F496347
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2071 | 772 | 4142 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100004306|Ga0070659_1000043064 |
| Length | 293 |
| Sequence | VLHPVASLAVLYWWLAVQPNPSFNAKRLAKIKDLRSKTKSNMRKPVIAGNWKMYKTLGEAVDTALSLKPLVANANHCEVVIAPVFTALKTVADRLEGSNIHVAGQDCATQNEEGAHTGEIAPFMLRDVGARYVIIGHSERRQFYGETDKTVNQKTKAALAAGLTAIVCVGESLEQRDQGNAQNVVGNQVTGGLVELTASDLDRIILAYEPVWAIGTGRTATPEQAQEMHAFIRRVFADRHSTEAAASVRVLYGGSVKPDNIAGLMGQGDIDGALVGGASLKAESFAEIVNFKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 161 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 165 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 167 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 254 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 255 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 257 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 264 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 266 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 267 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 268 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 269 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 270 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 271 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 273 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 274 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 275 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 277 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 278 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 279 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 280 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 281 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 282 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 283 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 284 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 289 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 290 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 291 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 298 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 300 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 306 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 315 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 316 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 317 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 318 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 319 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 320 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 321 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 322 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 323 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 324 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 325 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 326 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 327 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 328 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 329 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 330 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 335 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 336 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 337 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 338 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 339 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 340 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 384 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 385 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 386 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 387 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 388 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 389 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 392 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 393 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 394 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 395 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 396 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 397 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 398 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 399 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 400 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 401 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 402 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 403 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 404 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 405 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 406 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 407 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 408 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 409 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 410 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 411 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 412 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 439 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 440 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 441 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 443 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 444 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 446 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 447 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 452 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 457 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 458 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 459 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 475 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 485 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 488 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 490 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 491 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 493 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 494 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 495 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 496 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 497 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 500 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 502 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 503 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 505 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 508 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 509 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 510 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 511 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 512 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 513 | 2512875024 | |||
| 514 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 515 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 516 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 517 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 518 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 519 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 520 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 521 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 522 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 523 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 524 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 525 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 526 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 527 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 528 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 529 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 530 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 531 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 532 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 533 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 534 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 535 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 536 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 537 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 538 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 539 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 540 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 541 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 542 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 543 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 544 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 545 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 546 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 547 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 548 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 549 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 550 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 551 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 552 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 553 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 554 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 555 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 556 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 557 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 558 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 559 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 560 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 561 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 562 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 563 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 564 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 565 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 566 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 567 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 568 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 569 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 570 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 571 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 572 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 573 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 574 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 575 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 576 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 577 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 578 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 579 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 580 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 581 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 582 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 583 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 584 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 585 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 586 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 587 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 588 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 589 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 590 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 591 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 592 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 593 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 594 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 595 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 596 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 597 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 598 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 599 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 600 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 601 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 602 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 603 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 604 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 605 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 606 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 607 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 608 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 609 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 610 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 611 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 612 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 613 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 614 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 615 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 616 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 617 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 618 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 619 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 620 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 621 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 622 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 623 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 624 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 625 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 626 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 627 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 628 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 629 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 630 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 631 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 632 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 633 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 634 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 635 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 636 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 637 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 638 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 639 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 640 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 641 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 642 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 643 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 644 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 645 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 646 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 647 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 648 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 649 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 650 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 651 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 652 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 653 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 654 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 655 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 656 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 657 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 658 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 659 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 660 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 661 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 662 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 663 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 664 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 665 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 666 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 667 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 668 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 669 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 670 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 671 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 672 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 673 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 674 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 675 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 676 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 677 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 678 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 679 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 680 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 681 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 682 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 683 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 684 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 685 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 686 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 687 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 688 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 689 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 690 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 691 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 692 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 693 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 694 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 695 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 696 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 697 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 698 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 699 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 700 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 701 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 702 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 703 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 704 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 705 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 706 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 707 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 708 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 709 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 710 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 711 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 712 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 713 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 714 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 715 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 716 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 717 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 718 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 719 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 720 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 721 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 722 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 723 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 724 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 725 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 726 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 727 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 728 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 729 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 730 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 731 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 732 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 733 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 734 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 735 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 736 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 737 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 738 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 739 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 740 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 741 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 742 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 743 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 744 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 745 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 746 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 747 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 748 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 749 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 750 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 751 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 752 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 753 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 754 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 755 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 756 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 757 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 758 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 759 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 760 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 761 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 762 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 763 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 764 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 765 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 766 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 767 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 768 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 769 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 770 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 771 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 772 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.62 |
| Metatranscriptomes | 0.63 |
| Isolates | 12.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.15 |
| Nodule | 9.85 |
| Rhizoplane | 3.77 |
| Rhizosphere | 75.42 |
| Stem | 0 |
| Stem Tuber | 0.29 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070659_100004306 | 3300005366 | Bacteria | 10162 |
| 2 | CNAas_1000040 | 3300000532 | Bacteria | 8742 |
| 3 | JGI24740J21852_10006921 | 3300001979 | Bacteria | 4655 |
| 4 | JGI24739J22299_10049812 | 3300001989 | Bacteria | 1357 |
| 5 | JGI24737J22298_10040690 | 3300001990 | Bacteria | 1426 |
| 6 | JGI24735J21928_10015514 | 3300002067 | Bacteria | 2376 |
| 7 | JGI24735J21928_10021675 | 3300002067 | Bacteria | 1960 |
| 8 | JGI24750J21931_1014682 | 3300002070 | Bacteria | 1055 |
| 9 | JGI24034J26672_10000026 | 3300002239 | Bacteria | 109498 |
| 10 | JGI24751J29686_10000030 | 3300002459 | Bacteria | 92588 |
| 11 | JGI25162J39368_1000075 | 3300002737 | Bacteria | 120760 |
| 12 | JGI25157J39369_1000694 | 3300002741 | Bacteria | 18206 |
| 13 | JGI25406J46586_10003840 | 3300003203 | Bacteria | 7021 |
| 14 | JGI25406J46586_10059736 | 3300003203 | Bacteria | 1237 |
