Bacteria 8994
1050 Ga0265340_10089159 3300031247 Bacteria 1444
1051 Ga0265340_10144329 3300031247 Bacteria 1088
1052 Ga0265339_10000685 3300031249 Bacteria 26127
1053 Ga0265339_10007974 3300031249 Bacteria 6792
1054 Ga0265339_10015979 3300031249 Bacteria 4485
1055 Ga0265339_10032527 3300031249 Bacteria 2941
1056 Ga0265339_10040343 3300031249 Bacteria 2595
1057 Ga0265339_10223758 3300031249 Bacteria 919
1058 Ga0265331_10000102 3300031250 Bacteria 115584
1059 Ga0265331_10033783 3300031250 Bacteria 2528
1060 Ga0265316_10022216 3300031344 Bacteria 5357
1061 Ga0265316_10082428 3300031344 Unclassified 2464
1062 Ga0265316_10086431 3300031344 Bacteria 2397
1063 Ga0265316_10143833 3300031344 Bacteria 1790
1064 Ga0265316_10173427 3300031344 Bacteria 1608
1065 Ga0265316_10240214 3300031344 Unclassified 1332
1066 Ga0307408_100089283 3300031548 Bacteria 2323
1067 Ga0265313_10000865 3300031595 Bacteria 30547
1068 Ga0307508_10196223 3300031616 Bacteria 1620
1069 Ga0316575_10001077 3300031665 Bacteria 8500
1070 Ga0316575_10011041 3300031665 Bacteria 3333
1071 Ga0316575_10050339 3300031665 Bacteria 1659
1072 Ga0316575_10165460 3300031665 Bacteria 915
1073 Ga0316579_10038435 3300031691 Bacteria 2213
1074 Ga0316579_10091232 3300031691 Bacteria 1455
1075 Ga0265314_10000258 3300031711 Bacteria 77755
1076 Ga0265314_10060363 3300031711 Bacteria 2588
1077 Ga0265314_10114059 3300031711 Bacteria 1712
1078 Ga0265314_10161977 3300031711 Bacteria 1360
1079 Ga0265314_10310288 3300031711 Bacteria 881
1080 Ga0265342_10001056 3300031712 Bacteria 26936
1081 Ga0265342_10007754 3300031712 Bacteria 7812
1082 Ga0265342_10035673 3300031712 Bacteria 3043
1083 Ga0265342_10165782 3300031712 Bacteria 1219
1084 Ga0265342_10238253 3300031712 Unclassified 975
1085 Ga0316576_10001112 3300031727 Bacteria 14055
1086 Ga0316576_10033327 3300031727 Bacteria 3665
1087 Ga0316576_10083745 3300031727 Bacteria 2370
1088 Ga0316576_10099442 3300031727 Bacteria 2173
1089 Ga0316576_10143290 3300031727 Bacteria 1799
1090 Ga0316576_10248342 3300031727 Bacteria 1336
1091 Ga0316578_10011768 3300031728 Bacteria 4593
1092 Ga0316578_10044301 3300031728 Bacteria 2588
1093 Ga0316578_10054356 3300031728 Bacteria 2348
1094 Ga0316578_10129128 3300031728 Bacteria 1520
1095 Ga0316578_10186846 3300031728 Bacteria 1248
1096 Ga0316578_10230492 3300031728 Bacteria 1112
1097 Ga0307405_10102765 3300031731 Bacteria 1920
1098 Ga0316577_10008546 3300031733 Bacteria 5492
1099 Ga0316577_10014688 3300031733 Bacteria 4302
1100 Ga0316577_10020005 3300031733 Bacteria 3708
1101 Ga0316577_10038969 3300031733 Bacteria 2659
1102 Ga0307413_10157747 3300031824 Bacteria 1590
1103 Ga0307413_10167609 3300031824 Bacteria 1551
1104 Ga0307410_10147722 3300031852 Bacteria 1746
1105 Ga0307410_10181137 3300031852 Bacteria 1595
1106 Ga0307410_10222037 3300031852 Bacteria 1454
1107 Ga0307410_10435769 3300031852 Bacteria 1066
1108 Ga0307406_10031996 3300031901 Bacteria 3207
1109 Ga0307406_10170919 3300031901 Bacteria 1573
1110 Ga0307409_100109755 3300031995 Bacteria 2310
1111 Ga0307409_100394241 3300031995 Bacteria 1320
1112 Ga0307409_100395838 3300031995 Bacteria 1318
1113 Ga0307416_100243039 3300032002 Bacteria 1746
1114 Ga0307414_10008080 3300032004 Bacteria 5944
1115 Ga0307414_10299504 3300032004 Bacteria 1360
1116 Ga0307411_10120154 3300032005 Bacteria 1899
1117 Ga0307411_10423843 3300032005 Bacteria 1106
1118 Ga0307415_100033995 3300032126 Bacteria 3314
1119 Ga0307415_100510014 3300032126 Unclassified 1053
1120 Ga0316583_10007407 3300032133 Bacteria 3951
1121 Ga0316585_10019994 3300032137 Bacteria 2046
1122 Ga0316593_10005355 3300032168 Bacteria 3376
1123 Ga0316593_10010568 3300032168 Bacteria 2651
1124 Ga0316593_10013111 3300032168 Bacteria 2447
1125 Ga0316593_10020510 3300032168 Bacteria 2056
1126 Ga0316593_10057683 3300032168 Bacteria 1322
1127 Ga0316593_10062211 3300032168 Bacteria 1278
1128 Ga0316596_1011731 3300033541 Bacteria 2147
1129 Ga0316596_1024299 3300033541 Bacteria 1556
1130 Ga0373930_0011932 3300034816 Bacteria 1576
1131 Ga0373941_0001589 3300035115 Bacteria 4830
1132 Ga0373941_0037090 3300035115 Bacteria 1486
1133 Ga0373945_0033785 3300035116 Bacteria 1820
1134 Ga0373956_0387337 3300035119 Bacteria 667
1135 Ga0373943_0049967 3300035170 Bacteria 2054
1136 Ga0373946_0093571 3300035171 Bacteria 1336
1137 Ga0316574_0000439 3300035398 Bacteria 16537
1138 Ga0316574_0017026 3300035398 Bacteria 4244
1139 Ga0316574_0100775 3300035398 Bacteria 1848
1140 Ga0373931_0040463 3300035691 Bacteria 2446
1141 Ga0373931_0068199 3300035691 Bacteria 1935
1142 Ga0373935_0037988 3300035692 Bacteria 3013
1143 Ga0373935_0052142 3300035692 Bacteria 2600
1144 Ga0373927_0044672 3300035695 Bacteria 2866
1145 Ga0373937_0005450 3300036401 Bacteria 10892
1146 Ga0373937_0047707 3300036401 Bacteria 3920
1147 Ga0373937_0547774 3300036401 Bacteria 1099
1148 Ga0316582_0020619 3300036647 Bacteria 3880
1149 Ga0316582_0025596 3300036647 Bacteria 3545
1150 Ga0316582_0053359 3300036647 Bacteria 2571
1151 Ga0316582_0148054 3300036647 Bacteria 1586
1152 Ga0316582_0318950 3300036647 Bacteria 1068
1153 Ga0316582_0388358 3300036647 Bacteria 961
1154 Ga0316584_0001402 3300036712 Bacteria 14393
1155 Ga0316584_0003289 3300036712 Bacteria 10458
1156 Ga0316584_0003840 3300036712 Bacteria 9850
1157 Ga0316584_0003883 3300036712 Bacteria 9806
1158 Ga0316584_0011924 3300036712 Bacteria 6123
1159 Ga0316584_0023348 3300036712 Bacteria 4519
1160 Ga0316584_0023535 3300036712 Bacteria 4499
1161 Ga0316584_0195144 3300036712 Bacteria 1496
1162 Ga0316584_0562059 3300036712 Bacteria 795
1163 Ga0373925_0207428 3300037068 Bacteria 1560
1164 Ga0373925_0222760 3300037068 Bacteria 1506
1165 Ga0395899_0012908 3300037312 Bacteria 6393
1166 Ga0395899_0070048 3300037312 Bacteria 2567
1167 Ga0395899_0486162 3300037312 Bacteria 803
1168 Ga0395900_0025391 3300037418 Bacteria 6066
1169 Ga0395900_0140129 3300037418 Bacteria 2477
1170 Ga0395900_0181520 3300037418 Bacteria 2138
1171 Ga0395900_0196989 3300037418 Bacteria 2040
1172 Ga0395900_0415781 3300037418 Bacteria 1306
1173 Ga0395900_0733914 3300037418 Bacteria 919
1174 Ga0395900_0836032 3300037418 Bacteria 847
1175 Ga0395898_0080689 3300037466 Bacteria 3137
1176 Ga0395898_0125664 3300037466 Bacteria 2457
1177 Ga0395898_0162225 3300037466 Bacteria 2138
1178 Ga0395898_0193157 3300037466 Bacteria 1945
1179 Ga0395898_0636552 3300037466 Bacteria 1009
1180 Ga0395905_0000911 3300037471 Bacteria 38191
1181 Ga0395905_0006827 3300037471 Bacteria 11423
1182 Ga0395905_0008081 3300037471 Bacteria 10392
1183 Ga0395905_0040992 3300037471 Bacteria 4344
1184 Ga0395905_0052360 3300037471 Bacteria 3821
1185 Ga0395905_0171218 3300037471 Bacteria 2040
1186 Ga0395905_0227978 3300037471 Bacteria 1742
1187 Ga0395905_0299862 3300037471 Bacteria 1494
1188 Ga0395905_0316347 3300037471 Bacteria 1450
1189 Ga0395905_0860694 3300037471 Bacteria 809
1190 Ga0316581_0004894 3300037588 Bacteria 3450
1191 Ga0316581_0018084 3300037588 Bacteria 2043
1192 Ga0436364_0003086 3300037853 Bacteria 2692
1193 Ga0436364_0079644 3300037853 Bacteria 315114
1194 Ga0436364_0207864 3300037853 Bacteria 4093
1195 Ga0436364_0310410 3300037853 Bacteria 6647
1196 Ga0436364_0374781 3300037853 Bacteria 2708
1197 Ga0436364_0517934 3300037853 Bacteria 2665
1198 Ga0436364_0545736 3300037853 Bacteria 12413
1199 Ga0436364_0598581 3300037853 Bacteria 1322
1200 Ga0436364_0635932 3300037853 Bacteria 1196
1201 Ga0436364_0653298 3300037853 Bacteria 1171
1202 Ga0436364_0935450 3300037853 Unclassified 2024
1203 Ga0436364_1040205 3300037853 Bacteria 1666
1204 Ga0436364_1113697 3300037853 Bacteria 5886
1205 Ga0436364_1161322 3300037853 Bacteria 4503
1206 Ga0436364_1291049 3300037853 Bacteria 3015
1207 Ga0436364_1366309 3300037853 Bacteria 1860
1208 Ga0395901_0006071 3300038443 Bacteria 12242
1209 Ga0395901_0094751 3300038443 Bacteria 3128
1210 Ga0395901_0109329 3300038443 Bacteria 2902
1211 Ga0395901_0205365 3300038443 Bacteria 2064
1212 Ga0395901_0695327 3300038443 Bacteria 1015
1213 Ga0400484_42049 3300038725 Bacteria 3922
1214 Ga0400490_04614 3300038726 Bacteria 12566
1215 Ga0400490_13335 3300038726 Bacteria 8774
1216 Ga0400486_07680 3300038742 Bacteria 16080
1217 Ga0400483_195000 3300039062 Bacteria 103610
1218 Ga0400483_278927 3300039062 Bacteria 1901
1219 Ga0436365_0227260 3300039437 Bacteria 4977
1220 Ga0436365_0283204 3300039437 Bacteria 28751
1221 Ga0436365_0421852 3300039437 Bacteria 162876
1222 Ga0436365_0426125 3300039437 Bacteria 1963
1223 Ga0436365_0847170 3300039437 Bacteria 1144
1224 Ga0436365_0935686 3300039437 Bacteria 2770
1225 Ga0436365_0994234 3300039437 Bacteria 49963
1226 Ga0436365_1114212 3300039437 Bacteria 2342
1227 Ga0436365_1132500 3300039437 Bacteria 1715
1228 Ga0436365_1397674 3300039437 Bacteria 2110
1229 Ga0436365_1422517 3300039437 Bacteria 874
1230 Ga0436365_1595370 3300039437 Bacteria 63808
1231 Ga0436365_1779432 3300039437 Bacteria 5390
1232 Ga0436360_0295164 3300039438 Bacteria 14242
1233 Ga0436360_0355578 3300039438 Bacteria 1182
1234 Ga0436360_0413033 3300039438 Bacteria 1384
1235 Ga0436360_0459232 3300039438 Bacteria 3214
1236 Ga0436360_0587385 3300039438 Bacteria 965
1237 Ga0436361_0073402 3300039447 Bacteria 1508
1238 Ga0436363_0096334 3300039450 Bacteria 850
1239 Ga0436363_0162148 3300039450 Bacteria 3683
1240 Ga0436363_0171561 3300039450 Bacteria 925
1241 Ga0436363_0222055 3300039450 Bacteria 2207
1242 Ga0436363_0516425 3300039450 Bacteria 5850
1243 Ga0436363_0550052 3300039450 Bacteria 837
1244 Ga0436363_0849922 3300039450 Bacteria 1309
1245 Ga0436362_0315526 3300039453 Bacteria 1702
1246 Ga0436362_0605469 3300039453 Bacteria 2595
1247 Ga0436362_0735076 3300039453 Bacteria 999
1248 Ga0436362_0764253 3300039453 Bacteria 1191
1249 Ga0436362_0808991 3300039453 Bacteria 4956
1250 Ga0439433_0080256 3300041999 Bacteria 793
1251 Ga0439448_0015703 3300042005 Bacteria 2297
1252 Ga0439458_0072768 3300042157 Bacteria 869
1253 Ga0439458_0126685 3300042157 Bacteria 675
1254 Ga0439434_0082002 3300042435 Bacteria 1024
1255 Ga0451577_0001956 3300042876 Bacteria 25985
1256 Ga0451577_0121152 3300042876 Bacteria 2343
1257 Ga0451577_0175909 3300042876 Bacteria 1929
1258 Ga0451577_0446006 3300042876 Bacteria 1175
1259 Ga0451577_0710005 3300042876 Bacteria 910
1260 Ga0451577_0737711 3300042876 Bacteria 891
1261 Ga0466969_0006535 3300044656 Bacteria 6203
1262 Ga0466972_0086629 3300044658 Bacteria 1488
1263 Ga0453683_0000118 3300044673 Bacteria 117158
1264 Ga0453683_0000280 3300044673 Bacteria 66926
1265 Ga0453683_0000891 3300044673 Bacteria 28627
1266 Ga0453683_0001047 3300044673 Bacteria 25702
1267 Ga0453683_0005938 3300044673 Bacteria 8425
1268 Ga0453683_0027559 3300044673 Bacteria 3602
1269 Ga0453683_0075393 3300044673 Bacteria 2112
1270 Ga0453683_0150042 3300044673 Bacteria 1473
1271 Ga0453683_0256609 3300044673 Bacteria 1115
1272 Ga0466966_0007455 3300044684 Bacteria 7256
1273 Ga0466963_0075224 3300044694 Bacteria 2279
1274 Ga0453684_0000829 3300044712 Bacteria 104404
1275 Ga0453684_0005096 3300044712 Bacteria 26493
1276 Ga0453684_0022082 3300044712 Bacteria 9465
1277 Ga0453684_0028475 3300044712 Bacteria 7967
1278 Ga0453684_0050873 3300044712 Bacteria 5442
1279 Ga0453684_0052888 3300044712 Bacteria 5305
1280 Ga0453684_0064823 3300044712 Bacteria 4663
1281 Ga0453684_0073587 3300044712 Bacteria 4306
1282 Ga0453684_0080822 3300044712 Bacteria 4057
1283 Ga0453684_0084451 3300044712 Bacteria 3948
1284 Ga0453684_0178157 3300044712 Bacteria 2498
1285 Ga0453684_0196101 3300044712 Bacteria 2358
1286 Ga0453684_0231434 3300044712 Bacteria 2133
1287 Ga0453684_0291175 3300044712 Bacteria 1859
1288 Ga0453684_0360342 3300044712 Bacteria 1637
1289 Ga0453684_0523887 3300044712 Bacteria 1309
1290 Ga0466971_0010408 3300044719 Bacteria 4064
1291 Ga0466968_0211427 3300044735 Bacteria 911
1292 Ga0466970_0237370 3300044765 Bacteria 1020
1293 Ga0466957_0001594 3300044842 Bacteria 11920
1294 Ga0466957_0178423 3300044842 Bacteria 1386
1295 Ga0466959_0007114 3300045049 Bacteria 7828
1296 Ga0466959_0015161 3300045049 Bacteria 5614
1297 Ga0451576_0000001 3300045051 Bacteria 1802108
1298 Ga0451576_0000019 3300045051 Bacteria 545863
1299 Ga0451576_0000213 3300045051 Bacteria 144536
1300 Ga0451576_0001202 3300045051 Bacteria 46283