| 15 | JGI25406J46586_10077736 | 3300003203 | Bacteria | 1025 |
| 16 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 17 | JGI25165J46597_1010963 | 3300003214 | Bacteria | 1307 |
| 18 | rootH2_10077725 | 3300003320 | Bacteria | 4265 |
| 19 | rootH2_10078133 | 3300003320 | Bacteria | 1155 |
| 20 | rootH2_10198277 | 3300003320 | Bacteria | 4919 |
| 21 | rootL2_10259676 | 3300003322 | Bacteria | 2900 |
| 22 | rootH1_10005877 | 3300003323 | Bacteria | 4516 |
| 23 | rootH1_10012091 | 3300003323 | Bacteria | 4371 |
| 24 | JGI25160J50197_1002193 | 3300003354 | Bacteria | 9182 |
| 25 | JGI25404J52841_10010830 | 3300003659 | Bacteria | 1962 |
| 26 | Ga0055529_1001715 | 3300003763 | Bacteria | 5611 |
| 27 | Ga0065165_1004344 | 3300005262 | Bacteria | 8892 |
| 28 | Ga0065714_10064504 | 3300005288 | Bacteria | 46817 |
| 29 | Ga0065704_10128089 | 3300005289 | Bacteria | 1667 |
| 30 | Ga0065704_10139293 | 3300005289 | Unclassified | 1535 |
| 31 | Ga0065704_10209631 | 3300005289 | Bacteria | 1114 |
| 32 | Ga0065712_10067766 | 3300005290 | Bacteria | 46828 |
| 33 | Ga0065712_10079152 | 3300005290 | Bacteria | 3253 |
| 34 | Ga0065712_10120433 | 3300005290 | Bacteria | 1678 |
| 35 | Ga0065712_10122253 | 3300005290 | Unclassified | 1654 |
| 36 | Ga0065712_10182341 | 3300005290 | Bacteria | 1186 |
| 37 | Ga0065715_10001956 | 3300005293 | Bacteria | 5504 |
| 38 | Ga0065715_10022986 | 3300005293 | Bacteria | 1475 |
| 39 | Ga0065715_10041779 | 3300005293 | Bacteria | 1617 |
| 40 | Ga0065715_10089158 | 3300005293 | Bacteria | 13366 |
| 41 | Ga0065715_10152536 | 3300005293 | Bacteria | 1712 |
| 42 | Ga0065715_10188464 | 3300005293 | Bacteria | 1430 |
| 43 | Ga0065715_10301965 | 3300005293 | Bacteria | 1039 |
| 44 | Ga0065707_10195597 | 3300005295 | Unclassified | 1336 |
| 45 | Ga0065707_10199019 | 3300005295 | Bacteria | 1320 |
| 46 | Ga0065707_10237340 | 3300005295 | Bacteria | 1168 |
| 47 | Ga0065707_10288125 | 3300005295 | Bacteria | 1031 |
| 48 | Ga0070658_10001208 | 3300005327 | Bacteria | 22135 |
| 49 | Ga0070658_10014417 | 3300005327 | Bacteria | 6343 |
| 50 | Ga0070658_10056805 | 3300005327 | Bacteria | 3182 |
| 51 | Ga0070676_10002075 | 3300005328 | Bacteria | 10197 |
| 52 | Ga0070683_100001378 | 3300005329 | Bacteria | 18632 |
| 53 | Ga0070683_100073796 | 3300005329 | Bacteria | 3185 |
| 54 | Ga0070690_100000812 | 3300005330 | Bacteria | 15800 |
| 55 | Ga0070690_100001011 | 3300005330 | Bacteria | 14383 |
| 56 | Ga0070690_100001334 | 3300005330 | Bacteria | 12820 |
| 57 | Ga0070690_100236242 | 3300005330 | Bacteria | 1287 |
| 58 | Ga0070670_100002791 | 3300005331 | Bacteria | 14445 |
| 59 | Ga0070670_100033283 | 3300005331 | Bacteria | 4440 |
| 60 | Ga0070670_100133728 | 3300005331 | Bacteria | 2142 |
| 61 | Ga0070670_100604021 | 3300005331 | Bacteria | 982 |
| 62 | Ga0070677_10000526 | 3300005333 | Bacteria | 13130 |
| 63 | Ga0070677_10152901 | 3300005333 | Bacteria | 1076 |
| 64 | Ga0068869_100103722 | 3300005334 | Unclassified | 2155 |
| 65 | Ga0068869_100143427 | 3300005334 | Bacteria | 1846 |
| 66 | Ga0068869_100168917 | 3300005334 | Bacteria | 1708 |
| 67 | Ga0068869_100250304 | 3300005334 | Bacteria | 1415 |
| 68 | Ga0070666_10001337 | 3300005335 | Bacteria | 14951 |
| 69 | Ga0070666_10018053 | 3300005335 | Bacteria | 4530 |
| 70 | Ga0070666_10051188 | 3300005335 | Bacteria | 2780 |
| 71 | Ga0070666_10088334 | 3300005335 | Bacteria | 2126 |
| 72 | Ga0070680_100001985 | 3300005336 | Bacteria | 15054 |
| 73 | Ga0070680_100010302 | 3300005336 | Bacteria | 7206 |
| 74 | Ga0070680_100012770 | 3300005336 | Bacteria | 6531 |
| 75 | Ga0070680_100326609 | 3300005336 | Unclassified | 1303 |
| 76 | Ga0070682_100023706 | 3300005337 | Bacteria | 3645 |
| 77 | Ga0070682_100029208 | 3300005337 | Bacteria | 3319 |
| 78 | Ga0070682_100034027 | 3300005337 | Bacteria | 3100 |
| 79 | Ga0068868_100001472 | 3300005338 | Bacteria | 16253 |
| 80 | Ga0068868_100035781 | 3300005338 | Bacteria | 3840 |
| 81 | Ga0068868_100039981 | 3300005338 | Bacteria | 3647 |
| 82 | Ga0070660_100001829 | 3300005339 | Bacteria | 14621 |
| 83 | Ga0070660_100005970 | 3300005339 | Bacteria | 8417 |
| 84 | Ga0070660_100018548 | 3300005339 | Bacteria | 5086 |
| 85 | Ga0070660_100042990 | 3300005339 | Bacteria | 3451 |
| 86 | Ga0070660_100071913 | 3300005339 | Bacteria | 2701 |
| 87 | Ga0070660_100111006 | 3300005339 | Bacteria | 2181 |
| 88 | Ga0070689_100003426 | 3300005340 | Bacteria | 10550 |
| 89 | Ga0070689_100040778 | 3300005340 | Bacteria | 3560 |
| 90 | Ga0070689_100128362 | 3300005340 | Bacteria | 2031 |
| 91 | Ga0070689_100440593 | 3300005340 | Bacteria | 1107 |
| 92 | Ga0070691_10020783 | 3300005341 | Bacteria | 3034 |
| 93 | Ga0070691_10041162 | 3300005341 | Bacteria | 2184 |
| 94 | Ga0070691_10157322 | 3300005341 | Bacteria | 1169 |
| 95 | Ga0070687_100000129 | 3300005343 | Bacteria | 26037 |
| 96 | Ga0070687_100170001 | 3300005343 | Unclassified | 1297 |
| 97 | Ga0070687_100271253 | 3300005343 | Bacteria | 1063 |
| 98 | Ga0070661_100001499 | 3300005344 | Bacteria | 16227 |
| 99 | Ga0070661_100004800 | 3300005344 | Bacteria | 9309 |
| 100 | Ga0070661_100011435 | 3300005344 | Bacteria | 6183 |
| 101 | Ga0070661_100020420 | 3300005344 | Bacteria | 4723 |
| 102 | Ga0070661_100113963 | 3300005344 | Bacteria | 2021 |
| 103 | Ga0070661_100340548 | 3300005344 | Bacteria | 1175 |
| 104 | Ga0070692_10056376 | 3300005345 | Unclassified | 2057 |
| 105 | Ga0070692_10078838 | 3300005345 | Bacteria | 1769 |
| 106 | Ga0070668_100001092 | 3300005347 | Bacteria | 19121 |
| 107 | Ga0070668_100020391 | 3300005347 | Bacteria | 5002 |
| 108 | Ga0070668_100312028 | 3300005347 | Bacteria | 1322 |
| 109 | Ga0070669_100001544 | 3300005353 | Bacteria | 16649 |
| 110 | Ga0070669_100047892 | 3300005353 | Bacteria | 3119 |
| 111 | Ga0070669_100066581 | 3300005353 | Unclassified | 2655 |
| 112 | Ga0070669_100115061 | 3300005353 | Bacteria | 2045 |
| 113 | Ga0070669_100321252 | 3300005353 | Bacteria | 1250 |
| 114 | Ga0070669_100520740 | 3300005353 | Bacteria | 989 |
| 115 | Ga0070675_100011835 | 3300005354 | Bacteria | 6836 |
| 116 | Ga0070675_100116649 | 3300005354 | Bacteria | 2265 |
| 117 | Ga0070675_100469098 | 3300005354 | Bacteria | 1131 |
| 118 | Ga0070671_100001853 | 3300005355 | Bacteria | 16122 |
| 119 | Ga0070671_100073369 | 3300005355 | Bacteria | 2858 |
| 120 | Ga0070671_100089287 | 3300005355 | Bacteria | 2580 |
| 121 | Ga0070671_100155199 | 3300005355 | Bacteria | 1934 |
| 122 | Ga0070671_100228293 | 3300005355 | Bacteria | 1580 |
| 123 | Ga0070674_100356481 | 3300005356 | Bacteria | 1183 |
| 124 | Ga0070673_100082833 | 3300005364 | Bacteria | 2605 |
| 125 | Ga0070673_100172015 | 3300005364 | Bacteria | 1849 |
| 126 | Ga0070673_100272870 | 3300005364 | Bacteria | 1481 |
| 127 | Ga0070673_100288759 | 3300005364 | Bacteria | 1441 |
| 128 | Ga0070673_100351064 | 3300005364 | Bacteria | 1309 |
| 129 | Ga0070673_100525780 | 3300005364 | Bacteria | 1072 |
| 130 | Ga0070688_100000657 | 3300005365 | Bacteria | 17170 |
| 131 | Ga0070688_100006128 | 3300005365 | Bacteria | 6395 |
| 132 | Ga0070659_100002328 | 3300005366 | Bacteria | 13511 |
| 133 | Ga0070659_100013504 | 3300005366 | Bacteria | 6080 |
| 134 | Ga0070659_100023287 | 3300005366 | Bacteria | 4738 |
| 135 | Ga0070659_100081787 | 3300005366 | Bacteria | 2580 |
| 136 | Ga0070659_100352857 | 3300005366 | Bacteria | 1234 |
| 137 | Ga0070659_100608543 | 3300005366 | Bacteria | 939 |
| 138 | Ga0070667_100003253 | 3300005367 | Bacteria | 13881 |
| 139 | Ga0070667_100018342 | 3300005367 | Bacteria | 5803 |
| 140 | Ga0070667_100134011 | 3300005367 | Bacteria | 2165 |
| 141 | Ga0070667_100173995 | 3300005367 | Bacteria | 1901 |
| 142 | Ga0070703_10058342 | 3300005406 | Unclassified | 1256 |
| 143 | Ga0070709_10005740 | 3300005434 | Bacteria | 6730 |
| 144 | Ga0070714_100380444 | 3300005435 | Bacteria | 1331 |
| 145 | Ga0070710_10004618 | 3300005437 | Bacteria | 6510 |
| 146 | Ga0070701_10011515 | 3300005438 | Bacteria | 3958 |
| 147 | Ga0070701_10113763 | 3300005438 | Bacteria | 1515 |
| 148 | Ga0070711_100078337 | 3300005439 | Bacteria | 2348 |
| 149 | Ga0070711_100084992 | 3300005439 | Bacteria | 2265 |
| 150 | Ga0070705_100001751 | 3300005440 | Bacteria | 11277 |
| 151 | Ga0070705_100027907 | 3300005440 | Bacteria | 3086 |
| 152 | Ga0070705_100067072 | 3300005440 | Bacteria | 2154 |
| 153 | Ga0070705_100105070 | 3300005440 | Bacteria | 1792 |
| 154 | Ga0070700_100000719 | 3300005441 | Bacteria | 16343 |
| 155 | Ga0070700_100012018 | 3300005441 | Bacteria | 4812 |
| 156 | Ga0070700_100020667 | 3300005441 | Bacteria | 3818 |
| 157 | Ga0070700_100039705 | 3300005441 | Bacteria | 2877 |
| 158 | Ga0070700_100062514 | 3300005441 | Bacteria | 2352 |
| 159 | Ga0070700_100257511 | 3300005441 | Unclassified | 1255 |
| 160 | Ga0070694_100006547 | 3300005444 | Bacteria | 7075 |
| 161 | Ga0070694_100008855 | 3300005444 | Bacteria | 6165 |
| 162 | Ga0070694_100044502 | 3300005444 | Bacteria | 2971 |
| 163 | Ga0070694_100109337 | 3300005444 | Bacteria | 1967 |
| 164 | Ga0070694_100201814 | 3300005444 | Bacteria | 1483 |
| 165 | Ga0070694_100333469 | 3300005444 | Bacteria | 1171 |
| 166 | Ga0070694_100381266 | 3300005444 | Bacteria | 1100 |
| 167 | Ga0070708_100005855 | 3300005445 | Bacteria | 9764 |
| 168 | Ga0070708_100137339 | 3300005445 | Bacteria | 2266 |
| 169 | Ga0070708_100677381 | 3300005445 | Bacteria | 971 |
| 170 | Ga0070663_100002023 | 3300005455 | Bacteria | 11326 |
| 171 | Ga0070663_100005687 | 3300005455 | Bacteria | 7428 |
| 172 | Ga0070663_100011762 | 3300005455 | Bacteria | 5508 |
| 173 | Ga0070663_100048511 | 3300005455 | Bacteria | 3011 |
| 174 | Ga0070663_100283642 | 3300005455 | Bacteria | 1320 |
| 175 | Ga0070678_100001372 | 3300005456 | Bacteria | 12958 |
| 176 | Ga0070678_100032969 | 3300005456 | Bacteria | 3591 |
| 177 | Ga0070678_100531052 | 3300005456 | Bacteria | 1042 |
| 178 | Ga0070662_100141147 | 3300005457 | Bacteria | 1867 |
| 179 | Ga0070662_100180045 | 3300005457 | Bacteria | 1666 |
| 180 | Ga0070681_10002315 | 3300005458 | Bacteria | 17415 |
| 181 | Ga0070681_10003664 | 3300005458 | Bacteria | 14404 |
| 182 | Ga0070681_10007845 | 3300005458 | Bacteria | 10437 |
| 183 | Ga0070681_10010655 | 3300005458 | Bacteria | 9087 |
| 184 | Ga0070681_10015116 | 3300005458 | Bacteria | 7678 |
| 185 | Ga0070681_10018723 | 3300005458 | Bacteria | 6929 |
| 186 | Ga0070681_10051872 | 3300005458 | Bacteria | 4091 |
| 187 | Ga0070681_10166545 | 3300005458 | Bacteria | 2126 |
| 188 | Ga0070681_10348936 | 3300005458 | Bacteria | 1390 |
| 189 | Ga0068867_100006387 | 3300005459 | Bacteria | 8330 |
| 190 | Ga0068867_100013233 | 3300005459 | Bacteria | 5844 |
| 191 | Ga0068867_100074453 | 3300005459 | Unclassified | 2545 |
| 192 | Ga0068867_100257362 | 3300005459 | Bacteria | 1422 |
| 193 | Ga0070685_10001416 | 3300005466 | Bacteria | 12577 |
| 194 | Ga0070685_10004344 | 3300005466 | Bacteria | 7153 |
| 195 | Ga0070685_10082845 | 3300005466 | Bacteria | 1926 |
| 196 | Ga0070706_100000125 | 3300005467 | Bacteria | 94689 |
| 197 | Ga0070706_100008529 | 3300005467 | Bacteria | 9554 |
| 198 | Ga0070706_100210603 | 3300005467 | Bacteria | 1815 |
| 199 | Ga0070706_100565234 | 3300005467 | Bacteria | 1058 |
| 200 | Ga0070707_100003600 | 3300005468 | Bacteria | 14608 |
| 201 | Ga0070707_100011087 | 3300005468 | Bacteria | 8394 |
| 202 | Ga0070707_100012513 | 3300005468 | Bacteria | 7925 |
| 203 | Ga0070707_100260130 | 3300005468 | Bacteria | 1688 |
| 204 | Ga0070707_100304531 | 3300005468 | Unclassified | 1548 |
| 205 | Ga0070707_100430159 | 3300005468 | Unclassified | 1280 |
| 206 | Ga0070698_100005037 | 3300005471 | Bacteria | 14476 |
| 207 | Ga0070698_100006865 | 3300005471 | Bacteria | 12329 |
| 208 | Ga0070698_100008229 | 3300005471 | Bacteria | 11282 |
| 209 | Ga0070699_100000352 | 3300005518 | Bacteria | 44680 |
| 210 | Ga0070699_100000880 | 3300005518 | Bacteria | 27937 |
| 211 | Ga0070699_100004094 | 3300005518 | Bacteria | 12885 |
| 212 | Ga0070699_100111738 | 3300005518 | Bacteria | 2399 |
| 213 | Ga0070679_100000587 | 3300005530 | Bacteria | 30801 |
| 214 | Ga0070679_100008410 | 3300005530 | Bacteria | 9712 |
| 215 | Ga0070679_100011201 | 3300005530 | Bacteria | 8547 |
| 216 | Ga0070679_100077077 | 3300005530 | Bacteria | 3322 |
| 217 | Ga0070684_100043562 | 3300005535 | Bacteria | 3876 |
| 218 | Ga0070684_100059847 | 3300005535 | Bacteria | 3331 |
| 219 | Ga0070684_100533696 | 3300005535 | Bacteria | 1088 |
| 220 | Ga0070697_100031128 | 3300005536 | Bacteria | 4289 |
| 221 | Ga0070697_100055838 | 3300005536 | Bacteria | 3212 |
| 222 | Ga0070697_100153616 | 3300005536 | Bacteria | 1941 |
| 223 | Ga0068853_100003665 | 3300005539 | Bacteria | 11782 |
| 224 | Ga0068853_100003943 | 3300005539 | Bacteria | 11396 |
| 225 | Ga0068853_100027252 | 3300005539 | Bacteria | 4800 |
| 226 | Ga0068853_100040630 | 3300005539 | Bacteria | 3969 |
| 227 | Ga0068853_100051948 | 3300005539 | Bacteria | 3530 |
| 228 | Ga0068853_100093101 | 3300005539 | Bacteria | 2652 |
| 229 | Ga0068853_100163691 | 3300005539 | Bacteria | 2009 |
| 230 | Ga0068853_100170360 | 3300005539 | Bacteria | 1969 |
| 231 | Ga0070672_100000867 | 3300005543 | Bacteria | 18097 |
| 232 | Ga0070672_100016594 | 3300005543 | Bacteria | 5276 |
| 233 | Ga0070672_100042656 | 3300005543 | Bacteria | 3493 |
| 234 | Ga0070672_100197393 | 3300005543 | Bacteria | 1682 |
| 235 | Ga0070672_100560480 | 3300005543 | Bacteria | 993 |
| 236 | Ga0070672_100656057 | 3300005543 | Unclassified | 917 |
| 237 | Ga0070686_100004310 | 3300005544 | Bacteria | 7831 |
| 238 | Ga0070686_100006195 | 3300005544 | Bacteria | 6640 |
| 239 | Ga0070686_100022101 | 3300005544 | Bacteria | 3786 |
| 240 | Ga0070686_100142294 | 3300005544 | Bacteria | 1671 |
| 241 | Ga0070686_100221860 | 3300005544 | Bacteria | 1366 |
| 242 | Ga0070695_100008518 | 3300005545 | Bacteria | 6087 |
| 243 | Ga0070695_100053158 | 3300005545 | Bacteria | 2604 |
| 244 | Ga0070695_100267266 | 3300005545 | Bacteria | 1251 |
| 245 | Ga0070695_100510046 | 3300005545 | Unclassified | 931 |
| 246 | Ga0070696_100040295 | 3300005546 | Bacteria | 3225 |
| 247 | Ga0070696_100514153 | 3300005546 | Bacteria | 954 |
| 248 | Ga0070696_100693071 | 3300005546 | Bacteria | 830 |
| 249 | Ga0070693_100020755 | 3300005547 | Bacteria | 3470 |
| 250 | Ga0070693_100030719 | 3300005547 | Bacteria | 2939 |
| 251 | Ga0070693_100052530 | 3300005547 | Bacteria | 2337 |
| 252 | Ga0070693_100070706 | 3300005547 | Bacteria | 2054 |
| 253 | Ga0070665_100010998 | 3300005548 | Bacteria | 9149 |
| 254 | Ga0070665_100018974 | 3300005548 | Bacteria | 6900 |
| 255 | Ga0070665_100023145 | 3300005548 | Bacteria | 6257 |
| 256 | Ga0070665_100024444 | 3300005548 | Bacteria | 6084 |
| 257 | Ga0070665_100046320 | 3300005548 | Bacteria | 4369 |
| 258 | Ga0070665_100263305 | 3300005548 | Bacteria | 1725 |
| 259 | Ga0070665_100283231 | 3300005548 | Bacteria | 1659 |
| 260 | Ga0070665_100350250 | 3300005548 | Bacteria | 1482 |
| 261 | Ga0070665_100553282 | 3300005548 | Bacteria | 1163 |
| 262 | Ga0070704_100000897 | 3300005549 | Bacteria | 14913 |
| 263 | Ga0070704_100054755 | 3300005549 | Bacteria | 2824 |
| 264 | Ga0070704_100096074 | 3300005549 | Bacteria | 2221 |
| 265 | Ga0070704_100134808 | 3300005549 | Bacteria | 1919 |
| 266 | Ga0070704_100161122 | 3300005549 | Bacteria | 1774 |
| 267 | Ga0070704_100325872 | 3300005549 | Bacteria | 1289 |
| 268 | Ga0070704_100605301 | 3300005549 | Bacteria | 963 |
| 269 | Ga0068855_100003374 | 3300005563 | Bacteria | 19561 |
| 270 | Ga0068855_100004501 | 3300005563 | Bacteria | 17027 |
| 271 | Ga0068855_100018186 | 3300005563 | Bacteria | 8443 |
| 272 | Ga0068855_100037556 | 3300005563 | Bacteria | 5759 |
| 273 | Ga0068855_100089580 | 3300005563 | Bacteria | 3552 |
| 274 | Ga0068855_100108358 | 3300005563 | Bacteria | 3190 |
| 275 | Ga0068855_100151181 | 3300005563 | Bacteria | 2640 |
| 276 | Ga0068855_100240449 | 3300005563 | Bacteria | 2023 |
| 277 | Ga0068855_100250783 | 3300005563 | Bacteria | 1974 |
| 278 | Ga0068855_100802958 | 3300005563 | Bacteria | 1000 |
| 279 | Ga0068855_100926808 | 3300005563 | Bacteria | 919 |
| 280 | Ga0070664_100000070 | 3300005564 | Bacteria | 63788 |
| 281 | Ga0070664_100001934 | 3300005564 | Bacteria | 16649 |
| 282 | Ga0070664_100017132 | 3300005564 | Bacteria | 5948 |
| 283 | Ga0070664_100026866 | 3300005564 | Bacteria | 4780 |
| 284 | Ga0070664_100047571 | 3300005564 | Bacteria | 3624 |
| 285 | Ga0068857_100003654 | 3300005577 | Bacteria | 12893 |
| 286 | Ga0068857_100004680 | 3300005577 | Bacteria | 11592 |
| 287 | Ga0068857_100033566 | 3300005577 | Bacteria | 4539 |
| 288 | Ga0068857_100037853 | 3300005577 | Bacteria | 4274 |
| 289 | Ga0068857_100061463 | 3300005577 | Bacteria | 3337 |
| 290 | Ga0068854_100001002 | 3300005578 | Bacteria | 17023 |
| 291 | Ga0068854_100010067 | 3300005578 | Bacteria | 6124 |
| 292 | Ga0068854_100046307 | 3300005578 | Bacteria | 3096 |
| 293 | Ga0068854_100103155 | 3300005578 | Bacteria | 2141 |
| 294 | Ga0068854_100253706 | 3300005578 | Unclassified | 1406 |
| 295 | Ga0068856_100005597 | 3300005614 | Bacteria | 12362 |
| 296 | Ga0068856_100021359 | 3300005614 | Bacteria | 6293 |
| 297 | Ga0068856_100216883 | 3300005614 | Bacteria | 1929 |
| 298 | Ga0068856_100312957 | 3300005614 | Bacteria | 1588 |
| 299 | Ga0068856_100341639 | 3300005614 | Bacteria | 1515 |
| 300 | Ga0068856_100526334 | 3300005614 | Bacteria | 1203 |
| 301 | Ga0070702_100017673 | 3300005615 | Bacteria | 3684 |
| 302 | Ga0070702_100033498 | 3300005615 | Bacteria | 2825 |
| 303 | Ga0070702_100060385 | 3300005615 | Bacteria | 2204 |
| 304 | Ga0070702_100252847 | 3300005615 | Bacteria | 1195 |
| 305 | Ga0070702_100308007 | 3300005615 | Bacteria | 1098 |
| 306 | Ga0068852_100001511 | 3300005616 | Bacteria | 15733 |
| 307 | Ga0068852_100006048 | 3300005616 | Bacteria | 8718 |
| 308 | Ga0068852_100065307 | 3300005616 | Bacteria | 3174 |
| 309 | Ga0068852_100232089 | 3300005616 | Bacteria | 1759 |
| 310 | Ga0068852_100241597 | 3300005616 | Bacteria | 1726 |
| 311 | Ga0068852_100399548 | 3300005616 | Bacteria | 1352 |
| 312 | Ga0068852_100662403 | 3300005616 | Bacteria | 1052 |
| 313 | Ga0068852_100672893 | 3300005616 | Bacteria | 1044 |
| 314 | Ga0068859_100009084 | 3300005617 | Bacteria | 10038 |
| 315 | Ga0068859_100022162 | 3300005617 | Bacteria | 6369 |
| 316 | Ga0068859_100027560 | 3300005617 | Bacteria | 5698 |
| 317 | Ga0068859_100029327 | 3300005617 | Bacteria | 5521 |
| 318 | Ga0068859_100050914 | 3300005617 | Bacteria | 4162 |
| 319 | Ga0068859_100059991 | 3300005617 | Bacteria | 3833 |
| 320 | Ga0068859_100102105 | 3300005617 | Bacteria | 2925 |
| 321 | Ga0068859_100169710 | 3300005617 | Bacteria | 2262 |
| 322 | Ga0068859_100355574 | 3300005617 | Bacteria | 1560 |
| 323 | Ga0068864_100003320 | 3300005618 | Bacteria | 13297 |
| 324 | Ga0068864_100014922 | 3300005618 | Bacteria | 6455 |
| 325 | Ga0068864_100024719 | 3300005618 | Bacteria | 5054 |
| 326 | Ga0068864_100035972 | 3300005618 | Bacteria | 4218 |
| 327 | Ga0068864_100040419 | 3300005618 | Bacteria | 3990 |
| 328 | Ga0068864_100178664 | 3300005618 | Bacteria | 1939 |
| 329 | Ga0068864_100246022 | 3300005618 | Bacteria | 1658 |
| 330 | Ga0068864_100676324 | 3300005618 | Unclassified | 1007 |
| 331 | Ga0068866_10000167 | 3300005718 | Bacteria | 30374 |
| 332 | Ga0068861_100001113 | 3300005719 | Bacteria | 16659 |
| 333 | Ga0068861_100020275 | 3300005719 | Bacteria | 4758 |
| 334 | Ga0068861_100340958 | 3300005719 | Bacteria | 1311 |
| 335 | Ga0068861_100558303 | 3300005719 | Bacteria | 1044 |
| 336 | Ga0068851_10000382 | 3300005834 | Bacteria | 20035 |
| 337 | Ga0068851_10010828 | 3300005834 | Bacteria | 4262 |
| 338 | Ga0068851_10062572 | 3300005834 | Bacteria | 1909 |
| 339 | Ga0068863_100002882 | 3300005841 | Bacteria | 17031 |
| 340 | Ga0068863_100080336 | 3300005841 | Unclassified | 3088 |
| 341 | Ga0068863_100208714 | 3300005841 | Bacteria | 1880 |
| 342 | Ga0068863_100264213 | 3300005841 | Bacteria | 1664 |
| 343 | Ga0068858_100005307 | 3300005842 | Bacteria | 12636 |
| 344 | Ga0068858_100006538 | 3300005842 | Bacteria | 11336 |
| 345 | Ga0068858_100018581 | 3300005842 | Bacteria | 6510 |
| 346 | Ga0068858_100041680 | 3300005842 | Bacteria | 4257 |
| 347 | Ga0068858_100049299 | 3300005842 | Bacteria | 3900 |
| 348 | Ga0068858_100059043 | 3300005842 | Bacteria | 3545 |
| 349 | Ga0068858_100206719 | 3300005842 | Unclassified | 1857 |
| 350 | Ga0068858_100275829 | 3300005842 | Bacteria | 1601 |
| 351 | Ga0068860_100007853 | 3300005843 | Bacteria | 10650 |
| 352 | Ga0068860_100011324 | 3300005843 | Bacteria | 8789 |
| 353 | Ga0068860_100019352 | 3300005843 | Bacteria | 6604 |
| 354 | Ga0068860_100030361 | 3300005843 | Bacteria | 5198 |
| 355 | Ga0068860_100061705 | 3300005843 | Bacteria | 3561 |
| 356 | Ga0068860_100243218 | 3300005843 | Bacteria | 1751 |
| 357 | Ga0068862_100014640 | 3300005844 | Bacteria | 6515 |
| 358 | Ga0068862_100080071 | 3300005844 | Bacteria | 2832 |
| 359 | Ga0068862_100095635 | 3300005844 | Bacteria | 2592 |
| 360 | Ga0068862_100156570 | 3300005844 | Bacteria | 2031 |
| 361 | Ga0068862_100655808 | 3300005844 | Bacteria | 1013 |
| 362 | Ga0068862_100860223 | 3300005844 | Bacteria | 889 |
| 363 | Ga0081455_10017929 | 3300005937 | Bacteria | 6765 |
| 364 | Ga0081540_1000138 | 3300005983 | Bacteria | 76659 |
| 365 | Ga0081540_1000640 | 3300005983 | Bacteria | 33222 |
| 366 | Ga0081540_1001923 | 3300005983 | Bacteria | 17413 |
| 367 | Ga0081540_1003393 | 3300005983 | Bacteria | 12631 |
| 368 | Ga0081540_1017951 | 3300005983 | Bacteria | 4359 |
| 369 | Ga0081540_1093371 | 3300005983 | Bacteria | 1318 |
| 370 | Ga0081539_10000110 | 3300005985 | Bacteria | 190555 |
| 371 | Ga0081539_10001757 | 3300005985 | Bacteria | 34548 |
| 372 | Ga0081539_10005290 | 3300005985 | Bacteria | 13293 |
| 373 | Ga0081539_10006601 | 3300005985 | Bacteria | 11020 |
| 374 | Ga0081539_10016624 | 3300005985 | Bacteria | 5235 |
| 375 | Ga0070717_10038368 | 3300006028 | Bacteria | 3893 |
| 376 | Ga0070717_10114601 | 3300006028 | Bacteria | 2303 |
| 377 | Ga0075365_10003274 | 3300006038 | Bacteria | 8304 |
| 378 | Ga0075365_10005800 | 3300006038 | Bacteria | 6706 |
| 379 | Ga0075365_10009956 | 3300006038 | Bacteria | 5505 |
| 380 | Ga0075368_10010236 | 3300006042 | Bacteria | 3386 |
| 381 | Ga0075363_100040656 | 3300006048 | Bacteria | 2451 |
| 382 | Ga0075364_10027328 | 3300006051 | Bacteria | 3644 |
| 383 | Ga0070715_10000063 | 3300006163 | Bacteria | 34937 |
| 384 | Ga0070716_100078021 | 3300006173 | Bacteria | 1968 |
| 385 | Ga0070716_100116535 | 3300006173 | Bacteria | 1665 |
| 386 | Ga0075362_10008752 | 3300006177 | Bacteria | 3888 |
| 387 | Ga0075362_10018996 | 3300006177 | Bacteria | 2853 |
| 388 | Ga0075367_10017171 | 3300006178 | Bacteria | 3967 |
| 389 | Ga0075367_10026146 | 3300006178 | Bacteria | 3307 |
| 390 | Ga0075367_10070535 | 3300006178 | Bacteria | 2101 |
| 391 | Ga0075367_10090436 | 3300006178 | Bacteria | 1862 |
| 392 | Ga0075369_10003352 | 3300006186 | Bacteria | 5823 |
| 393 | Ga0075369_10105201 | 3300006186 | Bacteria | 1268 |
| 394 | Ga0097621_100000449 | 3300006237 | Bacteria | 28814 |
| 395 | Ga0097621_100259045 | 3300006237 | Bacteria | 1525 |
| 396 | Ga0097621_100273719 | 3300006237 | Bacteria | 1484 |
| 397 | Ga0075370_10023704 | 3300006353 | Bacteria | 3383 |
| 398 | Ga0068871_100001759 | 3300006358 | Bacteria | 14597 |
| 399 | Ga0068871_100064226 | 3300006358 | Bacteria | 3005 |
| 400 | Ga0068871_100314906 | 3300006358 | Bacteria | 1376 |
| 401 | Ga0068871_100376467 | 3300006358 | Bacteria | 1260 |
| 402 | Ga0075428_100009001 | 3300006844 | Bacteria | 11076 |
| 403 | Ga0075428_100047133 | 3300006844 | Bacteria | 4734 |
| 404 | Ga0075428_100049375 | 3300006844 | Bacteria | 4616 |
| 405 | Ga0075428_100065603 | 3300006844 | Bacteria | 3976 |
| 406 | Ga0075428_100185233 | 3300006844 | Bacteria | 2253 |
| 407 | Ga0075428_100287649 | 3300006844 | Bacteria | 1768 |
| 408 | Ga0075430_100076170 | 3300006846 | Bacteria | 2811 |
| 409 | Ga0075430_100080323 | 3300006846 | Bacteria | 2732 |
| 410 | Ga0075430_100518947 | 3300006846 | Bacteria | 983 |
| 411 | Ga0075431_100000392 | 3300006847 | Bacteria | 35161 |
| 412 | Ga0075431_100001188 | 3300006847 | Bacteria | 23484 |
| 413 | Ga0075433_10008826 | 3300006852 | Bacteria | 8041 |
| 414 | Ga0075433_10044089 | 3300006852 | Bacteria | 3875 |
| 415 | Ga0075433_10045889 | 3300006852 | Unclassified | 3799 |
| 416 | Ga0075433_10062021 | 3300006852 | Bacteria | 3274 |
| 417 | Ga0075433_10118535 | 3300006852 | Bacteria | 2349 |
| 418 | Ga0075433_10176928 | 3300006852 | Bacteria | 1899 |
| 419 | Ga0075434_100004782 | 3300006871 | Bacteria | 12262 |
| 420 | Ga0075434_100019404 | 3300006871 | Bacteria | 6580 |
| 421 | Ga0075434_100020621 | 3300006871 | Bacteria | 6397 |
| 422 | Ga0075434_100035585 | 3300006871 | Bacteria | 4923 |
| 423 | Ga0075434_100110623 | 3300006871 | Bacteria | 2758 |
| 424 | Ga0075434_100120201 | 3300006871 | Bacteria | 2642 |
| 425 | Ga0075434_100217845 | 3300006871 | Bacteria | 1929 |
| 426 | Ga0075434_100240687 | 3300006871 | Bacteria | 1829 |
| 427 | Ga0075434_100277852 | 3300006871 | Bacteria | 1694 |
| 428 | Ga0075429_100124879 | 3300006880 | Bacteria | 2251 |
| 429 | Ga0075429_100295766 | 3300006880 | Unclassified | 1417 |
| 430 | Ga0075429_100395773 | 3300006880 | Unclassified | 1210 |
| 431 | Ga0068865_100002359 | 3300006881 | Bacteria | 11142 |
| 432 | Ga0068865_100024668 | 3300006881 | Bacteria | 3947 |
| 433 | Ga0068865_100141872 | 3300006881 | Bacteria | 1812 |
| 434 | Ga0068865_100365257 | 3300006881 | Bacteria | 1173 |
| 435 | Ga0075436_100001175 | 3300006914 | Bacteria | 17759 |
| 436 | Ga0097620_100009084 | 3300006931 | Bacteria | 10038 |
| 437 | Ga0097620_100022163 | 3300006931 | Bacteria | 6369 |
| 438 | Ga0097620_100027559 | 3300006931 | Bacteria | 5698 |
| 439 | Ga0097620_100029326 | 3300006931 | Bacteria | 5521 |
| 440 | Ga0097620_100050908 | 3300006931 | Bacteria | 4162 |
| 441 | Ga0097620_100059986 | 3300006931 | Bacteria | 3833 |
| 442 | Ga0097620_100102107 | 3300006931 | Bacteria | 2925 |
| 443 | Ga0097620_100169714 | 3300006931 | Bacteria | 2262 |
| 444 | Ga0097620_100355571 | 3300006931 | Bacteria | 1560 |
| 445 | Ga0079104_1000209 | 3300006946 | Bacteria | 81844 |
| 446 | Ga0075435_100009611 | 3300007076 | Bacteria | 7018 |
| 447 | Ga0099794_10003880 | 3300007265 | Bacteria | 5788 |
| 448 | Ga0105251_10056175 | 3300009011 | Bacteria | 1864 |
| 449 | Ga0105244_10000145 | 3300009036 | Bacteria | 73760 |
| 450 | Ga0105250_10000127 | 3300009092 | Bacteria | 66039 |
| 451 | Ga0105240_10007255 | 3300009093 | Bacteria | 16136 |
| 452 | Ga0105240_10021381 | 3300009093 | Bacteria | 8606 |
| 453 | Ga0105240_10062851 | 3300009093 | Bacteria | 4621 |
| 454 | Ga0105240_10094300 | 3300009093 | Bacteria | 3651 |
| 455 | Ga0105240_10122464 | 3300009093 | Bacteria | 3130 |
| 456 | Ga0105240_10134066 | 3300009093 | Bacteria | 2967 |
| 457 | Ga0105240_10142856 | 3300009093 | Bacteria | 2860 |
| 458 | Ga0105240_10158004 | 3300009093 | Bacteria | 2695 |
| 459 | Ga0105240_10162374 | 3300009093 | Bacteria | 2653 |
| 460 | Ga0105240_10189757 | 3300009093 | Bacteria | 2417 |
| 461 | Ga0105240_10478093 | 3300009093 | Bacteria | 1389 |
| 462 | Ga0105240_10769101 | 3300009093 | Bacteria | 1046 |
| 463 | Ga0111539_10000358 | 3300009094 | Bacteria | 56148 |
| 464 | Ga0111539_10059338 | 3300009094 | Bacteria | 4537 |
| 465 | Ga0111539_10076099 | 3300009094 | Bacteria | 3952 |
| 466 | Ga0111539_10112739 | 3300009094 | Bacteria | 3190 |
| 467 | Ga0111539_10310035 | 3300009094 | Bacteria | 1836 |
| 468 | Ga0111539_10351792 | 3300009094 | Bacteria | 1715 |
| 469 | Ga0111539_10375944 | 3300009094 | Bacteria | 1654 |
| 470 | Ga0105245_10003941 | 3300009098 | Bacteria | 13204 |
| 471 | Ga0105245_10107745 | 3300009098 | Bacteria | 2587 |
| 472 | Ga0105245_10487140 | 3300009098 | Bacteria | 1247 |
| 473 | Ga0105245_10668767 | 3300009098 | Bacteria | 1070 |
| 474 | Ga0105247_10000047 | 3300009101 | Bacteria | 151385 |
| 475 | Ga0105247_10000680 | 3300009101 | Bacteria | 26882 |
| 476 | Ga0105247_10001044 | 3300009101 | Bacteria | 20780 |
| 477 | Ga0105247_10063001 | 3300009101 | Bacteria | 2301 |
| 478 | Ga0105247_10093410 | 3300009101 | Bacteria | 1912 |
| 479 | Ga0105247_10103760 | 3300009101 | Bacteria | 1821 |
| 480 | Ga0114129_10005694 | 3300009147 | Bacteria | 17649 |
| 481 | Ga0114129_10070556 | 3300009147 | Bacteria | 4872 |
| 482 | Ga0114129_10281624 | 3300009147 | Bacteria | 2221 |
| 483 | Ga0114129_10313848 | 3300009147 | Bacteria | 2086 |
| 484 | Ga0114129_10473193 | 3300009147 | Unclassified | 1640 |
| 485 | Ga0114129_10481150 | 3300009147 | Bacteria | 1624 |
| 486 | Ga0114129_10514193 | 3300009147 | Unclassified | 1562 |
| 487 | Ga0114129_10610367 | 3300009147 | Bacteria | 1412 |
| 488 | Ga0114129_10759767 | 3300009147 | Bacteria | 1240 |
| 489 | Ga0105243_10000027 | 3300009148 | Bacteria | 191224 |
| 490 | Ga0105243_10000474 | 3300009148 | Bacteria | 41200 |
| 491 | Ga0105243_10007357 | 3300009148 | Bacteria | 8465 |
| 492 | Ga0105243_10025565 | 3300009148 | Bacteria | 4514 |
| 493 | Ga0105243_10046747 | 3300009148 | Bacteria | 3406 |
| 494 | Ga0105243_10147343 | 3300009148 | Bacteria | 2016 |
| 495 | Ga0105243_10378635 | 3300009148 | Bacteria | 1308 |
| 496 | Ga0105243_10410071 | 3300009148 | Bacteria | 1261 |
| 497 | Ga0105241_10000690 | 3300009174 | Bacteria | 25453 |
| 498 | Ga0105241_10050218 | 3300009174 | Bacteria | 3178 |
| 499 | Ga0105241_10070341 | 3300009174 | Bacteria | 2715 |
| 500 | Ga0105241_10072947 | 3300009174 | Bacteria | 2669 |
| 501 | Ga0105241_10102582 | 3300009174 | Bacteria | 2277 |
| 502 | Ga0105241_10294902 | 3300009174 | Bacteria | 1390 |
| 503 | Ga0105241_10298249 | 3300009174 | Bacteria | 1382 |
| 504 | Ga0105241_10585830 | 3300009174 | Bacteria | 1006 |
| 505 | Ga0105242_10000038 | 3300009176 | Bacteria | 90379 |
| 506 | Ga0105242_10000107 | 3300009176 | Bacteria | 59805 |
| 507 | Ga0105242_10001950 | 3300009176 | Bacteria | 16240 |
| 508 | Ga0105242_10005047 | 3300009176 | Bacteria | 10192 |
| 509 | Ga0105242_10028561 | 3300009176 | Bacteria | 4443 |
| 510 | Ga0105242_10123128 | 3300009176 | Bacteria | 2229 |
| 511 | Ga0105242_10160011 | 3300009176 | Bacteria | 1970 |
| 512 | Ga0105248_10003364 | 3300009177 | Bacteria | 17776 |
| 513 | Ga0105248_10020227 | 3300009177 | Bacteria | 7373 |
| 514 | Ga0105248_10028561 | 3300009177 | Bacteria | 6215 |
| 515 | Ga0105248_10032857 | 3300009177 | Bacteria | 5797 |
| 516 | Ga0105248_10071202 | 3300009177 | Bacteria | 3905 |
| 517 | Ga0105248_10169319 | 3300009177 | Bacteria | 2462 |
| 518 | Ga0105248_10250961 | 3300009177 | Bacteria | 1992 |
| 519 | Ga0105248_10321545 | 3300009177 | Bacteria | 1742 |
| 520 | Ga0105237_10000829 | 3300009545 | Bacteria | 42345 |
| 521 | Ga0105237_10003821 | 3300009545 | Bacteria | 17702 |
| 522 | Ga0105237_10033099 | 3300009545 | Bacteria | 5236 |
| 523 | Ga0105237_10045544 | 3300009545 | Bacteria | 4414 |
| 524 | Ga0105237_10047386 | 3300009545 | Bacteria | 4321 |
| 525 | Ga0105237_10059203 | 3300009545 | Bacteria | 3832 |
| 526 | Ga0105237_10099103 | 3300009545 | Bacteria | 2906 |
| 527 | Ga0105237_10246404 | 3300009545 | Bacteria | 1789 |
| 528 | Ga0105237_10258032 | 3300009545 | Bacteria | 1745 |
| 529 | Ga0105238_10001511 | 3300009551 | Bacteria | 23281 |
| 530 | Ga0105238_10021004 | 3300009551 | Bacteria | 6652 |
| 531 | Ga0105238_10027120 | 3300009551 | Bacteria | 5839 |
| 532 | Ga0105238_10058950 | 3300009551 | Bacteria | 3847 |
| 533 | Ga0105238_10141237 | 3300009551 | Bacteria | 2385 |
| 534 | Ga0105238_10240618 | 3300009551 | Bacteria | 1787 |
| 535 | Ga0105238_10625288 | 3300009551 | Bacteria | 1086 |
| 536 | Ga0105238_10770149 | 3300009551 | Bacteria | 977 |
| 537 | Ga0105249_10000113 | 3300009553 | Bacteria | 108613 |
| 538 | Ga0105249_10001390 | 3300009553 | Bacteria | 21177 |
| 539 | Ga0105249_10001767 | 3300009553 | Bacteria | 18831 |
| 540 | Ga0105249_10022829 | 3300009553 | Bacteria | 5609 |
| 541 | Ga0105249_10490726 | 3300009553 | Bacteria | 1272 |
| 542 | Ga0105239_10000857 | 3300010375 | Bacteria | 43236 |
| 543 | Ga0105239_10003469 | 3300010375 | Bacteria | 19288 |
| 544 | Ga0105239_10049011 | 3300010375 | Bacteria | 4631 |
| 545 | Ga0105239_10060038 | 3300010375 | Bacteria | 4173 |
| 546 | Ga0105239_10076176 | 3300010375 | Bacteria | 3689 |
| 547 | Ga0105239_10165419 | 3300010375 | Bacteria | 2473 |
| 548 | Ga0105239_10241798 | 3300010375 | Bacteria | 2026 |
| 549 | Ga0105239_10887796 | 3300010375 | Bacteria | 1023 |
| 550 | Ga0105246_10001442 | 3300011119 | Bacteria | 14078 |
| 551 | Ga0105246_10073632 | 3300011119 | Bacteria | 2412 |
| 552 | Ga0105246_10086527 | 3300011119 | Bacteria | 2247 |
| 553 | Ga0105246_10280360 | 3300011119 | Bacteria | 1337 |
| 554 | Ga0105246_10319732 | 3300011119 | Unclassified | 1261 |
| 555 | Ga0157373_10003881 | 3300013100 | Bacteria | 11298 |
| 556 | Ga0157373_10018812 | 3300013100 | Bacteria | 5027 |
| 557 | Ga0157373_10044566 | 3300013100 | Bacteria | 3166 |
| 558 | Ga0157373_10044616 | 3300013100 | Bacteria | 3165 |
| 559 | Ga0157373_10186683 | 3300013100 | Bacteria | 1460 |
| 560 | Ga0157371_10000858 | 3300013102 | Bacteria | 34677 |
| 561 | Ga0157371_10310404 | 3300013102 | Bacteria | 1143 |
| 562 | Ga0157371_10317708 | 3300013102 | Bacteria | 1130 |
| 563 | Ga0157370_10001310 | 3300013104 | Bacteria | 31043 |
| 564 | Ga0157370_10066474 | 3300013104 | Bacteria | 3410 |
| 565 | Ga0157370_10084349 | 3300013104 | Bacteria | 2986 |
| 566 | Ga0157370_10104065 | 3300013104 | Bacteria | 2657 |
| 567 | Ga0157370_10193563 | 3300013104 | Bacteria | 1887 |
| 568 | Ga0157369_10002570 | 3300013105 | Bacteria | 21720 |
| 569 | Ga0157369_10007844 | 3300013105 | Bacteria | 12281 |
| 570 | Ga0157369_10065636 | 3300013105 | Bacteria | 3906 |
| 571 | Ga0157369_10070649 | 3300013105 | Bacteria | 3750 |
| 572 | Ga0157369_10125796 | 3300013105 | Bacteria | 2718 |
| 573 | Ga0157369_10196245 | 3300013105 | Bacteria | 2120 |
| 574 | Ga0157374_10002021 | 3300013296 | Bacteria | 17019 |
| 575 | Ga0157374_10913170 | 3300013296 | Bacteria | 896 |
| 576 | Ga0157378_10000048 | 3300013297 | Bacteria | 104914 |
| 577 | Ga0157378_10001435 | 3300013297 | Bacteria | 21473 |
| 578 | Ga0157378_10005648 | 3300013297 | Bacteria | 10955 |
| 579 | Ga0157378_10025656 | 3300013297 | Bacteria | 5189 |
| 580 | Ga0157378_10113691 | 3300013297 | Bacteria | 2486 |
| 581 | Ga0157378_10229130 | 3300013297 | Bacteria | 1770 |
| 582 | Ga0157378_10381753 | 3300013297 | Bacteria | 1384 |
| 583 | Ga0157378_10528555 | 3300013297 | Bacteria | 1182 |
| 584 | Ga0157378_10645347 | 3300013297 | Bacteria | 1074 |
| 585 | Ga0163162_10000023 | 3300013306 | Bacteria | 193395 |
| 586 | Ga0163162_10001226 | 3300013306 | Bacteria | 23960 |
| 587 | Ga0163162_10051608 | 3300013306 | Bacteria | 4127 |
| 588 | Ga0163162_10053079 | 3300013306 | Bacteria | 4073 |
| 589 | Ga0163162_10108278 | 3300013306 | Bacteria | 2875 |
| 590 | Ga0163162_10148629 | 3300013306 | Bacteria | 2460 |
| 591 | Ga0163162_10203558 | 3300013306 | Bacteria | 2109 |
| 592 | Ga0163162_10208523 | 3300013306 | Bacteria | 2083 |
| 593 | Ga0163162_10216899 | 3300013306 | Bacteria | 2043 |
| 594 | Ga0163162_10658561 | 3300013306 | Bacteria | 1170 |
| 595 | Ga0157372_10006136 | 3300013307 | Bacteria | 12772 |
| 596 | Ga0157372_10068693 | 3300013307 | Bacteria | 3984 |
| 597 | Ga0157372_10286185 | 3300013307 | Unclassified | 1917 |
| 598 | Ga0157372_10494190 | 3300013307 | Bacteria | 1427 |
| 599 | Ga0157372_11515511 | 3300013307 | Bacteria | 772 |
| 600 | Ga0157375_10002065 | 3300013308 | Bacteria | 17352 |
| 601 | Ga0157375_10006519 | 3300013308 | Bacteria | 10158 |
| 602 | Ga0157375_10048768 | 3300013308 | Bacteria | 4145 |
| 603 | Ga0157375_10124856 | 3300013308 | Unclassified | 2687 |
| 604 | Ga0157375_10245995 | 3300013308 | Bacteria | 1949 |
| 605 | Ga0157375_10254236 | 3300013308 | Bacteria | 1918 |
| 606 | Ga0157375_10348662 | 3300013308 | Bacteria | 1646 |
| 607 | Ga0163163_10000156 | 3300014325 | Bacteria | 70968 |
| 608 | Ga0163163_10054400 | 3300014325 | Bacteria | 3954 |
| 609 | Ga0163163_10073729 | 3300014325 | Bacteria | 3404 |
| 610 | Ga0163163_10304950 | 3300014325 | Bacteria | 1645 |
| 611 | Ga0163163_10377167 | 3300014325 | Unclassified | 1476 |
| 612 | Ga0163163_10776315 | 3300014325 | Bacteria | 1022 |
| 613 | Ga0157380_10001458 | 3300014326 | Bacteria | 15474 |
| 614 | Ga0157380_10012266 | 3300014326 | Bacteria | 6210 |
| 615 | Ga0157380_10029038 | 3300014326 | Bacteria | 4225 |
| 616 | Ga0157380_10039177 | 3300014326 | Bacteria | 3684 |
| 617 | Ga0157380_10040754 | 3300014326 | Bacteria | 3620 |
| 618 | Ga0157380_10053569 | 3300014326 | Bacteria | 3199 |
| 619 | Ga0157380_10284365 | 3300014326 | Bacteria | 1515 |
| 620 | Ga0157380_10322233 | 3300014326 | Bacteria | 1433 |
| 621 | Ga0157377_10001610 | 3300014745 | Bacteria | 9828 |
| 622 | Ga0157377_10050432 | 3300014745 | Bacteria | 2344 |
| 623 | Ga0157379_10056062 | 3300014968 | Bacteria | 3522 |
| 624 | Ga0157379_10105838 | 3300014968 | Bacteria | 2525 |
| 625 | Ga0157379_10123869 | 3300014968 | Bacteria | 2326 |
| 626 | Ga0157379_10153851 | 3300014968 | Bacteria | 2074 |
| 627 | Ga0157379_10162021 | 3300014968 | Bacteria | 2019 |
| 628 | Ga0157376_10032402 | 3300014969 | Bacteria | 4197 |
| 629 | Ga0157376_10054345 | 3300014969 | Bacteria | 3338 |
| 630 | Ga0157376_10124275 | 3300014969 | Bacteria | 2292 |
| 631 | Ga0157376_10147821 | 3300014969 | Bacteria | 2116 |
| 632 | Ga0157376_10159828 | 3300014969 | Bacteria | 2041 |
| 633 | Ga0157376_11005865 | 3300014969 | Bacteria | 856 |
| 634 | Ga0182006_1023433 | 3300015261 | Bacteria | 2557 |
| 635 | Ga0182007_10030676 | 3300015262 | Bacteria | 1835 |
| 636 | Ga0182007_10056709 | 3300015262 | Unclassified | 1286 |
| 637 | Ga0163161_10017220 | 3300017792 | Bacteria | 5055 |
| 638 | Ga0163161_10025332 | 3300017792 | Bacteria | 4198 |
| 639 | Ga0163161_10059173 | 3300017792 | Bacteria | 2786 |
| 640 | Ga0163161_10159882 | 3300017792 | Bacteria | 1717 |
| 641 | Ga0163161_10174310 | 3300017792 | Bacteria | 1646 |
| 642 | Ga0163161_10231857 | 3300017792 | Bacteria | 1433 |
| 643 | Ga0163161_10337928 | 3300017792 | Bacteria | 1194 |
| 644 | Ga0163161_10355781 | 3300017792 | Bacteria | 1165 |
| 645 | Ga0213873_10062851 | 3300021358 | Bacteria | 1008 |
| 646 | Ga0213874_10021966 | 3300021377 | Bacteria | 1765 |
| 647 | Ga0213874_10023511 | 3300021377 | Bacteria | 1720 |
| 648 | Ga0213876_10000043 | 3300021384 | Bacteria | 162257 |
| 649 | Ga0213876_10000283 | 3300021384 | Bacteria | 46166 |
| 650 | Ga0213876_10000541 | 3300021384 | Bacteria | 28477 |
| 651 | Ga0213876_10000580 | 3300021384 | Bacteria | 27228 |
| 652 | Ga0213876_10059369 | 3300021384 | Bacteria | 2019 |
| 653 | Ga0213876_10123628 | 3300021384 | Bacteria | 1374 |
| 654 | Ga0213876_10297933 | 3300021384 | Bacteria | 857 |
| 655 | Ga0213875_10000276 | 3300021388 | Bacteria | 50734 |
| 656 | Ga0213875_10005719 | 3300021388 | Bacteria | 6623 |
| 657 | Ga0213875_10007545 | 3300021388 | Bacteria | 5607 |
| 658 | Ga0213875_10073977 | 3300021388 | Bacteria | 1590 |
| 659 | Ga0213875_10091254 | 3300021388 | Unclassified | 1421 |
| 660 | Ga0213875_10119755 | 3300021388 | Bacteria | 1230 |
| 661 | Ga0213875_10165417 | 3300021388 | Unclassified | 1038 |
| 662 | Ga0213871_10002403 | 3300021441 | Bacteria | 3436 |
| 663 | Ga0224712_10012148 | 3300022467 | Bacteria | 2699 |
| 664 | Ga0224572_1007204 | 3300024225 | Bacteria | 2032 |
| 665 | Ga0207672_1000156 | 3300025223 | Bacteria | 9398 |
| 666 | Ga0209646_1019801 | 3300025246 | Bacteria | 977 |
| 667 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 668 | Ga0209677_100440 | 3300025253 | Bacteria | 24115 |
| 669 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 670 | Ga0209148_1008001 | 3300025254 | Bacteria | 2154 |
| 671 | Ga0209759_1000146 | 3300025256 | Bacteria | 121497 |
| 672 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 673 | Ga0209233_1000297 | 3300025261 | Bacteria | 61773 |
| 674 | Ga0209233_1004351 | 3300025261 | Bacteria | 4834 |
| 675 | Ga0209455_1000133 | 3300025272 | Bacteria | 155670 |
| 676 | Ga0209455_1009471 | 3300025272 | Bacteria | 2556 |
| 677 | Ga0209675_1001307 | 3300025291 | Bacteria | 14774 |
| 678 | Ga0209758_1012195 | 3300025297 | Bacteria | 4843 |
| 679 | Ga0209758_1024001 | 3300025297 | Bacteria | 2734 |
| 680 | Ga0209256_1002428 | 3300025299 | Bacteria | 15246 |
| 681 | Ga0207697_10001372 | 3300025315 | Bacteria | 13331 |
| 682 | Ga0207697_10029948 | 3300025315 | Bacteria | 2228 |
| 683 | Ga0207697_10129407 | 3300025315 | Bacteria | 1090 |
| 684 | Ga0207656_10000298 | 3300025321 | Bacteria | 17134 |
| 685 | Ga0207656_10005843 | 3300025321 | Bacteria | 4384 |
| 686 | Ga0207656_10032171 | 3300025321 | Bacteria | 2178 |
| 687 | Ga0207696_1000134 | 3300025711 | Bacteria | 130099 |
| 688 | Ga0207655_1000298 | 3300025728 | Bacteria | 74953 |
| 689 | Ga0207653_10000400 | 3300025885 | Bacteria | 19184 |
| 690 | Ga0207682_10000214 | 3300025893 | Bacteria | 26263 |
| 691 | Ga0207692_10008338 | 3300025898 | Bacteria | 4285 |
| 692 | Ga0207642_10000260 | 3300025899 | Bacteria | 15834 |
| 693 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 694 | Ga0207710_10002316 | 3300025900 | Bacteria | 8893 |
| 695 | Ga0207710_10002769 | 3300025900 | Bacteria | 8015 |
| 696 | Ga0207710_10050509 | 3300025900 | Bacteria | 1866 |
| 697 | Ga0207688_10000836 | 3300025901 | Bacteria | 15457 |
| 698 | Ga0207688_10045664 | 3300025901 | Bacteria | 2444 |
| 699 | Ga0207688_10074619 | 3300025901 | Bacteria | 1929 |
| 700 | Ga0207680_10001615 | 3300025903 | Bacteria | 10655 |
| 701 | Ga0207680_10004606 | 3300025903 | Bacteria | 6544 |
| 702 | Ga0207680_10070356 | 3300025903 | Bacteria | 2165 |
| 703 | Ga0207647_10001682 | 3300025904 | Bacteria | 17032 |
| 704 | Ga0207647_10004899 | 3300025904 | Bacteria | 9879 |
| 705 | Ga0207647_10009697 | 3300025904 | Bacteria | 6832 |
| 706 | Ga0207647_10021671 | 3300025904 | Bacteria | 4285 |
| 707 | Ga0207647_10081547 | 3300025904 | Bacteria | 1938 |
| 708 | Ga0207685_10000041 | 3300025905 | Bacteria | 57491 |
| 709 | Ga0207645_10000251 | 3300025907 | Bacteria | 44805 |
| 710 | Ga0207645_10002159 | 3300025907 | Bacteria | 15722 |
| 711 | Ga0207645_10189759 | 3300025907 | Bacteria | 1350 |
| 712 | Ga0207643_10000176 | 3300025908 | Bacteria | 43543 |
| 713 | Ga0207643_10067989 | 3300025908 | Bacteria | 2046 |
| 714 | Ga0207705_10011075 | 3300025909 | Bacteria | 6538 |
| 715 | Ga0207705_10015184 | 3300025909 | Bacteria | 5534 |
| 716 | Ga0207705_10029984 | 3300025909 | Bacteria | 3880 |
| 717 | Ga0207705_10043327 | 3300025909 | Bacteria | 3233 |
| 718 | Ga0207705_10066183 | 3300025909 | Bacteria | 2613 |
| 719 | Ga0207705_10135850 | 3300025909 | Bacteria | 1833 |
| 720 | Ga0207705_10139696 | 3300025909 | Bacteria | 1808 |
| 721 | Ga0207684_10000130 | 3300025910 | Bacteria | 137931 |
| 722 | Ga0207684_10001792 | 3300025910 | Bacteria | 22526 |
| 723 | Ga0207684_10107705 | 3300025910 | Bacteria | 2384 |
| 724 | Ga0207684_10131173 | 3300025910 | Bacteria | 2151 |
| 725 | Ga0207684_10165352 | 3300025910 | Bacteria | 1906 |
| 726 | Ga0207654_10001318 | 3300025911 | Bacteria | 13235 |
| 727 | Ga0207654_10017455 | 3300025911 | Bacteria | 3752 |
| 728 | Ga0207654_10020733 | 3300025911 | Bacteria | 3489 |
| 729 | Ga0207654_10115339 | 3300025911 | Bacteria | 1678 |
| 730 | Ga0207654_10284014 | 3300025911 | Bacteria | 1120 |
| 731 | Ga0207707_10000577 | 3300025912 | Bacteria | 37232 |
| 732 | Ga0207707_10013845 | 3300025912 | Bacteria | 7034 |
| 733 | Ga0207707_10027146 | 3300025912 | Bacteria | 5006 |
| 734 | Ga0207707_10038041 | 3300025912 | Bacteria | 4204 |
| 735 | Ga0207707_10057171 | 3300025912 | Bacteria | 3395 |
| 736 | Ga0207707_10072545 | 3300025912 | Bacteria | 3001 |
| 737 | Ga0207707_10135112 | 3300025912 | Bacteria | 2156 |
| 738 | Ga0207707_10151696 | 3300025912 | Bacteria | 2026 |
| 739 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 740 | Ga0207695_10004415 | 3300025913 | Bacteria | 19212 |
| 741 | Ga0207695_10011746 | 3300025913 | Bacteria | 10577 |
| 742 | Ga0207695_10051889 | 3300025913 | Bacteria | 4302 |
| 743 | Ga0207695_10076795 | 3300025913 | Bacteria | 3394 |
| 744 | Ga0207695_10128836 | 3300025913 | Bacteria | 2489 |
| 745 | Ga0207695_10205545 | 3300025913 | Bacteria | 1882 |
| 746 | Ga0207695_10291348 | 3300025913 | Bacteria | 1524 |
| 747 | Ga0207695_10316714 | 3300025913 | Bacteria | 1450 |
| 748 | Ga0207695_10328574 | 3300025913 | Bacteria | 1418 |
| 749 | Ga0207695_10411011 | 3300025913 | Bacteria | 1238 |
| 750 | Ga0207695_10666506 | 3300025913 | Bacteria | 921 |
| 751 | Ga0207671_10002285 | 3300025914 | Bacteria | 20737 |
| 752 | Ga0207671_10009012 | 3300025914 | Bacteria | 8392 |
| 753 | Ga0207671_10012933 | 3300025914 | Bacteria | 6680 |
| 754 | Ga0207671_10030414 | 3300025914 | Bacteria | 4027 |
| 755 | Ga0207671_10216238 | 3300025914 | Bacteria | 1500 |
| 756 | Ga0207671_10256790 | 3300025914 | Bacteria | 1375 |
| 757 | Ga0207671_10363776 | 3300025914 | Bacteria | 1148 |
| 758 | Ga0207671_10609738 | 3300025914 | Bacteria | 870 |
| 759 | Ga0207663_10082208 | 3300025916 | Bacteria | 2112 |
| 760 | Ga0207660_10004634 | 3300025917 | Bacteria | 8962 |
| 761 | Ga0207660_10013164 | 3300025917 | Bacteria | 5416 |
| 762 | Ga0207660_10037192 | 3300025917 | Bacteria | 3390 |
| 763 | Ga0207660_10118160 | 3300025917 | Bacteria | 2005 |
| 764 | Ga0207660_10314999 | 3300025917 | Unclassified | 1248 |
| 765 | Ga0207660_10416795 | 3300025917 | Bacteria | 1083 |
| 766 | Ga0207662_10000146 | 3300025918 | Bacteria | 34142 |
| 767 | Ga0207662_10043744 | 3300025918 | Bacteria | 2642 |
| 768 | Ga0207662_10046470 | 3300025918 | Bacteria | 2568 |
| 769 | Ga0207662_10176936 | 3300025918 | Bacteria | 1371 |
| 770 | Ga0207657_10003084 | 3300025919 | Bacteria | 17826 |
| 771 | Ga0207657_10012251 | 3300025919 | Bacteria | 8472 |
| 772 | Ga0207657_10022391 | 3300025919 | Bacteria | 5913 |
| 773 | Ga0207657_10022630 | 3300025919 | Bacteria | 5875 |