1301 Ga0451576_0012429 3300045051 Bacteria 9562
1302 Ga0451576_0016088 3300045051 Bacteria 8263
1303 Ga0451576_0024883 3300045051 Bacteria 6460
1304 Ga0451576_0036606 3300045051 Bacteria 5201
1305 Ga0451576_0094400 3300045051 Bacteria 3111
1306 Ga0451576_0170485 3300045051 Bacteria 2272
1307 Ga0451576_0775981 3300045051 Bacteria 1007
1308 Ga0451576_0875787 3300045051 Bacteria 942
1309 Ga0451576_1066620 3300045051 Bacteria 846
1310 Ga0466958_0004041 3300045836 Bacteria 7691
1311 Ga0466958_0010957 3300045836 Bacteria 5094
1312 Ga0466967_0061444 3300045976 Bacteria 3333
1313 Ga0466967_0353804 3300045976 Bacteria 1422
1314 Ga0495627_000443 3300046453 Bacteria 36101
1315 Ga0495592_0044537 3300046454 Unclassified 3315
1316 Ga0495603_0047372 3300046455 Bacteria 2560
1317 Ga0495629_0235070 3300046459 Bacteria 1263
1318 Ga0495580_0193675 3300046472 Bacteria 1402
1319 Ga0495662_0193291 3300046476 Unclassified 1003
1320 Ga0495584_0011661 3300046491 Bacteria 4499
1321 Ga0495583_0000020 3300046506 Bacteria 296185
1322 Ga0495606_0037111 3300046507 Bacteria 3311
1323 Ga0495608_0027558 3300046511 Bacteria 3865
1324 Ga0495610_0040933 3300046512 Bacteria 2330
1325 Ga0495618_0202566 3300046514 Bacteria 1256
1326 Ga0495628_0288816 3300046516 Bacteria 1216
1327 Ga0495630_0560077 3300046517 Unclassified 876
1328 Ga0495632_0015594 3300046519 Bacteria 4250
1329 Ga0495643_0080866 3300046522 Bacteria 1690
1330 Ga0495648_0101400 3300046524 Bacteria 1588
1331 Ga0495640_0400802 3300046533 Bacteria 842
1332 Ga0495598_0007838 3300046537 Bacteria 2466
1333 Ga0495621_0005527 3300046539 Bacteria 3636
1334 Ga0495597_0048524 3300046542 Bacteria 1878
1335 Ga0495645_0200046 3300046543 Bacteria 1356
1336 Ga0495622_0002426 3300046557 Bacteria 9051
1337 Ga0495633_0152475 3300046558 Bacteria 1067
1338 Ga0495668_0209532 3300046616 Bacteria 1067
1339 Ga0495625_0026301 3300046660 Bacteria 4399
1340 Ga0495625_0403083 3300046660 Bacteria 854
1341 Ga0495599_0259220 3300046678 Bacteria 1057
1342 Ga0495658_0429262 3300046683 Bacteria 843
1343 Ga0495669_0030631 3300046684 Bacteria 2362
1344 Ga0495669_0158264 3300046684 Bacteria 1074
1345 Ga0495670_0000265 3300046691 Bacteria 24414
1346 Ga0495604_0187267 3300047317 Bacteria 1444
1347 Ga0495636_0111664 3300047318 Bacteria 1203
1348 Ga0495672_0071022 3300047320 Bacteria 1971
1349 Ga0495683_0053018 3300047323 Bacteria 2023
1350 Ga0495681_0011264 3300047470 Bacteria 5340
1351 Ga0495684_0144711 3300047471 Bacteria 1781
1352 Ga0495686_0170494 3300047472 Bacteria 1266
1353 Ga0495593_0041920 3300047673 Bacteria 2459
1354 Ga0495593_0066861 3300047673 Bacteria 1872
1355 Ga0495602_0014256 3300048088 Bacteria 8076
1356 Ga0496100_0039379 3300048903 Bacteria 3002
1357 Ga0496100_0064222 3300048903 Bacteria 2428
1358 Ga0496100_0136829 3300048903 Bacteria 1731
1359 Ga0496100_0142886 3300048903 Bacteria 1698
1360 Ga0496101_0005585 3300048904 Bacteria 8030
1361 Ga0496101_0016841 3300048904 Bacteria 4947
1362 Ga0496101_0113614 3300048904 Bacteria 2041
1363 Ga0496101_0138124 3300048904 Bacteria 1856
1364 Ga0496102_0002747 3300048905 Bacteria 15004
1365 Ga0496102_0005255 3300048905 Bacteria 10995
1366 Ga0496102_0033196 3300048905 Bacteria 4637
1367 Ga0496102_0131609 3300048905 Bacteria 2342
1368 Ga0496102_0260303 3300048905 Bacteria 1636
1369 Ga0496102_0331589 3300048905 Bacteria 1433
1370 Ga0496103_0002057 3300048906 Bacteria 12872
1371 Ga0496103_0020842 3300048906 Bacteria 3941
1372 Ga0496103_0027204 3300048906 Bacteria 3464
1373 Ga0496104_0010951 3300048907 Bacteria 8114
1374 Ga0496104_0017799 3300048907 Bacteria 6479
1375 Ga0496104_0094192 3300048907 Bacteria 2865
1376 Ga0496104_0149079 3300048907 Bacteria 2246
1377 Ga0496104_0306260 3300048907 Bacteria 1501
1378 Ga0496104_0351283 3300048907 Bacteria 1387
1379 Ga0496104_0890781 3300048907 Bacteria 795
1380 Ga0496105_0008864 3300048908 Bacteria 7837
1381 Ga0496105_0044390 3300048908 Bacteria 3666
1382 Ga0496105_0172825 3300048908 Bacteria 1771
1383 Ga0496105_0268040 3300048908 Bacteria 1380
1384 Ga0496106_0004676 3300048909 Bacteria 10151
1385 Ga0496106_0005250 3300048909 Bacteria 9599
1386 Ga0496106_0020957 3300048909 Bacteria 4850
1387 Ga0496106_0069286 3300048909 Bacteria 2692
1388 Ga0496106_0133009 3300048909 Bacteria 1952
1389 Ga0496106_0177142 3300048909 Bacteria 1692
1390 Ga0496107_0001506 3300048910 Bacteria 14468
1391 Ga0496107_0006946 3300048910 Bacteria 7801
1392 Ga0496107_0055141 3300048910 Bacteria 2871
1393 Ga0496107_0062331 3300048910 Bacteria 2701
1394 Ga0496107_0128403 3300048910 Bacteria 1871
1395 Ga0496107_0236291 3300048910 Bacteria 1360
1396 Ga0496108_0013562 3300048911 Bacteria 6651
1397 Ga0496108_0032831 3300048911 Bacteria 4311
1398 Ga0496108_0037537 3300048911 Bacteria 4036
1399 Ga0496108_0076730 3300048911 Bacteria 2825
1400 Ga0496108_0098113 3300048911 Bacteria 2497
1401 Ga0496108_0299570 3300048911 Bacteria 1400
1402 Ga0496109_0006013 3300048912 Bacteria 10195
1403 Ga0496109_0020848 3300048912 Bacteria 5791
1404 Ga0496109_0027322 3300048912 Bacteria 5093
1405 Ga0496109_0116835 3300048912 Bacteria 2483
1406 Ga0496109_0151170 3300048912 Bacteria 2174
1407 Ga0496109_0164906 3300048912 Bacteria 2077
1408 Ga0496109_0533397 3300048912 Bacteria 1107
1409 Ga0496110_0042694 3300048913 Bacteria 3958
1410 Ga0496110_0087569 3300048913 Bacteria 2781
1411 Ga0496110_0116341 3300048913 Bacteria 2407
1412 Ga0496110_0168117 3300048913 Bacteria 1989
1413 Ga0496110_0638853 3300048913 Bacteria 964
1414 Ga0496111_0000242 3300048914 Bacteria 26131
1415 Ga0496111_0028631 3300048914 Bacteria 3949
1416 Ga0496112_0001235 3300048915 Bacteria 19294
1417 Ga0496112_0025166 3300048915 Bacteria 5712
1418 Ga0496112_0031568 3300048915 Bacteria 5140
1419 Ga0496112_0031888 3300048915 Bacteria 5114
1420 Ga0496112_0332913 3300048915 Bacteria 1462
1421 Ga0496112_0456462 3300048915 Bacteria 1215
1422 Ga0496112_0583431 3300048915 Bacteria 1050
1423 Ga0496113_0287318 3300048916 Bacteria 1315
1424 Ga0496114_0036337 3300048917 Bacteria 4072
1425 Ga0496114_0173980 3300048917 Bacteria 1877
1426 Ga0496114_0205853 3300048917 Bacteria 1725
1427 Ga0496114_0303375 3300048917 Bacteria 1410
1428 Ga0496115_0052518 3300048918 Bacteria 3270
1429 Ga0496115_0087400 3300048918 Bacteria 2544
1430 Ga0496117_0003941 3300048920 Bacteria 16793
1431 Ga0496118_0002145 3300048921 Bacteria 27524
1432 Ga0496118_0084428 3300048921 Bacteria 2215
1433 Ga0496119_0003925 3300048922 Bacteria 15085
1434 Ga0496119_0020238 3300048922 Bacteria 4861
1435 Ga0496119_0080829 3300048922 Bacteria 1874
1436 Ga0496119_0103005 3300048922 Bacteria 1599
1437 Ga0496119_0105036 3300048922 Bacteria 1578
1438 Ga0496119_0199427 3300048922 Bacteria 1037
1439 Ga0496120_0008156 3300048923 Bacteria 7682
1440 Ga0496120_0102441 3300048923 Bacteria 1510
1441 Ga0496121_0000009 3300048924 Bacteria 836971
1442 Ga0496121_0000751 3300048924 Bacteria 59594
1443 Ga0496121_0065751 3300048924 Bacteria 2948
1444 Ga0496121_0269258 3300048924 Bacteria 1172
1445 Ga0496122_0000025 3300048925 Bacteria 362915
1446 Ga0496122_0034633 3300048925 Bacteria 4128
1447 Ga0496122_0098694 3300048925 Bacteria 1960
1448 Ga0496123_0000054 3300048926 Bacteria 234046
1449 Ga0496123_0030694 3300048926 Bacteria 3928
1450 Ga0496124_0036426 3300048927 Bacteria 4291
1451 Ga0496124_0048353 3300048927 Bacteria 3635
1452 Ga0496124_0080967 3300048927 Bacteria 2671
1453 Ga0496125_0043147 3300048928 Bacteria 3833
1454 Ga0496125_0047369 3300048928 Bacteria 3596
1455 Ga0496125_0188098 3300048928 Bacteria 1367
1456 Ga0496126_0073247 3300048929 Bacteria 3045
1457 Ga0496126_0201568 3300048929 Bacteria 1680
1458 Ga0501293_007669 3300049516 Unclassified 897
1459 Ga0501296_002969 3300049519 Bacteria 1800
1460 Ga0501297_011866 3300049520 Bacteria 1006
1461 Ga0501298_005636 3300049521 Bacteria 2016
1462 Ga0501299_002465 3300049522 Bacteria 2562
1463 Ga0501031_0005703 3300049568 Bacteria 8115
1464 Ga0501031_0049069 3300049568 Bacteria 2750
1465 Ga0501031_0103948 3300049568 Bacteria 1854
1466 Ga0501031_0261108 3300049568 Bacteria 1125
1467 Ga0501031_0262297 3300049568 Bacteria 1122
1468 Ga0501032_0000064 3300049569 Bacteria 91971
1469 Ga0501032_0001600 3300049569 Bacteria 18059
1470 Ga0501032_0025086 3300049569 Bacteria 4110
1471 Ga0501032_0031757 3300049569 Bacteria 3620
1472 Ga0501032_0032937 3300049569 Bacteria 3551
1473 Ga0501032_0068479 3300049569 Bacteria 2369
1474 Ga0501032_0235317 3300049569 Bacteria 1191
1475 Ga0501032_0489339 3300049569 Bacteria 786
1476 Ga0501033_0000286 3300049570 Bacteria 48628
1477 Ga0501033_0002532 3300049570 Bacteria 15473
1478 Ga0501033_0016268 3300049570 Bacteria 5633
1479 Ga0501033_0020977 3300049570 Bacteria 4934
1480 Ga0501033_0045254 3300049570 Bacteria 3275
1481 Ga0501033_0088657 3300049570 Bacteria 2264
1482 Ga0501033_0093339 3300049570 Bacteria 2201
1483 Ga0501033_0116907 3300049570 Bacteria 1937
1484 Ga0501033_0143786 3300049570 Bacteria 1724
1485 Ga0501033_0192474 3300049570 Bacteria 1459
1486 Ga0501033_0206863 3300049570 Bacteria 1400
1487 Ga0501034_0000097 3300049571 Bacteria 161027
1488 Ga0501034_0000174 3300049571 Bacteria 119615
1489 Ga0501034_0002221 3300049571 Bacteria 23948
1490 Ga0501034_0002380 3300049571 Bacteria 22851
1491 Ga0501034_0022346 3300049571 Bacteria 6446
1492 Ga0501034_0024404 3300049571 Bacteria 6151
1493 Ga0501034_0076402 3300049571 Bacteria 3356
1494 Ga0501034_0083319 3300049571 Bacteria 3200
1495 Ga0501034_0107639 3300049571 Bacteria 2779
1496 Ga0501034_0120131 3300049571 Bacteria 2614
1497 Ga0501034_0134238 3300049571 Bacteria 2457
1498 Ga0501034_0220435 3300049571 Bacteria 1849
1499 Ga0501034_0233815 3300049571 Bacteria 1786
1500 Ga0501034_0243812 3300049571 Bacteria 1742
1501 Ga0501034_0254534 3300049571 Bacteria 1700
1502 Ga0501034_0270112 3300049571 Bacteria 1642
1503 Ga0501034_0592451 3300049571 Bacteria 1015
1504 Ga0501034_0610149 3300049571 Bacteria 996
1505 Ga0501034_0668045 3300049571 Bacteria 939
1506 Ga0501036_0004998 3300049572 Bacteria 10727
1507 Ga0501036_0054187 3300049572 Bacteria 3397
1508 Ga0501036_0077234 3300049572 Bacteria 2817
1509 Ga0501036_0182860 3300049572 Bacteria 1764
1510 Ga0501036_0298455 3300049572 Bacteria 1348
1511 Ga0501036_0488418 3300049572 Bacteria 1025
1512 Ga0501036_0820233 3300049572 Bacteria 765
1513 Ga0501037_0000118 3300049573 Bacteria 73584
1514 Ga0501037_0006091 3300049573 Bacteria 8816
1515 Ga0501037_0053085 3300049573 Bacteria 2964
1516 Ga0501037_0136640 3300049573 Bacteria 1756
1517 Ga0501037_0155025 3300049573 Bacteria 1635
1518 Ga0501037_0204238 3300049573 Bacteria 1395
1519 Ga0501037_0483499 3300049573 Bacteria 841
1520 Ga0501038_0000031 3300049574 Bacteria 132231
1521 Ga0501038_0003995 3300049574 Bacteria 13696
1522 Ga0501038_0007946 3300049574 Bacteria 9775
1523 Ga0501038_0028402 3300049574 Bacteria 4971
1524 Ga0501038_0041630 3300049574 Bacteria 4005
1525 Ga0501038_0041926 3300049574 Bacteria 3989
1526 Ga0501038_0157169 3300049574 Bacteria 1850
1527 Ga0501038_0165500 3300049574 Bacteria 1794
1528 Ga0501038_0316604 3300049574 Bacteria 1221
1529 Ga0501038_0498346 3300049574 Bacteria 931
1530 Ga0501039_0000057 3300049575 Bacteria 89756
1531 Ga0501039_0017563 3300049575 Bacteria 5488
1532 Ga0501039_0041392 3300049575 Bacteria 3559
1533 Ga0501039_0047324 3300049575 Bacteria 3324
1534 Ga0501039_0216886 3300049575 Bacteria 1504
1535 Ga0501040_0001144 3300049576 Bacteria 16848
1536 Ga0501040_0189556 3300049576 Bacteria 1459
1537 Ga0501041_0042622 3300049577 Bacteria 2759
1538 Ga0501043_0000048 3300049579 Bacteria 109146
1539 Ga0501043_0054965 3300049579 Bacteria 3128
1540 Ga0501043_0072840 3300049579 Bacteria 2698
1541 Ga0501043_0103181 3300049579 Bacteria 2241
1542 Ga0501043_0133472 3300049579 Bacteria 1946
1543 Ga0501043_0156188 3300049579 Bacteria 1784
1544 Ga0501043_0164505 3300049579 Bacteria 1732
1545 Ga0501043_0238183 3300049579 Bacteria 1404
1546 Ga0501043_0569552 3300049579 Bacteria 839
1547 Ga0501046_0010968 3300049580 Bacteria 7770
1548 Ga0501046_0014309 3300049580 Bacteria 6699
1549 Ga0501046_0026372 3300049580 Bacteria 4747
1550 Ga0501046_0051871 3300049580 Bacteria 3235
1551 Ga0501046_0204766 3300049580 Bacteria 1467
1552 Ga0501046_0338445 3300049580 Bacteria 1094
1553 Ga0501046_0368610 3300049580 Bacteria 1041