| 774 | Ga0207657_10173175 | 3300025919 | Bacteria | 1748 |
| 775 | Ga0207657_10273208 | 3300025919 | Bacteria | 1343 |
| 776 | Ga0207649_10000907 | 3300025920 | Bacteria | 18679 |
| 777 | Ga0207649_10001001 | 3300025920 | Bacteria | 17489 |
| 778 | Ga0207649_10003509 | 3300025920 | Bacteria | 8570 |
| 779 | Ga0207649_10053105 | 3300025920 | Bacteria | 2517 |
| 780 | Ga0207652_10010606 | 3300025921 | Bacteria | 7417 |
| 781 | Ga0207652_10043700 | 3300025921 | Bacteria | 3815 |
| 782 | Ga0207652_10068600 | 3300025921 | Bacteria | 3077 |
| 783 | Ga0207652_10075441 | 3300025921 | Bacteria | 2939 |
| 784 | Ga0207652_10104189 | 3300025921 | Bacteria | 2509 |
| 785 | Ga0207646_10004552 | 3300025922 | Bacteria | 15002 |
| 786 | Ga0207646_10004920 | 3300025922 | Bacteria | 14288 |
| 787 | Ga0207646_10149616 | 3300025922 | Bacteria | 2105 |
| 788 | Ga0207646_10251620 | 3300025922 | Bacteria | 1596 |
| 789 | Ga0207646_10269196 | 3300025922 | Bacteria | 1540 |
| 790 | Ga0207681_10001125 | 3300025923 | Bacteria | 17320 |
| 791 | Ga0207681_10009832 | 3300025923 | Bacteria | 5850 |
| 792 | Ga0207681_10014548 | 3300025923 | Bacteria | 4893 |
| 793 | Ga0207681_10284649 | 3300025923 | Bacteria | 1303 |
| 794 | Ga0207681_10292495 | 3300025923 | Bacteria | 1286 |
| 795 | Ga0207694_10001152 | 3300025924 | Bacteria | 22948 |
| 796 | Ga0207694_10002336 | 3300025924 | Bacteria | 15508 |
| 797 | Ga0207694_10022362 | 3300025924 | Bacteria | 4796 |
| 798 | Ga0207694_10028283 | 3300025924 | Bacteria | 4274 |
| 799 | Ga0207694_10071691 | 3300025924 | Bacteria | 2707 |
| 800 | Ga0207694_10405997 | 3300025924 | Bacteria | 1133 |
| 801 | Ga0207650_10000010 | 3300025925 | Bacteria | 454110 |
| 802 | Ga0207650_10001243 | 3300025925 | Bacteria | 18523 |
| 803 | Ga0207650_10603065 | 3300025925 | Bacteria | 923 |
| 804 | Ga0207659_10000831 | 3300025926 | Bacteria | 18326 |
| 805 | Ga0207687_10015252 | 3300025927 | Bacteria | 5035 |
| 806 | Ga0207687_10268305 | 3300025927 | Bacteria | 1363 |
| 807 | Ga0207687_10323474 | 3300025927 | Bacteria | 1249 |
| 808 | Ga0207687_10324228 | 3300025927 | Bacteria | 1248 |
| 809 | Ga0207687_10345839 | 3300025927 | Bacteria | 1210 |
| 810 | Ga0207700_10014164 | 3300025928 | Bacteria | 5217 |
| 811 | Ga0207644_10000285 | 3300025931 | Bacteria | 33388 |
| 812 | Ga0207644_10001068 | 3300025931 | Bacteria | 17518 |
| 813 | Ga0207644_10080345 | 3300025931 | Unclassified | 2408 |
| 814 | Ga0207644_10109564 | 3300025931 | Bacteria | 2086 |
| 815 | Ga0207644_10268626 | 3300025931 | Bacteria | 1366 |
| 816 | Ga0207690_10002228 | 3300025932 | Bacteria | 11822 |
| 817 | Ga0207690_10011176 | 3300025932 | Bacteria | 5358 |
| 818 | Ga0207690_10036252 | 3300025932 | Bacteria | 3192 |
| 819 | Ga0207690_10045184 | 3300025932 | Bacteria | 2908 |
| 820 | Ga0207690_10275600 | 3300025932 | Bacteria | 1308 |
| 821 | Ga0207706_10032261 | 3300025933 | Bacteria | 4665 |
| 822 | Ga0207706_10166685 | 3300025933 | Bacteria | 1936 |
| 823 | Ga0207706_10211548 | 3300025933 | Bacteria | 1700 |
| 824 | Ga0207706_10263151 | 3300025933 | Bacteria | 1505 |
| 825 | Ga0207706_10313566 | 3300025933 | Bacteria | 1365 |
| 826 | Ga0207686_10000008 | 3300025934 | Bacteria | 245575 |
| 827 | Ga0207686_10000463 | 3300025934 | Bacteria | 26873 |
| 828 | Ga0207686_10009014 | 3300025934 | Bacteria | 5401 |
| 829 | Ga0207686_10016548 | 3300025934 | Bacteria | 4139 |
| 830 | Ga0207686_10053520 | 3300025934 | Bacteria | 2524 |
| 831 | Ga0207686_10312709 | 3300025934 | Bacteria | 1171 |
| 832 | Ga0207709_10000025 | 3300025935 | Bacteria | 364795 |
| 833 | Ga0207709_10000493 | 3300025935 | Bacteria | 35663 |
| 834 | Ga0207709_10001939 | 3300025935 | Bacteria | 13588 |
| 835 | Ga0207709_10003815 | 3300025935 | Bacteria | 8847 |
| 836 | Ga0207709_10035958 | 3300025935 | Bacteria | 2932 |
| 837 | Ga0207709_10190844 | 3300025935 | Bacteria | 1455 |
| 838 | Ga0207670_10000695 | 3300025936 | Bacteria | 17783 |
| 839 | Ga0207670_10004103 | 3300025936 | Bacteria | 7799 |
| 840 | Ga0207670_10064713 | 3300025936 | Bacteria | 2507 |
| 841 | Ga0207670_10115390 | 3300025936 | Bacteria | 1942 |
| 842 | Ga0207670_10152603 | 3300025936 | Bacteria | 1716 |
| 843 | Ga0207669_10000390 | 3300025937 | Bacteria | 19429 |
| 844 | Ga0207704_10000842 | 3300025938 | Bacteria | 13606 |
| 845 | Ga0207704_10087011 | 3300025938 | Bacteria | 2040 |
| 846 | Ga0207704_10094645 | 3300025938 | Bacteria | 1973 |
| 847 | Ga0207704_10761095 | 3300025938 | Bacteria | 806 |
| 848 | Ga0207665_10013886 | 3300025939 | Bacteria | 5296 |
| 849 | Ga0207665_10253016 | 3300025939 | Bacteria | 1302 |
| 850 | Ga0207691_10000371 | 3300025940 | Bacteria | 45123 |
| 851 | Ga0207691_10046619 | 3300025940 | Bacteria | 3981 |
| 852 | Ga0207691_10066790 | 3300025940 | Bacteria | 3253 |
| 853 | Ga0207691_10272142 | 3300025940 | Bacteria | 1458 |
| 854 | Ga0207691_10286898 | 3300025940 | Bacteria | 1416 |
| 855 | Ga0207711_10000513 | 3300025941 | Bacteria | 39782 |
| 856 | Ga0207711_10006144 | 3300025941 | Bacteria | 10148 |
| 857 | Ga0207711_10008004 | 3300025941 | Bacteria | 8842 |
| 858 | Ga0207711_10017397 | 3300025941 | Bacteria | 5973 |
| 859 | Ga0207711_10077141 | 3300025941 | Bacteria | 2904 |
| 860 | Ga0207711_10095914 | 3300025941 | Bacteria | 2617 |
| 861 | Ga0207711_10195015 | 3300025941 | Bacteria | 1847 |
| 862 | Ga0207689_10002310 | 3300025942 | Bacteria | 17860 |
| 863 | Ga0207689_10022079 | 3300025942 | Bacteria | 5352 |
| 864 | Ga0207689_10027470 | 3300025942 | Bacteria | 4763 |
| 865 | Ga0207689_10047194 | 3300025942 | Bacteria | 3558 |
| 866 | Ga0207689_10094886 | 3300025942 | Bacteria | 2450 |
| 867 | Ga0207689_10098748 | 3300025942 | Bacteria | 2399 |
| 868 | Ga0207689_10149553 | 3300025942 | Bacteria | 1925 |
| 869 | Ga0207689_10226814 | 3300025942 | Unclassified | 1544 |
| 870 | Ga0207689_10309475 | 3300025942 | Bacteria | 1310 |
| 871 | Ga0207661_10002789 | 3300025944 | Bacteria | 12046 |
| 872 | Ga0207661_10386847 | 3300025944 | Bacteria | 1267 |
| 873 | Ga0207679_10000102 | 3300025945 | Bacteria | 70199 |
| 874 | Ga0207679_10000425 | 3300025945 | Bacteria | 30008 |
| 875 | Ga0207679_10026299 | 3300025945 | Bacteria | 4011 |
| 876 | Ga0207679_10239496 | 3300025945 | Bacteria | 1537 |
| 877 | Ga0207679_10311808 | 3300025945 | Bacteria | 1360 |
| 878 | Ga0207679_10348756 | 3300025945 | Bacteria | 1290 |
| 879 | Ga0207679_10419024 | 3300025945 | Bacteria | 1181 |
| 880 | Ga0207667_10006351 | 3300025949 | Bacteria | 14330 |
| 881 | Ga0207667_10010676 | 3300025949 | Bacteria | 10720 |
| 882 | Ga0207667_10017409 | 3300025949 | Bacteria | 8089 |
| 883 | Ga0207667_10086548 | 3300025949 | Bacteria | 3243 |
| 884 | Ga0207667_10093626 | 3300025949 | Bacteria | 3103 |
| 885 | Ga0207667_10133566 | 3300025949 | Bacteria | 2556 |
| 886 | Ga0207667_10195728 | 3300025949 | Bacteria | 2074 |
| 887 | Ga0207667_10272149 | 3300025949 | Bacteria | 1731 |
| 888 | Ga0207651_10000093 | 3300025960 | Bacteria | 39865 |
| 889 | Ga0207651_10001385 | 3300025960 | Bacteria | 10984 |
| 890 | Ga0207651_10125775 | 3300025960 | Bacteria | 1953 |
| 891 | Ga0207651_10132730 | 3300025960 | Bacteria | 1909 |
| 892 | Ga0207712_10000408 | 3300025961 | Bacteria | 36889 |
| 893 | Ga0207712_10001464 | 3300025961 | Bacteria | 16101 |
| 894 | Ga0207712_10171804 | 3300025961 | Bacteria | 1695 |
| 895 | Ga0207712_10196151 | 3300025961 | Bacteria | 1597 |
| 896 | Ga0207712_10224990 | 3300025961 | Bacteria | 1502 |
| 897 | Ga0207712_10287102 | 3300025961 | Bacteria | 1345 |
| 898 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 899 | Ga0207668_10000798 | 3300025972 | Bacteria | 19311 |
| 900 | Ga0207668_10279507 | 3300025972 | Bacteria | 1368 |
| 901 | Ga0207640_10000598 | 3300025981 | Bacteria | 21453 |
| 902 | Ga0207640_10007397 | 3300025981 | Bacteria | 6061 |
| 903 | Ga0207640_10099808 | 3300025981 | Bacteria | 2032 |
| 904 | Ga0207640_10126128 | 3300025981 | Bacteria | 1843 |
| 905 | Ga0207640_10139361 | 3300025981 | Bacteria | 1766 |
| 906 | Ga0207640_10242125 | 3300025981 | Bacteria | 1394 |
| 907 | Ga0207640_10396827 | 3300025981 | Bacteria | 1122 |
| 908 | Ga0207658_10001648 | 3300025986 | Bacteria | 17064 |
| 909 | Ga0207658_10016124 | 3300025986 | Bacteria | 5133 |
| 910 | Ga0207658_10023732 | 3300025986 | Bacteria | 4284 |
| 911 | Ga0207658_10025324 | 3300025986 | Bacteria | 4154 |
| 912 | Ga0207658_10036943 | 3300025986 | Bacteria | 3505 |
| 913 | Ga0207658_10577090 | 3300025986 | Bacteria | 1008 |
| 914 | Ga0207677_10000456 | 3300026023 | Bacteria | 27537 |
| 915 | Ga0207677_10051529 | 3300026023 | Bacteria | 2791 |
| 916 | Ga0207677_10201657 | 3300026023 | Bacteria | 1582 |
| 917 | Ga0207703_10000384 | 3300026035 | Bacteria | 47335 |
| 918 | Ga0207703_10000867 | 3300026035 | Bacteria | 29660 |
| 919 | Ga0207703_10045116 | 3300026035 | Bacteria | 3545 |
| 920 | Ga0207703_10050255 | 3300026035 | Bacteria | 3374 |
| 921 | Ga0207703_10285496 | 3300026035 | Bacteria | 1500 |
| 922 | Ga0207703_10473076 | 3300026035 | Bacteria | 1173 |
| 923 | Ga0207639_10003324 | 3300026041 | Bacteria | 10825 |
| 924 | Ga0207639_10004761 | 3300026041 | Bacteria | 9144 |
| 925 | Ga0207639_10012411 | 3300026041 | Bacteria | 5931 |
| 926 | Ga0207639_10014309 | 3300026041 | Bacteria | 5576 |
| 927 | Ga0207639_10750963 | 3300026041 | Bacteria | 907 |
| 928 | Ga0207678_10000100 | 3300026067 | Bacteria | 70537 |
| 929 | Ga0207678_10002390 | 3300026067 | Bacteria | 17041 |
| 930 | Ga0207678_10010485 | 3300026067 | Bacteria | 8138 |
| 931 | Ga0207678_10040568 | 3300026067 | Bacteria | 4037 |
| 932 | Ga0207678_10047821 | 3300026067 | Bacteria | 3699 |
| 933 | Ga0207678_10446371 | 3300026067 | Bacteria | 1124 |
| 934 | Ga0207678_10561183 | 3300026067 | Bacteria | 999 |
| 935 | Ga0207708_10001694 | 3300026075 | Bacteria | 16322 |
| 936 | Ga0207708_10023885 | 3300026075 | Bacteria | 4623 |
| 937 | Ga0207708_10028396 | 3300026075 | Bacteria | 4237 |
| 938 | Ga0207708_10085114 | 3300026075 | Bacteria | 2432 |
| 939 | Ga0207708_10102988 | 3300026075 | Bacteria | 2211 |
| 940 | Ga0207708_10153194 | 3300026075 | Bacteria | 1817 |
| 941 | Ga0207702_10003152 | 3300026078 | Bacteria | 15271 |
| 942 | Ga0207702_10167061 | 3300026078 | Bacteria | 2014 |
| 943 | Ga0207702_10181949 | 3300026078 | Bacteria | 1936 |
| 944 | Ga0207702_10243222 | 3300026078 | Bacteria | 1687 |
| 945 | Ga0207702_10305491 | 3300026078 | Bacteria | 1511 |
| 946 | Ga0207702_10705024 | 3300026078 | Bacteria | 995 |
| 947 | Ga0207641_10001449 | 3300026088 | Bacteria | 23273 |
| 948 | Ga0207641_10057795 | 3300026088 | Bacteria | 3300 |
| 949 | Ga0207641_10083361 | 3300026088 | Bacteria | 2780 |
| 950 | Ga0207641_10115170 | 3300026088 | Bacteria | 2390 |
| 951 | Ga0207641_10209104 | 3300026088 | Bacteria | 1803 |
| 952 | Ga0207641_10359365 | 3300026088 | Bacteria | 1390 |
| 953 | Ga0207648_10002737 | 3300026089 | Bacteria | 18733 |
| 954 | Ga0207648_10008878 | 3300026089 | Bacteria | 9676 |
| 955 | Ga0207648_10065955 | 3300026089 | Bacteria | 3157 |
| 956 | Ga0207648_10173974 | 3300026089 | Bacteria | 1904 |
| 957 | Ga0207648_10206900 | 3300026089 | Bacteria | 1741 |
| 958 | Ga0207648_10303271 | 3300026089 | Bacteria | 1433 |
| 959 | Ga0207648_10738430 | 3300026089 | Bacteria | 914 |
| 960 | Ga0207676_10001221 | 3300026095 | Bacteria | 19155 |
| 961 | Ga0207676_10019238 | 3300026095 | Bacteria | 4978 |
| 962 | Ga0207676_10024955 | 3300026095 | Bacteria | 4431 |
| 963 | Ga0207676_10032052 | 3300026095 | Bacteria | 3957 |
| 964 | Ga0207676_10313320 | 3300026095 | Bacteria | 1437 |
| 965 | Ga0207676_10725031 | 3300026095 | Bacteria | 965 |
| 966 | Ga0207674_10000671 | 3300026116 | Bacteria | 44489 |
| 967 | Ga0207674_10002399 | 3300026116 | Bacteria | 23688 |
| 968 | Ga0207674_10029109 | 3300026116 | Bacteria | 5821 |
| 969 | Ga0207674_10088526 | 3300026116 | Bacteria | 3089 |
| 970 | Ga0207674_10153778 | 3300026116 | Bacteria | 2256 |
| 971 | Ga0207674_10164935 | 3300026116 | Bacteria | 2169 |
| 972 | Ga0207674_10174661 | 3300026116 | Bacteria | 2101 |
| 973 | Ga0207674_10266209 | 3300026116 | Bacteria | 1661 |
| 974 | Ga0207674_10568106 | 3300026116 | Bacteria | 1096 |
| 975 | Ga0207675_100001958 | 3300026118 | Bacteria | 20583 |
| 976 | Ga0207675_100002014 | 3300026118 | Bacteria | 20259 |
| 977 | Ga0207675_100012425 | 3300026118 | Bacteria | 7956 |
| 978 | Ga0207675_100143234 | 3300026118 | Bacteria | 2271 |
| 979 | Ga0207675_100447650 | 3300026118 | Bacteria | 1279 |
| 980 | Ga0207675_100637354 | 3300026118 | Bacteria | 1071 |
| 981 | Ga0207683_10000375 | 3300026121 | Bacteria | 41120 |
| 982 | Ga0207683_10021422 | 3300026121 | Bacteria | 5534 |
| 983 | Ga0207683_10087003 | 3300026121 | Bacteria | 2779 |
| 984 | Ga0207683_10130809 | 3300026121 | Bacteria | 2257 |
| 985 | Ga0207683_10341395 | 3300026121 | Bacteria | 1373 |
| 986 | Ga0207683_10680892 | 3300026121 | Bacteria | 953 |
| 987 | Ga0207698_10000755 | 3300026142 | Bacteria | 18774 |
| 988 | Ga0207698_10008764 | 3300026142 | Bacteria | 6415 |
| 989 | Ga0207698_10021968 | 3300026142 | Bacteria | 4423 |
| 990 | Ga0207698_10142014 | 3300026142 | Bacteria | 2070 |
| 991 | Ga0207698_10400789 | 3300026142 | Bacteria | 1311 |
| 992 | Ga0207698_10599607 | 3300026142 | Bacteria | 1086 |
| 993 | Ga0207698_10795302 | 3300026142 | Bacteria | 948 |
| 994 | Ga0209281_1000580 | 3300027111 | Bacteria | 43078 |
| 995 | Ga0209588_1109662 | 3300027671 | Unclassified | 887 |
| 996 | Ga0209813_10039879 | 3300027866 | Bacteria | 1425 |
| 997 | Ga0207428_10013505 | 3300027907 | Bacteria | 7131 |
| 998 | Ga0207428_10425070 | 3300027907 | Bacteria | 971 |
| 999 | Ga0268266_10002601 | 3300028379 | Bacteria | 19127 |
| 1000 | Ga0268266_10176790 | 3300028379 | Bacteria | 1941 |
| 1001 | Ga0268266_10334851 | 3300028379 | Bacteria | 1419 |
| 1002 | Ga0268266_10705925 | 3300028379 | Bacteria | 972 |
| 1003 | Ga0268265_10001155 | 3300028380 | Bacteria | 23203 |
| 1004 | Ga0268265_10041099 | 3300028380 | Bacteria | 3419 |
| 1005 | Ga0268265_10087003 | 3300028380 | Bacteria | 2485 |
| 1006 | Ga0268265_10132990 | 3300028380 | Bacteria | 2071 |
| 1007 | Ga0268265_10837196 | 3300028380 | Bacteria | 899 |
| 1008 | Ga0268264_10000938 | 3300028381 | Bacteria | 30247 |
| 1009 | Ga0268264_10006852 | 3300028381 | Bacteria | 9564 |
| 1010 | Ga0268264_10013722 | 3300028381 | Bacteria | 6670 |
| 1011 | Ga0268264_10048036 | 3300028381 | Bacteria | 3549 |
| 1012 | Ga0268264_10059751 | 3300028381 | Unclassified | 3194 |
| 1013 | Ga0268264_10095284 | 3300028381 | Bacteria | 2575 |
| 1014 | Ga0268264_10176763 | 3300028381 | Bacteria | 1935 |
| 1015 | Ga0268264_10317674 | 3300028381 | Bacteria | 1471 |
| 1016 | Ga0268264_10410677 | 3300028381 | Bacteria | 1303 |
| 1017 | Ga0265337_1011859 | 3300028556 | Bacteria | 2987 |
| 1018 | Ga0265337_1027974 | 3300028556 | Bacteria | 1696 |
| 1019 | Ga0265326_10002848 | 3300028558 | Bacteria | 5776 |
| 1020 | Ga0265319_1002530 | 3300028563 | Bacteria | 9901 |
| 1021 | Ga0265319_1027664 | 3300028563 | Bacteria | 2008 |
| 1022 | Ga0265334_10002924 | 3300028573 | Bacteria | 7831 |
| 1023 | Ga0265334_10064086 | 3300028573 | Bacteria | 1381 |
| 1024 | Ga0265318_10000015 | 3300028577 | Bacteria | 187234 |
| 1025 | Ga0265318_10001067 | 3300028577 | Bacteria | 17279 |
| 1026 | Ga0265318_10107796 | 3300028577 | Bacteria | 1024 |
| 1027 | Ga0265322_10039179 | 3300028654 | Unclassified | 1348 |
| 1028 | Ga0265336_10096874 | 3300028666 | Bacteria | 879 |
| 1029 | Ga0265338_10001151 | 3300028800 | Bacteria | 43728 |
| 1030 | Ga0265338_10020696 | 3300028800 | Bacteria | 6904 |
| 1031 | Ga0265338_10023976 | 3300028800 | Bacteria | 6250 |
| 1032 | Ga0265338_10035877 | 3300028800 | Bacteria | 4755 |
| 1033 | Ga0265338_10128359 | 3300028800 | Bacteria | 2007 |
| 1034 | Ga0265338_10133069 | 3300028800 | Bacteria | 1960 |
| 1035 | Ga0265338_10327454 | 3300028800 | Bacteria | 1107 |
| 1036 | Ga0265762_1004498 | 3300030760 | Bacteria | 2495 |
| 1037 | Ga0265762_1008314 | 3300030760 | Unclassified | 1846 |
| 1038 | Ga0265765_1005577 | 3300030879 | Bacteria | 1321 |
| 1039 | Ga0265760_10034992 | 3300031090 | Bacteria | 1486 |
| 1040 | Ga0265328_10079421 | 3300031239 | Bacteria | 1209 |
| 1041 | Ga0265320_10017283 | 3300031240 | Bacteria | 4011 |
| 1042 | Ga0265320_10079449 | 3300031240 | Bacteria | 1533 |
| 1043 | Ga0265320_10081828 | 3300031240 | Bacteria | 1506 |
| 1044 | Ga0265320_10215209 | 3300031240 | Bacteria | 856 |
| 1045 | Ga0265325_10001084 | 3300031241 | Bacteria | 19604 |
| 1046 | Ga0265325_10089163 | 3300031241 | Bacteria | 1523 |
| 1047 | Ga0265325_10098895 | 3300031241 | Bacteria | 1430 |
| 1048 | Ga0265325_10188254 | 3300031241 | Bacteria | 958 |
| 1049 | Ga0265340_10003394 | 3300031247 | Bacteria | 8994 |
| 1050 | Ga0265340_10089159 | 3300031247 | Bacteria | 1444 |
| 1051 | Ga0265340_10144329 | 3300031247 | Bacteria | 1088 |
| 1052 | Ga0265339_10000685 | 3300031249 | Bacteria | 26127 |
| 1053 | Ga0265339_10007974 | 3300031249 | Bacteria | 6792 |
| 1054 | Ga0265339_10015979 | 3300031249 | Bacteria | 4485 |
| 1055 | Ga0265339_10032527 | 3300031249 | Bacteria | 2941 |
| 1056 | Ga0265339_10040343 | 3300031249 | Bacteria | 2595 |
| 1057 | Ga0265339_10223758 | 3300031249 | Bacteria | 919 |
| 1058 | Ga0265331_10000102 | 3300031250 | Bacteria | 115584 |
| 1059 | Ga0265331_10033783 | 3300031250 | Bacteria | 2528 |
| 1060 | Ga0265316_10022216 | 3300031344 | Bacteria | 5357 |
| 1061 | Ga0265316_10082428 | 3300031344 | Unclassified | 2464 |
| 1062 | Ga0265316_10086431 | 3300031344 | Bacteria | 2397 |
| 1063 | Ga0265316_10143833 | 3300031344 | Bacteria | 1790 |
| 1064 | Ga0265316_10173427 | 3300031344 | Bacteria | 1608 |
| 1065 | Ga0265316_10240214 | 3300031344 | Unclassified | 1332 |
| 1066 | Ga0307408_100089283 | 3300031548 | Bacteria | 2323 |
| 1067 | Ga0265313_10000865 | 3300031595 | Bacteria | 30547 |
| 1068 | Ga0307508_10196223 | 3300031616 | Bacteria | 1620 |
| 1069 | Ga0316575_10001077 | 3300031665 | Bacteria | 8500 |
| 1070 | Ga0316575_10011041 | 3300031665 | Bacteria | 3333 |
| 1071 | Ga0316575_10050339 | 3300031665 | Bacteria | 1659 |
| 1072 | Ga0316575_10165460 | 3300031665 | Bacteria | 915 |
| 1073 | Ga0316579_10038435 | 3300031691 | Bacteria | 2213 |
| 1074 | Ga0316579_10091232 | 3300031691 | Bacteria | 1455 |
| 1075 | Ga0265314_10000258 | 3300031711 | Bacteria | 77755 |
| 1076 | Ga0265314_10060363 | 3300031711 | Bacteria | 2588 |
| 1077 | Ga0265314_10114059 | 3300031711 | Bacteria | 1712 |
| 1078 | Ga0265314_10161977 | 3300031711 | Bacteria | 1360 |
| 1079 | Ga0265314_10310288 | 3300031711 | Bacteria | 881 |
| 1080 | Ga0265342_10001056 | 3300031712 | Bacteria | 26936 |
| 1081 | Ga0265342_10007754 | 3300031712 | Bacteria | 7812 |
| 1082 | Ga0265342_10035673 | 3300031712 | Bacteria | 3043 |
| 1083 | Ga0265342_10165782 | 3300031712 | Bacteria | 1219 |
| 1084 | Ga0265342_10238253 | 3300031712 | Unclassified | 975 |
| 1085 | Ga0316576_10001112 | 3300031727 | Bacteria | 14055 |
| 1086 | Ga0316576_10033327 | 3300031727 | Bacteria | 3665 |
| 1087 | Ga0316576_10083745 | 3300031727 | Bacteria | 2370 |
| 1088 | Ga0316576_10099442 | 3300031727 | Bacteria | 2173 |
| 1089 | Ga0316576_10143290 | 3300031727 | Bacteria | 1799 |
| 1090 | Ga0316576_10248342 | 3300031727 | Bacteria | 1336 |
| 1091 | Ga0316578_10011768 | 3300031728 | Bacteria | 4593 |
| 1092 | Ga0316578_10044301 | 3300031728 | Bacteria | 2588 |
| 1093 | Ga0316578_10054356 | 3300031728 | Bacteria | 2348 |
| 1094 | Ga0316578_10129128 | 3300031728 | Bacteria | 1520 |
| 1095 | Ga0316578_10186846 | 3300031728 | Bacteria | 1248 |
| 1096 | Ga0316578_10230492 | 3300031728 | Bacteria | 1112 |
| 1097 | Ga0307405_10102765 | 3300031731 | Bacteria | 1920 |
| 1098 | Ga0316577_10008546 | 3300031733 | Bacteria | 5492 |
| 1099 | Ga0316577_10014688 | 3300031733 | Bacteria | 4302 |
| 1100 | Ga0316577_10020005 | 3300031733 | Bacteria | 3708 |
| 1101 | Ga0316577_10038969 | 3300031733 | Bacteria | 2659 |
| 1102 | Ga0307413_10157747 | 3300031824 | Bacteria | 1590 |
| 1103 | Ga0307413_10167609 | 3300031824 | Bacteria | 1551 |
| 1104 | Ga0307410_10147722 | 3300031852 | Bacteria | 1746 |
| 1105 | Ga0307410_10181137 | 3300031852 | Bacteria | 1595 |
| 1106 | Ga0307410_10222037 | 3300031852 | Bacteria | 1454 |
| 1107 | Ga0307410_10435769 | 3300031852 | Bacteria | 1066 |
| 1108 | Ga0307406_10031996 | 3300031901 | Bacteria | 3207 |
| 1109 | Ga0307406_10170919 | 3300031901 | Bacteria | 1573 |
| 1110 | Ga0307409_100109755 | 3300031995 | Bacteria | 2310 |
| 1111 | Ga0307409_100394241 | 3300031995 | Bacteria | 1320 |
| 1112 | Ga0307409_100395838 | 3300031995 | Bacteria | 1318 |
| 1113 | Ga0307416_100243039 | 3300032002 | Bacteria | 1746 |
| 1114 | Ga0307414_10008080 | 3300032004 | Bacteria | 5944 |
| 1115 | Ga0307414_10299504 | 3300032004 | Bacteria | 1360 |
| 1116 | Ga0307411_10120154 | 3300032005 | Bacteria | 1899 |
| 1117 | Ga0307411_10423843 | 3300032005 | Bacteria | 1106 |
| 1118 | Ga0307415_100033995 | 3300032126 | Bacteria | 3314 |
| 1119 | Ga0307415_100510014 | 3300032126 | Unclassified | 1053 |
| 1120 | Ga0316583_10007407 | 3300032133 | Bacteria | 3951 |
| 1121 | Ga0316585_10019994 | 3300032137 | Bacteria | 2046 |
| 1122 | Ga0316593_10005355 | 3300032168 | Bacteria | 3376 |
| 1123 | Ga0316593_10010568 | 3300032168 | Bacteria | 2651 |
| 1124 | Ga0316593_10013111 | 3300032168 | Bacteria | 2447 |
| 1125 | Ga0316593_10020510 | 3300032168 | Bacteria | 2056 |
| 1126 | Ga0316593_10057683 | 3300032168 | Bacteria | 1322 |
| 1127 | Ga0316593_10062211 | 3300032168 | Bacteria | 1278 |
| 1128 | Ga0316596_1011731 | 3300033541 | Bacteria | 2147 |
| 1129 | Ga0316596_1024299 | 3300033541 | Bacteria | 1556 |
| 1130 | Ga0373930_0011932 | 3300034816 | Bacteria | 1576 |
| 1131 | Ga0373941_0001589 | 3300035115 | Bacteria | 4830 |
| 1132 | Ga0373941_0037090 | 3300035115 | Bacteria | 1486 |
| 1133 | Ga0373945_0033785 | 3300035116 | Bacteria | 1820 |
| 1134 | Ga0373956_0387337 | 3300035119 | Bacteria | 667 |
| 1135 | Ga0373943_0049967 | 3300035170 | Bacteria | 2054 |
| 1136 | Ga0373946_0093571 | 3300035171 | Bacteria | 1336 |
| 1137 | Ga0316574_0000439 | 3300035398 | Bacteria | 16537 |
| 1138 | Ga0316574_0017026 | 3300035398 | Bacteria | 4244 |
| 1139 | Ga0316574_0100775 | 3300035398 | Bacteria | 1848 |
| 1140 | Ga0373931_0040463 | 3300035691 | Bacteria | 2446 |
| 1141 | Ga0373931_0068199 | 3300035691 | Bacteria | 1935 |
| 1142 | Ga0373935_0037988 | 3300035692 | Bacteria | 3013 |
| 1143 | Ga0373935_0052142 | 3300035692 | Bacteria | 2600 |
| 1144 | Ga0373927_0044672 | 3300035695 | Bacteria | 2866 |
| 1145 | Ga0373937_0005450 | 3300036401 | Bacteria | 10892 |
| 1146 | Ga0373937_0047707 | 3300036401 | Bacteria | 3920 |
| 1147 | Ga0373937_0547774 | 3300036401 | Bacteria | 1099 |
| 1148 | Ga0316582_0020619 | 3300036647 | Bacteria | 3880 |
| 1149 | Ga0316582_0025596 | 3300036647 | Bacteria | 3545 |
| 1150 | Ga0316582_0053359 | 3300036647 | Bacteria | 2571 |
| 1151 | Ga0316582_0148054 | 3300036647 | Bacteria | 1586 |
| 1152 | Ga0316582_0318950 | 3300036647 | Bacteria | 1068 |
| 1153 | Ga0316582_0388358 | 3300036647 | Bacteria | 961 |
| 1154 | Ga0316584_0001402 | 3300036712 | Bacteria | 14393 |
| 1155 | Ga0316584_0003289 | 3300036712 | Bacteria | 10458 |
| 1156 | Ga0316584_0003840 | 3300036712 | Bacteria | 9850 |
| 1157 | Ga0316584_0003883 | 3300036712 | Bacteria | 9806 |
| 1158 | Ga0316584_0011924 | 3300036712 | Bacteria | 6123 |
| 1159 | Ga0316584_0023348 | 3300036712 | Bacteria | 4519 |
| 1160 | Ga0316584_0023535 | 3300036712 | Bacteria | 4499 |
| 1161 | Ga0316584_0195144 | 3300036712 | Bacteria | 1496 |
| 1162 | Ga0316584_0562059 | 3300036712 | Bacteria | 795 |
| 1163 | Ga0373925_0207428 | 3300037068 | Bacteria | 1560 |
| 1164 | Ga0373925_0222760 | 3300037068 | Bacteria | 1506 |
| 1165 | Ga0395899_0012908 | 3300037312 | Bacteria | 6393 |
| 1166 | Ga0395899_0070048 | 3300037312 | Bacteria | 2567 |
| 1167 | Ga0395899_0486162 | 3300037312 | Bacteria | 803 |
| 1168 | Ga0395900_0025391 | 3300037418 | Bacteria | 6066 |
| 1169 | Ga0395900_0140129 | 3300037418 | Bacteria | 2477 |
| 1170 | Ga0395900_0181520 | 3300037418 | Bacteria | 2138 |
| 1171 | Ga0395900_0196989 | 3300037418 | Bacteria | 2040 |
| 1172 | Ga0395900_0415781 | 3300037418 | Bacteria | 1306 |
| 1173 | Ga0395900_0733914 | 3300037418 | Bacteria | 919 |
| 1174 | Ga0395900_0836032 | 3300037418 | Bacteria | 847 |
| 1175 | Ga0395898_0080689 | 3300037466 | Bacteria | 3137 |
| 1176 | Ga0395898_0125664 | 3300037466 | Bacteria | 2457 |
| 1177 | Ga0395898_0162225 | 3300037466 | Bacteria | 2138 |
| 1178 | Ga0395898_0193157 | 3300037466 | Bacteria | 1945 |
| 1179 | Ga0395898_0636552 | 3300037466 | Bacteria | 1009 |
| 1180 | Ga0395905_0000911 | 3300037471 | Bacteria | 38191 |
| 1181 | Ga0395905_0006827 | 3300037471 | Bacteria | 11423 |
| 1182 | Ga0395905_0008081 | 3300037471 | Bacteria | 10392 |
| 1183 | Ga0395905_0040992 | 3300037471 | Bacteria | 4344 |
| 1184 | Ga0395905_0052360 | 3300037471 | Bacteria | 3821 |
| 1185 | Ga0395905_0171218 | 3300037471 | Bacteria | 2040 |
| 1186 | Ga0395905_0227978 | 3300037471 | Bacteria | 1742 |
| 1187 | Ga0395905_0299862 | 3300037471 | Bacteria | 1494 |
| 1188 | Ga0395905_0316347 | 3300037471 | Bacteria | 1450 |
| 1189 | Ga0395905_0860694 | 3300037471 | Bacteria | 809 |
| 1190 | Ga0316581_0004894 | 3300037588 | Bacteria | 3450 |
| 1191 | Ga0316581_0018084 | 3300037588 | Bacteria | 2043 |
| 1192 | Ga0436364_0003086 | 3300037853 | Bacteria | 2692 |
| 1193 | Ga0436364_0079644 | 3300037853 | Bacteria | 315114 |
| 1194 | Ga0436364_0207864 | 3300037853 | Bacteria | 4093 |
| 1195 | Ga0436364_0310410 | 3300037853 | Bacteria | 6647 |
| 1196 | Ga0436364_0374781 | 3300037853 | Bacteria | 2708 |
| 1197 | Ga0436364_0517934 | 3300037853 | Bacteria | 2665 |
| 1198 | Ga0436364_0545736 | 3300037853 | Bacteria | 12413 |
| 1199 | Ga0436364_0598581 | 3300037853 | Bacteria | 1322 |
| 1200 | Ga0436364_0635932 | 3300037853 | Bacteria | 1196 |
| 1201 | Ga0436364_0653298 | 3300037853 | Bacteria | 1171 |
| 1202 | Ga0436364_0935450 | 3300037853 | Unclassified | 2024 |
| 1203 | Ga0436364_1040205 | 3300037853 | Bacteria | 1666 |
| 1204 | Ga0436364_1113697 | 3300037853 | Bacteria | 5886 |
| 1205 | Ga0436364_1161322 | 3300037853 | Bacteria | 4503 |
| 1206 | Ga0436364_1291049 | 3300037853 | Bacteria | 3015 |
| 1207 | Ga0436364_1366309 | 3300037853 | Bacteria | 1860 |
| 1208 | Ga0395901_0006071 | 3300038443 | Bacteria | 12242 |
| 1209 | Ga0395901_0094751 | 3300038443 | Bacteria | 3128 |
| 1210 | Ga0395901_0109329 | 3300038443 | Bacteria | 2902 |
| 1211 | Ga0395901_0205365 | 3300038443 | Bacteria | 2064 |
| 1212 | Ga0395901_0695327 | 3300038443 | Bacteria | 1015 |
| 1213 | Ga0400484_42049 | 3300038725 | Bacteria | 3922 |
| 1214 | Ga0400490_04614 | 3300038726 | Bacteria | 12566 |
| 1215 | Ga0400490_13335 | 3300038726 | Bacteria | 8774 |
| 1216 | Ga0400486_07680 | 3300038742 | Bacteria | 16080 |
| 1217 | Ga0400483_195000 | 3300039062 | Bacteria | 103610 |
| 1218 | Ga0400483_278927 | 3300039062 | Bacteria | 1901 |
| 1219 | Ga0436365_0227260 | 3300039437 | Bacteria | 4977 |
| 1220 | Ga0436365_0283204 | 3300039437 | Bacteria | 28751 |
| 1221 | Ga0436365_0421852 | 3300039437 | Bacteria | 162876 |
| 1222 | Ga0436365_0426125 | 3300039437 | Bacteria | 1963 |
| 1223 | Ga0436365_0847170 | 3300039437 | Bacteria | 1144 |
| 1224 | Ga0436365_0935686 | 3300039437 | Bacteria | 2770 |
| 1225 | Ga0436365_0994234 | 3300039437 | Bacteria | 49963 |
| 1226 | Ga0436365_1114212 | 3300039437 | Bacteria | 2342 |
| 1227 | Ga0436365_1132500 | 3300039437 | Bacteria | 1715 |
| 1228 | Ga0436365_1397674 | 3300039437 | Bacteria | 2110 |
| 1229 | Ga0436365_1422517 | 3300039437 | Bacteria | 874 |
| 1230 | Ga0436365_1595370 | 3300039437 | Bacteria | 63808 |
| 1231 | Ga0436365_1779432 | 3300039437 | Bacteria | 5390 |
| 1232 | Ga0436360_0295164 | 3300039438 | Bacteria | 14242 |
| 1233 | Ga0436360_0355578 | 3300039438 | Bacteria | 1182 |
| 1234 | Ga0436360_0413033 | 3300039438 | Bacteria | 1384 |
| 1235 | Ga0436360_0459232 | 3300039438 | Bacteria | 3214 |
| 1236 | Ga0436360_0587385 | 3300039438 | Bacteria | 965 |
| 1237 | Ga0436361_0073402 | 3300039447 | Bacteria | 1508 |
| 1238 | Ga0436363_0096334 | 3300039450 | Bacteria | 850 |
| 1239 | Ga0436363_0162148 | 3300039450 | Bacteria | 3683 |
| 1240 | Ga0436363_0171561 | 3300039450 | Bacteria | 925 |
| 1241 | Ga0436363_0222055 | 3300039450 | Bacteria | 2207 |
| 1242 | Ga0436363_0516425 | 3300039450 | Bacteria | 5850 |
| 1243 | Ga0436363_0550052 | 3300039450 | Bacteria | 837 |
| 1244 | Ga0436363_0849922 | 3300039450 | Bacteria | 1309 |
| 1245 | Ga0436362_0315526 | 3300039453 | Bacteria | 1702 |
| 1246 | Ga0436362_0605469 | 3300039453 | Bacteria | 2595 |
| 1247 | Ga0436362_0735076 | 3300039453 | Bacteria | 999 |
| 1248 | Ga0436362_0764253 | 3300039453 | Bacteria | 1191 |
| 1249 | Ga0436362_0808991 | 3300039453 | Bacteria | 4956 |
| 1250 | Ga0439433_0080256 | 3300041999 | Bacteria | 793 |
| 1251 | Ga0439448_0015703 | 3300042005 | Bacteria | 2297 |
| 1252 | Ga0439458_0072768 | 3300042157 | Bacteria | 869 |
| 1253 | Ga0439458_0126685 | 3300042157 | Bacteria | 675 |
| 1254 | Ga0439434_0082002 | 3300042435 | Bacteria | 1024 |
| 1255 | Ga0451577_0001956 | 3300042876 | Bacteria | 25985 |
| 1256 | Ga0451577_0121152 | 3300042876 | Bacteria | 2343 |
| 1257 | Ga0451577_0175909 | 3300042876 | Bacteria | 1929 |
| 1258 | Ga0451577_0446006 | 3300042876 | Bacteria | 1175 |
| 1259 | Ga0451577_0710005 | 3300042876 | Bacteria | 910 |
| 1260 | Ga0451577_0737711 | 3300042876 | Bacteria | 891 |
| 1261 | Ga0466969_0006535 | 3300044656 | Bacteria | 6203 |
| 1262 | Ga0466972_0086629 | 3300044658 | Bacteria | 1488 |
| 1263 | Ga0453683_0000118 | 3300044673 | Bacteria | 117158 |
| 1264 | Ga0453683_0000280 | 3300044673 | Bacteria | 66926 |
| 1265 | Ga0453683_0000891 | 3300044673 | Bacteria | 28627 |
| 1266 | Ga0453683_0001047 | 3300044673 | Bacteria | 25702 |
| 1267 | Ga0453683_0005938 | 3300044673 | Bacteria | 8425 |
| 1268 | Ga0453683_0027559 | 3300044673 | Bacteria | 3602 |
| 1269 | Ga0453683_0075393 | 3300044673 | Bacteria | 2112 |
| 1270 | Ga0453683_0150042 | 3300044673 | Bacteria | 1473 |
| 1271 | Ga0453683_0256609 | 3300044673 | Bacteria | 1115 |
| 1272 | Ga0466966_0007455 | 3300044684 | Bacteria | 7256 |
| 1273 | Ga0466963_0075224 | 3300044694 | Bacteria | 2279 |
| 1274 | Ga0453684_0000829 | 3300044712 | Bacteria | 104404 |
| 1275 | Ga0453684_0005096 | 3300044712 | Bacteria | 26493 |
| 1276 | Ga0453684_0022082 | 3300044712 | Bacteria | 9465 |
| 1277 | Ga0453684_0028475 | 3300044712 | Bacteria | 7967 |
| 1278 | Ga0453684_0050873 | 3300044712 | Bacteria | 5442 |
| 1279 | Ga0453684_0052888 | 3300044712 | Bacteria | 5305 |
| 1280 | Ga0453684_0064823 | 3300044712 | Bacteria | 4663 |
| 1281 | Ga0453684_0073587 | 3300044712 | Bacteria | 4306 |
| 1282 | Ga0453684_0080822 | 3300044712 | Bacteria | 4057 |
| 1283 | Ga0453684_0084451 | 3300044712 | Bacteria | 3948 |
| 1284 | Ga0453684_0178157 | 3300044712 | Bacteria | 2498 |
| 1285 | Ga0453684_0196101 | 3300044712 | Bacteria | 2358 |
| 1286 | Ga0453684_0231434 | 3300044712 | Bacteria | 2133 |
| 1287 | Ga0453684_0291175 | 3300044712 | Bacteria | 1859 |
| 1288 | Ga0453684_0360342 | 3300044712 | Bacteria | 1637 |
| 1289 | Ga0453684_0523887 | 3300044712 | Bacteria | 1309 |
| 1290 | Ga0466971_0010408 | 3300044719 | Bacteria | 4064 |
| 1291 | Ga0466968_0211427 | 3300044735 | Bacteria | 911 |
| 1292 | Ga0466970_0237370 | 3300044765 | Bacteria | 1020 |
| 1293 | Ga0466957_0001594 | 3300044842 | Bacteria | 11920 |
| 1294 | Ga0466957_0178423 | 3300044842 | Bacteria | 1386 |
| 1295 | Ga0466959_0007114 | 3300045049 | Bacteria | 7828 |
| 1296 | Ga0466959_0015161 | 3300045049 | Bacteria | 5614 |
| 1297 | Ga0451576_0000001 | 3300045051 | Bacteria | 1802108 |
| 1298 | Ga0451576_0000019 | 3300045051 | Bacteria | 545863 |
| 1299 | Ga0451576_0000213 | 3300045051 | Bacteria | 144536 |
| 1300 | Ga0451576_0001202 | 3300045051 | Bacteria | 46283 |
| 1301 | Ga0451576_0012429 | 3300045051 | Bacteria | 9562 |
| 1302 | Ga0451576_0016088 | 3300045051 | Bacteria | 8263 |
| 1303 | Ga0451576_0024883 | 3300045051 | Bacteria | 6460 |
| 1304 | Ga0451576_0036606 | 3300045051 | Bacteria | 5201 |
| 1305 | Ga0451576_0094400 | 3300045051 | Bacteria | 3111 |
| 1306 | Ga0451576_0170485 | 3300045051 | Bacteria | 2272 |
| 1307 | Ga0451576_0775981 | 3300045051 | Bacteria | 1007 |
| 1308 | Ga0451576_0875787 | 3300045051 | Bacteria | 942 |
| 1309 | Ga0451576_1066620 | 3300045051 | Bacteria | 846 |
| 1310 | Ga0466958_0004041 | 3300045836 | Bacteria | 7691 |
| 1311 | Ga0466958_0010957 | 3300045836 | Bacteria | 5094 |
| 1312 | Ga0466967_0061444 | 3300045976 | Bacteria | 3333 |
| 1313 | Ga0466967_0353804 | 3300045976 | Bacteria | 1422 |
| 1314 | Ga0495627_000443 | 3300046453 | Bacteria | 36101 |
| 1315 | Ga0495592_0044537 | 3300046454 | Unclassified | 3315 |
| 1316 | Ga0495603_0047372 | 3300046455 | Bacteria | 2560 |
| 1317 | Ga0495629_0235070 | 3300046459 | Bacteria | 1263 |
| 1318 | Ga0495580_0193675 | 3300046472 | Bacteria | 1402 |
| 1319 | Ga0495662_0193291 | 3300046476 | Unclassified | 1003 |
| 1320 | Ga0495584_0011661 | 3300046491 | Bacteria | 4499 |
| 1321 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 1322 | Ga0495606_0037111 | 3300046507 | Bacteria | 3311 |
| 1323 | Ga0495608_0027558 | 3300046511 | Bacteria | 3865 |
| 1324 | Ga0495610_0040933 | 3300046512 | Bacteria | 2330 |
| 1325 | Ga0495618_0202566 | 3300046514 | Bacteria | 1256 |
| 1326 | Ga0495628_0288816 | 3300046516 | Bacteria | 1216 |
| 1327 | Ga0495630_0560077 | 3300046517 | Unclassified | 876 |
| 1328 | Ga0495632_0015594 | 3300046519 | Bacteria | 4250 |
| 1329 | Ga0495643_0080866 | 3300046522 | Bacteria | 1690 |
| 1330 | Ga0495648_0101400 | 3300046524 | Bacteria | 1588 |
| 1331 | Ga0495640_0400802 | 3300046533 | Bacteria | 842 |
| 1332 | Ga0495598_0007838 | 3300046537 | Bacteria | 2466 |
| 1333 | Ga0495621_0005527 | 3300046539 | Bacteria | 3636 |
| 1334 | Ga0495597_0048524 | 3300046542 | Bacteria | 1878 |
| 1335 | Ga0495645_0200046 | 3300046543 | Bacteria | 1356 |
| 1336 | Ga0495622_0002426 | 3300046557 | Bacteria | 9051 |
| 1337 | Ga0495633_0152475 | 3300046558 | Bacteria | 1067 |
| 1338 | Ga0495668_0209532 | 3300046616 | Bacteria | 1067 |
| 1339 | Ga0495625_0026301 | 3300046660 | Bacteria | 4399 |
| 1340 | Ga0495625_0403083 | 3300046660 | Bacteria | 854 |
| 1341 | Ga0495599_0259220 | 3300046678 | Bacteria | 1057 |
| 1342 | Ga0495658_0429262 | 3300046683 | Bacteria | 843 |
| 1343 | Ga0495669_0030631 | 3300046684 | Bacteria | 2362 |
| 1344 | Ga0495669_0158264 | 3300046684 | Bacteria | 1074 |
| 1345 | Ga0495670_0000265 | 3300046691 | Bacteria | 24414 |
| 1346 | Ga0495604_0187267 | 3300047317 | Bacteria | 1444 |
| 1347 | Ga0495636_0111664 | 3300047318 | Bacteria | 1203 |
| 1348 | Ga0495672_0071022 | 3300047320 | Bacteria | 1971 |
| 1349 | Ga0495683_0053018 | 3300047323 | Bacteria | 2023 |
| 1350 | Ga0495681_0011264 | 3300047470 | Bacteria | 5340 |
| 1351 | Ga0495684_0144711 | 3300047471 | Bacteria | 1781 |
| 1352 | Ga0495686_0170494 | 3300047472 | Bacteria | 1266 |
| 1353 | Ga0495593_0041920 | 3300047673 | Bacteria | 2459 |
| 1354 | Ga0495593_0066861 | 3300047673 | Bacteria | 1872 |
| 1355 | Ga0495602_0014256 | 3300048088 | Bacteria | 8076 |
| 1356 | Ga0496100_0039379 | 3300048903 | Bacteria | 3002 |
| 1357 | Ga0496100_0064222 | 3300048903 | Bacteria | 2428 |
| 1358 | Ga0496100_0136829 | 3300048903 | Bacteria | 1731 |
| 1359 | Ga0496100_0142886 | 3300048903 | Bacteria | 1698 |
| 1360 | Ga0496101_0005585 | 3300048904 | Bacteria | 8030 |
| 1361 | Ga0496101_0016841 | 3300048904 | Bacteria | 4947 |
| 1362 | Ga0496101_0113614 | 3300048904 | Bacteria | 2041 |
| 1363 | Ga0496101_0138124 | 3300048904 | Bacteria | 1856 |
| 1364 | Ga0496102_0002747 | 3300048905 | Bacteria | 15004 |
| 1365 | Ga0496102_0005255 | 3300048905 | Bacteria | 10995 |
| 1366 | Ga0496102_0033196 | 3300048905 | Bacteria | 4637 |
| 1367 | Ga0496102_0131609 | 3300048905 | Bacteria | 2342 |
| 1368 | Ga0496102_0260303 | 3300048905 | Bacteria | 1636 |
| 1369 | Ga0496102_0331589 | 3300048905 | Bacteria | 1433 |
| 1370 | Ga0496103_0002057 | 3300048906 | Bacteria | 12872 |
| 1371 | Ga0496103_0020842 | 3300048906 | Bacteria | 3941 |
| 1372 | Ga0496103_0027204 | 3300048906 | Bacteria | 3464 |
| 1373 | Ga0496104_0010951 | 3300048907 | Bacteria | 8114 |
| 1374 | Ga0496104_0017799 | 3300048907 | Bacteria | 6479 |
| 1375 | Ga0496104_0094192 | 3300048907 | Bacteria | 2865 |
| 1376 | Ga0496104_0149079 | 3300048907 | Bacteria | 2246 |
| 1377 | Ga0496104_0306260 | 3300048907 | Bacteria | 1501 |
| 1378 | Ga0496104_0351283 | 3300048907 | Bacteria | 1387 |
| 1379 | Ga0496104_0890781 | 3300048907 | Bacteria | 795 |
| 1380 | Ga0496105_0008864 | 3300048908 | Bacteria | 7837 |
| 1381 | Ga0496105_0044390 | 3300048908 | Bacteria | 3666 |
| 1382 | Ga0496105_0172825 | 3300048908 | Bacteria | 1771 |
| 1383 | Ga0496105_0268040 | 3300048908 | Bacteria | 1380 |
| 1384 | Ga0496106_0004676 | 3300048909 | Bacteria | 10151 |
| 1385 | Ga0496106_0005250 | 3300048909 | Bacteria | 9599 |
| 1386 | Ga0496106_0020957 | 3300048909 | Bacteria | 4850 |
| 1387 | Ga0496106_0069286 | 3300048909 | Bacteria | 2692 |
| 1388 | Ga0496106_0133009 | 3300048909 | Bacteria | 1952 |
| 1389 | Ga0496106_0177142 | 3300048909 | Bacteria | 1692 |
| 1390 | Ga0496107_0001506 | 3300048910 | Bacteria | 14468 |
| 1391 | Ga0496107_0006946 | 3300048910 | Bacteria | 7801 |
| 1392 | Ga0496107_0055141 | 3300048910 | Bacteria | 2871 |
| 1393 | Ga0496107_0062331 | 3300048910 | Bacteria | 2701 |
| 1394 | Ga0496107_0128403 | 3300048910 | Bacteria | 1871 |
| 1395 | Ga0496107_0236291 | 3300048910 | Bacteria | 1360 |
| 1396 | Ga0496108_0013562 | 3300048911 | Bacteria | 6651 |
| 1397 | Ga0496108_0032831 | 3300048911 | Bacteria | 4311 |
| 1398 | Ga0496108_0037537 | 3300048911 | Bacteria | 4036 |
| 1399 | Ga0496108_0076730 | 3300048911 | Bacteria | 2825 |
| 1400 | Ga0496108_0098113 | 3300048911 | Bacteria | 2497 |
| 1401 | Ga0496108_0299570 | 3300048911 | Bacteria | 1400 |
| 1402 | Ga0496109_0006013 | 3300048912 | Bacteria | 10195 |
| 1403 | Ga0496109_0020848 | 3300048912 | Bacteria | 5791 |
| 1404 | Ga0496109_0027322 | 3300048912 | Bacteria | 5093 |
| 1405 | Ga0496109_0116835 | 3300048912 | Bacteria | 2483 |
| 1406 | Ga0496109_0151170 | 3300048912 | Bacteria | 2174 |
| 1407 | Ga0496109_0164906 | 3300048912 | Bacteria | 2077 |
| 1408 | Ga0496109_0533397 | 3300048912 | Bacteria | 1107 |
| 1409 | Ga0496110_0042694 | 3300048913 | Bacteria | 3958 |
| 1410 | Ga0496110_0087569 | 3300048913 | Bacteria | 2781 |
| 1411 | Ga0496110_0116341 | 3300048913 | Bacteria | 2407 |
| 1412 | Ga0496110_0168117 | 3300048913 | Bacteria | 1989 |
| 1413 | Ga0496110_0638853 | 3300048913 | Bacteria | 964 |
| 1414 | Ga0496111_0000242 | 3300048914 | Bacteria | 26131 |
| 1415 | Ga0496111_0028631 | 3300048914 | Bacteria | 3949 |
| 1416 | Ga0496112_0001235 | 3300048915 | Bacteria | 19294 |
| 1417 | Ga0496112_0025166 | 3300048915 | Bacteria | 5712 |
| 1418 | Ga0496112_0031568 | 3300048915 | Bacteria | 5140 |
| 1419 | Ga0496112_0031888 | 3300048915 | Bacteria | 5114 |
| 1420 | Ga0496112_0332913 | 3300048915 | Bacteria | 1462 |
| 1421 | Ga0496112_0456462 | 3300048915 | Bacteria | 1215 |
| 1422 | Ga0496112_0583431 | 3300048915 | Bacteria | 1050 |
| 1423 | Ga0496113_0287318 | 3300048916 | Bacteria | 1315 |
| 1424 | Ga0496114_0036337 | 3300048917 | Bacteria | 4072 |
| 1425 | Ga0496114_0173980 | 3300048917 | Bacteria | 1877 |
| 1426 | Ga0496114_0205853 | 3300048917 | Bacteria | 1725 |
| 1427 | Ga0496114_0303375 | 3300048917 | Bacteria | 1410 |
| 1428 | Ga0496115_0052518 | 3300048918 | Bacteria | 3270 |
| 1429 | Ga0496115_0087400 | 3300048918 | Bacteria | 2544 |
| 1430 | Ga0496117_0003941 | 3300048920 | Bacteria | 16793 |
| 1431 | Ga0496118_0002145 | 3300048921 | Bacteria | 27524 |
| 1432 | Ga0496118_0084428 | 3300048921 | Bacteria | 2215 |
| 1433 | Ga0496119_0003925 | 3300048922 | Bacteria | 15085 |
| 1434 | Ga0496119_0020238 | 3300048922 | Bacteria | 4861 |
| 1435 | Ga0496119_0080829 | 3300048922 | Bacteria | 1874 |
| 1436 | Ga0496119_0103005 | 3300048922 | Bacteria | 1599 |
| 1437 | Ga0496119_0105036 | 3300048922 | Bacteria | 1578 |
| 1438 | Ga0496119_0199427 | 3300048922 | Bacteria | 1037 |
| 1439 | Ga0496120_0008156 | 3300048923 | Bacteria | 7682 |
| 1440 | Ga0496120_0102441 | 3300048923 | Bacteria | 1510 |
| 1441 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 1442 | Ga0496121_0000751 | 3300048924 | Bacteria | 59594 |
| 1443 | Ga0496121_0065751 | 3300048924 | Bacteria | 2948 |
| 1444 | Ga0496121_0269258 | 3300048924 | Bacteria | 1172 |
| 1445 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 1446 | Ga0496122_0034633 | 3300048925 | Bacteria | 4128 |
| 1447 | Ga0496122_0098694 | 3300048925 | Bacteria | 1960 |
| 1448 | Ga0496123_0000054 | 3300048926 | Bacteria | 234046 |
| 1449 | Ga0496123_0030694 | 3300048926 | Bacteria | 3928 |
| 1450 | Ga0496124_0036426 | 3300048927 | Bacteria | 4291 |
| 1451 | Ga0496124_0048353 | 3300048927 | Bacteria | 3635 |
| 1452 | Ga0496124_0080967 | 3300048927 | Bacteria | 2671 |
| 1453 | Ga0496125_0043147 | 3300048928 | Bacteria | 3833 |
| 1454 | Ga0496125_0047369 | 3300048928 | Bacteria | 3596 |
| 1455 | Ga0496125_0188098 | 3300048928 | Bacteria | 1367 |
| 1456 | Ga0496126_0073247 | 3300048929 | Bacteria | 3045 |
| 1457 | Ga0496126_0201568 | 3300048929 | Bacteria | 1680 |
| 1458 | Ga0501293_007669 | 3300049516 | Unclassified | 897 |
| 1459 | Ga0501296_002969 | 3300049519 | Bacteria | 1800 |
| 1460 | Ga0501297_011866 | 3300049520 | Bacteria | 1006 |
| 1461 | Ga0501298_005636 | 3300049521 | Bacteria | 2016 |
| 1462 | Ga0501299_002465 | 3300049522 | Bacteria | 2562 |
| 1463 | Ga0501031_0005703 | 3300049568 | Bacteria | 8115 |
| 1464 | Ga0501031_0049069 | 3300049568 | Bacteria | 2750 |
| 1465 | Ga0501031_0103948 | 3300049568 | Bacteria | 1854 |
| 1466 | Ga0501031_0261108 | 3300049568 | Bacteria | 1125 |
| 1467 | Ga0501031_0262297 | 3300049568 | Bacteria | 1122 |
| 1468 | Ga0501032_0000064 | 3300049569 | Bacteria | 91971 |
| 1469 | Ga0501032_0001600 | 3300049569 | Bacteria | 18059 |
| 1470 | Ga0501032_0025086 | 3300049569 | Bacteria | 4110 |
| 1471 | Ga0501032_0031757 | 3300049569 | Bacteria | 3620 |
| 1472 | Ga0501032_0032937 | 3300049569 | Bacteria | 3551 |
| 1473 | Ga0501032_0068479 | 3300049569 | Bacteria | 2369 |
| 1474 | Ga0501032_0235317 | 3300049569 | Bacteria | 1191 |
| 1475 | Ga0501032_0489339 | 3300049569 | Bacteria | 786 |
| 1476 | Ga0501033_0000286 | 3300049570 | Bacteria | 48628 |
| 1477 | Ga0501033_0002532 | 3300049570 | Bacteria | 15473 |
| 1478 | Ga0501033_0016268 | 3300049570 | Bacteria | 5633 |
| 1479 | Ga0501033_0020977 | 3300049570 | Bacteria | 4934 |
| 1480 | Ga0501033_0045254 | 3300049570 | Bacteria | 3275 |
| 1481 | Ga0501033_0088657 | 3300049570 | Bacteria | 2264 |
| 1482 | Ga0501033_0093339 | 3300049570 | Bacteria | 2201 |
| 1483 | Ga0501033_0116907 | 3300049570 | Bacteria | 1937 |
| 1484 | Ga0501033_0143786 | 3300049570 | Bacteria | 1724 |
| 1485 | Ga0501033_0192474 | 3300049570 | Bacteria | 1459 |
| 1486 | Ga0501033_0206863 | 3300049570 | Bacteria | 1400 |
| 1487 | Ga0501034_0000097 | 3300049571 | Bacteria | 161027 |
| 1488 | Ga0501034_0000174 | 3300049571 | Bacteria | 119615 |
| 1489 | Ga0501034_0002221 | 3300049571 | Bacteria | 23948 |
| 1490 | Ga0501034_0002380 | 3300049571 | Bacteria | 22851 |
| 1491 | Ga0501034_0022346 | 3300049571 | Bacteria | 6446 |
| 1492 | Ga0501034_0024404 | 3300049571 | Bacteria | 6151 |
| 1493 | Ga0501034_0076402 | 3300049571 | Bacteria | 3356 |
| 1494 | Ga0501034_0083319 | 3300049571 | Bacteria | 3200 |
| 1495 | Ga0501034_0107639 | 3300049571 | Bacteria | 2779 |
| 1496 | Ga0501034_0120131 | 3300049571 | Bacteria | 2614 |
| 1497 | Ga0501034_0134238 | 3300049571 | Bacteria | 2457 |
| 1498 | Ga0501034_0220435 | 3300049571 | Bacteria | 1849 |
| 1499 | Ga0501034_0233815 | 3300049571 | Bacteria | 1786 |
| 1500 | Ga0501034_0243812 | 3300049571 | Bacteria | 1742 |
| 1501 | Ga0501034_0254534 | 3300049571 | Bacteria | 1700 |
| 1502 | Ga0501034_0270112 | 3300049571 | Bacteria | 1642 |
| 1503 | Ga0501034_0592451 | 3300049571 | Bacteria | 1015 |
| 1504 | Ga0501034_0610149 | 3300049571 | Bacteria | 996 |
| 1505 | Ga0501034_0668045 | 3300049571 | Bacteria | 939 |
| 1506 | Ga0501036_0004998 | 3300049572 | Bacteria | 10727 |
| 1507 | Ga0501036_0054187 | 3300049572 | Bacteria | 3397 |
| 1508 | Ga0501036_0077234 | 3300049572 | Bacteria | 2817 |
| 1509 | Ga0501036_0182860 | 3300049572 | Bacteria | 1764 |
| 1510 | Ga0501036_0298455 | 3300049572 | Bacteria | 1348 |
| 1511 | Ga0501036_0488418 | 3300049572 | Bacteria | 1025 |
| 1512 | Ga0501036_0820233 | 3300049572 | Bacteria | 765 |
| 1513 | Ga0501037_0000118 | 3300049573 | Bacteria | 73584 |
| 1514 | Ga0501037_0006091 | 3300049573 | Bacteria | 8816 |
| 1515 | Ga0501037_0053085 | 3300049573 | Bacteria | 2964 |
| 1516 | Ga0501037_0136640 | 3300049573 | Bacteria | 1756 |
| 1517 | Ga0501037_0155025 | 3300049573 | Bacteria | 1635 |
| 1518 | Ga0501037_0204238 | 3300049573 | Bacteria | 1395 |
| 1519 | Ga0501037_0483499 | 3300049573 | Bacteria | 841 |
| 1520 | Ga0501038_0000031 | 3300049574 | Bacteria | 132231 |
| 1521 | Ga0501038_0003995 | 3300049574 | Bacteria | 13696 |
| 1522 | Ga0501038_0007946 | 3300049574 | Bacteria | 9775 |
| 1523 | Ga0501038_0028402 | 3300049574 | Bacteria | 4971 |
| 1524 | Ga0501038_0041630 | 3300049574 | Bacteria | 4005 |
| 1525 | Ga0501038_0041926 | 3300049574 | Bacteria | 3989 |
| 1526 | Ga0501038_0157169 | 3300049574 | Bacteria | 1850 |
| 1527 | Ga0501038_0165500 | 3300049574 | Bacteria | 1794 |
| 1528 | Ga0501038_0316604 | 3300049574 | Bacteria | 1221 |
| 1529 | Ga0501038_0498346 | 3300049574 | Bacteria | 931 |
| 1530 | Ga0501039_0000057 | 3300049575 | Bacteria | 89756 |
| 1531 | Ga0501039_0017563 | 3300049575 | Bacteria | 5488 |
| 1532 | Ga0501039_0041392 | 3300049575 | Bacteria | 3559 |
| 1533 | Ga0501039_0047324 | 3300049575 | Bacteria | 3324 |
| 1534 | Ga0501039_0216886 | 3300049575 | Bacteria | 1504 |
| 1535 | Ga0501040_0001144 | 3300049576 | Bacteria | 16848 |
| 1536 | Ga0501040_0189556 | 3300049576 | Bacteria | 1459 |
| 1537 | Ga0501041_0042622 | 3300049577 | Bacteria | 2759 |