1554 Ga0501046_0401988 3300049580 Bacteria 989
1555 Ga0501047_0003748 3300049581 Bacteria 14320
1556 Ga0501047_0008494 3300049581 Bacteria 9687
1557 Ga0501047_0048076 3300049581 Bacteria 4120
1558 Ga0501047_0054470 3300049581 Bacteria 3869
1559 Ga0501047_0062229 3300049581 Bacteria 3600
1560 Ga0501047_0069524 3300049581 Bacteria 3390
1561 Ga0501047_0152583 3300049581 Bacteria 2185
1562 Ga0501047_0186826 3300049581 Bacteria 1937
1563 Ga0501047_0252256 3300049581 Bacteria 1613
1564 Ga0501047_0317678 3300049581 Bacteria 1398
1565 Ga0501047_0442731 3300049581 Bacteria 1129
1566 Ga0501047_0458236 3300049581 Bacteria 1104
1567 Ga0501047_0478199 3300049581 Bacteria 1073
1568 Ga0501047_0514213 3300049581 Bacteria 1023
1569 Ga0501047_0591718 3300049581 Bacteria 931
1570 Ga0501048_0030793 3300049582 Bacteria 3883
1571 Ga0501048_0057459 3300049582 Bacteria 2759
1572 Ga0501048_0125816 3300049582 Bacteria 1812
1573 Ga0501048_0186831 3300049582 Bacteria 1469
1574 Ga0501067_0027568 3300049583 Bacteria 3148
1575 Ga0501067_0051142 3300049583 Bacteria 2291
1576 Ga0501067_0097648 3300049583 Bacteria 1631
1577 Ga0501067_0121329 3300049583 Bacteria 1454
1578 Ga0501067_0189576 3300049583 Bacteria 1145
1579 Ga0501067_0242958 3300049583 Bacteria 1002
1580 Ga0501067_0351840 3300049583 Bacteria 821
1581 Ga0501068_0035832 3300049584 Bacteria 2963
1582 Ga0501068_0065095 3300049584 Bacteria 2218
1583 Ga0501068_0085297 3300049584 Bacteria 1943
1584 Ga0501068_0095279 3300049584 Bacteria 1840
1585 Ga0501068_0294420 3300049584 Bacteria 1038
1586 Ga0501069_0020534 3300049585 Bacteria 3579
1587 Ga0501069_0047390 3300049585 Bacteria 2385
1588 Ga0501069_0248398 3300049585 Bacteria 1038
1589 Ga0501070_0029009 3300049586 Bacteria 4640
1590 Ga0501070_0029317 3300049586 Bacteria 4615
1591 Ga0501070_0039424 3300049586 Bacteria 3940
1592 Ga0501070_0051500 3300049586 Bacteria 3417
1593 Ga0501070_0052146 3300049586 Bacteria 3396
1594 Ga0501070_0087469 3300049586 Bacteria 2579
1595 Ga0501070_0318144 3300049586 Bacteria 1266
1596 Ga0501071_0032763 3300049587 Bacteria 3691
1597 Ga0501071_0039321 3300049587 Bacteria 3384
1598 Ga0501071_0181489 3300049587 Bacteria 1577
1599 Ga0501071_0222043 3300049587 Unclassified 1422
1600 Ga0501072_0109972 3300049588 Bacteria 2193
1601 Ga0501072_0110278 3300049588 Bacteria 2190
1602 Ga0501072_0308239 3300049588 Bacteria 1259
1603 Ga0501072_0496817 3300049588 Bacteria 965
1604 Ga0501072_0582490 3300049588 Bacteria 883
1605 Ga0501073_0014781 3300049589 Bacteria 5668
1606 Ga0501073_0020495 3300049589 Bacteria 4768
1607 Ga0501073_0089425 3300049589 Bacteria 2140
1608 Ga0501073_0090002 3300049589 Bacteria 2133
1609 Ga0501073_0108511 3300049589 Bacteria 1926
1610 Ga0501073_0458198 3300049589 Bacteria 881
1611 Ga0501073_0531311 3300049589 Bacteria 813
1612 Ga0501074_0013095 3300049590 Bacteria 6029
1613 Ga0501074_0023939 3300049590 Bacteria 4437
1614 Ga0501074_0024895 3300049590 Bacteria 4348
1615 Ga0501074_0057774 3300049590 Bacteria 2795
1616 Ga0501074_0081104 3300049590 Bacteria 2326
1617 Ga0501075_0005167 3300049591 Bacteria 8933
1618 Ga0501075_0028092 3300049591 Bacteria 4150
1619 Ga0501076_0006377 3300049592 Bacteria 8557
1620 Ga0501076_0191194 3300049592 Bacteria 1670
1621 Ga0501076_0321462 3300049592 Bacteria 1269
1622 Ga0501077_0009579 3300049593 Bacteria 6022
1623 Ga0501077_0098052 3300049593 Bacteria 1858
1624 Ga0501202_023766 3300049652 Unclassified 1239
1625 Ga0501202_039277 3300049652 Bacteria 1017
1626 Ga0501217_081826 3300049661 Bacteria 895
1627 Ga0501223_001670 3300049663 Bacteria 5094
1628 Ga0501233_006769 3300049668 Bacteria 2163
1629 Ga0501235_003437 3300049669 Bacteria 3425
1630 Ga0501235_016642 3300049669 Bacteria 1626
1631 Ga0501249_042551 3300049679 Unclassified 1033
1632 Ga0501255_020100 3300049684 Bacteria 857
1633 Ga0501261_013782 3300049690 Bacteria 1100
1634 Ga0501225_0001550 3300049705 Bacteria 7211
1635 Ga0501225_0044761 3300049705 Bacteria 1225
1636 Ga0501234_002639 3300049707 Bacteria 2824
1637 Ga0501079_0007423 3300049741 Bacteria 8295
1638 Ga0501079_0035953 3300049741 Bacteria 3814
1639 Ga0501079_0059738 3300049741 Bacteria 2941
1640 Ga0501079_0201938 3300049741 Bacteria 1553
1641 Ga0501079_0244124 3300049741 Bacteria 1403
1642 Ga0501079_0410660 3300049741 Bacteria 1062
1643 Ga0501080_0008721 3300049742 Bacteria 9208
1644 Ga0501080_0009091 3300049742 Bacteria 9042
1645 Ga0501080_0009451 3300049742 Bacteria 8893
1646 Ga0501080_0051261 3300049742 Bacteria 3840
1647 Ga0501080_0069725 3300049742 Bacteria 3270
1648 Ga0501080_0115442 3300049742 Bacteria 2489
1649 Ga0501080_0127479 3300049742 Bacteria 2356
1650 Ga0501080_0156121 3300049742 Bacteria 2108
1651 Ga0501080_0284471 3300049742 Bacteria 1502
1652 Ga0501081_0001736 3300049743 Bacteria 13518
1653 Ga0501081_0023556 3300049743 Bacteria 4127
1654 Ga0501081_0149491 3300049743 Bacteria 1677
1655 Ga0501083_0044651 3300049744 Bacteria 2999
1656 Ga0501083_0049244 3300049744 Bacteria 2840
1657 Ga0501083_0063763 3300049744 Bacteria 2457
1658 Ga0501083_0243283 3300049744 Bacteria 1171
1659 Ga0501083_0288918 3300049744 Bacteria 1066
1660 Ga0501083_0429998 3300049744 Bacteria 859
1661 Ga0501270_007195 3300049767 Bacteria 1369
1662 Ga0501283_000325 3300049779 Bacteria 6309
1663 Ga0501035_0000118 3300049822 Bacteria 95482
1664 Ga0501035_0003976 3300049822 Bacteria 14088
1665 Ga0501035_0030120 3300049822 Bacteria 4948
1666 Ga0501035_0059706 3300049822 Bacteria 3396
1667 Ga0501035_0083249 3300049822 Bacteria 2823
1668 Ga0501035_0096309 3300049822 Bacteria 2600
1669 Ga0501035_0105131 3300049822 Bacteria 2475
1670 Ga0501035_0290401 3300049822 Bacteria 1380
1671 Ga0501035_0344252 3300049822 Bacteria 1248
1672 Ga0501044_0000504 3300049823 Bacteria 47543
1673 Ga0501044_0021869 3300049823 Bacteria 6819
1674 Ga0501044_0056387 3300049823 Bacteria 4034
1675 Ga0501044_0076395 3300049823 Bacteria 3399
1676 Ga0501044_0079183 3300049823 Bacteria 3330
1677 Ga0501044_0103067 3300049823 Bacteria 2868
1678 Ga0501044_0165513 3300049823 Bacteria 2185
1679 Ga0501044_0172041 3300049823 Bacteria 2137
1680 Ga0501044_0213873 3300049823 Bacteria 1881
1681 Ga0501044_0235427 3300049823 Bacteria 1777
1682 Ga0501044_0265553 3300049823 Bacteria 1654
1683 Ga0501044_0299120 3300049823 Bacteria 1538
1684 Ga0501044_0318935 3300049823 Bacteria 1479
1685 Ga0501044_0441433 3300049823 Bacteria 1209
1686 Ga0501044_0589506 3300049823 Bacteria 1005
1687 Ga0501045_0004800 3300049824 Bacteria 9340
1688 Ga0501045_0473744 3300049824 Bacteria 930
1689 Ga0501226_005037 3300049853 Bacteria 1515
1690 nmdc:mga03n38_226150_c1 3300050490 Bacteria 979
1691 nmdc:mga03n38_35806_c1 3300050490 Bacteria 2130
1692 nmdc:mga00v17_276191_c1 3300050491 Bacteria 1091
1693 nmdc:mga0yw44_18283_c1 3300050492 Bacteria 3834
1694 nmdc:mga0yw44_21084_c1 3300050492 Bacteria 3630
1695 nmdc:mga0yw44_398199_c1 3300050492 Bacteria 931
1696 nmdc:mga06z11_27303_c1 3300050494 Bacteria 2728
1697 nmdc:mga04h51_19968_c1 3300050495 Bacteria 1994
1698 nmdc:mga07m45_12880_c1 3300050496 Bacteria 3603
1699 nmdc:mga07m45_20065_c1 3300050496 Bacteria 3628
1700 nmdc:mga05p37_115286_c1 3300050507 Bacteria 3303
1701 nmdc:mga05p37_1172521_c1 3300050507 Bacteria 797
1702 nmdc:mga05p37_285757_c1 3300050507 Bacteria 1965
1703 nmdc:mga05p37_300144_c1 3300050507 Unclassified 1909
1704 nmdc:mga05p37_31141_c1 3300050507 Bacteria 6515
1705 nmdc:mga05p37_317055_c1 3300050507 Bacteria 1846
1706 nmdc:mga05p37_329514_c1 3300050507 Bacteria 1804
1707 nmdc:mga05p37_486728_c1 3300050507 Bacteria 1419
1708 nmdc:mga05p37_734563_c1 3300050507 Unclassified 1091
1709 nmdc:mga09592_23768_c1 3300050508 Bacteria 5063
1710 nmdc:mga0qj67_72848_c1 3300050509 Bacteria 2743
1711 nmdc:mga06r32_12560_c1 3300050510 Bacteria 7647
1712 nmdc:mga06r32_433336_c1 3300050510 Bacteria 1295
1713 nmdc:mga06r32_976_c1 3300050510 Bacteria 25615
1714 nmdc:mga08y16_1009107_c1 3300050511 Bacteria 812
1715 nmdc:mga08y16_226482_c1 3300050511 Bacteria 1935
1716 nmdc:mga08y16_278776_c1 3300050511 Bacteria 1725
1717 nmdc:mga08y16_292919_c1 3300050511 Bacteria 1678
1718 nmdc:mga08y16_72419_c1 3300050511 Bacteria 3591
1719 nmdc:mga08y16_75051_c1 3300050511 Bacteria 3525
1720 nmdc:mga08y16_86150_c1 3300050511 Bacteria 3274
1721 nmdc:mga0n895_129906_c1 3300050512 Bacteria 2544
1722 nmdc:mga0n895_141334_c1 3300050512 Bacteria 2436
1723 nmdc:mga0n895_226829_c1 3300050512 Bacteria 1896
1724 nmdc:mga0n895_240226_c1 3300050512 Bacteria 1838
1725 nmdc:mga0n895_2522_c1 3300050512 Bacteria 14348
1726 nmdc:mga0n895_594604_c1 3300050512 Bacteria 1109
1727 nmdc:mga0n895_89055_c1 3300050512 Unclassified 3087
1728 nmdc:mga0rr50_10031_c1 3300050513 Bacteria 5259
1729 nmdc:mga0rr50_137562_c1 3300050513 Bacteria 1962
1730 nmdc:mga0rr50_169_c1 3300050513 Bacteria 34726
1731 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
1732 nmdc:mga0a205_132190_c1 3300050515 Bacteria 1977
1733 nmdc:mga0a205_289709_c1 3300050515 Bacteria 1512
1734 nmdc:mga0a205_323773_c1 3300050515 Bacteria 1412
1735 nmdc:mga0a205_347774_c1 3300050515 Unclassified 1350
1736 nmdc:mga0a205_460169_c1 3300050515 Bacteria 1132
1737 nmdc:mga0a205_72336_c1 3300050515 Bacteria 3331
1738 nmdc:mga0a205_84763_c1 3300050515 Bacteria 3061
1739 Ga0495601_0000235 3300053077 Bacteria 29620
1740 Ga0500610_0168365 3300053079 Bacteria 1084
1741 Ga0500635_0000302 3300053080 Bacteria 17373
1742 Ga0500635_0001280 3300053080 Bacteria 6005
1743 Ga0495655_0011188 3300053083 Bacteria 1795
1744 Ga0495595_0017221 3300053084 Bacteria 3108
1745 Ga0495619_0035488 3300053085 Bacteria 3243
1746 Ga0495619_0117877 3300053085 Bacteria 1818
1747 Ga0495619_0351034 3300053085 Bacteria 1020
1748 Ga0500578_0140706 3300053086 Bacteria 1509
1749 Ga0500647_0026024 3300053091 Bacteria 2758
1750 Ga0500651_0016713 3300053093 Bacteria 4515
1751 Ga0500566_0041234 3300053094 Bacteria 2667
1752 Ga0500641_0003377 3300053096 Bacteria 5646
1753 Ga0500641_0005166 3300053096 Bacteria 4626
1754 Ga0500562_003232 3300053108 Bacteria 4071
1755 Ga0500593_000013 3300053117 Bacteria 59669
1756 Ga0500595_006840 3300053119 Bacteria 4798
1757 Ga0500608_000573 3300053122 Bacteria 13643
1758 Ga0500614_001562 3300053123 Bacteria 5419
1759 Ga0500618_002996 3300053125 Bacteria 6010
1760 Ga0500618_003083 3300053125 Bacteria 5893
1761 Ga0500618_036011 3300053125 Bacteria 1147
1762 Ga0500655_015690 3300053133 Bacteria 1391
1763 Ga0500559_0084876 3300053136 Bacteria 1444
1764 Ga0500559_0182351 3300053136 Bacteria 989
1765 Ga0500564_158915 3300053138 Bacteria 958
1766 Ga0500573_0000008 3300053140 Bacteria 237795
1767 Ga0500573_0077380 3300053140 Bacteria 1893
1768 Ga0500577_0006420 3300053142 Bacteria 3244
1769 Ga0500577_0025434 3300053142 Bacteria 2003
1770 Ga0500616_0000250 3300053153 Bacteria 83271
1771 Ga0500616_0000797 3300053153 Bacteria 36110
1772 Ga0500616_0004513 3300053153 Bacteria 9885
1773 Ga0500616_0032743 3300053153 Bacteria 2840
1774 Ga0500620_000225 3300053155 Bacteria 11219
1775 Ga0500620_107336 3300053155 Bacteria 977
1776 Ga0500622_0037248 3300053156 Bacteria 2541
1777 Ga0500627_0095586 3300053158 Bacteria 1331
1778 Ga0500638_166041 3300053162 Bacteria 966
1779 Ga0500639_040789 3300053163 Bacteria 2443
1780 Ga0500636_0010526 3300053177 Bacteria 5399
1781 Ga0500637_0010845 3300053178 Bacteria 4688
1782 Ga0500637_0187572 3300053178 Bacteria 1182
1783 Ga0500625_088391 3300053729 Bacteria 1333
1784 Ga0500645_022384 3300053730 Bacteria 1944
1785 Ga0500645_069379 3300053730 Bacteria 1013
1786 Ga0500596_003174 3300053735 Bacteria 3155
1787 Ga0501084_0000137 3300054114 Bacteria 55092
1788 Ga0501084_0001317 3300054114 Bacteria 19557
1789 Ga0501084_0016901 3300054114 Bacteria 6064
1790 Ga0501084_0023706 3300054114 Bacteria 5118
1791 Ga0501084_0036990 3300054114 Bacteria 4078
1792 Ga0501084_0061753 3300054114 Bacteria 3137
1793 Ga0501084_0226380 3300054114 Bacteria 1578
1794 Ga0501084_0240168 3300054114 Bacteria 1529
1795 Ga0501084_0425019 3300054114 Unclassified 1123
1796 Ga0501084_0514318 3300054114 Bacteria 1012
1797 Ga0501082_0004024 3300060353 Bacteria 12827
1798 Ga0501082_0006081 3300060353 Bacteria 10477
1799 Ga0501082_0015392 3300060353 Bacteria 6582
1800 Ga0501082_0100996 3300060353 Bacteria 2495
1801 Ga0501082_0388232 3300060353 Bacteria 1218
1802 Ga0501082_0721415 3300060353 Bacteria 872
1803 Ga0466962_0005568 3300061719 Bacteria 6045
1804 Ga0466962_0005965 3300061719 Bacteria 5852
1805 Ga0466962_0063868 3300061719 Bacteria 1758
1806 Ga0530510_0003542 3300061734 Bacteria 10748
1807 Ga0530510_0007842 3300061734 Bacteria 7446
1808 2503202330 2503198000 Bacteria 6884444
1809 2509370432 2509276018 Bacteria 6910194
1810 2510317396 2510065059 Bacteria 6847884
1811 2512930770 2512875016 Bacteria 6529530
1812 2512958499 2512875024 Bacteria 7195110
1813 2513609818 2513237090 Bacteria 7096802
1814 2514035088 2513237164 Bacteria 7563725
1815 2523107326 2522572158 Bacteria 6514390
1816 2524536916 2524023228 Bacteria 10118060
1817 2538427084 2537561728 Bacteria 5149301
1818 2561468298 2558860983 Bacteria 4133860
1819 2588516432 2588253730 Bacteria 6881675
1820 2599720883 2599185236 Bacteria 6875203
1821 2599940040 2599185301 Bacteria 6161860
1822 2643775671 2643221551 Bacteria 3750538
1823 2643794118 2643221555 Bacteria 3749717
1824 2643988106 2643221595 Bacteria 6565519
1825 2644155281 2643221627 Bacteria 6761570
1826 2673167664 2671180531 Bacteria 9045424
1827 2688070184 2687453257 Bacteria 6784659
1828 2688599312 2687453392 Bacteria 6880454
1829 2692316460 2690316117 Bacteria 6800650
1830 2694632106 2693429783 Bacteria 7019804
1831 2694634487 2693429784 Bacteria 7241525
1832 2707100829 2706794495 Bacteria 4536932
1833 2715500121 2713897090 Bacteria 3353799
1834 2756675784 2756170246 Bacteria 7451806
1835 2792581223 2791355082 Bacteria 5973319
1836 2792623229 2791355091 Bacteria 6135441
1837 2792626993 2791355092 Bacteria 6248105
1838 2792745993 2791355123 Bacteria 8049106
1839 2793281495 2791355253 Bacteria 5171699
1840 2819688596 2818991461 Bacteria 7026071
1841 2821127798 2821123053 Bacteria 7836056
1842 2828309680 2828305725 Bacteria 4916900
1843 2834578651 2834578030 Bacteria 3530182
1844 2838738222 2838736955 Bacteria 5760694
1845 2841841408 2841840854 Bacteria 5761912
1846 2841859422 2841859092 Bacteria 5436171
1847 2842141186 2842140634 Bacteria 5759631
1848 2842516206 2842515876 Bacteria 5436280
1849 2844006554 2844002411 Bacteria 7168230
1850 2844014595 2844009547 Bacteria 6728125
1851 2847418474 2847417321 Bacteria 6913799
1852 2847670720 2847670302 Bacteria 6165597
1853 2847693055 2847686936 Bacteria 6278406
1854 2848993452 2848992105 Bacteria 6810864
1855 2852104164 2852103415 Bacteria 5193810
1856 2854604223 2854601825 Bacteria 4797592
1857 2855199189 2855195626 Bacteria 4927512
1858 2855873363 2855872281 Bacteria 6964271
1859 2856316176 2856314179 Bacteria 6477897
1860 2856325988 2856320880 Bacteria 7263508
1861 2856330435 2856328259 Bacteria 6528202
1862 2856340521 2856334872 Bacteria 7037011
1863 2856368938 2856364286 Bacteria 6939991
1864 2857349514 2857349434 Bacteria 7926032
1865 2857370737 2857367948 Bacteria 6965560
1866 2857534461 2857531043 Bacteria 6754041
1867 2857732589 2857729791 Bacteria 4040535
1868 2858468106 2858466076 Bacteria 4722413
1869 2869170140 2869169390 Bacteria 6659796
1870 2869239750 2869234852 Bacteria 6654993
1871 2869248441 2869242130 Bacteria 6609239
1872 2869250070 2869249662 Bacteria 6868783
1873 2869258256 2869256925 Bacteria 6981691
1874 2869270969 2869264136 Bacteria 6880765
1875 2869272585 2869271264 Bacteria 6908218
1876 2869278745 2869278585 Bacteria 7077053
1877 2869291457 2869285874 Bacteria 6901219
1878 2871276570 2871272651 Bacteria 5042015
1879 2871284836 2871282230 Bacteria 4917173
1880 2871433737 2871429161 Bacteria 6547891
1881 2871442259 2871435913 Bacteria 6880295
1882 2871455440 2871451962 Bacteria 7336357
1883 2871461625 2871459585 Bacteria 6866887
1884 2871484452 2871481445 Bacteria 6700002
1885 2871500638 2871495908 Bacteria 6935695
1886 2874103493 2874102143 Bacteria 6342645
1887 2874116192 2874109183 Bacteria 6517025
1888 2874117189 2874116593 Bacteria 6674494
1889 2874133731 2874131515 Bacteria 6820270
1890 2874145330 2874139085 Bacteria 7021506
1891 2874153314 2874146452 Bacteria 7533118
1892 2874160579 2874155637 Bacteria 6724144
1893 2874165777 2874162495 Bacteria 6174670
1894 2874176346 2874168670 Bacteria 8062617
1895 2876365559 2876363079 Bacteria 6544991
1896 2876384962 2876377896 Bacteria 6565995
1897 2876391333 2876386047 Bacteria 6698674
1898 2876395080 2876392853 Bacteria 6660880
1899 2876403161 2876399893 Bacteria 6927900
1900 2876412434 2876406927 Bacteria 6191900
1901 2876419605 2876413966 Bacteria 6831344
1902 2876425387 2876420981 Bacteria 6687741
1903 2878041500 2878035449 Bacteria 6555736
1904 2878737053 2878730984 Bacteria 6380721
1905 2878743578 2878738818 Bacteria 7136951
1906 2878751348 2878745973 Bacteria 6867388
1907 2878764727 2878760144 Bacteria 6823465
1908 2878771828 2878767105 Bacteria 6898628
1909 2878778322 2878774303 Bacteria 6108671
1910 2878787922 2878781027 Bacteria 6834456
1911 2881152749 2881147464 Bacteria 7779814
1912 2881168447 2881161766 Bacteria 7127907
1913 2884965065 2884960567 Bacteria 5437054
1914 2885310422 2885305155 Bacteria 7348390
1915 2885331659 2885326080 Bacteria 7134805
1916 2885338486 2885334103 Bacteria 7216818
1917 2888340263 2888337043 Bacteria 6629336
1918 2888356690 2888350351 Bacteria 7372807
1919 2889011566 2889010040 Bacteria 6749192
1920 2889023328 2889016732 Bacteria 6700763
1921 2889420872 2889415604 Bacteria 8048700
1922 2894818949 2894817345 Bacteria 4892941
1923 2900055063 2900051742 Bacteria 4985156
1924 2903455725 2903448605 Bacteria 7357801
1925 2903501864 2903492973 Bacteria 13473544
1926 2903517899 2903513507 Bacteria 6344008
1927 2903522915 2903521522 Bacteria 6525694
1928 2903533105 2903528002 Bacteria 6586099
1929 2903545451 2903540706 Bacteria 7062119
1930 2904509211 2904504865 Bacteria 5152820
1931 2904661711 2904659560 Bacteria 6685615
1932 2906313265 2906308376 Bacteria 6841989
1933 2906325976 2906321335 Bacteria 6579571
1934 2906335164 2906328253 Bacteria 6585166
1935 2906368027 2906363423 Bacteria 6856682
1936 2906375860 2906370794 Bacteria 6881062
1937 2906379095 2906378014 Bacteria 6911440
1938 2906389644 2906386501 Bacteria 5977019
1939 2906397538 2906393657 Bacteria 6790866
1940 2906405968 2906401398 Bacteria 6693206
1941 2906412756 2906408224 Bacteria 6162342
1942 2906416313 2906414383 Bacteria 6580790
1943 2908743378 2908739725 Bacteria 8628932
1944 2917557072 2917554339 Bacteria 4987857
1945 2919680938 2919679072 Bacteria 4629602
1946 2920110133 2920107658 Bacteria 10042636
1947 2922137271 2922130491 Bacteria 7173936
1948 2922153453 2922151315 Bacteria 6902399
1949 2922164208 2922158528 Bacteria 6573167
1950 2922174153 2922172374 Bacteria 6167644
1951 2922182209 2922178524 Bacteria 6025201
1952 2922186504 2922185730 Bacteria 7113964
1953 2924713233 2924710171 Bacteria 6752351
1954 2924726342 2924718760 Bacteria 6331356
1955 2924728209 2924726620 Bacteria 6271473
1956 2924735925 2924733363 Bacteria 7574837
1957 2924746576 2924741084 Bacteria 6661321
1958 2924768866 2924762789 Bacteria 6561353
1959 2924781390 2924776078 Bacteria 7492003
1960 2928122931 2928121344 Bacteria 3972376
1961 2935633614 2935630451 Bacteria 8169952
1962 2937820585 2937813078 Bacteria 7783518
1963 2937827171 2937822353 Bacteria 7290551
1964 2937853856 2937848649 Bacteria 6983481
1965 2937864342 2937861824 Bacteria 6660327
1966 2937879101 2937877337 Bacteria 7246526
1967 2937898304 2937891427 Bacteria 6357007
1968 2937975153 2937972304 Bacteria 7532020
1969 2937985267 2937980651 Bacteria 6517427
1970 2937999301 2937994558 Bacteria 7036190
1971 2958034861 2958034702 Bacteria 6989922
1972 2958043010 2958041894 Bacteria 13082850
1973 2958067105 2958064165 Bacteria 7158582
1974 2958086275 2958084443 Bacteria 7312792
1975 2958104572 2958100919 Bacteria 6800575
1976 2958109233 2958108152 Bacteria 6681128
1977 2958122358 2958115193 Bacteria 6923548
1978 2958129193 2958122699 Bacteria 7280457
1979 2958135856 2958130278 Bacteria 6897202
1980 2958151130 2958144490 Bacteria 6677056
1981 2958161519 2958158011 Bacteria 6058449
1982 2958169775 2958165035 Bacteria 6906348
1983 2958177564 2958172287 Bacteria 6716688
1984 2958185323 2958179912 Bacteria 6874908
1985 2961083590 2961077736 Bacteria 7079850
1986 2961116864 2961114664 Bacteria 6680456
1987 2961143907 2961136820 Bacteria 6775228
1988 2961168235 2961163497 Bacteria 6901077
1989 2961187387 2961183825 Bacteria 6688536
1990 2963648456 2963644680 Bacteria 6530403
1991 2965023054 2965018300 Bacteria 6883036
1992 2965029412 2965025482 Bacteria 6532201
1993 2965036658 2965032056 Bacteria 6887443
1994 2965045426 2965040258 Bacteria 6855979
1995 2965051761 2965047637 Bacteria 6623551
1996 2965068400 2965062239 Bacteria 7412989
1997 2965122262 2965119406 Bacteria 6956431
1998 2968017730 2968016561 Bacteria 7022047
1999 2968084970 2968083720 Bacteria 7351627
2000 2968091901 2968091066 Bacteria 6052692
2001 2968099405 2968097103 Bacteria 6107094
2002 2968112771 2968110612 Bacteria 6814636
2003 2968122993 2968117919 Bacteria 6536078
2004 2968129962 2968128360 Bacteria 6270294
2005 2968140158 2968138860 Bacteria 6605449
2006 2968176635 2968171901 Bacteria 6894245
2007 2970472095 2970469710 Bacteria 6969209
2008 2970495933 2970489779 Bacteria 6517260
2009 2970516441 2970510686 Bacteria 7006402
2010 2970535548 2970532167 Bacteria 6553173
2011 2970548212 2970547951 Bacteria 6931819
2012 2970559574 2970554993 Bacteria 6814252
2013 2970593341 2970593180 Bacteria 7073582
2014 2970624037 2970619444 Bacteria 6986144
2015 2970633962 2970627176 Bacteria 6680862
2016 2977848883 2977843712 Bacteria 6753583
2017 2977851986 2977851361 Bacteria 6694324
2018 2977861855 2977858184 Bacteria 6215359
2019 2977867554 2977864932 Bacteria 7534097
2020 2977877940 2977872689 Bacteria 7270173
2021 2977906076 2977898635 Bacteria 6675551
2022 2977917864 2977915119 Bacteria 6829656
2023 2977928986 2977922695 Bacteria 6956781
2024 2977941519 2977935797 Bacteria 6252826
2025 2977947047 2977942078 Bacteria 7570577
2026 2977957422 2977950692 Bacteria 6893264
2027 2977958780 2977957713 Bacteria 6877875
2028 2977978591 2977971508 Bacteria 7472917
2029 2979711814 2979710463 Bacteria 6785254
2030 2979752058 2979742915 Bacteria 7301278
2031 2979769689 2979764755 Bacteria 6610066
2032 2979777917 2979772303 Bacteria 6618277
2033 2979786103 2979779861 Bacteria 6219781
2034 2979797597 2979793036 Bacteria 6808957
2035 2987645421 2987636660 Bacteria 8088555
2036 2987649830 2987645492 Bacteria 6117018
2037 2987658290 2987652177 Bacteria 6969023
2038 2987664249 2987659509 Bacteria 6966464
2039 2987670544 2987666974 Bacteria 6509233
2040 2987677347 2987673487 Bacteria 6884027
2041 2995728088 2995726249 Bacteria 3470435
2042 2996348394 2996341866 Bacteria 6643098
2043 2996351027 2996348954 Bacteria 7239054
2044 2996392675 2996386984 Bacteria 6978667
2045 3000018694 3000017691 Bacteria 3772574
2046 3003933368 3003930520 Bacteria 5667563
2047 3004169703 3004167301 Bacteria 8330599
2048 3004193304 3004188549 Bacteria 6952365
2049 3004206328 3004203850 Bacteria 7307914
2050 3004241853 3004239961 Bacteria 6892290
2051 3004254174 3004248173 Bacteria 6563236
2052 3004275307 3004268573 Bacteria 7043476
2053 3004277725 3004275668 Bacteria 7114440
2054 3004296135 3004289098 Bacteria 6135450
2055 3004340875 3004334049 Bacteria 8449246
2056 637073816 637000159 Bacteria 7596297
2057 649873817 649633066 Bacteria 6690028
2058 8004304783 8004300914 Bacteria 6132239
2059 8004366751 8004361976 Bacteria 6858373
2060 8004393988 8004387939 Bacteria 7049250
2061 8004447230 8004445564 Bacteria 6322258
2062 8004646830 8004640170 Bacteria 6723001
2063 8004713792 8004703790 Bacteria 8006957
2064 8004719521 8004714634 Bacteria 6776161
2065 8004730442 8004727605 Bacteria 6643904
2066 8006941435 8006933436 Bacteria 10410654
2067 8006981148 8006973647 Bacteria 10679141
2068 8049294366 8049293176 Bacteria 6128433
2069 8054565037 8054563764 Bacteria 5592885
2070 8055035903 8055034563 Bacteria 3562128
2071 8055038543 8055037949 Bacteria 3337834
2072 Ga0070659_100004306
2073 CNAas_1000040
2074 JGI24740J21852_10006921
2075 JGI24739J22299_10049812
2076 JGI24737J22298_10040690
2077 JGI24735J21928_10015514
2078 JGI24735J21928_10021675
2079 JGI24750J21931_1014682
2080 JGI24034J26672_10000026