| 1538 | Ga0501043_0000048 | 3300049579 | Bacteria | 109146 |
| 1539 | Ga0501043_0054965 | 3300049579 | Bacteria | 3128 |
| 1540 | Ga0501043_0072840 | 3300049579 | Bacteria | 2698 |
| 1541 | Ga0501043_0103181 | 3300049579 | Bacteria | 2241 |
| 1542 | Ga0501043_0133472 | 3300049579 | Bacteria | 1946 |
| 1543 | Ga0501043_0156188 | 3300049579 | Bacteria | 1784 |
| 1544 | Ga0501043_0164505 | 3300049579 | Bacteria | 1732 |
| 1545 | Ga0501043_0238183 | 3300049579 | Bacteria | 1404 |
| 1546 | Ga0501043_0569552 | 3300049579 | Bacteria | 839 |
| 1547 | Ga0501046_0010968 | 3300049580 | Bacteria | 7770 |
| 1548 | Ga0501046_0014309 | 3300049580 | Bacteria | 6699 |
| 1549 | Ga0501046_0026372 | 3300049580 | Bacteria | 4747 |
| 1550 | Ga0501046_0051871 | 3300049580 | Bacteria | 3235 |
| 1551 | Ga0501046_0204766 | 3300049580 | Bacteria | 1467 |
| 1552 | Ga0501046_0338445 | 3300049580 | Bacteria | 1094 |
| 1553 | Ga0501046_0368610 | 3300049580 | Bacteria | 1041 |
| 1554 | Ga0501046_0401988 | 3300049580 | Bacteria | 989 |
| 1555 | Ga0501047_0003748 | 3300049581 | Bacteria | 14320 |
| 1556 | Ga0501047_0008494 | 3300049581 | Bacteria | 9687 |
| 1557 | Ga0501047_0048076 | 3300049581 | Bacteria | 4120 |
| 1558 | Ga0501047_0054470 | 3300049581 | Bacteria | 3869 |
| 1559 | Ga0501047_0062229 | 3300049581 | Bacteria | 3600 |
| 1560 | Ga0501047_0069524 | 3300049581 | Bacteria | 3390 |
| 1561 | Ga0501047_0152583 | 3300049581 | Bacteria | 2185 |
| 1562 | Ga0501047_0186826 | 3300049581 | Bacteria | 1937 |
| 1563 | Ga0501047_0252256 | 3300049581 | Bacteria | 1613 |
| 1564 | Ga0501047_0317678 | 3300049581 | Bacteria | 1398 |
| 1565 | Ga0501047_0442731 | 3300049581 | Bacteria | 1129 |
| 1566 | Ga0501047_0458236 | 3300049581 | Bacteria | 1104 |
| 1567 | Ga0501047_0478199 | 3300049581 | Bacteria | 1073 |
| 1568 | Ga0501047_0514213 | 3300049581 | Bacteria | 1023 |
| 1569 | Ga0501047_0591718 | 3300049581 | Bacteria | 931 |
| 1570 | Ga0501048_0030793 | 3300049582 | Bacteria | 3883 |
| 1571 | Ga0501048_0057459 | 3300049582 | Bacteria | 2759 |
| 1572 | Ga0501048_0125816 | 3300049582 | Bacteria | 1812 |
| 1573 | Ga0501048_0186831 | 3300049582 | Bacteria | 1469 |
| 1574 | Ga0501067_0027568 | 3300049583 | Bacteria | 3148 |
| 1575 | Ga0501067_0051142 | 3300049583 | Bacteria | 2291 |
| 1576 | Ga0501067_0097648 | 3300049583 | Bacteria | 1631 |
| 1577 | Ga0501067_0121329 | 3300049583 | Bacteria | 1454 |
| 1578 | Ga0501067_0189576 | 3300049583 | Bacteria | 1145 |
| 1579 | Ga0501067_0242958 | 3300049583 | Bacteria | 1002 |
| 1580 | Ga0501067_0351840 | 3300049583 | Bacteria | 821 |
| 1581 | Ga0501068_0035832 | 3300049584 | Bacteria | 2963 |
| 1582 | Ga0501068_0065095 | 3300049584 | Bacteria | 2218 |
| 1583 | Ga0501068_0085297 | 3300049584 | Bacteria | 1943 |
| 1584 | Ga0501068_0095279 | 3300049584 | Bacteria | 1840 |
| 1585 | Ga0501068_0294420 | 3300049584 | Bacteria | 1038 |
| 1586 | Ga0501069_0020534 | 3300049585 | Bacteria | 3579 |
| 1587 | Ga0501069_0047390 | 3300049585 | Bacteria | 2385 |
| 1588 | Ga0501069_0248398 | 3300049585 | Bacteria | 1038 |
| 1589 | Ga0501070_0029009 | 3300049586 | Bacteria | 4640 |
| 1590 | Ga0501070_0029317 | 3300049586 | Bacteria | 4615 |
| 1591 | Ga0501070_0039424 | 3300049586 | Bacteria | 3940 |
| 1592 | Ga0501070_0051500 | 3300049586 | Bacteria | 3417 |
| 1593 | Ga0501070_0052146 | 3300049586 | Bacteria | 3396 |
| 1594 | Ga0501070_0087469 | 3300049586 | Bacteria | 2579 |
| 1595 | Ga0501070_0318144 | 3300049586 | Bacteria | 1266 |
| 1596 | Ga0501071_0032763 | 3300049587 | Bacteria | 3691 |
| 1597 | Ga0501071_0039321 | 3300049587 | Bacteria | 3384 |
| 1598 | Ga0501071_0181489 | 3300049587 | Bacteria | 1577 |
| 1599 | Ga0501071_0222043 | 3300049587 | Unclassified | 1422 |
| 1600 | Ga0501072_0109972 | 3300049588 | Bacteria | 2193 |
| 1601 | Ga0501072_0110278 | 3300049588 | Bacteria | 2190 |
| 1602 | Ga0501072_0308239 | 3300049588 | Bacteria | 1259 |
| 1603 | Ga0501072_0496817 | 3300049588 | Bacteria | 965 |
| 1604 | Ga0501072_0582490 | 3300049588 | Bacteria | 883 |
| 1605 | Ga0501073_0014781 | 3300049589 | Bacteria | 5668 |
| 1606 | Ga0501073_0020495 | 3300049589 | Bacteria | 4768 |
| 1607 | Ga0501073_0089425 | 3300049589 | Bacteria | 2140 |
| 1608 | Ga0501073_0090002 | 3300049589 | Bacteria | 2133 |
| 1609 | Ga0501073_0108511 | 3300049589 | Bacteria | 1926 |
| 1610 | Ga0501073_0458198 | 3300049589 | Bacteria | 881 |
| 1611 | Ga0501073_0531311 | 3300049589 | Bacteria | 813 |
| 1612 | Ga0501074_0013095 | 3300049590 | Bacteria | 6029 |
| 1613 | Ga0501074_0023939 | 3300049590 | Bacteria | 4437 |
| 1614 | Ga0501074_0024895 | 3300049590 | Bacteria | 4348 |
| 1615 | Ga0501074_0057774 | 3300049590 | Bacteria | 2795 |
| 1616 | Ga0501074_0081104 | 3300049590 | Bacteria | 2326 |
| 1617 | Ga0501075_0005167 | 3300049591 | Bacteria | 8933 |
| 1618 | Ga0501075_0028092 | 3300049591 | Bacteria | 4150 |
| 1619 | Ga0501076_0006377 | 3300049592 | Bacteria | 8557 |
| 1620 | Ga0501076_0191194 | 3300049592 | Bacteria | 1670 |
| 1621 | Ga0501076_0321462 | 3300049592 | Bacteria | 1269 |
| 1622 | Ga0501077_0009579 | 3300049593 | Bacteria | 6022 |
| 1623 | Ga0501077_0098052 | 3300049593 | Bacteria | 1858 |
| 1624 | Ga0501202_023766 | 3300049652 | Unclassified | 1239 |
| 1625 | Ga0501202_039277 | 3300049652 | Bacteria | 1017 |
| 1626 | Ga0501217_081826 | 3300049661 | Bacteria | 895 |
| 1627 | Ga0501223_001670 | 3300049663 | Bacteria | 5094 |
| 1628 | Ga0501233_006769 | 3300049668 | Bacteria | 2163 |
| 1629 | Ga0501235_003437 | 3300049669 | Bacteria | 3425 |
| 1630 | Ga0501235_016642 | 3300049669 | Bacteria | 1626 |
| 1631 | Ga0501249_042551 | 3300049679 | Unclassified | 1033 |
| 1632 | Ga0501255_020100 | 3300049684 | Bacteria | 857 |
| 1633 | Ga0501261_013782 | 3300049690 | Bacteria | 1100 |
| 1634 | Ga0501225_0001550 | 3300049705 | Bacteria | 7211 |
| 1635 | Ga0501225_0044761 | 3300049705 | Bacteria | 1225 |
| 1636 | Ga0501234_002639 | 3300049707 | Bacteria | 2824 |
| 1637 | Ga0501079_0007423 | 3300049741 | Bacteria | 8295 |
| 1638 | Ga0501079_0035953 | 3300049741 | Bacteria | 3814 |
| 1639 | Ga0501079_0059738 | 3300049741 | Bacteria | 2941 |
| 1640 | Ga0501079_0201938 | 3300049741 | Bacteria | 1553 |
| 1641 | Ga0501079_0244124 | 3300049741 | Bacteria | 1403 |
| 1642 | Ga0501079_0410660 | 3300049741 | Bacteria | 1062 |
| 1643 | Ga0501080_0008721 | 3300049742 | Bacteria | 9208 |
| 1644 | Ga0501080_0009091 | 3300049742 | Bacteria | 9042 |
| 1645 | Ga0501080_0009451 | 3300049742 | Bacteria | 8893 |
| 1646 | Ga0501080_0051261 | 3300049742 | Bacteria | 3840 |
| 1647 | Ga0501080_0069725 | 3300049742 | Bacteria | 3270 |
| 1648 | Ga0501080_0115442 | 3300049742 | Bacteria | 2489 |
| 1649 | Ga0501080_0127479 | 3300049742 | Bacteria | 2356 |
| 1650 | Ga0501080_0156121 | 3300049742 | Bacteria | 2108 |
| 1651 | Ga0501080_0284471 | 3300049742 | Bacteria | 1502 |
| 1652 | Ga0501081_0001736 | 3300049743 | Bacteria | 13518 |
| 1653 | Ga0501081_0023556 | 3300049743 | Bacteria | 4127 |
| 1654 | Ga0501081_0149491 | 3300049743 | Bacteria | 1677 |
| 1655 | Ga0501083_0044651 | 3300049744 | Bacteria | 2999 |
| 1656 | Ga0501083_0049244 | 3300049744 | Bacteria | 2840 |
| 1657 | Ga0501083_0063763 | 3300049744 | Bacteria | 2457 |
| 1658 | Ga0501083_0243283 | 3300049744 | Bacteria | 1171 |
| 1659 | Ga0501083_0288918 | 3300049744 | Bacteria | 1066 |
| 1660 | Ga0501083_0429998 | 3300049744 | Bacteria | 859 |
| 1661 | Ga0501270_007195 | 3300049767 | Bacteria | 1369 |
| 1662 | Ga0501283_000325 | 3300049779 | Bacteria | 6309 |
| 1663 | Ga0501035_0000118 | 3300049822 | Bacteria | 95482 |
| 1664 | Ga0501035_0003976 | 3300049822 | Bacteria | 14088 |
| 1665 | Ga0501035_0030120 | 3300049822 | Bacteria | 4948 |
| 1666 | Ga0501035_0059706 | 3300049822 | Bacteria | 3396 |
| 1667 | Ga0501035_0083249 | 3300049822 | Bacteria | 2823 |
| 1668 | Ga0501035_0096309 | 3300049822 | Bacteria | 2600 |
| 1669 | Ga0501035_0105131 | 3300049822 | Bacteria | 2475 |
| 1670 | Ga0501035_0290401 | 3300049822 | Bacteria | 1380 |
| 1671 | Ga0501035_0344252 | 3300049822 | Bacteria | 1248 |
| 1672 | Ga0501044_0000504 | 3300049823 | Bacteria | 47543 |
| 1673 | Ga0501044_0021869 | 3300049823 | Bacteria | 6819 |
| 1674 | Ga0501044_0056387 | 3300049823 | Bacteria | 4034 |
| 1675 | Ga0501044_0076395 | 3300049823 | Bacteria | 3399 |
| 1676 | Ga0501044_0079183 | 3300049823 | Bacteria | 3330 |
| 1677 | Ga0501044_0103067 | 3300049823 | Bacteria | 2868 |
| 1678 | Ga0501044_0165513 | 3300049823 | Bacteria | 2185 |
| 1679 | Ga0501044_0172041 | 3300049823 | Bacteria | 2137 |
| 1680 | Ga0501044_0213873 | 3300049823 | Bacteria | 1881 |
| 1681 | Ga0501044_0235427 | 3300049823 | Bacteria | 1777 |
| 1682 | Ga0501044_0265553 | 3300049823 | Bacteria | 1654 |
| 1683 | Ga0501044_0299120 | 3300049823 | Bacteria | 1538 |
| 1684 | Ga0501044_0318935 | 3300049823 | Bacteria | 1479 |
| 1685 | Ga0501044_0441433 | 3300049823 | Bacteria | 1209 |
| 1686 | Ga0501044_0589506 | 3300049823 | Bacteria | 1005 |
| 1687 | Ga0501045_0004800 | 3300049824 | Bacteria | 9340 |
| 1688 | Ga0501045_0473744 | 3300049824 | Bacteria | 930 |
| 1689 | Ga0501226_005037 | 3300049853 | Bacteria | 1515 |
| 1690 | nmdc:mga03n38_226150_c1 | 3300050490 | Bacteria | 979 |
| 1691 | nmdc:mga03n38_35806_c1 | 3300050490 | Bacteria | 2130 |
| 1692 | nmdc:mga00v17_276191_c1 | 3300050491 | Bacteria | 1091 |
| 1693 | nmdc:mga0yw44_18283_c1 | 3300050492 | Bacteria | 3834 |
| 1694 | nmdc:mga0yw44_21084_c1 | 3300050492 | Bacteria | 3630 |
| 1695 | nmdc:mga0yw44_398199_c1 | 3300050492 | Bacteria | 931 |
| 1696 | nmdc:mga06z11_27303_c1 | 3300050494 | Bacteria | 2728 |
| 1697 | nmdc:mga04h51_19968_c1 | 3300050495 | Bacteria | 1994 |
| 1698 | nmdc:mga07m45_12880_c1 | 3300050496 | Bacteria | 3603 |
| 1699 | nmdc:mga07m45_20065_c1 | 3300050496 | Bacteria | 3628 |
| 1700 | nmdc:mga05p37_115286_c1 | 3300050507 | Bacteria | 3303 |
| 1701 | nmdc:mga05p37_1172521_c1 | 3300050507 | Bacteria | 797 |
| 1702 | nmdc:mga05p37_285757_c1 | 3300050507 | Bacteria | 1965 |
| 1703 | nmdc:mga05p37_300144_c1 | 3300050507 | Unclassified | 1909 |
| 1704 | nmdc:mga05p37_31141_c1 | 3300050507 | Bacteria | 6515 |
| 1705 | nmdc:mga05p37_317055_c1 | 3300050507 | Bacteria | 1846 |
| 1706 | nmdc:mga05p37_329514_c1 | 3300050507 | Bacteria | 1804 |
| 1707 | nmdc:mga05p37_486728_c1 | 3300050507 | Bacteria | 1419 |
| 1708 | nmdc:mga05p37_734563_c1 | 3300050507 | Unclassified | 1091 |
| 1709 | nmdc:mga09592_23768_c1 | 3300050508 | Bacteria | 5063 |
| 1710 | nmdc:mga0qj67_72848_c1 | 3300050509 | Bacteria | 2743 |
| 1711 | nmdc:mga06r32_12560_c1 | 3300050510 | Bacteria | 7647 |
| 1712 | nmdc:mga06r32_433336_c1 | 3300050510 | Bacteria | 1295 |
| 1713 | nmdc:mga06r32_976_c1 | 3300050510 | Bacteria | 25615 |
| 1714 | nmdc:mga08y16_1009107_c1 | 3300050511 | Bacteria | 812 |
| 1715 | nmdc:mga08y16_226482_c1 | 3300050511 | Bacteria | 1935 |
| 1716 | nmdc:mga08y16_278776_c1 | 3300050511 | Bacteria | 1725 |
| 1717 | nmdc:mga08y16_292919_c1 | 3300050511 | Bacteria | 1678 |
| 1718 | nmdc:mga08y16_72419_c1 | 3300050511 | Bacteria | 3591 |
| 1719 | nmdc:mga08y16_75051_c1 | 3300050511 | Bacteria | 3525 |
| 1720 | nmdc:mga08y16_86150_c1 | 3300050511 | Bacteria | 3274 |
| 1721 | nmdc:mga0n895_129906_c1 | 3300050512 | Bacteria | 2544 |
| 1722 | nmdc:mga0n895_141334_c1 | 3300050512 | Bacteria | 2436 |
| 1723 | nmdc:mga0n895_226829_c1 | 3300050512 | Bacteria | 1896 |
| 1724 | nmdc:mga0n895_240226_c1 | 3300050512 | Bacteria | 1838 |
| 1725 | nmdc:mga0n895_2522_c1 | 3300050512 | Bacteria | 14348 |
| 1726 | nmdc:mga0n895_594604_c1 | 3300050512 | Bacteria | 1109 |
| 1727 | nmdc:mga0n895_89055_c1 | 3300050512 | Unclassified | 3087 |
| 1728 | nmdc:mga0rr50_10031_c1 | 3300050513 | Bacteria | 5259 |
| 1729 | nmdc:mga0rr50_137562_c1 | 3300050513 | Bacteria | 1962 |
| 1730 | nmdc:mga0rr50_169_c1 | 3300050513 | Bacteria | 34726 |
| 1731 | nmdc:mga08x19_26_c1 | 3300050514 | Bacteria | 228913 |
| 1732 | nmdc:mga0a205_132190_c1 | 3300050515 | Bacteria | 1977 |
| 1733 | nmdc:mga0a205_289709_c1 | 3300050515 | Bacteria | 1512 |
| 1734 | nmdc:mga0a205_323773_c1 | 3300050515 | Bacteria | 1412 |
| 1735 | nmdc:mga0a205_347774_c1 | 3300050515 | Unclassified | 1350 |
| 1736 | nmdc:mga0a205_460169_c1 | 3300050515 | Bacteria | 1132 |
| 1737 | nmdc:mga0a205_72336_c1 | 3300050515 | Bacteria | 3331 |
| 1738 | nmdc:mga0a205_84763_c1 | 3300050515 | Bacteria | 3061 |
| 1739 | Ga0495601_0000235 | 3300053077 | Bacteria | 29620 |
| 1740 | Ga0500610_0168365 | 3300053079 | Bacteria | 1084 |
| 1741 | Ga0500635_0000302 | 3300053080 | Bacteria | 17373 |
| 1742 | Ga0500635_0001280 | 3300053080 | Bacteria | 6005 |
| 1743 | Ga0495655_0011188 | 3300053083 | Bacteria | 1795 |
| 1744 | Ga0495595_0017221 | 3300053084 | Bacteria | 3108 |
| 1745 | Ga0495619_0035488 | 3300053085 | Bacteria | 3243 |
| 1746 | Ga0495619_0117877 | 3300053085 | Bacteria | 1818 |
| 1747 | Ga0495619_0351034 | 3300053085 | Bacteria | 1020 |
| 1748 | Ga0500578_0140706 | 3300053086 | Bacteria | 1509 |
| 1749 | Ga0500647_0026024 | 3300053091 | Bacteria | 2758 |
| 1750 | Ga0500651_0016713 | 3300053093 | Bacteria | 4515 |
| 1751 | Ga0500566_0041234 | 3300053094 | Bacteria | 2667 |
| 1752 | Ga0500641_0003377 | 3300053096 | Bacteria | 5646 |
| 1753 | Ga0500641_0005166 | 3300053096 | Bacteria | 4626 |
| 1754 | Ga0500562_003232 | 3300053108 | Bacteria | 4071 |
| 1755 | Ga0500593_000013 | 3300053117 | Bacteria | 59669 |
| 1756 | Ga0500595_006840 | 3300053119 | Bacteria | 4798 |
| 1757 | Ga0500608_000573 | 3300053122 | Bacteria | 13643 |
| 1758 | Ga0500614_001562 | 3300053123 | Bacteria | 5419 |
| 1759 | Ga0500618_002996 | 3300053125 | Bacteria | 6010 |
| 1760 | Ga0500618_003083 | 3300053125 | Bacteria | 5893 |
| 1761 | Ga0500618_036011 | 3300053125 | Bacteria | 1147 |
| 1762 | Ga0500655_015690 | 3300053133 | Bacteria | 1391 |
| 1763 | Ga0500559_0084876 | 3300053136 | Bacteria | 1444 |
| 1764 | Ga0500559_0182351 | 3300053136 | Bacteria | 989 |
| 1765 | Ga0500564_158915 | 3300053138 | Bacteria | 958 |
| 1766 | Ga0500573_0000008 | 3300053140 | Bacteria | 237795 |
| 1767 | Ga0500573_0077380 | 3300053140 | Bacteria | 1893 |
| 1768 | Ga0500577_0006420 | 3300053142 | Bacteria | 3244 |
| 1769 | Ga0500577_0025434 | 3300053142 | Bacteria | 2003 |
| 1770 | Ga0500616_0000250 | 3300053153 | Bacteria | 83271 |
| 1771 | Ga0500616_0000797 | 3300053153 | Bacteria | 36110 |
| 1772 | Ga0500616_0004513 | 3300053153 | Bacteria | 9885 |
| 1773 | Ga0500616_0032743 | 3300053153 | Bacteria | 2840 |
| 1774 | Ga0500620_000225 | 3300053155 | Bacteria | 11219 |
| 1775 | Ga0500620_107336 | 3300053155 | Bacteria | 977 |
| 1776 | Ga0500622_0037248 | 3300053156 | Bacteria | 2541 |
| 1777 | Ga0500627_0095586 | 3300053158 | Bacteria | 1331 |
| 1778 | Ga0500638_166041 | 3300053162 | Bacteria | 966 |
| 1779 | Ga0500639_040789 | 3300053163 | Bacteria | 2443 |
| 1780 | Ga0500636_0010526 | 3300053177 | Bacteria | 5399 |
| 1781 | Ga0500637_0010845 | 3300053178 | Bacteria | 4688 |
| 1782 | Ga0500637_0187572 | 3300053178 | Bacteria | 1182 |
| 1783 | Ga0500625_088391 | 3300053729 | Bacteria | 1333 |
| 1784 | Ga0500645_022384 | 3300053730 | Bacteria | 1944 |
| 1785 | Ga0500645_069379 | 3300053730 | Bacteria | 1013 |
| 1786 | Ga0500596_003174 | 3300053735 | Bacteria | 3155 |
| 1787 | Ga0501084_0000137 | 3300054114 | Bacteria | 55092 |
| 1788 | Ga0501084_0001317 | 3300054114 | Bacteria | 19557 |
| 1789 | Ga0501084_0016901 | 3300054114 | Bacteria | 6064 |
| 1790 | Ga0501084_0023706 | 3300054114 | Bacteria | 5118 |
| 1791 | Ga0501084_0036990 | 3300054114 | Bacteria | 4078 |
| 1792 | Ga0501084_0061753 | 3300054114 | Bacteria | 3137 |
| 1793 | Ga0501084_0226380 | 3300054114 | Bacteria | 1578 |
| 1794 | Ga0501084_0240168 | 3300054114 | Bacteria | 1529 |
| 1795 | Ga0501084_0425019 | 3300054114 | Unclassified | 1123 |
| 1796 | Ga0501084_0514318 | 3300054114 | Bacteria | 1012 |
| 1797 | Ga0501082_0004024 | 3300060353 | Bacteria | 12827 |
| 1798 | Ga0501082_0006081 | 3300060353 | Bacteria | 10477 |
| 1799 | Ga0501082_0015392 | 3300060353 | Bacteria | 6582 |
| 1800 | Ga0501082_0100996 | 3300060353 | Bacteria | 2495 |
| 1801 | Ga0501082_0388232 | 3300060353 | Bacteria | 1218 |
| 1802 | Ga0501082_0721415 | 3300060353 | Bacteria | 872 |
| 1803 | Ga0466962_0005568 | 3300061719 | Bacteria | 6045 |
| 1804 | Ga0466962_0005965 | 3300061719 | Bacteria | 5852 |
| 1805 | Ga0466962_0063868 | 3300061719 | Bacteria | 1758 |
| 1806 | Ga0530510_0003542 | 3300061734 | Bacteria | 10748 |
| 1807 | Ga0530510_0007842 | 3300061734 | Bacteria | 7446 |
| 1808 | 2503202330 | 2503198000 | Bacteria | 6884444 |
| 1809 | 2509370432 | 2509276018 | Bacteria | 6910194 |
| 1810 | 2510317396 | 2510065059 | Bacteria | 6847884 |
| 1811 | 2512930770 | 2512875016 | Bacteria | 6529530 |
| 1812 | 2512958499 | 2512875024 | Bacteria | 7195110 |
| 1813 | 2513609818 | 2513237090 | Bacteria | 7096802 |
| 1814 | 2514035088 | 2513237164 | Bacteria | 7563725 |
| 1815 | 2523107326 | 2522572158 | Bacteria | 6514390 |
| 1816 | 2524536916 | 2524023228 | Bacteria | 10118060 |
| 1817 | 2538427084 | 2537561728 | Bacteria | 5149301 |
| 1818 | 2561468298 | 2558860983 | Bacteria | 4133860 |
| 1819 | 2588516432 | 2588253730 | Bacteria | 6881675 |
| 1820 | 2599720883 | 2599185236 | Bacteria | 6875203 |
| 1821 | 2599940040 | 2599185301 | Bacteria | 6161860 |
| 1822 | 2643775671 | 2643221551 | Bacteria | 3750538 |
| 1823 | 2643794118 | 2643221555 | Bacteria | 3749717 |
| 1824 | 2643988106 | 2643221595 | Bacteria | 6565519 |
| 1825 | 2644155281 | 2643221627 | Bacteria | 6761570 |
| 1826 | 2673167664 | 2671180531 | Bacteria | 9045424 |
| 1827 | 2688070184 | 2687453257 | Bacteria | 6784659 |
| 1828 | 2688599312 | 2687453392 | Bacteria | 6880454 |
| 1829 | 2692316460 | 2690316117 | Bacteria | 6800650 |
| 1830 | 2694632106 | 2693429783 | Bacteria | 7019804 |
| 1831 | 2694634487 | 2693429784 | Bacteria | 7241525 |
| 1832 | 2707100829 | 2706794495 | Bacteria | 4536932 |
| 1833 | 2715500121 | 2713897090 | Bacteria | 3353799 |
| 1834 | 2756675784 | 2756170246 | Bacteria | 7451806 |
| 1835 | 2792581223 | 2791355082 | Bacteria | 5973319 |
| 1836 | 2792623229 | 2791355091 | Bacteria | 6135441 |
| 1837 | 2792626993 | 2791355092 | Bacteria | 6248105 |
| 1838 | 2792745993 | 2791355123 | Bacteria | 8049106 |
| 1839 | 2793281495 | 2791355253 | Bacteria | 5171699 |
| 1840 | 2819688596 | 2818991461 | Bacteria | 7026071 |
| 1841 | 2821127798 | 2821123053 | Bacteria | 7836056 |
| 1842 | 2828309680 | 2828305725 | Bacteria | 4916900 |
| 1843 | 2834578651 | 2834578030 | Bacteria | 3530182 |
| 1844 | 2838738222 | 2838736955 | Bacteria | 5760694 |
| 1845 | 2841841408 | 2841840854 | Bacteria | 5761912 |
| 1846 | 2841859422 | 2841859092 | Bacteria | 5436171 |
| 1847 | 2842141186 | 2842140634 | Bacteria | 5759631 |
| 1848 | 2842516206 | 2842515876 | Bacteria | 5436280 |
| 1849 | 2844006554 | 2844002411 | Bacteria | 7168230 |
| 1850 | 2844014595 | 2844009547 | Bacteria | 6728125 |
| 1851 | 2847418474 | 2847417321 | Bacteria | 6913799 |
| 1852 | 2847670720 | 2847670302 | Bacteria | 6165597 |
| 1853 | 2847693055 | 2847686936 | Bacteria | 6278406 |
| 1854 | 2848993452 | 2848992105 | Bacteria | 6810864 |
| 1855 | 2852104164 | 2852103415 | Bacteria | 5193810 |
| 1856 | 2854604223 | 2854601825 | Bacteria | 4797592 |
| 1857 | 2855199189 | 2855195626 | Bacteria | 4927512 |
| 1858 | 2855873363 | 2855872281 | Bacteria | 6964271 |
| 1859 | 2856316176 | 2856314179 | Bacteria | 6477897 |
| 1860 | 2856325988 | 2856320880 | Bacteria | 7263508 |
| 1861 | 2856330435 | 2856328259 | Bacteria | 6528202 |
| 1862 | 2856340521 | 2856334872 | Bacteria | 7037011 |
| 1863 | 2856368938 | 2856364286 | Bacteria | 6939991 |
| 1864 | 2857349514 | 2857349434 | Bacteria | 7926032 |
| 1865 | 2857370737 | 2857367948 | Bacteria | 6965560 |
| 1866 | 2857534461 | 2857531043 | Bacteria | 6754041 |
| 1867 | 2857732589 | 2857729791 | Bacteria | 4040535 |
| 1868 | 2858468106 | 2858466076 | Bacteria | 4722413 |
| 1869 | 2869170140 | 2869169390 | Bacteria | 6659796 |
| 1870 | 2869239750 | 2869234852 | Bacteria | 6654993 |
| 1871 | 2869248441 | 2869242130 | Bacteria | 6609239 |
| 1872 | 2869250070 | 2869249662 | Bacteria | 6868783 |
| 1873 | 2869258256 | 2869256925 | Bacteria | 6981691 |
| 1874 | 2869270969 | 2869264136 | Bacteria | 6880765 |
| 1875 | 2869272585 | 2869271264 | Bacteria | 6908218 |
| 1876 | 2869278745 | 2869278585 | Bacteria | 7077053 |
| 1877 | 2869291457 | 2869285874 | Bacteria | 6901219 |
| 1878 | 2871276570 | 2871272651 | Bacteria | 5042015 |
| 1879 | 2871284836 | 2871282230 | Bacteria | 4917173 |
| 1880 | 2871433737 | 2871429161 | Bacteria | 6547891 |
| 1881 | 2871442259 | 2871435913 | Bacteria | 6880295 |
| 1882 | 2871455440 | 2871451962 | Bacteria | 7336357 |
| 1883 | 2871461625 | 2871459585 | Bacteria | 6866887 |
| 1884 | 2871484452 | 2871481445 | Bacteria | 6700002 |
| 1885 | 2871500638 | 2871495908 | Bacteria | 6935695 |
| 1886 | 2874103493 | 2874102143 | Bacteria | 6342645 |
| 1887 | 2874116192 | 2874109183 | Bacteria | 6517025 |
| 1888 | 2874117189 | 2874116593 | Bacteria | 6674494 |
| 1889 | 2874133731 | 2874131515 | Bacteria | 6820270 |
| 1890 | 2874145330 | 2874139085 | Bacteria | 7021506 |
| 1891 | 2874153314 | 2874146452 | Bacteria | 7533118 |
| 1892 | 2874160579 | 2874155637 | Bacteria | 6724144 |
| 1893 | 2874165777 | 2874162495 | Bacteria | 6174670 |
| 1894 | 2874176346 | 2874168670 | Bacteria | 8062617 |
| 1895 | 2876365559 | 2876363079 | Bacteria | 6544991 |
| 1896 | 2876384962 | 2876377896 | Bacteria | 6565995 |
| 1897 | 2876391333 | 2876386047 | Bacteria | 6698674 |
| 1898 | 2876395080 | 2876392853 | Bacteria | 6660880 |
| 1899 | 2876403161 | 2876399893 | Bacteria | 6927900 |
| 1900 | 2876412434 | 2876406927 | Bacteria | 6191900 |
| 1901 | 2876419605 | 2876413966 | Bacteria | 6831344 |
| 1902 | 2876425387 | 2876420981 | Bacteria | 6687741 |
| 1903 | 2878041500 | 2878035449 | Bacteria | 6555736 |
| 1904 | 2878737053 | 2878730984 | Bacteria | 6380721 |
| 1905 | 2878743578 | 2878738818 | Bacteria | 7136951 |
| 1906 | 2878751348 | 2878745973 | Bacteria | 6867388 |
| 1907 | 2878764727 | 2878760144 | Bacteria | 6823465 |
| 1908 | 2878771828 | 2878767105 | Bacteria | 6898628 |
| 1909 | 2878778322 | 2878774303 | Bacteria | 6108671 |
| 1910 | 2878787922 | 2878781027 | Bacteria | 6834456 |
| 1911 | 2881152749 | 2881147464 | Bacteria | 7779814 |
| 1912 | 2881168447 | 2881161766 | Bacteria | 7127907 |
| 1913 | 2884965065 | 2884960567 | Bacteria | 5437054 |
| 1914 | 2885310422 | 2885305155 | Bacteria | 7348390 |
| 1915 | 2885331659 | 2885326080 | Bacteria | 7134805 |
| 1916 | 2885338486 | 2885334103 | Bacteria | 7216818 |
| 1917 | 2888340263 | 2888337043 | Bacteria | 6629336 |
| 1918 | 2888356690 | 2888350351 | Bacteria | 7372807 |
| 1919 | 2889011566 | 2889010040 | Bacteria | 6749192 |
| 1920 | 2889023328 | 2889016732 | Bacteria | 6700763 |
| 1921 | 2889420872 | 2889415604 | Bacteria | 8048700 |
| 1922 | 2894818949 | 2894817345 | Bacteria | 4892941 |
| 1923 | 2900055063 | 2900051742 | Bacteria | 4985156 |
| 1924 | 2903455725 | 2903448605 | Bacteria | 7357801 |