2081 JGI24751J29686_10000030
2082 JGI25162J39368_1000075
2083 JGI25157J39369_1000694
2084 JGI25406J46586_10003840
2085 JGI25406J46586_10059736
2086 JGI25406J46586_10077736
2087 JGI25165J46597_1000033
2088 JGI25165J46597_1010963
2089 rootH2_10077725
2090 rootH2_10078133
2091 rootH2_10198277
2092 rootL2_10259676
2093 rootH1_10005877
2094 rootH1_10012091
2095 JGI25160J50197_1002193
2096 JGI25404J52841_10010830
2097 Ga0055529_1001715
2098 Ga0065165_1004344
2099 Ga0065714_10064504
2100 Ga0065704_10128089
2101 Ga0065704_10139293
2102 Ga0065704_10209631
2103 Ga0065712_10067766
2104 Ga0065712_10079152
2105 Ga0065712_10120433
2106 Ga0065712_10122253
2107 Ga0065712_10182341
2108 Ga0065715_10001956
2109 Ga0065715_10022986
2110 Ga0065715_10041779
2111 Ga0065715_10089158
2112 Ga0065715_10152536
2113 Ga0065715_10188464
2114 Ga0065715_10301965
2115 Ga0065707_10195597
2116 Ga0065707_10199019
2117 Ga0065707_10237340
2118 Ga0065707_10288125
2119 Ga0070658_10001208
2120 Ga0070658_10014417
2121 Ga0070658_10056805
2122 Ga0070676_10002075
2123 Ga0070683_100001378
2124 Ga0070683_100073796
2125 Ga0070690_100000812
2126 Ga0070690_100001011
2127 Ga0070690_100001334
2128 Ga0070690_100236242
2129 Ga0070670_100002791
2130 Ga0070670_100033283
2131 Ga0070670_100133728
2132 Ga0070670_100604021
2133 Ga0070677_10000526
2134 Ga0070677_10152901
2135 Ga0068869_100103722
2136 Ga0068869_100143427
2137 Ga0068869_100168917
2138 Ga0068869_100250304
2139 Ga0070666_10001337
2140 Ga0070666_10018053
2141 Ga0070666_10051188
2142 Ga0070666_10088334
2143 Ga0070680_100001985
2144 Ga0070680_100010302
2145 Ga0070680_100012770
2146 Ga0070680_100326609
2147 Ga0070682_100023706
2148 Ga0070682_100029208
2149 Ga0070682_100034027
2150 Ga0068868_100001472
2151 Ga0068868_100035781
2152 Ga0068868_100039981
2153 Ga0070660_100001829
2154 Ga0070660_100005970
2155 Ga0070660_100018548
2156 Ga0070660_100042990
2157 Ga0070660_100071913
2158 Ga0070660_100111006
2159 Ga0070689_100003426
2160 Ga0070689_100040778
2161 Ga0070689_100128362
2162 Ga0070689_100440593
2163 Ga0070691_10020783
2164 Ga0070691_10041162
2165 Ga0070691_10157322
2166 Ga0070687_100000129
2167 Ga0070687_100170001
2168 Ga0070687_100271253
2169 Ga0070661_100001499
2170 Ga0070661_100004800
2171 Ga0070661_100011435
2172 Ga0070661_100020420
2173 Ga0070661_100113963
2174 Ga0070661_100340548
2175 Ga0070692_10056376
2176 Ga0070692_10078838
2177 Ga0070668_100001092
2178 Ga0070668_100020391
2179 Ga0070668_100312028
2180 Ga0070669_100001544
2181 Ga0070669_100047892
2182 Ga0070669_100066581
2183 Ga0070669_100115061
2184 Ga0070669_100321252
2185 Ga0070669_100520740
2186 Ga0070675_100011835
2187 Ga0070675_100116649
2188 Ga0070675_100469098
2189 Ga0070671_100001853
2190 Ga0070671_100073369
2191 Ga0070671_100089287
2192 Ga0070671_100155199
2193 Ga0070671_100228293
2194 Ga0070674_100356481
2195 Ga0070673_100082833
2196 Ga0070673_100172015
2197 Ga0070673_100272870
2198 Ga0070673_100288759
2199 Ga0070673_100351064
2200 Ga0070673_100525780
2201 Ga0070688_100000657
2202 Ga0070688_100006128
2203 Ga0070659_100002328
2204 Ga0070659_100013504
2205 Ga0070659_100023287
2206 Ga0070659_100081787
2207 Ga0070659_100352857
2208 Ga0070659_100608543
2209 Ga0070667_100003253
2210 Ga0070667_100018342
2211 Ga0070667_100134011
2212 Ga0070667_100173995
2213 Ga0070703_10058342
2214 Ga0070709_10005740
2215 Ga0070714_100380444
2216 Ga0070710_10004618
2217 Ga0070701_10011515
2218 Ga0070701_10113763
2219 Ga0070711_100078337
2220 Ga0070711_100084992
2221 Ga0070705_100001751
2222 Ga0070705_100027907
2223 Ga0070705_100067072
2224 Ga0070705_100105070
2225 Ga0070700_100000719
2226 Ga0070700_100012018
2227 Ga0070700_100020667
2228 Ga0070700_100039705
2229 Ga0070700_100062514
2230 Ga0070700_100257511
2231 Ga0070694_100006547
2232 Ga0070694_100008855
2233 Ga0070694_100044502
2234 Ga0070694_100109337
2235 Ga0070694_100201814
2236 Ga0070694_100333469
2237 Ga0070694_100381266
2238 Ga0070708_100005855
2239 Ga0070708_100137339
2240 Ga0070708_100677381
2241 Ga0070663_100002023
2242 Ga0070663_100005687
2243 Ga0070663_100011762
2244 Ga0070663_100048511
2245 Ga0070663_100283642
2246 Ga0070678_100001372
2247 Ga0070678_100032969
2248 Ga0070678_100531052
2249 Ga0070662_100141147
2250 Ga0070662_100180045
2251 Ga0070681_10002315
2252 Ga0070681_10003664
2253 Ga0070681_10007845
2254 Ga0070681_10010655
2255 Ga0070681_10015116
2256 Ga0070681_10018723
2257 Ga0070681_10051872
2258 Ga0070681_10166545
2259 Ga0070681_10348936
2260 Ga0068867_100006387
2261 Ga0068867_100013233
2262 Ga0068867_100074453
2263 Ga0068867_100257362
2264 Ga0070685_10001416
2265 Ga0070685_10004344
2266 Ga0070685_10082845
2267 Ga0070706_100000125
2268 Ga0070706_100008529
2269 Ga0070706_100210603
2270 Ga0070706_100565234
2271 Ga0070707_100003600
2272 Ga0070707_100011087
2273 Ga0070707_100012513
2274 Ga0070707_100260130
2275 Ga0070707_100304531
2276 Ga0070707_100430159
2277 Ga0070698_100005037
2278 Ga0070698_100006865
2279 Ga0070698_100008229
2280 Ga0070699_100000352
2281 Ga0070699_100000880
2282 Ga0070699_100004094
2283 Ga0070699_100111738
2284 Ga0070679_100000587
2285 Ga0070679_100008410
2286 Ga0070679_100011201
2287 Ga0070679_100077077
2288 Ga0070684_100043562
2289 Ga0070684_100059847
2290 Ga0070684_100533696
2291 Ga0070697_100031128
2292 Ga0070697_100055838
2293 Ga0070697_100153616
2294 Ga0068853_100003665
2295 Ga0068853_100003943
2296 Ga0068853_100027252
2297 Ga0068853_100040630
2298 Ga0068853_100051948
2299 Ga0068853_100093101
2300 Ga0068853_100163691
2301 Ga0068853_100170360
2302 Ga0070672_100000867
2303 Ga0070672_100016594
2304 Ga0070672_100042656
2305 Ga0070672_100197393
2306 Ga0070672_100560480
2307 Ga0070672_100656057
2308 Ga0070686_100004310
2309 Ga0070686_100006195
2310 Ga0070686_100022101
2311 Ga0070686_100142294
2312 Ga0070686_100221860
2313 Ga0070695_100008518
2314 Ga0070695_100053158
2315 Ga0070695_100267266
2316 Ga0070695_100510046
2317 Ga0070696_100040295
2318 Ga0070696_100514153
2319 Ga0070696_100693071
2320 Ga0070693_100020755
2321 Ga0070693_100030719
2322 Ga0070693_100052530
2323 Ga0070693_100070706
2324 Ga0070665_100010998
2325 Ga0070665_100018974
2326 Ga0070665_100023145
2327 Ga0070665_100024444
2328 Ga0070665_100046320
2329 Ga0070665_100263305
2330 Ga0070665_100283231
2331 Ga0070665_100350250
2332 Ga0070665_100553282
2333 Ga0070704_100000897
2334 Ga0070704_100054755
2335 Ga0070704_100096074
2336 Ga0070704_100134808
2337 Ga0070704_100161122
2338 Ga0070704_100325872
2339 Ga0070704_100605301
2340 Ga0068855_100003374
2341 Ga0068855_100004501
2342 Ga0068855_100018186
2343 Ga0068855_100037556
2344 Ga0068855_100089580
2345 Ga0068855_100108358
2346 Ga0068855_100151181
2347 Ga0068855_100240449
2348 Ga0068855_100250783
2349 Ga0068855_100802958
2350 Ga0068855_100926808
2351 Ga0070664_100000070
2352 Ga0070664_100001934
2353 Ga0070664_100017132
2354 Ga0070664_100026866
2355 Ga0070664_100047571
2356 Ga0068857_100003654
2357 Ga0068857_100004680
2358 Ga0068857_100033566
2359 Ga0068857_100037853
2360 Ga0068857_100061463
2361 Ga0068854_100001002
2362 Ga0068854_100010067
2363 Ga0068854_100046307
2364 Ga0068854_100103155
2365 Ga0068854_100253706
2366 Ga0068856_100005597
2367 Ga0068856_100021359
2368 Ga0068856_100216883
2369 Ga0068856_100312957
2370 Ga0068856_100341639
2371 Ga0068856_100526334
2372 Ga0070702_100017673
2373 Ga0070702_100033498
2374 Ga0070702_100060385
2375 Ga0070702_100252847
2376 Ga0070702_100308007
2377 Ga0068852_100001511
2378 Ga0068852_100006048
2379 Ga0068852_100065307
2380 Ga0068852_100232089
2381 Ga0068852_100241597
2382 Ga0068852_100399548
2383 Ga0068852_100662403
2384 Ga0068852_100672893
2385 Ga0068859_100009084
2386 Ga0068859_100022162
2387 Ga0068859_100027560
2388 Ga0068859_100029327
2389 Ga0068859_100050914
2390 Ga0068859_100059991
2391 Ga0068859_100102105
2392 Ga0068859_100169710
2393 Ga0068859_100355574
2394 Ga0068864_100003320
2395 Ga0068864_100014922
2396 Ga0068864_100024719
2397 Ga0068864_100035972
2398 Ga0068864_100040419
2399 Ga0068864_100178664
2400 Ga0068864_100246022
2401 Ga0068864_100676324
2402 Ga0068866_10000167
2403 Ga0068861_100001113
2404 Ga0068861_100020275
2405 Ga0068861_100340958
2406 Ga0068861_100558303
2407 Ga0068851_10000382
2408 Ga0068851_10010828
2409 Ga0068851_10062572
2410 Ga0068863_100002882
2411 Ga0068863_100080336
2412 Ga0068863_100208714
2413 Ga0068863_100264213
2414 Ga0068858_100005307
2415 Ga0068858_100006538
2416 Ga0068858_100018581
2417 Ga0068858_100041680
2418 Ga0068858_100049299
2419 Ga0068858_100059043
2420 Ga0068858_100206719
2421 Ga0068858_100275829
2422 Ga0068860_100007853
2423 Ga0068860_100011324
2424 Ga0068860_100019352
2425 Ga0068860_100030361
2426 Ga0068860_100061705
2427 Ga0068860_100243218
2428 Ga0068862_100014640
2429 Ga0068862_100080071
2430 Ga0068862_100095635
2431 Ga0068862_100156570
2432 Ga0068862_100655808
2433 Ga0068862_100860223
2434 Ga0081455_10017929
2435 Ga0081540_1000138
2436 Ga0081540_1000640
2437 Ga0081540_1001923
2438 Ga0081540_1003393
2439 Ga0081540_1017951
2440 Ga0081540_1093371
2441 Ga0081539_10000110
2442 Ga0081539_10001757
2443 Ga0081539_10005290
2444 Ga0081539_10006601
2445 Ga0081539_10016624
2446 Ga0070717_10038368
2447 Ga0070717_10114601
2448 Ga0075365_10003274
2449 Ga0075365_10005800
2450 Ga0075365_10009956
2451 Ga0075368_10010236
2452 Ga0075363_100040656
2453 Ga0075364_10027328
2454 Ga0070715_10000063
2455 Ga0070716_100078021
2456 Ga0070716_100116535
2457 Ga0075362_10008752
2458 Ga0075362_10018996
2459 Ga0075367_10017171
2460 Ga0075367_10026146
2461 Ga0075367_10070535
2462 Ga0075367_10090436
2463 Ga0075369_10003352
2464 Ga0075369_10105201
2465 Ga0097621_100000449
2466 Ga0097621_100259045
2467 Ga0097621_100273719
2468 Ga0075370_10023704
2469 Ga0068871_100001759
2470 Ga0068871_100064226
2471 Ga0068871_100314906
2472 Ga0068871_100376467
2473 Ga0075428_100009001
2474 Ga0075428_100047133
2475 Ga0075428_100049375
2476 Ga0075428_100065603
2477 Ga0075428_100185233
2478 Ga0075428_100287649
2479 Ga0075430_100076170
2480 Ga0075430_100080323
2481 Ga0075430_100518947
2482 Ga0075431_100000392
2483 Ga0075431_100001188
2484 Ga0075433_10008826
2485 Ga0075433_10044089
2486 Ga0075433_10045889
2487 Ga0075433_10062021
2488 Ga0075433_10118535
2489 Ga0075433_10176928
2490 Ga0075434_100004782
2491 Ga0075434_100019404
2492 Ga0075434_100020621
2493 Ga0075434_100035585
2494 Ga0075434_100110623
2495 Ga0075434_100120201
2496 Ga0075434_100217845
2497 Ga0075434_100240687
2498 Ga0075434_100277852
2499 Ga0075429_100124879
2500 Ga0075429_100295766
2501 Ga0075429_100395773
2502 Ga0068865_100002359
2503 Ga0068865_100024668
2504 Ga0068865_100141872
2505 Ga0068865_100365257
2506 Ga0075436_100001175
2507 Ga0097620_100009084
2508 Ga0097620_100022163
2509 Ga0097620_100027559
2510 Ga0097620_100029326
2511 Ga0097620_100050908
2512 Ga0097620_100059986
2513 Ga0097620_100102107
2514 Ga0097620_100169714
2515 Ga0097620_100355571
2516 Ga0079104_1000209
2517 Ga0075435_100009611
2518 Ga0099794_10003880
2519 Ga0105251_10056175
2520 Ga0105244_10000145
2521 Ga0105250_10000127
2522 Ga0105240_10007255
2523 Ga0105240_10021381
2524 Ga0105240_10062851
2525 Ga0105240_10094300
2526 Ga0105240_10122464
2527 Ga0105240_10134066
2528 Ga0105240_10142856
2529 Ga0105240_10158004
2530 Ga0105240_10162374
2531 Ga0105240_10189757
2532 Ga0105240_10478093
2533 Ga0105240_10769101
2534 Ga0111539_10000358
2535 Ga0111539_10059338
2536 Ga0111539_10076099
2537 Ga0111539_10112739
2538 Ga0111539_10310035
2539 Ga0111539_10351792
2540 Ga0111539_10375944
2541 Ga0105245_10003941
2542 Ga0105245_10107745
2543 Ga0105245_10487140
2544 Ga0105245_10668767
2545 Ga0105247_10000047
2546 Ga0105247_10000680
2547 Ga0105247_10001044
2548 Ga0105247_10063001
2549 Ga0105247_10093410
2550 Ga0105247_10103760
2551 Ga0114129_10005694
2552 Ga0114129_10070556
2553 Ga0114129_10281624
2554 Ga0114129_10313848
2555 Ga0114129_10473193
2556 Ga0114129_10481150
2557 Ga0114129_10514193
2558 Ga0114129_10610367
2559 Ga0114129_10759767
2560 Ga0105243_10000027
2561 Ga0105243_10000474
2562 Ga0105243_10007357
2563 Ga0105243_10025565
2564 Ga0105243_10046747
2565 Ga0105243_10147343
2566 Ga0105243_10378635
2567 Ga0105243_10410071
2568 Ga0105241_10000690
2569 Ga0105241_10050218
2570 Ga0105241_10070341
2571 Ga0105241_10072947
2572 Ga0105241_10102582
2573 Ga0105241_10294902
2574 Ga0105241_10298249
2575 Ga0105241_10585830
2576 Ga0105242_10000038
2577 Ga0105242_10000107
2578 Ga0105242_10001950
2579 Ga0105242_10005047
2580 Ga0105242_10028561
2581 Ga0105242_10123128
2582 Ga0105242_10160011
2583 Ga0105248_10003364
2584 Ga0105248_10020227
2585 Ga0105248_10028561
2586 Ga0105248_10032857
2587 Ga0105248_10071202
2588 Ga0105248_10169319
2589 Ga0105248_10250961
2590 Ga0105248_10321545
2591 Ga0105237_10000829
2592 Ga0105237_10003821
2593 Ga0105237_10033099
2594 Ga0105237_10045544
2595 Ga0105237_10047386
2596 Ga0105237_10059203
2597 Ga0105237_10099103
2598 Ga0105237_10246404
2599 Ga0105237_10258032
2600 Ga0105238_10001511
2601 Ga0105238_10021004
2602 Ga0105238_10027120
2603 Ga0105238_10058950
2604 Ga0105238_10141237
2605 Ga0105238_10240618
2606 Ga0105238_10625288
2607 Ga0105238_10770149
2608 Ga0105249_10000113
2609 Ga0105249_10001390
2610 Ga0105249_10001767
2611 Ga0105249_10022829
2612 Ga0105249_10490726
2613 Ga0105239_10000857
2614 Ga0105239_10003469
2615 Ga0105239_10049011
2616 Ga0105239_10060038
2617 Ga0105239_10076176
2618 Ga0105239_10165419
2619 Ga0105239_10241798
2620 Ga0105239_10887796
2621 Ga0105246_10001442
2622 Ga0105246_10073632
2623 Ga0105246_10086527
2624 Ga0105246_10280360
2625 Ga0105246_10319732
2626 Ga0157373_10003881
2627 Ga0157373_10018812
2628 Ga0157373_10044566
2629 Ga0157373_10044616
2630 Ga0157373_10186683
2631 Ga0157371_10000858
2632 Ga0157371_10310404
2633 Ga0157371_10317708
2634 Ga0157370_10001310
2635 Ga0157370_10066474
2636 Ga0157370_10084349
2637 Ga0157370_10104065
2638 Ga0157370_10193563
2639 Ga0157369_10002570
2640 Ga0157369_10007844
2641 Ga0157369_10065636
2642 Ga0157369_10070649
2643 Ga0157369_10125796
2644 Ga0157369_10196245
2645 Ga0157374_10002021
2646 Ga0157374_10913170
2647 Ga0157378_10000048
2648 Ga0157378_10001435
2649 Ga0157378_10005648
2650 Ga0157378_10025656
2651 Ga0157378_10113691
2652 Ga0157378_10229130
2653 Ga0157378_10381753
2654 Ga0157378_10528555
2655 Ga0157378_10645347
2656 Ga0163162_10000023
2657 Ga0163162_10001226
2658 Ga0163162_10051608
2659 Ga0163162_10053079
2660 Ga0163162_10108278
2661 Ga0163162_10148629
2662 Ga0163162_10203558
2663 Ga0163162_10208523
2664 Ga0163162_10216899
2665 Ga0163162_10658561
2666 Ga0157372_10006136
2667 Ga0157372_10068693
2668 Ga0157372_10286185
2669 Ga0157372_10494190
2670 Ga0157372_11515511
2671 Ga0157375_10002065
2672 Ga0157375_10006519
2673 Ga0157375_10048768
2674 Ga0157375_10124856
2675 Ga0157375_10245995
2676 Ga0157375_10254236
2677 Ga0157375_10348662
2678 Ga0163163_10000156
2679 Ga0163163_10054400
2680 Ga0163163_10073729
2681 Ga0163163_10304950
2682 Ga0163163_10377167
2683 Ga0163163_10776315
2684 Ga0157380_10001458
2685 Ga0157380_10012266
2686 Ga0157380_10029038
2687 Ga0157380_10039177
2688 Ga0157380_10040754
2689 Ga0157380_10053569
2690 Ga0157380_10284365
2691 Ga0157380_10322233
2692 Ga0157377_10001610
2693 Ga0157377_10050432
2694 Ga0157379_10056062
2695 Ga0157379_10105838
2696 Ga0157379_10123869
2697 Ga0157379_10153851
2698 Ga0157379_10162021
2699 Ga0157376_10032402
2700 Ga0157376_10054345
2701 Ga0157376_10124275
2702 Ga0157376_10147821
2703 Ga0157376_10159828
2704 Ga0157376_11005865
2705 Ga0182006_1023433
2706 Ga0182007_10030676
2707 Ga0182007_10056709
2708 Ga0163161_10017220
2709 Ga0163161_10025332
2710 Ga0163161_10059173
2711 Ga0163161_10159882
2712 Ga0163161_10174310
2713 Ga0163161_10231857
2714 Ga0163161_10337928
2715 Ga0163161_10355781
2716 Ga0213873_10062851
2717 Ga0213874_10021966
2718 Ga0213874_10023511
2719 Ga0213876_10000043
2720 Ga0213876_10000283
2721 Ga0213876_10000541
2722 Ga0213876_10000580
2723 Ga0213876_10059369
2724 Ga0213876_10123628
2725 Ga0213876_10297933
2726 Ga0213875_10000276
2727 Ga0213875_10005719
2728 Ga0213875_10007545
2729 Ga0213875_10073977
2730 Ga0213875_10091254
2731 Ga0213875_10119755
2732 Ga0213875_10165417
2733 Ga0213871_10002403
2734 Ga0224712_10012148
2735 Ga0224572_1007204
2736 Ga0207672_1000156
2737 Ga0209646_1019801
2738 Ga0209026_1000002
2739 Ga0209677_100440
2740 Ga0209148_1000072
2741 Ga0209148_1008001
2742 Ga0209759_1000146
2743 Ga0209233_1000027
2744 Ga0209233_1000297
2745 Ga0209233_1004351
2746 Ga0209455_1000133
2747 Ga0209455_1009471
2748 Ga0209675_1001307
2749 Ga0209758_1012195
2750 Ga0209758_1024001
2751 Ga0209256_1002428
2752 Ga0207697_10001372
2753 Ga0207697_10029948
2754 Ga0207697_10129407
2755 Ga0207656_10000298
2756 Ga0207656_10005843
2757 Ga0207656_10032171
2758 Ga0207696_1000134
2759 Ga0207655_1000298
2760 Ga0207653_10000400
2761 Ga0207682_10000214
2762 Ga0207692_10008338
2763 Ga0207642_10000260
2764 Ga0207710_10000001
2765 Ga0207710_10002316
2766 Ga0207710_10002769
2767 Ga0207710_10050509
2768 Ga0207688_10000836
2769 Ga0207688_10045664
2770 Ga0207688_10074619
2771 Ga0207680_10001615
2772 Ga0207680_10004606
2773 Ga0207680_10070356
2774 Ga0207647_10001682
2775 Ga0207647_10004899
2776 Ga0207647_10009697
2777 Ga0207647_10021671
2778 Ga0207647_10081547
2779 Ga0207685_10000041
2780 Ga0207645_10000251
2781 Ga0207645_10002159
2782 Ga0207645_10189759
2783 Ga0207643_10000176
2784 Ga0207643_10067989
2785 Ga0207705_10011075
2786 Ga0207705_10015184
2787 Ga0207705_10029984
2788 Ga0207705_10043327
2789 Ga0207705_10066183
2790 Ga0207705_10135850
2791 Ga0207705_10139696
2792 Ga0207684_10000130
2793 Ga0207684_10001792
2794 Ga0207684_10107705
2795 Ga0207684_10131173
2796 Ga0207684_10165352
2797 Ga0207654_10001318
2798 Ga0207654_10017455
2799 Ga0207654_10020733
2800 Ga0207654_10115339
2801 Ga0207654_10284014
2802 Ga0207707_10000577
2803 Ga0207707_10013845
2804 Ga0207707_10027146
2805 Ga0207707_10038041
2806 Ga0207707_10057171
2807 Ga0207707_10072545
2808 Ga0207707_10135112
2809 Ga0207707_10151696
2810 Ga0207695_10000011
2811 Ga0207695_10004415
2812 Ga0207695_10011746
2813 Ga0207695_10051889
2814 Ga0207695_10076795
2815 Ga0207695_10128836
2816 Ga0207695_10205545
2817 Ga0207695_10291348
2818 Ga0207695_10316714
2819 Ga0207695_10328574
2820 Ga0207695_10411011
2821 Ga0207695_10666506
2822 Ga0207671_10002285
2823 Ga0207671_10009012
2824 Ga0207671_10012933
2825 Ga0207671_10030414
2826 Ga0207671_10216238
2827 Ga0207671_10256790
2828 Ga0207671_10363776
2829 Ga0207671_10609738
2830 Ga0207663_10082208
2831 Ga0207660_10004634
2832 Ga0207660_10013164
2833 Ga0207660_10037192
2834 Ga0207660_10118160
2835 Ga0207660_10314999
2836 Ga0207660_10416795
2837 Ga0207662_10000146
2838 Ga0207662_10043744
2839 Ga0207662_10046470
2840 Ga0207662_10176936
2841 Ga0207657_10003084
2842 Ga0207657_10012251
2843 Ga0207657_10022391
2844 Ga0207657_10022630
2845 Ga0207657_10173175
2846 Ga0207657_10273208
2847 Ga0207649_10000907
2848 Ga0207649_10001001
2849 Ga0207649_10003509
2850 Ga0207649_10053105
2851 Ga0207652_10010606
2852 Ga0207652_10043700
2853 Ga0207652_10068600
2854 Ga0207652_10075441
2855 Ga0207652_10104189
2856 Ga0207646_10004552
2857 Ga0207646_10004920
2858 Ga0207646_10149616
2859 Ga0207646_10251620
2860 Ga0207646_10269196
2861 Ga0207681_10001125
2862 Ga0207681_10009832
2863 Ga0207681_10014548
2864 Ga0207681_10284649
2865 Ga0207681_10292495
2866 Ga0207694_10001152
2867 Ga0207694_10002336
2868 Ga0207694_10022362
2869 Ga0207694_10028283
2870 Ga0207694_10071691
2871 Ga0207694_10405997
2872 Ga0207650_10000010
2873 Ga0207650_10001243
2874 Ga0207650_10603065
2875 Ga0207659_10000831
2876 Ga0207687_10015252
2877 Ga0207687_10268305
2878 Ga0207687_10323474
2879 Ga0207687_10324228
2880 Ga0207687_10345839
2881 Ga0207700_10014164
2882 Ga0207644_10000285
2883 Ga0207644_10001068
2884 Ga0207644_10080345
2885 Ga0207644_10109564
2886 Ga0207644_10268626
2887 Ga0207690_10002228
2888 Ga0207690_10011176
2889 Ga0207690_10036252
2890 Ga0207690_10045184
2891 Ga0207690_10275600
2892 Ga0207706_10032261
2893 Ga0207706_10166685
2894 Ga0207706_10211548
2895 Ga0207706_10263151
2896 Ga0207706_10313566
2897 Ga0207686_10000008
2898 Ga0207686_10000463
2899 Ga0207686_10009014
2900 Ga0207686_10016548
2901 Ga0207686_10053520
2902 Ga0207686_10312709
2903 Ga0207709_10000025
2904 Ga0207709_10000493
2905 Ga0207709_10001939
2906 Ga0207709_10003815
2907 Ga0207709_10035958
2908 Ga0207709_10190844
2909 Ga0207670_10000695
2910 Ga0207670_10004103
2911 Ga0207670_10064713
2912 Ga0207670_10115390
2913 Ga0207670_10152603
2914 Ga0207669_10000390
2915 Ga0207704_10000842
2916 Ga0207704_10087011
2917 Ga0207704_10094645
2918 Ga0207704_10761095
2919 Ga0207665_10013886
2920 Ga0207665_10253016
2921 Ga0207691_10000371
2922 Ga0207691_10046619
2923 Ga0207691_10066790
2924 Ga0207691_10272142
2925 Ga0207691_10286898
2926 Ga0207711_10000513
2927 Ga0207711_10006144
2928 Ga0207711_10008004
2929 Ga0207711_10017397
2930 Ga0207711_10077141
2931 Ga0207711_10095914
2932 Ga0207711_10195015
2933 Ga0207689_10002310
2934 Ga0207689_10022079
2935 Ga0207689_10027470
2936 Ga0207689_10047194
2937 Ga0207689_10094886
2938 Ga0207689_10098748
2939 Ga0207689_10149553
2940 Ga0207689_10226814
2941 Ga0207689_10309475
2942 Ga0207661_10002789
2943 Ga0207661_10386847
2944 Ga0207679_10000102
2945 Ga0207679_10000425
2946 Ga0207679_10026299
2947 Ga0207679_10239496
2948 Ga0207679_10311808
2949 Ga0207679_10348756
2950 Ga0207679_10419024
2951 Ga0207667_10006351
2952 Ga0207667_10010676
2953 Ga0207667_10017409
2954 Ga0207667_10086548
2955 Ga0207667_10093626
2956 Ga0207667_10133566
2957 Ga0207667_10195728
2958 Ga0207667_10272149
2959 Ga0207651_10000093
2960 Ga0207651_10001385
2961 Ga0207651_10125775
2962 Ga0207651_10132730
2963 Ga0207712_10000408
2964 Ga0207712_10001464
2965 Ga0207712_10171804
2966 Ga0207712_10196151
2967 Ga0207712_10224990
2968 Ga0207712_10287102
2969 Ga0207668_10000060
2970 Ga0207668_10000798
2971 Ga0207668_10279507
2972 Ga0207640_10000598
2973 Ga0207640_10007397
2974 Ga0207640_10099808
2975 Ga0207640_10126128
2976 Ga0207640_10139361
2977 Ga0207640_10242125
2978 Ga0207640_10396827
2979 Ga0207658_10001648
2980 Ga0207658_10016124
2981 Ga0207658_10023732
2982 Ga0207658_10025324
2983 Ga0207658_10036943
2984 Ga0207658_10577090
2985 Ga0207677_10000456
2986 Ga0207677_10051529
2987 Ga0207677_10201657
2988 Ga0207703_10000384
2989 Ga0207703_10000867
2990 Ga0207703_10045116
2991 Ga0207703_10050255
2992 Ga0207703_10285496
2993 Ga0207703_10473076
2994 Ga0207639_10003324
2995 Ga0207639_10004761
2996 Ga0207639_10012411
2997 Ga0207639_10014309
2998 Ga0207639_10750963
2999 Ga0207678_10000100
3000 Ga0207678_10002390
3001 Ga0207678_10010485
3002 Ga0207678_10040568
3003 Ga0207678_10047821
3004 Ga0207678_10446371
3005 Ga0207678_10561183
3006 Ga0207708_10001694
3007 Ga0207708_10023885
3008 Ga0207708_10028396
3009 Ga0207708_10085114
3010 Ga0207708_10102988
3011 Ga0207708_10153194
3012 Ga0207702_10003152
3013 Ga0207702_10167061
3014 Ga0207702_10181949
3015 Ga0207702_10243222
3016 Ga0207702_10305491
3017 Ga0207702_10705024
3018 Ga0207641_10001449
3019 Ga0207641_10057795
3020 Ga0207641_10083361
3021 Ga0207641_10115170
3022 Ga0207641_10209104
3023 Ga0207641_10359365
3024 Ga0207648_10002737
3025 Ga0207648_10008878
3026 Ga0207648_10065955
3027 Ga0207648_10173974
3028 Ga0207648_10206900
3029 Ga0207648_10303271
3030 Ga0207648_10738430
3031 Ga0207676_10001221
3032 Ga0207676_10019238
3033 Ga0207676_10024955
3034 Ga0207676_10032052
3035 Ga0207676_10313320
3036 Ga0207676_10725031
3037 Ga0207674_10000671
3038 Ga0207674_10002399
3039 Ga0207674_10029109
3040 Ga0207674_10088526
3041 Ga0207674_10153778
3042 Ga0207674_10164935
3043 Ga0207674_10174661
3044 Ga0207674_10266209
3045 Ga0207674_10568106
3046 Ga0207675_100001958
3047 Ga0207675_100002014
3048 Ga0207675_100012425
3049 Ga0207675_100143234
3050 Ga0207675_100447650
3051 Ga0207675_100637354
3052 Ga0207683_10000375
3053 Ga0207683_10021422
3054 Ga0207683_10087003
3055 Ga0207683_10130809
3056 Ga0207683_10341395
3057 Ga0207683_10680892
3058 Ga0207698_10000755
3059 Ga0207698_10008764
3060 Ga0207698_10021968
3061 Ga0207698_10142014
3062 Ga0207698_10400789
3063 Ga0207698_10599607
3064 Ga0207698_10795302
3065 Ga0209281_1000580
3066 Ga0209588_1109662
3067 Ga0209813_10039879
3068 Ga0207428_10013505
3069 Ga0207428_10425070
3070 Ga0268266_10002601
3071 Ga0268266_10176790
3072 Ga0268266_10334851
3073 Ga0268266_10705925
3074 Ga0268265_10001155
3075 Ga0268265_10041099
3076 Ga0268265_10087003
3077 Ga0268265_10132990
3078 Ga0268265_10837196
3079 Ga0268264_10000938
3080 Ga0268264_10006852