| 1925 | 2903501864 | 2903492973 | Bacteria | 13473544 |
| 1926 | 2903517899 | 2903513507 | Bacteria | 6344008 |
| 1927 | 2903522915 | 2903521522 | Bacteria | 6525694 |
| 1928 | 2903533105 | 2903528002 | Bacteria | 6586099 |
| 1929 | 2903545451 | 2903540706 | Bacteria | 7062119 |
| 1930 | 2904509211 | 2904504865 | Bacteria | 5152820 |
| 1931 | 2904661711 | 2904659560 | Bacteria | 6685615 |
| 1932 | 2906313265 | 2906308376 | Bacteria | 6841989 |
| 1933 | 2906325976 | 2906321335 | Bacteria | 6579571 |
| 1934 | 2906335164 | 2906328253 | Bacteria | 6585166 |
| 1935 | 2906368027 | 2906363423 | Bacteria | 6856682 |
| 1936 | 2906375860 | 2906370794 | Bacteria | 6881062 |
| 1937 | 2906379095 | 2906378014 | Bacteria | 6911440 |
| 1938 | 2906389644 | 2906386501 | Bacteria | 5977019 |
| 1939 | 2906397538 | 2906393657 | Bacteria | 6790866 |
| 1940 | 2906405968 | 2906401398 | Bacteria | 6693206 |
| 1941 | 2906412756 | 2906408224 | Bacteria | 6162342 |
| 1942 | 2906416313 | 2906414383 | Bacteria | 6580790 |
| 1943 | 2908743378 | 2908739725 | Bacteria | 8628932 |
| 1944 | 2917557072 | 2917554339 | Bacteria | 4987857 |
| 1945 | 2919680938 | 2919679072 | Bacteria | 4629602 |
| 1946 | 2920110133 | 2920107658 | Bacteria | 10042636 |
| 1947 | 2922137271 | 2922130491 | Bacteria | 7173936 |
| 1948 | 2922153453 | 2922151315 | Bacteria | 6902399 |
| 1949 | 2922164208 | 2922158528 | Bacteria | 6573167 |
| 1950 | 2922174153 | 2922172374 | Bacteria | 6167644 |
| 1951 | 2922182209 | 2922178524 | Bacteria | 6025201 |
| 1952 | 2922186504 | 2922185730 | Bacteria | 7113964 |
| 1953 | 2924713233 | 2924710171 | Bacteria | 6752351 |
| 1954 | 2924726342 | 2924718760 | Bacteria | 6331356 |
| 1955 | 2924728209 | 2924726620 | Bacteria | 6271473 |
| 1956 | 2924735925 | 2924733363 | Bacteria | 7574837 |
| 1957 | 2924746576 | 2924741084 | Bacteria | 6661321 |
| 1958 | 2924768866 | 2924762789 | Bacteria | 6561353 |
| 1959 | 2924781390 | 2924776078 | Bacteria | 7492003 |
| 1960 | 2928122931 | 2928121344 | Bacteria | 3972376 |
| 1961 | 2935633614 | 2935630451 | Bacteria | 8169952 |
| 1962 | 2937820585 | 2937813078 | Bacteria | 7783518 |
| 1963 | 2937827171 | 2937822353 | Bacteria | 7290551 |
| 1964 | 2937853856 | 2937848649 | Bacteria | 6983481 |
| 1965 | 2937864342 | 2937861824 | Bacteria | 6660327 |
| 1966 | 2937879101 | 2937877337 | Bacteria | 7246526 |
| 1967 | 2937898304 | 2937891427 | Bacteria | 6357007 |
| 1968 | 2937975153 | 2937972304 | Bacteria | 7532020 |
| 1969 | 2937985267 | 2937980651 | Bacteria | 6517427 |
| 1970 | 2937999301 | 2937994558 | Bacteria | 7036190 |
| 1971 | 2958034861 | 2958034702 | Bacteria | 6989922 |
| 1972 | 2958043010 | 2958041894 | Bacteria | 13082850 |
| 1973 | 2958067105 | 2958064165 | Bacteria | 7158582 |
| 1974 | 2958086275 | 2958084443 | Bacteria | 7312792 |
| 1975 | 2958104572 | 2958100919 | Bacteria | 6800575 |
| 1976 | 2958109233 | 2958108152 | Bacteria | 6681128 |
| 1977 | 2958122358 | 2958115193 | Bacteria | 6923548 |
| 1978 | 2958129193 | 2958122699 | Bacteria | 7280457 |
| 1979 | 2958135856 | 2958130278 | Bacteria | 6897202 |
| 1980 | 2958151130 | 2958144490 | Bacteria | 6677056 |
| 1981 | 2958161519 | 2958158011 | Bacteria | 6058449 |
| 1982 | 2958169775 | 2958165035 | Bacteria | 6906348 |
| 1983 | 2958177564 | 2958172287 | Bacteria | 6716688 |
| 1984 | 2958185323 | 2958179912 | Bacteria | 6874908 |
| 1985 | 2961083590 | 2961077736 | Bacteria | 7079850 |
| 1986 | 2961116864 | 2961114664 | Bacteria | 6680456 |
| 1987 | 2961143907 | 2961136820 | Bacteria | 6775228 |
| 1988 | 2961168235 | 2961163497 | Bacteria | 6901077 |
| 1989 | 2961187387 | 2961183825 | Bacteria | 6688536 |
| 1990 | 2963648456 | 2963644680 | Bacteria | 6530403 |
| 1991 | 2965023054 | 2965018300 | Bacteria | 6883036 |
| 1992 | 2965029412 | 2965025482 | Bacteria | 6532201 |
| 1993 | 2965036658 | 2965032056 | Bacteria | 6887443 |
| 1994 | 2965045426 | 2965040258 | Bacteria | 6855979 |
| 1995 | 2965051761 | 2965047637 | Bacteria | 6623551 |
| 1996 | 2965068400 | 2965062239 | Bacteria | 7412989 |
| 1997 | 2965122262 | 2965119406 | Bacteria | 6956431 |
| 1998 | 2968017730 | 2968016561 | Bacteria | 7022047 |
| 1999 | 2968084970 | 2968083720 | Bacteria | 7351627 |
| 2000 | 2968091901 | 2968091066 | Bacteria | 6052692 |
| 2001 | 2968099405 | 2968097103 | Bacteria | 6107094 |
| 2002 | 2968112771 | 2968110612 | Bacteria | 6814636 |
| 2003 | 2968122993 | 2968117919 | Bacteria | 6536078 |
| 2004 | 2968129962 | 2968128360 | Bacteria | 6270294 |
| 2005 | 2968140158 | 2968138860 | Bacteria | 6605449 |
| 2006 | 2968176635 | 2968171901 | Bacteria | 6894245 |
| 2007 | 2970472095 | 2970469710 | Bacteria | 6969209 |
| 2008 | 2970495933 | 2970489779 | Bacteria | 6517260 |
| 2009 | 2970516441 | 2970510686 | Bacteria | 7006402 |
| 2010 | 2970535548 | 2970532167 | Bacteria | 6553173 |
| 2011 | 2970548212 | 2970547951 | Bacteria | 6931819 |
| 2012 | 2970559574 | 2970554993 | Bacteria | 6814252 |
| 2013 | 2970593341 | 2970593180 | Bacteria | 7073582 |
| 2014 | 2970624037 | 2970619444 | Bacteria | 6986144 |
| 2015 | 2970633962 | 2970627176 | Bacteria | 6680862 |
| 2016 | 2977848883 | 2977843712 | Bacteria | 6753583 |
| 2017 | 2977851986 | 2977851361 | Bacteria | 6694324 |
| 2018 | 2977861855 | 2977858184 | Bacteria | 6215359 |
| 2019 | 2977867554 | 2977864932 | Bacteria | 7534097 |
| 2020 | 2977877940 | 2977872689 | Bacteria | 7270173 |
| 2021 | 2977906076 | 2977898635 | Bacteria | 6675551 |
| 2022 | 2977917864 | 2977915119 | Bacteria | 6829656 |
| 2023 | 2977928986 | 2977922695 | Bacteria | 6956781 |
| 2024 | 2977941519 | 2977935797 | Bacteria | 6252826 |
| 2025 | 2977947047 | 2977942078 | Bacteria | 7570577 |
| 2026 | 2977957422 | 2977950692 | Bacteria | 6893264 |
| 2027 | 2977958780 | 2977957713 | Bacteria | 6877875 |
| 2028 | 2977978591 | 2977971508 | Bacteria | 7472917 |
| 2029 | 2979711814 | 2979710463 | Bacteria | 6785254 |
| 2030 | 2979752058 | 2979742915 | Bacteria | 7301278 |
| 2031 | 2979769689 | 2979764755 | Bacteria | 6610066 |
| 2032 | 2979777917 | 2979772303 | Bacteria | 6618277 |
| 2033 | 2979786103 | 2979779861 | Bacteria | 6219781 |
| 2034 | 2979797597 | 2979793036 | Bacteria | 6808957 |
| 2035 | 2987645421 | 2987636660 | Bacteria | 8088555 |
| 2036 | 2987649830 | 2987645492 | Bacteria | 6117018 |
| 2037 | 2987658290 | 2987652177 | Bacteria | 6969023 |
| 2038 | 2987664249 | 2987659509 | Bacteria | 6966464 |
| 2039 | 2987670544 | 2987666974 | Bacteria | 6509233 |
| 2040 | 2987677347 | 2987673487 | Bacteria | 6884027 |
| 2041 | 2995728088 | 2995726249 | Bacteria | 3470435 |
| 2042 | 2996348394 | 2996341866 | Bacteria | 6643098 |
| 2043 | 2996351027 | 2996348954 | Bacteria | 7239054 |
| 2044 | 2996392675 | 2996386984 | Bacteria | 6978667 |
| 2045 | 3000018694 | 3000017691 | Bacteria | 3772574 |
| 2046 | 3003933368 | 3003930520 | Bacteria | 5667563 |
| 2047 | 3004169703 | 3004167301 | Bacteria | 8330599 |
| 2048 | 3004193304 | 3004188549 | Bacteria | 6952365 |
| 2049 | 3004206328 | 3004203850 | Bacteria | 7307914 |
| 2050 | 3004241853 | 3004239961 | Bacteria | 6892290 |
| 2051 | 3004254174 | 3004248173 | Bacteria | 6563236 |
| 2052 | 3004275307 | 3004268573 | Bacteria | 7043476 |
| 2053 | 3004277725 | 3004275668 | Bacteria | 7114440 |
| 2054 | 3004296135 | 3004289098 | Bacteria | 6135450 |
| 2055 | 3004340875 | 3004334049 | Bacteria | 8449246 |
| 2056 | 637073816 | 637000159 | Bacteria | 7596297 |
| 2057 | 649873817 | 649633066 | Bacteria | 6690028 |
| 2058 | 8004304783 | 8004300914 | Bacteria | 6132239 |
| 2059 | 8004366751 | 8004361976 | Bacteria | 6858373 |
| 2060 | 8004393988 | 8004387939 | Bacteria | 7049250 |
| 2061 | 8004447230 | 8004445564 | Bacteria | 6322258 |
| 2062 | 8004646830 | 8004640170 | Bacteria | 6723001 |
| 2063 | 8004713792 | 8004703790 | Bacteria | 8006957 |
| 2064 | 8004719521 | 8004714634 | Bacteria | 6776161 |
| 2065 | 8004730442 | 8004727605 | Bacteria | 6643904 |
| 2066 | 8006941435 | 8006933436 | Bacteria | 10410654 |
| 2067 | 8006981148 | 8006973647 | Bacteria | 10679141 |
| 2068 | 8049294366 | 8049293176 | Bacteria | 6128433 |
| 2069 | 8054565037 | 8054563764 | Bacteria | 5592885 |
| 2070 | 8055035903 | 8055034563 | Bacteria | 3562128 |
| 2071 | 8055038543 | 8055037949 | Bacteria | 3337834 |
| 2072 | Ga0070659_100004306 | |||
| 2073 | CNAas_1000040 | |||
| 2074 | JGI24740J21852_10006921 | |||
| 2075 | JGI24739J22299_10049812 | |||
| 2076 | JGI24737J22298_10040690 | |||
| 2077 | JGI24735J21928_10015514 | |||
| 2078 | JGI24735J21928_10021675 | |||
| 2079 | JGI24750J21931_1014682 | |||
| 2080 | JGI24034J26672_10000026 | |||
| 2081 | JGI24751J29686_10000030 | |||
| 2082 | JGI25162J39368_1000075 | |||
| 2083 | JGI25157J39369_1000694 | |||
| 2084 | JGI25406J46586_10003840 | |||
| 2085 | JGI25406J46586_10059736 | |||
| 2086 | JGI25406J46586_10077736 | |||
| 2087 | JGI25165J46597_1000033 | |||
| 2088 | JGI25165J46597_1010963 | |||
| 2089 | rootH2_10077725 | |||
| 2090 | rootH2_10078133 | |||
| 2091 | rootH2_10198277 | |||
| 2092 | rootL2_10259676 | |||
| 2093 | rootH1_10005877 | |||
| 2094 | rootH1_10012091 | |||
| 2095 | JGI25160J50197_1002193 | |||
| 2096 | JGI25404J52841_10010830 | |||
| 2097 | Ga0055529_1001715 | |||
| 2098 | Ga0065165_1004344 | |||
| 2099 | Ga0065714_10064504 | |||
| 2100 | Ga0065704_10128089 | |||
| 2101 | Ga0065704_10139293 | |||
| 2102 | Ga0065704_10209631 | |||
| 2103 | Ga0065712_10067766 | |||
| 2104 | Ga0065712_10079152 | |||
| 2105 | Ga0065712_10120433 | |||
| 2106 | Ga0065712_10122253 | |||
| 2107 | Ga0065712_10182341 | |||
| 2108 | Ga0065715_10001956 | |||
| 2109 | Ga0065715_10022986 | |||
| 2110 | Ga0065715_10041779 | |||
| 2111 | Ga0065715_10089158 | |||
| 2112 | Ga0065715_10152536 | |||
| 2113 | Ga0065715_10188464 | |||
| 2114 | Ga0065715_10301965 | |||
| 2115 | Ga0065707_10195597 | |||
| 2116 | Ga0065707_10199019 | |||
| 2117 | Ga0065707_10237340 | |||
| 2118 | Ga0065707_10288125 | |||
| 2119 | Ga0070658_10001208 | |||
| 2120 | Ga0070658_10014417 | |||
| 2121 | Ga0070658_10056805 | |||
| 2122 | Ga0070676_10002075 | |||
| 2123 | Ga0070683_100001378 | |||
| 2124 | Ga0070683_100073796 | |||
| 2125 | Ga0070690_100000812 | |||
| 2126 | Ga0070690_100001011 | |||
| 2127 | Ga0070690_100001334 | |||
| 2128 | Ga0070690_100236242 | |||
| 2129 | Ga0070670_100002791 | |||
| 2130 | Ga0070670_100033283 | |||
| 2131 | Ga0070670_100133728 | |||
| 2132 | Ga0070670_100604021 | |||
| 2133 | Ga0070677_10000526 | |||
| 2134 | Ga0070677_10152901 | |||
| 2135 | Ga0068869_100103722 | |||
| 2136 | Ga0068869_100143427 | |||
| 2137 | Ga0068869_100168917 | |||
| 2138 | Ga0068869_100250304 | |||
| 2139 | Ga0070666_10001337 | |||
| 2140 | Ga0070666_10018053 | |||
| 2141 | Ga0070666_10051188 | |||
| 2142 | Ga0070666_10088334 | |||
| 2143 | Ga0070680_100001985 | |||
| 2144 | Ga0070680_100010302 | |||
| 2145 | Ga0070680_100012770 | |||
| 2146 | Ga0070680_100326609 | |||
| 2147 | Ga0070682_100023706 | |||
| 2148 | Ga0070682_100029208 | |||
| 2149 | Ga0070682_100034027 | |||
| 2150 | Ga0068868_100001472 | |||
| 2151 | Ga0068868_100035781 | |||
| 2152 | Ga0068868_100039981 | |||
| 2153 | Ga0070660_100001829 | |||
| 2154 | Ga0070660_100005970 | |||
| 2155 | Ga0070660_100018548 | |||
| 2156 | Ga0070660_100042990 | |||
| 2157 | Ga0070660_100071913 | |||
| 2158 | Ga0070660_100111006 | |||
| 2159 | Ga0070689_100003426 | |||
| 2160 | Ga0070689_100040778 | |||
| 2161 | Ga0070689_100128362 | |||
| 2162 | Ga0070689_100440593 | |||
| 2163 | Ga0070691_10020783 | |||
| 2164 | Ga0070691_10041162 | |||
| 2165 | Ga0070691_10157322 | |||
| 2166 | Ga0070687_100000129 | |||
| 2167 | Ga0070687_100170001 | |||
| 2168 | Ga0070687_100271253 | |||
| 2169 | Ga0070661_100001499 | |||
| 2170 | Ga0070661_100004800 | |||
| 2171 | Ga0070661_100011435 | |||
| 2172 | Ga0070661_100020420 | |||
| 2173 | Ga0070661_100113963 | |||
| 2174 | Ga0070661_100340548 | |||
| 2175 | Ga0070692_10056376 | |||
| 2176 | Ga0070692_10078838 | |||
| 2177 | Ga0070668_100001092 | |||
| 2178 | Ga0070668_100020391 | |||
| 2179 | Ga0070668_100312028 | |||
| 2180 | Ga0070669_100001544 | |||
| 2181 | Ga0070669_100047892 | |||
| 2182 | Ga0070669_100066581 | |||
| 2183 | Ga0070669_100115061 | |||
| 2184 | Ga0070669_100321252 | |||
| 2185 | Ga0070669_100520740 | |||
| 2186 | Ga0070675_100011835 | |||
| 2187 | Ga0070675_100116649 | |||
| 2188 | Ga0070675_100469098 | |||
| 2189 | Ga0070671_100001853 | |||
| 2190 | Ga0070671_100073369 | |||
| 2191 | Ga0070671_100089287 | |||
| 2192 | Ga0070671_100155199 | |||
| 2193 | Ga0070671_100228293 | |||
| 2194 | Ga0070674_100356481 | |||
| 2195 | Ga0070673_100082833 | |||
| 2196 | Ga0070673_100172015 | |||
| 2197 | Ga0070673_100272870 | |||
| 2198 | Ga0070673_100288759 | |||
| 2199 | Ga0070673_100351064 | |||
| 2200 | Ga0070673_100525780 | |||
| 2201 | Ga0070688_100000657 | |||
| 2202 | Ga0070688_100006128 | |||
| 2203 | Ga0070659_100002328 | |||
| 2204 | Ga0070659_100013504 | |||
| 2205 | Ga0070659_100023287 | |||
| 2206 | Ga0070659_100081787 | |||
| 2207 | Ga0070659_100352857 | |||
| 2208 | Ga0070659_100608543 | |||
| 2209 | Ga0070667_100003253 | |||
| 2210 | Ga0070667_100018342 | |||
| 2211 | Ga0070667_100134011 | |||
| 2212 | Ga0070667_100173995 | |||
| 2213 | Ga0070703_10058342 | |||
| 2214 | Ga0070709_10005740 | |||
| 2215 | Ga0070714_100380444 | |||
| 2216 | Ga0070710_10004618 | |||
| 2217 | Ga0070701_10011515 | |||
| 2218 | Ga0070701_10113763 | |||
| 2219 | Ga0070711_100078337 | |||
| 2220 | Ga0070711_100084992 | |||
| 2221 | Ga0070705_100001751 | |||
| 2222 | Ga0070705_100027907 | |||
| 2223 | Ga0070705_100067072 | |||
| 2224 | Ga0070705_100105070 | |||
| 2225 | Ga0070700_100000719 | |||
| 2226 | Ga0070700_100012018 | |||
| 2227 | Ga0070700_100020667 | |||
| 2228 | Ga0070700_100039705 | |||
| 2229 | Ga0070700_100062514 | |||
| 2230 | Ga0070700_100257511 | |||
| 2231 | Ga0070694_100006547 | |||
| 2232 | Ga0070694_100008855 | |||
| 2233 | Ga0070694_100044502 | |||
| 2234 | Ga0070694_100109337 | |||
| 2235 | Ga0070694_100201814 | |||
| 2236 | Ga0070694_100333469 | |||
| 2237 | Ga0070694_100381266 | |||
| 2238 | Ga0070708_100005855 | |||
| 2239 | Ga0070708_100137339 | |||
| 2240 | Ga0070708_100677381 | |||
| 2241 | Ga0070663_100002023 | |||
| 2242 | Ga0070663_100005687 | |||
| 2243 | Ga0070663_100011762 | |||
| 2244 | Ga0070663_100048511 | |||
| 2245 | Ga0070663_100283642 | |||
| 2246 | Ga0070678_100001372 | |||
| 2247 | Ga0070678_100032969 | |||
| 2248 | Ga0070678_100531052 | |||
| 2249 | Ga0070662_100141147 | |||
| 2250 | Ga0070662_100180045 | |||
| 2251 | Ga0070681_10002315 | |||
| 2252 | Ga0070681_10003664 | |||
| 2253 | Ga0070681_10007845 | |||
| 2254 | Ga0070681_10010655 | |||
| 2255 | Ga0070681_10015116 | |||
| 2256 | Ga0070681_10018723 | |||
| 2257 | Ga0070681_10051872 | |||
| 2258 | Ga0070681_10166545 | |||
| 2259 | Ga0070681_10348936 | |||
| 2260 | Ga0068867_100006387 | |||
| 2261 | Ga0068867_100013233 | |||
| 2262 | Ga0068867_100074453 | |||
| 2263 | Ga0068867_100257362 | |||
| 2264 | Ga0070685_10001416 | |||
| 2265 | Ga0070685_10004344 | |||
| 2266 | Ga0070685_10082845 | |||
| 2267 | Ga0070706_100000125 | |||
| 2268 | Ga0070706_100008529 | |||
| 2269 | Ga0070706_100210603 | |||
| 2270 | Ga0070706_100565234 | |||
| 2271 | Ga0070707_100003600 | |||
| 2272 | Ga0070707_100011087 | |||
| 2273 | Ga0070707_100012513 | |||
| 2274 | Ga0070707_100260130 | |||
| 2275 | Ga0070707_100304531 | |||
| 2276 | Ga0070707_100430159 | |||
| 2277 | Ga0070698_100005037 | |||
| 2278 | Ga0070698_100006865 | |||
| 2279 | Ga0070698_100008229 | |||
| 2280 | Ga0070699_100000352 | |||
| 2281 | Ga0070699_100000880 | |||
| 2282 | Ga0070699_100004094 | |||
| 2283 | Ga0070699_100111738 | |||
| 2284 | Ga0070679_100000587 | |||
| 2285 | Ga0070679_100008410 | |||
| 2286 | Ga0070679_100011201 | |||
| 2287 | Ga0070679_100077077 | |||
| 2288 | Ga0070684_100043562 | |||
| 2289 | Ga0070684_100059847 | |||
| 2290 | Ga0070684_100533696 | |||
| 2291 | Ga0070697_100031128 | |||
| 2292 | Ga0070697_100055838 | |||
| 2293 | Ga0070697_100153616 | |||
| 2294 | Ga0068853_100003665 | |||
| 2295 | Ga0068853_100003943 | |||
| 2296 | Ga0068853_100027252 | |||
| 2297 | Ga0068853_100040630 | |||
| 2298 | Ga0068853_100051948 | |||
| 2299 | Ga0068853_100093101 | |||
| 2300 | Ga0068853_100163691 | |||
| 2301 | Ga0068853_100170360 | |||
| 2302 | Ga0070672_100000867 | |||
| 2303 | Ga0070672_100016594 | |||
| 2304 | Ga0070672_100042656 | |||
| 2305 | Ga0070672_100197393 | |||
| 2306 | Ga0070672_100560480 | |||
| 2307 | Ga0070672_100656057 | |||
| 2308 | Ga0070686_100004310 | |||
| 2309 | Ga0070686_100006195 | |||
| 2310 | Ga0070686_100022101 | |||
| 2311 | Ga0070686_100142294 | |||
| 2312 | Ga0070686_100221860 | |||
| 2313 | Ga0070695_100008518 | |||
| 2314 | Ga0070695_100053158 | |||
| 2315 | Ga0070695_100267266 | |||
| 2316 | Ga0070695_100510046 | |||
| 2317 | Ga0070696_100040295 | |||
| 2318 | Ga0070696_100514153 | |||
| 2319 | Ga0070696_100693071 | |||
| 2320 | Ga0070693_100020755 | |||
| 2321 | Ga0070693_100030719 | |||
| 2322 | Ga0070693_100052530 | |||
| 2323 | Ga0070693_100070706 | |||
| 2324 | Ga0070665_100010998 | |||
| 2325 | Ga0070665_100018974 | |||
| 2326 | Ga0070665_100023145 | |||
| 2327 | Ga0070665_100024444 | |||
| 2328 | Ga0070665_100046320 | |||
| 2329 | Ga0070665_100263305 | |||
| 2330 | Ga0070665_100283231 | |||
| 2331 | Ga0070665_100350250 | |||
| 2332 | Ga0070665_100553282 | |||
| 2333 | Ga0070704_100000897 | |||
| 2334 | Ga0070704_100054755 | |||
| 2335 | Ga0070704_100096074 | |||
| 2336 | Ga0070704_100134808 | |||
| 2337 | Ga0070704_100161122 | |||
| 2338 | Ga0070704_100325872 | |||
| 2339 | Ga0070704_100605301 | |||
| 2340 | Ga0068855_100003374 | |||
| 2341 | Ga0068855_100004501 | |||
| 2342 | Ga0068855_100018186 | |||
| 2343 | Ga0068855_100037556 | |||
| 2344 | Ga0068855_100089580 | |||
| 2345 | Ga0068855_100108358 | |||
| 2346 | Ga0068855_100151181 | |||
| 2347 | Ga0068855_100240449 | |||
| 2348 | Ga0068855_100250783 | |||
| 2349 | Ga0068855_100802958 | |||
| 2350 | Ga0068855_100926808 | |||
| 2351 | Ga0070664_100000070 | |||
| 2352 | Ga0070664_100001934 | |||
| 2353 | Ga0070664_100017132 | |||
| 2354 | Ga0070664_100026866 | |||
| 2355 | Ga0070664_100047571 | |||
| 2356 | Ga0068857_100003654 | |||
| 2357 | Ga0068857_100004680 | |||
| 2358 | Ga0068857_100033566 | |||
| 2359 | Ga0068857_100037853 | |||
| 2360 | Ga0068857_100061463 | |||
| 2361 | Ga0068854_100001002 | |||
| 2362 | Ga0068854_100010067 | |||
| 2363 | Ga0068854_100046307 | |||
| 2364 | Ga0068854_100103155 | |||
| 2365 | Ga0068854_100253706 | |||
| 2366 | Ga0068856_100005597 | |||
| 2367 | Ga0068856_100021359 | |||
| 2368 | Ga0068856_100216883 | |||
| 2369 | Ga0068856_100312957 | |||
| 2370 | Ga0068856_100341639 | |||
| 2371 | Ga0068856_100526334 | |||
| 2372 | Ga0070702_100017673 | |||
| 2373 | Ga0070702_100033498 | |||
| 2374 | Ga0070702_100060385 | |||
| 2375 | Ga0070702_100252847 | |||
| 2376 | Ga0070702_100308007 | |||
| 2377 | Ga0068852_100001511 | |||
| 2378 | Ga0068852_100006048 | |||
| 2379 | Ga0068852_100065307 | |||
| 2380 | Ga0068852_100232089 | |||
| 2381 | Ga0068852_100241597 | |||
| 2382 | Ga0068852_100399548 | |||
| 2383 | Ga0068852_100662403 | |||
| 2384 | Ga0068852_100672893 | |||
| 2385 | Ga0068859_100009084 | |||
| 2386 | Ga0068859_100022162 | |||
| 2387 | Ga0068859_100027560 | |||
| 2388 | Ga0068859_100029327 | |||
| 2389 | Ga0068859_100050914 | |||
| 2390 | Ga0068859_100059991 | |||
| 2391 | Ga0068859_100102105 | |||
| 2392 | Ga0068859_100169710 | |||
| 2393 | Ga0068859_100355574 | |||
| 2394 | Ga0068864_100003320 | |||
| 2395 | Ga0068864_100014922 | |||
| 2396 | Ga0068864_100024719 | |||
| 2397 | Ga0068864_100035972 | |||
| 2398 | Ga0068864_100040419 | |||
| 2399 | Ga0068864_100178664 | |||
| 2400 | Ga0068864_100246022 | |||
| 2401 | Ga0068864_100676324 | |||
| 2402 | Ga0068866_10000167 | |||
| 2403 | Ga0068861_100001113 | |||
| 2404 | Ga0068861_100020275 | |||
| 2405 | Ga0068861_100340958 | |||
| 2406 | Ga0068861_100558303 | |||
| 2407 | Ga0068851_10000382 | |||
| 2408 | Ga0068851_10010828 | |||
| 2409 | Ga0068851_10062572 | |||
| 2410 | Ga0068863_100002882 | |||
| 2411 | Ga0068863_100080336 | |||
| 2412 | Ga0068863_100208714 | |||
| 2413 | Ga0068863_100264213 | |||
| 2414 | Ga0068858_100005307 | |||
| 2415 | Ga0068858_100006538 | |||
| 2416 | Ga0068858_100018581 | |||
| 2417 | Ga0068858_100041680 | |||
| 2418 | Ga0068858_100049299 | |||
| 2419 | Ga0068858_100059043 | |||
| 2420 | Ga0068858_100206719 | |||
| 2421 | Ga0068858_100275829 | |||
| 2422 | Ga0068860_100007853 | |||
| 2423 | Ga0068860_100011324 | |||
| 2424 | Ga0068860_100019352 | |||
| 2425 | Ga0068860_100030361 | |||
| 2426 | Ga0068860_100061705 | |||
| 2427 | Ga0068860_100243218 | |||
| 2428 | Ga0068862_100014640 | |||
| 2429 | Ga0068862_100080071 | |||
| 2430 | Ga0068862_100095635 | |||
| 2431 | Ga0068862_100156570 | |||
| 2432 | Ga0068862_100655808 | |||
| 2433 | Ga0068862_100860223 | |||
| 2434 | Ga0081455_10017929 | |||
| 2435 | Ga0081540_1000138 | |||
| 2436 | Ga0081540_1000640 | |||
| 2437 | Ga0081540_1001923 | |||
| 2438 | Ga0081540_1003393 | |||
| 2439 | Ga0081540_1017951 | |||
| 2440 | Ga0081540_1093371 | |||
| 2441 | Ga0081539_10000110 | |||
| 2442 | Ga0081539_10001757 | |||
| 2443 | Ga0081539_10005290 | |||
| 2444 | Ga0081539_10006601 | |||
| 2445 | Ga0081539_10016624 | |||
| 2446 | Ga0070717_10038368 | |||
| 2447 | Ga0070717_10114601 | |||
| 2448 | Ga0075365_10003274 | |||
| 2449 | Ga0075365_10005800 | |||
| 2450 | Ga0075365_10009956 | |||
| 2451 | Ga0075368_10010236 | |||
| 2452 | Ga0075363_100040656 | |||
| 2453 | Ga0075364_10027328 | |||
| 2454 | Ga0070715_10000063 | |||
| 2455 | Ga0070716_100078021 | |||
| 2456 | Ga0070716_100116535 | |||
| 2457 | Ga0075362_10008752 | |||
| 2458 | Ga0075362_10018996 | |||
| 2459 | Ga0075367_10017171 | |||
| 2460 | Ga0075367_10026146 | |||
| 2461 | Ga0075367_10070535 | |||
| 2462 | Ga0075367_10090436 | |||
| 2463 | Ga0075369_10003352 | |||
| 2464 | Ga0075369_10105201 | |||
| 2465 | Ga0097621_100000449 | |||
| 2466 | Ga0097621_100259045 | |||
| 2467 | Ga0097621_100273719 | |||
| 2468 | Ga0075370_10023704 | |||
| 2469 | Ga0068871_100001759 | |||
| 2470 | Ga0068871_100064226 | |||
| 2471 | Ga0068871_100314906 | |||
| 2472 | Ga0068871_100376467 | |||
| 2473 | Ga0075428_100009001 | |||
| 2474 | Ga0075428_100047133 | |||
| 2475 | Ga0075428_100049375 | |||
| 2476 | Ga0075428_100065603 | |||
| 2477 | Ga0075428_100185233 | |||
| 2478 | Ga0075428_100287649 | |||
| 2479 | Ga0075430_100076170 | |||
| 2480 | Ga0075430_100080323 | |||
| 2481 | Ga0075430_100518947 | |||
| 2482 | Ga0075431_100000392 | |||
| 2483 | Ga0075431_100001188 | |||
| 2484 | Ga0075433_10008826 | |||
| 2485 | Ga0075433_10044089 | |||
| 2486 | Ga0075433_10045889 | |||
| 2487 | Ga0075433_10062021 | |||
| 2488 | Ga0075433_10118535 | |||
| 2489 | Ga0075433_10176928 | |||
| 2490 | Ga0075434_100004782 | |||
| 2491 | Ga0075434_100019404 | |||
| 2492 | Ga0075434_100020621 | |||
| 2493 | Ga0075434_100035585 | |||
| 2494 | Ga0075434_100110623 | |||
| 2495 | Ga0075434_100120201 | |||