3081 Ga0268264_10013722
3082 Ga0268264_10048036
3083 Ga0268264_10059751
3084 Ga0268264_10095284
3085 Ga0268264_10176763
3086 Ga0268264_10317674
3087 Ga0268264_10410677
3088 Ga0265337_1011859
3089 Ga0265337_1027974
3090 Ga0265326_10002848
3091 Ga0265319_1002530
3092 Ga0265319_1027664
3093 Ga0265334_10002924
3094 Ga0265334_10064086
3095 Ga0265318_10000015
3096 Ga0265318_10001067
3097 Ga0265318_10107796
3098 Ga0265322_10039179
3099 Ga0265336_10096874
3100 Ga0265338_10001151
3101 Ga0265338_10020696
3102 Ga0265338_10023976
3103 Ga0265338_10035877
3104 Ga0265338_10128359
3105 Ga0265338_10133069
3106 Ga0265338_10327454
3107 Ga0265762_1004498
3108 Ga0265762_1008314
3109 Ga0265765_1005577
3110 Ga0265760_10034992
3111 Ga0265328_10079421
3112 Ga0265320_10017283
3113 Ga0265320_10079449
3114 Ga0265320_10081828
3115 Ga0265320_10215209
3116 Ga0265325_10001084
3117 Ga0265325_10089163
3118 Ga0265325_10098895
3119 Ga0265325_10188254
3120 Ga0265340_10003394
3121 Ga0265340_10089159
3122 Ga0265340_10144329
3123 Ga0265339_10000685
3124 Ga0265339_10007974
3125 Ga0265339_10015979
3126 Ga0265339_10032527
3127 Ga0265339_10040343
3128 Ga0265339_10223758
3129 Ga0265331_10000102
3130 Ga0265331_10033783
3131 Ga0265316_10022216
3132 Ga0265316_10082428
3133 Ga0265316_10086431
3134 Ga0265316_10143833
3135 Ga0265316_10173427
3136 Ga0265316_10240214
3137 Ga0307408_100089283
3138 Ga0265313_10000865
3139 Ga0307508_10196223
3140 Ga0316575_10001077
3141 Ga0316575_10011041
3142 Ga0316575_10050339
3143 Ga0316575_10165460
3144 Ga0316579_10038435
3145 Ga0316579_10091232
3146 Ga0265314_10000258
3147 Ga0265314_10060363
3148 Ga0265314_10114059
3149 Ga0265314_10161977
3150 Ga0265314_10310288
3151 Ga0265342_10001056
3152 Ga0265342_10007754
3153 Ga0265342_10035673
3154 Ga0265342_10165782
3155 Ga0265342_10238253
3156 Ga0316576_10001112
3157 Ga0316576_10033327
3158 Ga0316576_10083745
3159 Ga0316576_10099442
3160 Ga0316576_10143290
3161 Ga0316576_10248342
3162 Ga0316578_10011768
3163 Ga0316578_10044301
3164 Ga0316578_10054356
3165 Ga0316578_10129128
3166 Ga0316578_10186846
3167 Ga0316578_10230492
3168 Ga0307405_10102765
3169 Ga0316577_10008546
3170 Ga0316577_10014688
3171 Ga0316577_10020005
3172 Ga0316577_10038969
3173 Ga0307413_10157747
3174 Ga0307413_10167609
3175 Ga0307410_10147722
3176 Ga0307410_10181137
3177 Ga0307410_10222037
3178 Ga0307410_10435769
3179 Ga0307406_10031996
3180 Ga0307406_10170919
3181 Ga0307409_100109755
3182 Ga0307409_100394241
3183 Ga0307409_100395838
3184 Ga0307416_100243039
3185 Ga0307414_10008080
3186 Ga0307414_10299504
3187 Ga0307411_10120154
3188 Ga0307411_10423843
3189 Ga0307415_100033995
3190 Ga0307415_100510014
3191 Ga0316583_10007407
3192 Ga0316585_10019994
3193 Ga0316593_10005355
3194 Ga0316593_10010568
3195 Ga0316593_10013111
3196 Ga0316593_10020510
3197 Ga0316593_10057683
3198 Ga0316593_10062211
3199 Ga0316596_1011731
3200 Ga0316596_1024299
3201 Ga0373930_0011932
3202 Ga0373941_0001589
3203 Ga0373941_0037090
3204 Ga0373945_0033785
3205 Ga0373956_0387337
3206 Ga0373943_0049967
3207 Ga0373946_0093571
3208 Ga0316574_0000439
3209 Ga0316574_0017026
3210 Ga0316574_0100775
3211 Ga0373931_0040463
3212 Ga0373931_0068199
3213 Ga0373935_0037988
3214 Ga0373935_0052142
3215 Ga0373927_0044672
3216 Ga0373937_0005450
3217 Ga0373937_0047707
3218 Ga0373937_0547774
3219 Ga0316582_0020619
3220 Ga0316582_0025596
3221 Ga0316582_0053359
3222 Ga0316582_0148054
3223 Ga0316582_0318950
3224 Ga0316582_0388358
3225 Ga0316584_0001402
3226 Ga0316584_0003289
3227 Ga0316584_0003840
3228 Ga0316584_0003883
3229 Ga0316584_0011924
3230 Ga0316584_0023348
3231 Ga0316584_0023535
3232 Ga0316584_0195144
3233 Ga0316584_0562059
3234 Ga0373925_0207428
3235 Ga0373925_0222760
3236 Ga0395899_0012908
3237 Ga0395899_0070048
3238 Ga0395899_0486162
3239 Ga0395900_0025391
3240 Ga0395900_0140129
3241 Ga0395900_0181520
3242 Ga0395900_0196989
3243 Ga0395900_0415781
3244 Ga0395900_0733914
3245 Ga0395900_0836032
3246 Ga0395898_0080689
3247 Ga0395898_0125664
3248 Ga0395898_0162225
3249 Ga0395898_0193157
3250 Ga0395898_0636552
3251 Ga0395905_0000911
3252 Ga0395905_0006827
3253 Ga0395905_0008081
3254 Ga0395905_0040992
3255 Ga0395905_0052360
3256 Ga0395905_0171218
3257 Ga0395905_0227978
3258 Ga0395905_0299862
3259 Ga0395905_0316347
3260 Ga0395905_0860694
3261 Ga0316581_0004894
3262 Ga0316581_0018084
3263 Ga0436364_0003086
3264 Ga0436364_0079644
3265 Ga0436364_0207864
3266 Ga0436364_0310410
3267 Ga0436364_0374781
3268 Ga0436364_0517934
3269 Ga0436364_0545736
3270 Ga0436364_0598581
3271 Ga0436364_0635932
3272 Ga0436364_0653298
3273 Ga0436364_0935450
3274 Ga0436364_1040205
3275 Ga0436364_1113697
3276 Ga0436364_1161322
3277 Ga0436364_1291049
3278 Ga0436364_1366309
3279 Ga0395901_0006071
3280 Ga0395901_0094751
3281 Ga0395901_0109329
3282 Ga0395901_0205365
3283 Ga0395901_0695327
3284 Ga0400484_42049
3285 Ga0400490_04614
3286 Ga0400490_13335
3287 Ga0400486_07680
3288 Ga0400483_195000
3289 Ga0400483_278927
3290 Ga0436365_0227260
3291 Ga0436365_0283204
3292 Ga0436365_0421852
3293 Ga0436365_0426125
3294 Ga0436365_0847170
3295 Ga0436365_0935686
3296 Ga0436365_0994234
3297 Ga0436365_1114212
3298 Ga0436365_1132500
3299 Ga0436365_1397674
3300 Ga0436365_1422517
3301 Ga0436365_1595370
3302 Ga0436365_1779432
3303 Ga0436360_0295164
3304 Ga0436360_0355578
3305 Ga0436360_0413033
3306 Ga0436360_0459232
3307 Ga0436360_0587385
3308 Ga0436361_0073402
3309 Ga0436363_0096334
3310 Ga0436363_0162148
3311 Ga0436363_0171561
3312 Ga0436363_0222055
3313 Ga0436363_0516425
3314 Ga0436363_0550052
3315 Ga0436363_0849922
3316 Ga0436362_0315526
3317 Ga0436362_0605469
3318 Ga0436362_0735076
3319 Ga0436362_0764253
3320 Ga0436362_0808991
3321 Ga0439433_0080256
3322 Ga0439448_0015703
3323 Ga0439458_0072768
3324 Ga0439458_0126685
3325 Ga0439434_0082002
3326 Ga0451577_0001956
3327 Ga0451577_0121152
3328 Ga0451577_0175909
3329 Ga0451577_0446006
3330 Ga0451577_0710005
3331 Ga0451577_0737711
3332 Ga0466969_0006535
3333 Ga0466972_0086629
3334 Ga0453683_0000118
3335 Ga0453683_0000280
3336 Ga0453683_0000891
3337 Ga0453683_0001047
3338 Ga0453683_0005938
3339 Ga0453683_0027559
3340 Ga0453683_0075393
3341 Ga0453683_0150042
3342 Ga0453683_0256609
3343 Ga0466966_0007455
3344 Ga0466963_0075224
3345 Ga0453684_0000829
3346 Ga0453684_0005096
3347 Ga0453684_0022082
3348 Ga0453684_0028475
3349 Ga0453684_0050873
3350 Ga0453684_0052888
3351 Ga0453684_0064823
3352 Ga0453684_0073587
3353 Ga0453684_0080822
3354 Ga0453684_0084451
3355 Ga0453684_0178157
3356 Ga0453684_0196101
3357 Ga0453684_0231434
3358 Ga0453684_0291175
3359 Ga0453684_0360342
3360 Ga0453684_0523887
3361 Ga0466971_0010408
3362 Ga0466968_0211427
3363 Ga0466970_0237370
3364 Ga0466957_0001594
3365 Ga0466957_0178423
3366 Ga0466959_0007114
3367 Ga0466959_0015161
3368 Ga0451576_0000001
3369 Ga0451576_0000019
3370 Ga0451576_0000213
3371 Ga0451576_0001202
3372 Ga0451576_0012429
3373 Ga0451576_0016088
3374 Ga0451576_0024883
3375 Ga0451576_0036606
3376 Ga0451576_0094400
3377 Ga0451576_0170485
3378 Ga0451576_0775981
3379 Ga0451576_0875787
3380 Ga0451576_1066620
3381 Ga0466958_0004041
3382 Ga0466958_0010957
3383 Ga0466967_0061444
3384 Ga0466967_0353804
3385 Ga0495627_000443
3386 Ga0495592_0044537
3387 Ga0495603_0047372
3388 Ga0495629_0235070
3389 Ga0495580_0193675
3390 Ga0495662_0193291
3391 Ga0495584_0011661
3392 Ga0495583_0000020
3393 Ga0495606_0037111
3394 Ga0495608_0027558
3395 Ga0495610_0040933
3396 Ga0495618_0202566
3397 Ga0495628_0288816
3398 Ga0495630_0560077
3399 Ga0495632_0015594
3400 Ga0495643_0080866
3401 Ga0495648_0101400
3402 Ga0495640_0400802
3403 Ga0495598_0007838
3404 Ga0495621_0005527
3405 Ga0495597_0048524
3406 Ga0495645_0200046
3407 Ga0495622_0002426
3408 Ga0495633_0152475
3409 Ga0495668_0209532
3410 Ga0495625_0026301
3411 Ga0495625_0403083
3412 Ga0495599_0259220
3413 Ga0495658_0429262
3414 Ga0495669_0030631
3415 Ga0495669_0158264
3416 Ga0495670_0000265
3417 Ga0495604_0187267
3418 Ga0495636_0111664
3419 Ga0495672_0071022
3420 Ga0495683_0053018
3421 Ga0495681_0011264
3422 Ga0495684_0144711
3423 Ga0495686_0170494
3424 Ga0495593_0041920
3425 Ga0495593_0066861
3426 Ga0495602_0014256
3427 Ga0496100_0039379
3428 Ga0496100_0064222
3429 Ga0496100_0136829
3430 Ga0496100_0142886
3431 Ga0496101_0005585
3432 Ga0496101_0016841
3433 Ga0496101_0113614
3434 Ga0496101_0138124
3435 Ga0496102_0002747
3436 Ga0496102_0005255
3437 Ga0496102_0033196
3438 Ga0496102_0131609
3439 Ga0496102_0260303
3440 Ga0496102_0331589
3441 Ga0496103_0002057
3442 Ga0496103_0020842
3443 Ga0496103_0027204
3444 Ga0496104_0010951
3445 Ga0496104_0017799
3446 Ga0496104_0094192
3447 Ga0496104_0149079
3448 Ga0496104_0306260
3449 Ga0496104_0351283
3450 Ga0496104_0890781
3451 Ga0496105_0008864
3452 Ga0496105_0044390
3453 Ga0496105_0172825
3454 Ga0496105_0268040
3455 Ga0496106_0004676
3456 Ga0496106_0005250
3457 Ga0496106_0020957
3458 Ga0496106_0069286
3459 Ga0496106_0133009
3460 Ga0496106_0177142
3461 Ga0496107_0001506
3462 Ga0496107_0006946
3463 Ga0496107_0055141
3464 Ga0496107_0062331
3465 Ga0496107_0128403
3466 Ga0496107_0236291
3467 Ga0496108_0013562
3468 Ga0496108_0032831
3469 Ga0496108_0037537
3470 Ga0496108_0076730
3471 Ga0496108_0098113
3472 Ga0496108_0299570
3473 Ga0496109_0006013
3474 Ga0496109_0020848
3475 Ga0496109_0027322
3476 Ga0496109_0116835
3477 Ga0496109_0151170
3478 Ga0496109_0164906
3479 Ga0496109_0533397
3480 Ga0496110_0042694
3481 Ga0496110_0087569
3482 Ga0496110_0116341
3483 Ga0496110_0168117
3484 Ga0496110_0638853
3485 Ga0496111_0000242
3486 Ga0496111_0028631
3487 Ga0496112_0001235
3488 Ga0496112_0025166
3489 Ga0496112_0031568
3490 Ga0496112_0031888
3491 Ga0496112_0332913
3492 Ga0496112_0456462
3493 Ga0496112_0583431
3494 Ga0496113_0287318
3495 Ga0496114_0036337
3496 Ga0496114_0173980
3497 Ga0496114_0205853
3498 Ga0496114_0303375
3499 Ga0496115_0052518
3500 Ga0496115_0087400
3501 Ga0496117_0003941
3502 Ga0496118_0002145
3503 Ga0496118_0084428
3504 Ga0496119_0003925
3505 Ga0496119_0020238
3506 Ga0496119_0080829
3507 Ga0496119_0103005
3508 Ga0496119_0105036
3509 Ga0496119_0199427
3510 Ga0496120_0008156
3511 Ga0496120_0102441
3512 Ga0496121_0000009
3513 Ga0496121_0000751
3514 Ga0496121_0065751
3515 Ga0496121_0269258
3516 Ga0496122_0000025
3517 Ga0496122_0034633
3518 Ga0496122_0098694
3519 Ga0496123_0000054
3520 Ga0496123_0030694
3521 Ga0496124_0036426
3522 Ga0496124_0048353
3523 Ga0496124_0080967
3524 Ga0496125_0043147
3525 Ga0496125_0047369
3526 Ga0496125_0188098
3527 Ga0496126_0073247
3528 Ga0496126_0201568
3529 Ga0501293_007669
3530 Ga0501296_002969
3531 Ga0501297_011866
3532 Ga0501298_005636
3533 Ga0501299_002465
3534 Ga0501031_0005703
3535 Ga0501031_0049069
3536 Ga0501031_0103948
3537 Ga0501031_0261108
3538 Ga0501031_0262297
3539 Ga0501032_0000064
3540 Ga0501032_0001600
3541 Ga0501032_0025086
3542 Ga0501032_0031757
3543 Ga0501032_0032937
3544 Ga0501032_0068479
3545 Ga0501032_0235317
3546 Ga0501032_0489339
3547 Ga0501033_0000286
3548 Ga0501033_0002532
3549 Ga0501033_0016268
3550 Ga0501033_0020977
3551 Ga0501033_0045254
3552 Ga0501033_0088657
3553 Ga0501033_0093339
3554 Ga0501033_0116907
3555 Ga0501033_0143786
3556 Ga0501033_0192474
3557 Ga0501033_0206863
3558 Ga0501034_0000097
3559 Ga0501034_0000174
3560 Ga0501034_0002221
3561 Ga0501034_0002380
3562 Ga0501034_0022346
3563 Ga0501034_0024404
3564 Ga0501034_0076402
3565 Ga0501034_0083319
3566 Ga0501034_0107639
3567 Ga0501034_0120131
3568 Ga0501034_0134238
3569 Ga0501034_0220435
3570 Ga0501034_0233815
3571 Ga0501034_0243812
3572 Ga0501034_0254534
3573 Ga0501034_0270112
3574 Ga0501034_0592451
3575 Ga0501034_0610149
3576 Ga0501034_0668045
3577 Ga0501036_0004998
3578 Ga0501036_0054187
3579 Ga0501036_0077234
3580 Ga0501036_0182860
3581 Ga0501036_0298455
3582 Ga0501036_0488418
3583 Ga0501036_0820233
3584 Ga0501037_0000118
3585 Ga0501037_0006091
3586 Ga0501037_0053085
3587 Ga0501037_0136640
3588 Ga0501037_0155025
3589 Ga0501037_0204238
3590 Ga0501037_0483499
3591 Ga0501038_0000031
3592 Ga0501038_0003995
3593 Ga0501038_0007946
3594 Ga0501038_0028402
3595 Ga0501038_0041630
3596 Ga0501038_0041926
3597 Ga0501038_0157169
3598 Ga0501038_0165500
3599 Ga0501038_0316604
3600 Ga0501038_0498346
3601 Ga0501039_0000057
3602 Ga0501039_0017563
3603 Ga0501039_0041392
3604 Ga0501039_0047324
3605 Ga0501039_0216886
3606 Ga0501040_0001144
3607 Ga0501040_0189556
3608 Ga0501041_0042622
3609 Ga0501043_0000048
3610 Ga0501043_0054965
3611 Ga0501043_0072840
3612 Ga0501043_0103181
3613 Ga0501043_0133472
3614 Ga0501043_0156188
3615 Ga0501043_0164505
3616 Ga0501043_0238183
3617 Ga0501043_0569552
3618 Ga0501046_0010968
3619 Ga0501046_0014309
3620 Ga0501046_0026372
3621 Ga0501046_0051871
3622 Ga0501046_0204766
3623 Ga0501046_0338445
3624 Ga0501046_0368610
3625 Ga0501046_0401988
3626 Ga0501047_0003748
3627 Ga0501047_0008494
3628 Ga0501047_0048076
3629 Ga0501047_0054470
3630 Ga0501047_0062229
3631 Ga0501047_0069524
3632 Ga0501047_0152583
3633 Ga0501047_0186826
3634 Ga0501047_0252256
3635 Ga0501047_0317678
3636 Ga0501047_0442731
3637 Ga0501047_0458236
3638 Ga0501047_0478199
3639 Ga0501047_0514213
3640 Ga0501047_0591718
3641 Ga0501048_0030793
3642 Ga0501048_0057459
3643 Ga0501048_0125816
3644 Ga0501048_0186831
3645 Ga0501067_0027568
3646 Ga0501067_0051142
3647 Ga0501067_0097648
3648 Ga0501067_0121329
3649 Ga0501067_0189576
3650 Ga0501067_0242958
3651 Ga0501067_0351840
3652 Ga0501068_0035832
3653 Ga0501068_0065095
3654 Ga0501068_0085297
3655 Ga0501068_0095279
3656 Ga0501068_0294420
3657 Ga0501069_0020534
3658 Ga0501069_0047390
3659 Ga0501069_0248398
3660 Ga0501070_0029009
3661 Ga0501070_0029317
3662 Ga0501070_0039424
3663 Ga0501070_0051500
3664 Ga0501070_0052146
3665 Ga0501070_0087469
3666 Ga0501070_0318144
3667 Ga0501071_0032763
3668 Ga0501071_0039321
3669 Ga0501071_0181489
3670 Ga0501071_0222043
3671 Ga0501072_0109972
3672 Ga0501072_0110278
3673 Ga0501072_0308239
3674 Ga0501072_0496817
3675 Ga0501072_0582490
3676 Ga0501073_0014781
3677 Ga0501073_0020495
3678 Ga0501073_0089425
3679 Ga0501073_0090002
3680 Ga0501073_0108511
3681 Ga0501073_0458198
3682 Ga0501073_0531311
3683 Ga0501074_0013095
3684 Ga0501074_0023939
3685 Ga0501074_0024895
3686 Ga0501074_0057774
3687 Ga0501074_0081104
3688 Ga0501075_0005167
3689 Ga0501075_0028092
3690 Ga0501076_0006377
3691 Ga0501076_0191194
3692 Ga0501076_0321462
3693 Ga0501077_0009579
3694 Ga0501077_0098052
3695 Ga0501202_023766
3696 Ga0501202_039277
3697 Ga0501217_081826
3698 Ga0501223_001670
3699 Ga0501233_006769
3700 Ga0501235_003437
3701 Ga0501235_016642
3702 Ga0501249_042551
3703 Ga0501255_020100
3704 Ga0501261_013782
3705 Ga0501225_0001550
3706 Ga0501225_0044761
3707 Ga0501234_002639
3708 Ga0501079_0007423
3709 Ga0501079_0035953
3710 Ga0501079_0059738
3711 Ga0501079_0201938
3712 Ga0501079_0244124
3713 Ga0501079_0410660
3714 Ga0501080_0008721
3715 Ga0501080_0009091
3716 Ga0501080_0009451
3717 Ga0501080_0051261
3718 Ga0501080_0069725
3719 Ga0501080_0115442
3720 Ga0501080_0127479
3721 Ga0501080_0156121
3722 Ga0501080_0284471
3723 Ga0501081_0001736
3724 Ga0501081_0023556
3725 Ga0501081_0149491
3726 Ga0501083_0044651
3727 Ga0501083_0049244
3728 Ga0501083_0063763
3729 Ga0501083_0243283
3730 Ga0501083_0288918
3731 Ga0501083_0429998
3732 Ga0501270_007195
3733 Ga0501283_000325
3734 Ga0501035_0000118
3735 Ga0501035_0003976
3736 Ga0501035_0030120
3737 Ga0501035_0059706
3738 Ga0501035_0083249
3739 Ga0501035_0096309
3740 Ga0501035_0105131
3741 Ga0501035_0290401
3742 Ga0501035_0344252
3743 Ga0501044_0000504
3744 Ga0501044_0021869
3745 Ga0501044_0056387
3746 Ga0501044_0076395
3747 Ga0501044_0079183
3748 Ga0501044_0103067
3749 Ga0501044_0165513
3750 Ga0501044_0172041
3751 Ga0501044_0213873
3752 Ga0501044_0235427
3753 Ga0501044_0265553
3754 Ga0501044_0299120
3755 Ga0501044_0318935
3756 Ga0501044_0441433
3757 Ga0501044_0589506
3758 Ga0501045_0004800
3759 Ga0501045_0473744
3760 Ga0501226_005037
3761 nmdc:mga03n38_226150_c1
3762 nmdc:mga03n38_35806_c1
3763 nmdc:mga00v17_276191_c1
3764 nmdc:mga0yw44_18283_c1
3765 nmdc:mga0yw44_21084_c1
3766 nmdc:mga0yw44_398199_c1
3767 nmdc:mga06z11_27303_c1
3768 nmdc:mga04h51_19968_c1
3769 nmdc:mga07m45_12880_c1
3770 nmdc:mga07m45_20065_c1
3771 nmdc:mga05p37_115286_c1
3772 nmdc:mga05p37_1172521_c1
3773 nmdc:mga05p37_285757_c1
3774 nmdc:mga05p37_300144_c1
3775 nmdc:mga05p37_31141_c1
3776 nmdc:mga05p37_317055_c1
3777 nmdc:mga05p37_329514_c1
3778 nmdc:mga05p37_486728_c1
3779 nmdc:mga05p37_734563_c1
3780 nmdc:mga09592_23768_c1
3781 nmdc:mga0qj67_72848_c1
3782 nmdc:mga06r32_12560_c1
3783 nmdc:mga06r32_433336_c1
3784 nmdc:mga06r32_976_c1
3785 nmdc:mga08y16_1009107_c1
3786 nmdc:mga08y16_226482_c1
3787 nmdc:mga08y16_278776_c1
3788 nmdc:mga08y16_292919_c1
3789 nmdc:mga08y16_72419_c1
3790 nmdc:mga08y16_75051_c1
3791 nmdc:mga08y16_86150_c1
3792 nmdc:mga0n895_129906_c1
3793 nmdc:mga0n895_141334_c1
3794 nmdc:mga0n895_226829_c1
3795 nmdc:mga0n895_240226_c1
3796 nmdc:mga0n895_2522_c1
3797 nmdc:mga0n895_594604_c1
3798 nmdc:mga0n895_89055_c1
3799 nmdc:mga0rr50_10031_c1
3800 nmdc:mga0rr50_137562_c1
3801 nmdc:mga0rr50_169_c1
3802 nmdc:mga08x19_26_c1
3803 nmdc:mga0a205_132190_c1
3804 nmdc:mga0a205_289709_c1
3805 nmdc:mga0a205_323773_c1
3806 nmdc:mga0a205_347774_c1
3807 nmdc:mga0a205_460169_c1
3808 nmdc:mga0a205_72336_c1
3809 nmdc:mga0a205_84763_c1
3810 Ga0495601_0000235
3811 Ga0500610_0168365
3812 Ga0500635_0000302
3813 Ga0500635_0001280
3814 Ga0495655_0011188
3815 Ga0495595_0017221
3816 Ga0495619_0035488
3817 Ga0495619_0117877
3818 Ga0495619_0351034
3819 Ga0500578_0140706
3820 Ga0500647_0026024
3821 Ga0500651_0016713
3822 Ga0500566_0041234
3823 Ga0500641_0003377
3824 Ga0500641_0005166
3825 Ga0500562_003232
3826 Ga0500593_000013
3827 Ga0500595_006840
3828 Ga0500608_000573
3829 Ga0500614_001562
3830 Ga0500618_002996
3831 Ga0500618_003083
3832 Ga0500618_036011
3833 Ga0500655_015690
3834 Ga0500559_0084876
3835 Ga0500559_0182351
3836 Ga0500564_158915
3837 Ga0500573_0000008
3838 Ga0500573_0077380
3839 Ga0500577_0006420
3840 Ga0500577_0025434
3841 Ga0500616_0000250
3842 Ga0500616_0000797
3843 Ga0500616_0004513
3844 Ga0500616_0032743
3845 Ga0500620_000225
3846 Ga0500620_107336
3847 Ga0500622_0037248
3848 Ga0500627_0095586
3849 Ga0500638_166041
3850 Ga0500639_040789
3851 Ga0500636_0010526
3852 Ga0500637_0010845
3853 Ga0500637_0187572
3854 Ga0500625_088391
3855 Ga0500645_022384
3856 Ga0500645_069379
3857 Ga0500596_003174
3858 Ga0501084_0000137
3859 Ga0501084_0001317
3860 Ga0501084_0016901
3861 Ga0501084_0023706
3862 Ga0501084_0036990
3863 Ga0501084_0061753
3864 Ga0501084_0226380
3865 Ga0501084_0240168
3866 Ga0501084_0425019
3867 Ga0501084_0514318
3868 Ga0501082_0004024
3869 Ga0501082_0006081
3870 Ga0501082_0015392
3871 Ga0501082_0100996
3872 Ga0501082_0388232
3873 Ga0501082_0721415
3874 Ga0466962_0005568
3875 Ga0466962_0005965
3876 Ga0466962_0063868
3877 Ga0530510_0003542
3878 Ga0530510_0007842
3879 2503202330
3880 2509370432
3881 2510317396
3882 2512930770
3883 2512958499
3884 2513609818
3885 2514035088
3886 2523107326
3887 2524536916
3888 2538427084
3889 2561468298
3890 2588516432
3891 2599720883
3892 2599940040
3893 2643775671
3894 2643794118
3895 2643988106
3896 2644155281
3897 2673167664
3898 2688070184
3899 2688599312
3900 2692316460
3901 2694632106
3902 2694634487
3903 2707100829
3904 2715500121
3905 2756675784
3906 2792581223
3907 2792623229
3908 2792626993
3909 2792745993
3910 2793281495
3911 2819688596
3912 2821127798
3913 2828309680
3914 2834578651
3915 2838738222
3916 2841841408
3917 2841859422
3918 2842141186
3919 2842516206
3920 2844006554
3921 2844014595
3922 2847418474
3923 2847670720
3924 2847693055
3925 2848993452
3926 2852104164
3927 2854604223
3928 2855199189
3929 2855873363
3930 2856316176
3931 2856325988
3932 2856330435
3933 2856340521
3934 2856368938
3935 2857349514
3936 2857370737
3937 2857534461
3938 2857732589
3939 2858468106
3940 2869170140
3941 2869239750
3942 2869248441
3943 2869250070
3944 2869258256
3945 2869270969
3946 2869272585
3947 2869278745
3948 2869291457
3949 2871276570
3950 2871284836
3951 2871433737
3952 2871442259
3953 2871455440
3954 2871461625
3955 2871484452
3956 2871500638
3957 2874103493
3958 2874116192
3959 2874117189
3960 2874133731
3961 2874145330
3962 2874153314
3963 2874160579
3964 2874165777
3965 2874176346
3966 2876365559
3967 2876384962
3968 2876391333
3969 2876395080
3970 2876403161
3971 2876412434
3972 2876419605
3973 2876425387
3974 2878041500
3975 2878737053
3976 2878743578
3977 2878751348
3978 2878764727
3979 2878771828
3980 2878778322
3981 2878787922
3982 2881152749
3983 2881168447
3984 2884965065
3985 2885310422
3986 2885331659
3987 2885338486
3988 2888340263
3989 2888356690
3990 2889011566
3991 2889023328
3992 2889420872
3993 2894818949
3994 2900055063
3995 2903455725
3996 2903501864
3997 2903517899
3998 2903522915
3999 2903533105
4000 2903545451
4001 2904509211
4002 2904661711
4003 2906313265
4004 2906325976
4005 2906335164
4006 2906368027
4007 2906375860
4008 2906379095
4009 2906389644
4010 2906397538
4011 2906405968
4012 2906412756
4013 2906416313
4014 2908743378
4015 2917557072
4016 2919680938
4017 2920110133
4018 2922137271
4019 2922153453
4020 2922164208
4021 2922174153
4022 2922182209
4023 2922186504
4024 2924713233
4025 2924726342
4026 2924728209
4027 2924735925
4028 2924746576
4029 2924768866
4030 2924781390
4031 2928122931
4032 2935633614
4033 2937820585
4034 2937827171
4035 2937853856
4036 2937864342
4037 2937879101
4038 2937898304
4039 2937975153
4040 2937985267
4041 2937999301
4042 2958034861
4043 2958043010
4044 2958067105
4045 2958086275
4046 2958104572
4047 2958109233
4048 2958122358
4049 2958129193
4050 2958135856
4051 2958151130
4052 2958161519
4053 2958169775
4054 2958177564
4055 2958185323
4056 2961083590
4057 2961116864
4058 2961143907
4059 2961168235
4060 2961187387
4061 2963648456
4062 2965023054
4063 2965029412
4064 2965036658
4065 2965045426
4066 2965051761
4067 2965068400
4068 2965122262
4069 2968017730
4070 2968084970
4071 2968091901
4072 2968099405
4073 2968112771
4074 2968122993
4075 2968129962
4076 2968140158
4077 2968176635
4078 2970472095
4079 2970495933
4080 2970516441
4081 2970535548
4082 2970548212
4083 2970559574
4084 2970593341
4085 2970624037
4086 2970633962
4087 2977848883
4088 2977851986
4089 2977861855
4090 2977867554
4091 2977877940
4092 2977906076
4093 2977917864
4094 2977928986
4095 2977941519
4096 2977947047
4097 2977957422
4098 2977958780
4099 2977978591
4100 2979711814
4101 2979752058
4102 2979769689
4103 2979777917
4104 2979786103
4105 2979797597
4106 2987645421
4107 2987649830
4108 2987658290
4109 2987664249
4110 2987670544
4111 2987677347
4112 2995728088
4113 2996348394
4114 2996351027
4115 2996392675
4116 3000018694
4117 3003933368
4118 3004169703
4119 3004193304
4120 3004206328
4121 3004241853
4122 3004254174
4123 3004275307
4124 3004277725
4125 3004296135
4126 3004340875
4127 637073816
4128 649873817
4129 8004304783
4130 8004366751
4131 8004393988
4132 8004447230
4133 8004646830
4134 8004713792
4135 8004719521
4136 8004730442
4137 8006941435
4138 8006981148
4139 8049294366
4140 8054565037
4141 8055035903
4142 8055038543

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

45

292

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9824 1 240
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9807 1 239
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9796 1 241
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.9759 1 239
6nlh-assembly4.cif.gz_H structure of human triose phosphate isomerase r189a 0.9718 1 241
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9796 1 241 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9779 29 241 3.20.20.70
af_P17751_41_299_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9687 29 241 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 1 239 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 1 241 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S4TA46-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9995 114 238 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A351UNB1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9992 79 237 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7S0CIF1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9971 107 238 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A645DQY7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9961 84 239 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A660REK8-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.996 81 239 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map