| 2496 | Ga0075434_100217845 | |||
| 2497 | Ga0075434_100240687 | |||
| 2498 | Ga0075434_100277852 | |||
| 2499 | Ga0075429_100124879 | |||
| 2500 | Ga0075429_100295766 | |||
| 2501 | Ga0075429_100395773 | |||
| 2502 | Ga0068865_100002359 | |||
| 2503 | Ga0068865_100024668 | |||
| 2504 | Ga0068865_100141872 | |||
| 2505 | Ga0068865_100365257 | |||
| 2506 | Ga0075436_100001175 | |||
| 2507 | Ga0097620_100009084 | |||
| 2508 | Ga0097620_100022163 | |||
| 2509 | Ga0097620_100027559 | |||
| 2510 | Ga0097620_100029326 | |||
| 2511 | Ga0097620_100050908 | |||
| 2512 | Ga0097620_100059986 | |||
| 2513 | Ga0097620_100102107 | |||
| 2514 | Ga0097620_100169714 | |||
| 2515 | Ga0097620_100355571 | |||
| 2516 | Ga0079104_1000209 | |||
| 2517 | Ga0075435_100009611 | |||
| 2518 | Ga0099794_10003880 | |||
| 2519 | Ga0105251_10056175 | |||
| 2520 | Ga0105244_10000145 | |||
| 2521 | Ga0105250_10000127 | |||
| 2522 | Ga0105240_10007255 | |||
| 2523 | Ga0105240_10021381 | |||
| 2524 | Ga0105240_10062851 | |||
| 2525 | Ga0105240_10094300 | |||
| 2526 | Ga0105240_10122464 | |||
| 2527 | Ga0105240_10134066 | |||
| 2528 | Ga0105240_10142856 | |||
| 2529 | Ga0105240_10158004 | |||
| 2530 | Ga0105240_10162374 | |||
| 2531 | Ga0105240_10189757 | |||
| 2532 | Ga0105240_10478093 | |||
| 2533 | Ga0105240_10769101 | |||
| 2534 | Ga0111539_10000358 | |||
| 2535 | Ga0111539_10059338 | |||
| 2536 | Ga0111539_10076099 | |||
| 2537 | Ga0111539_10112739 | |||
| 2538 | Ga0111539_10310035 | |||
| 2539 | Ga0111539_10351792 | |||
| 2540 | Ga0111539_10375944 | |||
| 2541 | Ga0105245_10003941 | |||
| 2542 | Ga0105245_10107745 | |||
| 2543 | Ga0105245_10487140 | |||
| 2544 | Ga0105245_10668767 | |||
| 2545 | Ga0105247_10000047 | |||
| 2546 | Ga0105247_10000680 | |||
| 2547 | Ga0105247_10001044 | |||
| 2548 | Ga0105247_10063001 | |||
| 2549 | Ga0105247_10093410 | |||
| 2550 | Ga0105247_10103760 | |||
| 2551 | Ga0114129_10005694 | |||
| 2552 | Ga0114129_10070556 | |||
| 2553 | Ga0114129_10281624 | |||
| 2554 | Ga0114129_10313848 | |||
| 2555 | Ga0114129_10473193 | |||
| 2556 | Ga0114129_10481150 | |||
| 2557 | Ga0114129_10514193 | |||
| 2558 | Ga0114129_10610367 | |||
| 2559 | Ga0114129_10759767 | |||
| 2560 | Ga0105243_10000027 | |||
| 2561 | Ga0105243_10000474 | |||
| 2562 | Ga0105243_10007357 | |||
| 2563 | Ga0105243_10025565 | |||
| 2564 | Ga0105243_10046747 | |||
| 2565 | Ga0105243_10147343 | |||
| 2566 | Ga0105243_10378635 | |||
| 2567 | Ga0105243_10410071 | |||
| 2568 | Ga0105241_10000690 | |||
| 2569 | Ga0105241_10050218 | |||
| 2570 | Ga0105241_10070341 | |||
| 2571 | Ga0105241_10072947 | |||
| 2572 | Ga0105241_10102582 | |||
| 2573 | Ga0105241_10294902 | |||
| 2574 | Ga0105241_10298249 | |||
| 2575 | Ga0105241_10585830 | |||
| 2576 | Ga0105242_10000038 | |||
| 2577 | Ga0105242_10000107 | |||
| 2578 | Ga0105242_10001950 | |||
| 2579 | Ga0105242_10005047 | |||
| 2580 | Ga0105242_10028561 | |||
| 2581 | Ga0105242_10123128 | |||
| 2582 | Ga0105242_10160011 | |||
| 2583 | Ga0105248_10003364 | |||
| 2584 | Ga0105248_10020227 | |||
| 2585 | Ga0105248_10028561 | |||
| 2586 | Ga0105248_10032857 | |||
| 2587 | Ga0105248_10071202 | |||
| 2588 | Ga0105248_10169319 | |||
| 2589 | Ga0105248_10250961 | |||
| 2590 | Ga0105248_10321545 | |||
| 2591 | Ga0105237_10000829 | |||
| 2592 | Ga0105237_10003821 | |||
| 2593 | Ga0105237_10033099 | |||
| 2594 | Ga0105237_10045544 | |||
| 2595 | Ga0105237_10047386 | |||
| 2596 | Ga0105237_10059203 | |||
| 2597 | Ga0105237_10099103 | |||
| 2598 | Ga0105237_10246404 | |||
| 2599 | Ga0105237_10258032 | |||
| 2600 | Ga0105238_10001511 | |||
| 2601 | Ga0105238_10021004 | |||
| 2602 | Ga0105238_10027120 | |||
| 2603 | Ga0105238_10058950 | |||
| 2604 | Ga0105238_10141237 | |||
| 2605 | Ga0105238_10240618 | |||
| 2606 | Ga0105238_10625288 | |||
| 2607 | Ga0105238_10770149 | |||
| 2608 | Ga0105249_10000113 | |||
| 2609 | Ga0105249_10001390 | |||
| 2610 | Ga0105249_10001767 | |||
| 2611 | Ga0105249_10022829 | |||
| 2612 | Ga0105249_10490726 | |||
| 2613 | Ga0105239_10000857 | |||
| 2614 | Ga0105239_10003469 | |||
| 2615 | Ga0105239_10049011 | |||
| 2616 | Ga0105239_10060038 | |||
| 2617 | Ga0105239_10076176 | |||
| 2618 | Ga0105239_10165419 | |||
| 2619 | Ga0105239_10241798 | |||
| 2620 | Ga0105239_10887796 | |||
| 2621 | Ga0105246_10001442 | |||
| 2622 | Ga0105246_10073632 | |||
| 2623 | Ga0105246_10086527 | |||
| 2624 | Ga0105246_10280360 | |||
| 2625 | Ga0105246_10319732 | |||
| 2626 | Ga0157373_10003881 | |||
| 2627 | Ga0157373_10018812 | |||
| 2628 | Ga0157373_10044566 | |||
| 2629 | Ga0157373_10044616 | |||
| 2630 | Ga0157373_10186683 | |||
| 2631 | Ga0157371_10000858 | |||
| 2632 | Ga0157371_10310404 | |||
| 2633 | Ga0157371_10317708 | |||
| 2634 | Ga0157370_10001310 | |||
| 2635 | Ga0157370_10066474 | |||
| 2636 | Ga0157370_10084349 | |||
| 2637 | Ga0157370_10104065 | |||
| 2638 | Ga0157370_10193563 | |||
| 2639 | Ga0157369_10002570 | |||
| 2640 | Ga0157369_10007844 | |||
| 2641 | Ga0157369_10065636 | |||
| 2642 | Ga0157369_10070649 | |||
| 2643 | Ga0157369_10125796 | |||
| 2644 | Ga0157369_10196245 | |||
| 2645 | Ga0157374_10002021 | |||
| 2646 | Ga0157374_10913170 | |||
| 2647 | Ga0157378_10000048 | |||
| 2648 | Ga0157378_10001435 | |||
| 2649 | Ga0157378_10005648 | |||
| 2650 | Ga0157378_10025656 | |||
| 2651 | Ga0157378_10113691 | |||
| 2652 | Ga0157378_10229130 | |||
| 2653 | Ga0157378_10381753 | |||
| 2654 | Ga0157378_10528555 | |||
| 2655 | Ga0157378_10645347 | |||
| 2656 | Ga0163162_10000023 | |||
| 2657 | Ga0163162_10001226 | |||
| 2658 | Ga0163162_10051608 | |||
| 2659 | Ga0163162_10053079 | |||
| 2660 | Ga0163162_10108278 | |||
| 2661 | Ga0163162_10148629 | |||
| 2662 | Ga0163162_10203558 | |||
| 2663 | Ga0163162_10208523 | |||
| 2664 | Ga0163162_10216899 | |||
| 2665 | Ga0163162_10658561 | |||
| 2666 | Ga0157372_10006136 | |||
| 2667 | Ga0157372_10068693 | |||
| 2668 | Ga0157372_10286185 | |||
| 2669 | Ga0157372_10494190 | |||
| 2670 | Ga0157372_11515511 | |||
| 2671 | Ga0157375_10002065 | |||
| 2672 | Ga0157375_10006519 | |||
| 2673 | Ga0157375_10048768 | |||
| 2674 | Ga0157375_10124856 | |||
| 2675 | Ga0157375_10245995 | |||
| 2676 | Ga0157375_10254236 | |||
| 2677 | Ga0157375_10348662 | |||
| 2678 | Ga0163163_10000156 | |||
| 2679 | Ga0163163_10054400 | |||
| 2680 | Ga0163163_10073729 | |||
| 2681 | Ga0163163_10304950 | |||
| 2682 | Ga0163163_10377167 | |||
| 2683 | Ga0163163_10776315 | |||
| 2684 | Ga0157380_10001458 | |||
| 2685 | Ga0157380_10012266 | |||
| 2686 | Ga0157380_10029038 | |||
| 2687 | Ga0157380_10039177 | |||
| 2688 | Ga0157380_10040754 | |||
| 2689 | Ga0157380_10053569 | |||
| 2690 | Ga0157380_10284365 | |||
| 2691 | Ga0157380_10322233 | |||
| 2692 | Ga0157377_10001610 | |||
| 2693 | Ga0157377_10050432 | |||
| 2694 | Ga0157379_10056062 | |||
| 2695 | Ga0157379_10105838 | |||
| 2696 | Ga0157379_10123869 | |||
| 2697 | Ga0157379_10153851 | |||
| 2698 | Ga0157379_10162021 | |||
| 2699 | Ga0157376_10032402 | |||
| 2700 | Ga0157376_10054345 | |||
| 2701 | Ga0157376_10124275 | |||
| 2702 | Ga0157376_10147821 | |||
| 2703 | Ga0157376_10159828 | |||
| 2704 | Ga0157376_11005865 | |||
| 2705 | Ga0182006_1023433 | |||
| 2706 | Ga0182007_10030676 | |||
| 2707 | Ga0182007_10056709 | |||
| 2708 | Ga0163161_10017220 | |||
| 2709 | Ga0163161_10025332 | |||
| 2710 | Ga0163161_10059173 | |||
| 2711 | Ga0163161_10159882 | |||
| 2712 | Ga0163161_10174310 | |||
| 2713 | Ga0163161_10231857 | |||
| 2714 | Ga0163161_10337928 | |||
| 2715 | Ga0163161_10355781 | |||
| 2716 | Ga0213873_10062851 | |||
| 2717 | Ga0213874_10021966 | |||
| 2718 | Ga0213874_10023511 | |||
| 2719 | Ga0213876_10000043 | |||
| 2720 | Ga0213876_10000283 | |||
| 2721 | Ga0213876_10000541 | |||
| 2722 | Ga0213876_10000580 | |||
| 2723 | Ga0213876_10059369 | |||
| 2724 | Ga0213876_10123628 | |||
| 2725 | Ga0213876_10297933 | |||
| 2726 | Ga0213875_10000276 | |||
| 2727 | Ga0213875_10005719 | |||
| 2728 | Ga0213875_10007545 | |||
| 2729 | Ga0213875_10073977 | |||
| 2730 | Ga0213875_10091254 | |||
| 2731 | Ga0213875_10119755 | |||
| 2732 | Ga0213875_10165417 | |||
| 2733 | Ga0213871_10002403 | |||
| 2734 | Ga0224712_10012148 | |||
| 2735 | Ga0224572_1007204 | |||
| 2736 | Ga0207672_1000156 | |||
| 2737 | Ga0209646_1019801 | |||
| 2738 | Ga0209026_1000002 | |||
| 2739 | Ga0209677_100440 | |||
| 2740 | Ga0209148_1000072 | |||
| 2741 | Ga0209148_1008001 | |||
| 2742 | Ga0209759_1000146 | |||
| 2743 | Ga0209233_1000027 | |||
| 2744 | Ga0209233_1000297 | |||
| 2745 | Ga0209233_1004351 | |||
| 2746 | Ga0209455_1000133 | |||
| 2747 | Ga0209455_1009471 | |||
| 2748 | Ga0209675_1001307 | |||
| 2749 | Ga0209758_1012195 | |||
| 2750 | Ga0209758_1024001 | |||
| 2751 | Ga0209256_1002428 | |||
| 2752 | Ga0207697_10001372 | |||
| 2753 | Ga0207697_10029948 | |||
| 2754 | Ga0207697_10129407 | |||
| 2755 | Ga0207656_10000298 | |||
| 2756 | Ga0207656_10005843 | |||
| 2757 | Ga0207656_10032171 | |||
| 2758 | Ga0207696_1000134 | |||
| 2759 | Ga0207655_1000298 | |||
| 2760 | Ga0207653_10000400 | |||
| 2761 | Ga0207682_10000214 | |||
| 2762 | Ga0207692_10008338 | |||
| 2763 | Ga0207642_10000260 | |||
| 2764 | Ga0207710_10000001 | |||
| 2765 | Ga0207710_10002316 | |||
| 2766 | Ga0207710_10002769 | |||
| 2767 | Ga0207710_10050509 | |||
| 2768 | Ga0207688_10000836 | |||
| 2769 | Ga0207688_10045664 | |||
| 2770 | Ga0207688_10074619 | |||
| 2771 | Ga0207680_10001615 | |||
| 2772 | Ga0207680_10004606 | |||
| 2773 | Ga0207680_10070356 | |||
| 2774 | Ga0207647_10001682 | |||
| 2775 | Ga0207647_10004899 | |||
| 2776 | Ga0207647_10009697 | |||
| 2777 | Ga0207647_10021671 | |||
| 2778 | Ga0207647_10081547 | |||
| 2779 | Ga0207685_10000041 | |||
| 2780 | Ga0207645_10000251 | |||
| 2781 | Ga0207645_10002159 | |||
| 2782 | Ga0207645_10189759 | |||
| 2783 | Ga0207643_10000176 | |||
| 2784 | Ga0207643_10067989 | |||
| 2785 | Ga0207705_10011075 | |||
| 2786 | Ga0207705_10015184 | |||
| 2787 | Ga0207705_10029984 | |||
| 2788 | Ga0207705_10043327 | |||
| 2789 | Ga0207705_10066183 | |||
| 2790 | Ga0207705_10135850 | |||
| 2791 | Ga0207705_10139696 | |||
| 2792 | Ga0207684_10000130 | |||
| 2793 | Ga0207684_10001792 | |||
| 2794 | Ga0207684_10107705 | |||
| 2795 | Ga0207684_10131173 | |||
| 2796 | Ga0207684_10165352 | |||
| 2797 | Ga0207654_10001318 | |||
| 2798 | Ga0207654_10017455 | |||
| 2799 | Ga0207654_10020733 | |||
| 2800 | Ga0207654_10115339 | |||
| 2801 | Ga0207654_10284014 | |||
| 2802 | Ga0207707_10000577 | |||
| 2803 | Ga0207707_10013845 | |||
| 2804 | Ga0207707_10027146 | |||
| 2805 | Ga0207707_10038041 | |||
| 2806 | Ga0207707_10057171 | |||
| 2807 | Ga0207707_10072545 | |||
| 2808 | Ga0207707_10135112 | |||
| 2809 | Ga0207707_10151696 | |||
| 2810 | Ga0207695_10000011 | |||
| 2811 | Ga0207695_10004415 | |||
| 2812 | Ga0207695_10011746 | |||
| 2813 | Ga0207695_10051889 | |||
| 2814 | Ga0207695_10076795 | |||
| 2815 | Ga0207695_10128836 | |||
| 2816 | Ga0207695_10205545 | |||
| 2817 | Ga0207695_10291348 | |||
| 2818 | Ga0207695_10316714 | |||
| 2819 | Ga0207695_10328574 | |||
| 2820 | Ga0207695_10411011 | |||
| 2821 | Ga0207695_10666506 | |||
| 2822 | Ga0207671_10002285 | |||
| 2823 | Ga0207671_10009012 | |||
| 2824 | Ga0207671_10012933 | |||
| 2825 | Ga0207671_10030414 | |||
| 2826 | Ga0207671_10216238 | |||
| 2827 | Ga0207671_10256790 | |||
| 2828 | Ga0207671_10363776 | |||
| 2829 | Ga0207671_10609738 | |||
| 2830 | Ga0207663_10082208 | |||
| 2831 | Ga0207660_10004634 | |||
| 2832 | Ga0207660_10013164 | |||
| 2833 | Ga0207660_10037192 | |||
| 2834 | Ga0207660_10118160 | |||
| 2835 | Ga0207660_10314999 | |||
| 2836 | Ga0207660_10416795 | |||
| 2837 | Ga0207662_10000146 | |||
| 2838 | Ga0207662_10043744 | |||
| 2839 | Ga0207662_10046470 | |||
| 2840 | Ga0207662_10176936 | |||
| 2841 | Ga0207657_10003084 | |||
| 2842 | Ga0207657_10012251 | |||
| 2843 | Ga0207657_10022391 | |||
| 2844 | Ga0207657_10022630 | |||
| 2845 | Ga0207657_10173175 | |||
| 2846 | Ga0207657_10273208 | |||
| 2847 | Ga0207649_10000907 | |||
| 2848 | Ga0207649_10001001 | |||
| 2849 | Ga0207649_10003509 | |||
| 2850 | Ga0207649_10053105 | |||
| 2851 | Ga0207652_10010606 | |||
| 2852 | Ga0207652_10043700 | |||
| 2853 | Ga0207652_10068600 | |||
| 2854 | Ga0207652_10075441 | |||
| 2855 | Ga0207652_10104189 | |||
| 2856 | Ga0207646_10004552 | |||
| 2857 | Ga0207646_10004920 | |||
| 2858 | Ga0207646_10149616 | |||
| 2859 | Ga0207646_10251620 | |||
| 2860 | Ga0207646_10269196 | |||
| 2861 | Ga0207681_10001125 | |||
| 2862 | Ga0207681_10009832 | |||
| 2863 | Ga0207681_10014548 | |||
| 2864 | Ga0207681_10284649 | |||
| 2865 | Ga0207681_10292495 | |||
| 2866 | Ga0207694_10001152 | |||
| 2867 | Ga0207694_10002336 | |||
| 2868 | Ga0207694_10022362 | |||
| 2869 | Ga0207694_10028283 | |||
| 2870 | Ga0207694_10071691 | |||
| 2871 | Ga0207694_10405997 | |||
| 2872 | Ga0207650_10000010 | |||
| 2873 | Ga0207650_10001243 | |||
| 2874 | Ga0207650_10603065 | |||
| 2875 | Ga0207659_10000831 | |||
| 2876 | Ga0207687_10015252 | |||
| 2877 | Ga0207687_10268305 | |||
| 2878 | Ga0207687_10323474 | |||
| 2879 | Ga0207687_10324228 | |||
| 2880 | Ga0207687_10345839 | |||
| 2881 | Ga0207700_10014164 | |||
| 2882 | Ga0207644_10000285 | |||
| 2883 | Ga0207644_10001068 | |||
| 2884 | Ga0207644_10080345 | |||
| 2885 | Ga0207644_10109564 | |||
| 2886 | Ga0207644_10268626 | |||
| 2887 | Ga0207690_10002228 | |||
| 2888 | Ga0207690_10011176 | |||
| 2889 | Ga0207690_10036252 | |||
| 2890 | Ga0207690_10045184 | |||
| 2891 | Ga0207690_10275600 | |||
| 2892 | Ga0207706_10032261 | |||
| 2893 | Ga0207706_10166685 | |||
| 2894 | Ga0207706_10211548 | |||
| 2895 | Ga0207706_10263151 | |||
| 2896 | Ga0207706_10313566 | |||
| 2897 | Ga0207686_10000008 | |||
| 2898 | Ga0207686_10000463 | |||
| 2899 | Ga0207686_10009014 | |||
| 2900 | Ga0207686_10016548 | |||
| 2901 | Ga0207686_10053520 | |||
| 2902 | Ga0207686_10312709 | |||
| 2903 | Ga0207709_10000025 | |||
| 2904 | Ga0207709_10000493 | |||
| 2905 | Ga0207709_10001939 | |||
| 2906 | Ga0207709_10003815 | |||
| 2907 | Ga0207709_10035958 | |||
| 2908 | Ga0207709_10190844 | |||
| 2909 | Ga0207670_10000695 | |||
| 2910 | Ga0207670_10004103 | |||
| 2911 | Ga0207670_10064713 | |||
| 2912 | Ga0207670_10115390 | |||
| 2913 | Ga0207670_10152603 | |||
| 2914 | Ga0207669_10000390 | |||
| 2915 | Ga0207704_10000842 | |||
| 2916 | Ga0207704_10087011 | |||
| 2917 | Ga0207704_10094645 | |||
| 2918 | Ga0207704_10761095 | |||
| 2919 | Ga0207665_10013886 | |||
| 2920 | Ga0207665_10253016 | |||
| 2921 | Ga0207691_10000371 | |||
| 2922 | Ga0207691_10046619 | |||
| 2923 | Ga0207691_10066790 | |||
| 2924 | Ga0207691_10272142 | |||
| 2925 | Ga0207691_10286898 | |||
| 2926 | Ga0207711_10000513 | |||
| 2927 | Ga0207711_10006144 | |||
| 2928 | Ga0207711_10008004 | |||
| 2929 | Ga0207711_10017397 | |||
| 2930 | Ga0207711_10077141 | |||
| 2931 | Ga0207711_10095914 | |||
| 2932 | Ga0207711_10195015 | |||
| 2933 | Ga0207689_10002310 | |||
| 2934 | Ga0207689_10022079 | |||
| 2935 | Ga0207689_10027470 | |||
| 2936 | Ga0207689_10047194 | |||
| 2937 | Ga0207689_10094886 | |||
| 2938 | Ga0207689_10098748 | |||
| 2939 | Ga0207689_10149553 | |||
| 2940 | Ga0207689_10226814 | |||
| 2941 | Ga0207689_10309475 | |||
| 2942 | Ga0207661_10002789 | |||
| 2943 | Ga0207661_10386847 | |||
| 2944 | Ga0207679_10000102 | |||
| 2945 | Ga0207679_10000425 | |||
| 2946 | Ga0207679_10026299 | |||
| 2947 | Ga0207679_10239496 | |||
| 2948 | Ga0207679_10311808 | |||
| 2949 | Ga0207679_10348756 | |||
| 2950 | Ga0207679_10419024 | |||
| 2951 | Ga0207667_10006351 | |||
| 2952 | Ga0207667_10010676 | |||
| 2953 | Ga0207667_10017409 | |||
| 2954 | Ga0207667_10086548 | |||
| 2955 | Ga0207667_10093626 | |||
| 2956 | Ga0207667_10133566 | |||
| 2957 | Ga0207667_10195728 | |||
| 2958 | Ga0207667_10272149 | |||
| 2959 | Ga0207651_10000093 | |||
| 2960 | Ga0207651_10001385 | |||
| 2961 | Ga0207651_10125775 | |||
| 2962 | Ga0207651_10132730 | |||
| 2963 | Ga0207712_10000408 | |||
| 2964 | Ga0207712_10001464 | |||
| 2965 | Ga0207712_10171804 | |||
| 2966 | Ga0207712_10196151 | |||
| 2967 | Ga0207712_10224990 | |||
| 2968 | Ga0207712_10287102 | |||
| 2969 | Ga0207668_10000060 | |||
| 2970 | Ga0207668_10000798 | |||
| 2971 | Ga0207668_10279507 | |||
| 2972 | Ga0207640_10000598 | |||
| 2973 | Ga0207640_10007397 | |||
| 2974 | Ga0207640_10099808 | |||
| 2975 | Ga0207640_10126128 | |||
| 2976 | Ga0207640_10139361 | |||
| 2977 | Ga0207640_10242125 | |||
| 2978 | Ga0207640_10396827 | |||
| 2979 | Ga0207658_10001648 | |||
| 2980 | Ga0207658_10016124 | |||
| 2981 | Ga0207658_10023732 | |||
| 2982 | Ga0207658_10025324 | |||
| 2983 | Ga0207658_10036943 | |||
| 2984 | Ga0207658_10577090 | |||
| 2985 | Ga0207677_10000456 | |||
| 2986 | Ga0207677_10051529 | |||
| 2987 | Ga0207677_10201657 | |||
| 2988 | Ga0207703_10000384 | |||
| 2989 | Ga0207703_10000867 | |||
| 2990 | Ga0207703_10045116 | |||
| 2991 | Ga0207703_10050255 | |||
| 2992 | Ga0207703_10285496 | |||
| 2993 | Ga0207703_10473076 | |||
| 2994 | Ga0207639_10003324 | |||
| 2995 | Ga0207639_10004761 | |||
| 2996 | Ga0207639_10012411 | |||
| 2997 | Ga0207639_10014309 | |||
| 2998 | Ga0207639_10750963 | |||
| 2999 | Ga0207678_10000100 | |||
| 3000 | Ga0207678_10002390 | |||
| 3001 | Ga0207678_10010485 | |||
| 3002 | Ga0207678_10040568 | |||
| 3003 | Ga0207678_10047821 | |||
| 3004 | Ga0207678_10446371 | |||
| 3005 | Ga0207678_10561183 | |||
| 3006 | Ga0207708_10001694 | |||
| 3007 | Ga0207708_10023885 | |||
| 3008 | Ga0207708_10028396 | |||
| 3009 | Ga0207708_10085114 | |||
| 3010 | Ga0207708_10102988 | |||
| 3011 | Ga0207708_10153194 | |||
| 3012 | Ga0207702_10003152 | |||
| 3013 | Ga0207702_10167061 | |||
| 3014 | Ga0207702_10181949 | |||
| 3015 | Ga0207702_10243222 | |||
| 3016 | Ga0207702_10305491 | |||
| 3017 | Ga0207702_10705024 | |||
| 3018 | Ga0207641_10001449 | |||
| 3019 | Ga0207641_10057795 | |||
| 3020 | Ga0207641_10083361 | |||
| 3021 | Ga0207641_10115170 | |||
| 3022 | Ga0207641_10209104 | |||
| 3023 | Ga0207641_10359365 | |||
| 3024 | Ga0207648_10002737 | |||
| 3025 | Ga0207648_10008878 | |||
| 3026 | Ga0207648_10065955 | |||
| 3027 | Ga0207648_10173974 | |||
| 3028 | Ga0207648_10206900 | |||
| 3029 | Ga0207648_10303271 | |||
| 3030 | Ga0207648_10738430 | |||
| 3031 | Ga0207676_10001221 | |||
| 3032 | Ga0207676_10019238 | |||
| 3033 | Ga0207676_10024955 | |||
| 3034 | Ga0207676_10032052 | |||
| 3035 | Ga0207676_10313320 | |||
| 3036 | Ga0207676_10725031 | |||
| 3037 | Ga0207674_10000671 | |||
| 3038 | Ga0207674_10002399 | |||
| 3039 | Ga0207674_10029109 | |||
| 3040 | Ga0207674_10088526 | |||
| 3041 | Ga0207674_10153778 | |||
| 3042 | Ga0207674_10164935 | |||
| 3043 | Ga0207674_10174661 | |||
| 3044 | Ga0207674_10266209 | |||
| 3045 | Ga0207674_10568106 | |||
| 3046 | Ga0207675_100001958 | |||
| 3047 | Ga0207675_100002014 | |||
| 3048 | Ga0207675_100012425 | |||
| 3049 | Ga0207675_100143234 | |||
| 3050 | Ga0207675_100447650 | |||
| 3051 | Ga0207675_100637354 | |||
| 3052 | Ga0207683_10000375 | |||
| 3053 | Ga0207683_10021422 | |||
| 3054 | Ga0207683_10087003 | |||
| 3055 | Ga0207683_10130809 | |||
| 3056 | Ga0207683_10341395 | |||
| 3057 | Ga0207683_10680892 | |||
| 3058 | Ga0207698_10000755 | |||
| 3059 | Ga0207698_10008764 | |||
| 3060 | Ga0207698_10021968 | |||
| 3061 | Ga0207698_10142014 | |||
| 3062 | Ga0207698_10400789 | |||
| 3063 | Ga0207698_10599607 | |||
| 3064 | Ga0207698_10795302 | |||
| 3065 | Ga0209281_1000580 | |||
| 3066 | Ga0209588_1109662 | |||
| 3067 | Ga0209813_10039879 | |||
| 3068 | Ga0207428_10013505 | |||
| 3069 | Ga0207428_10425070 | |||
| 3070 | Ga0268266_10002601 | |||
| 3071 | Ga0268266_10176790 | |||
| 3072 | Ga0268266_10334851 | |||
| 3073 | Ga0268266_10705925 | |||
| 3074 | Ga0268265_10001155 | |||
| 3075 | Ga0268265_10041099 | |||
| 3076 | Ga0268265_10087003 | |||
| 3077 | Ga0268265_10132990 | |||
| 3078 | Ga0268265_10837196 | |||
| 3079 | Ga0268264_10000938 | |||
| 3080 | Ga0268264_10006852 | |||
| 3081 | Ga0268264_10013722 | |||
| 3082 | Ga0268264_10048036 | |||
| 3083 | Ga0268264_10059751 | |||
| 3084 | Ga0268264_10095284 | |||
| 3085 | Ga0268264_10176763 | |||
| 3086 | Ga0268264_10317674 | |||
| 3087 | Ga0268264_10410677 | |||
| 3088 | Ga0265337_1011859 | |||
| 3089 | Ga0265337_1027974 | |||
| 3090 | Ga0265326_10002848 | |||
| 3091 | Ga0265319_1002530 | |||
| 3092 | Ga0265319_1027664 | |||
| 3093 | Ga0265334_10002924 | |||
| 3094 | Ga0265334_10064086 | |||
| 3095 | Ga0265318_10000015 | |||
| 3096 | Ga0265318_10001067 | |||
| 3097 | Ga0265318_10107796 | |||
| 3098 | Ga0265322_10039179 | |||
| 3099 | Ga0265336_10096874 | |||
| 3100 | Ga0265338_10001151 | |||
| 3101 | Ga0265338_10020696 | |||
| 3102 | Ga0265338_10023976 | |||
| 3103 | Ga0265338_10035877 | |||
| 3104 | Ga0265338_10128359 | |||
| 3105 | Ga0265338_10133069 | |||
| 3106 | Ga0265338_10327454 | |||
| 3107 | Ga0265762_1004498 | |||
| 3108 | Ga0265762_1008314 | |||
| 3109 | Ga0265765_1005577 | |||
| 3110 | Ga0265760_10034992 | |||
| 3111 | Ga0265328_10079421 | |||
| 3112 | Ga0265320_10017283 | |||
| 3113 | Ga0265320_10079449 | |||
| 3114 | Ga0265320_10081828 | |||
| 3115 | Ga0265320_10215209 | |||
| 3116 | Ga0265325_10001084 | |||
| 3117 | Ga0265325_10089163 | |||
| 3118 | Ga0265325_10098895 | |||
| 3119 | Ga0265325_10188254 | |||
| 3120 | Ga0265340_10003394 | |||
| 3121 | Ga0265340_10089159 | |||
| 3122 | Ga0265340_10144329 | |||
| 3123 | Ga0265339_10000685 | |||
| 3124 | Ga0265339_10007974 | |||
| 3125 | Ga0265339_10015979 | |||
| 3126 | Ga0265339_10032527 | |||
| 3127 | Ga0265339_10040343 | |||
| 3128 | Ga0265339_10223758 | |||
| 3129 | Ga0265331_10000102 | |||
| 3130 | Ga0265331_10033783 | |||
| 3131 | Ga0265316_10022216 | |||
| 3132 | Ga0265316_10082428 | |||
| 3133 | Ga0265316_10086431 | |||
| 3134 | Ga0265316_10143833 | |||
| 3135 | Ga0265316_10173427 | |||
| 3136 | Ga0265316_10240214 | |||
| 3137 | Ga0307408_100089283 | |||
| 3138 | Ga0265313_10000865 | |||
| 3139 | Ga0307508_10196223 | |||
| 3140 | Ga0316575_10001077 | |||
| 3141 | Ga0316575_10011041 | |||
| 3142 | Ga0316575_10050339 | |||
| 3143 | Ga0316575_10165460 | |||
| 3144 | Ga0316579_10038435 | |||
| 3145 | Ga0316579_10091232 | |||
| 3146 | Ga0265314_10000258 | |||
| 3147 | Ga0265314_10060363 | |||
| 3148 | Ga0265314_10114059 | |||
| 3149 | Ga0265314_10161977 | |||
| 3150 | Ga0265314_10310288 | |||
| 3151 | Ga0265342_10001056 | |||
| 3152 | Ga0265342_10007754 | |||
| 3153 | Ga0265342_10035673 | |||
| 3154 | Ga0265342_10165782 | |||
| 3155 | Ga0265342_10238253 | |||
| 3156 | Ga0316576_10001112 | |||
| 3157 | Ga0316576_10033327 | |||
| 3158 | Ga0316576_10083745 | |||
| 3159 | Ga0316576_10099442 | |||
| 3160 | Ga0316576_10143290 | |||
| 3161 | Ga0316576_10248342 | |||
| 3162 | Ga0316578_10011768 | |||
| 3163 | Ga0316578_10044301 | |||
| 3164 | Ga0316578_10054356 | |||
| 3165 | Ga0316578_10129128 | |||
| 3166 | Ga0316578_10186846 | |||
| 3167 | Ga0316578_10230492 | |||
| 3168 | Ga0307405_10102765 | |||
| 3169 | Ga0316577_10008546 | |||
| 3170 | Ga0316577_10014688 | |||
| 3171 | Ga0316577_10020005 | |||
| 3172 | Ga0316577_10038969 | |||
| 3173 | Ga0307413_10157747 | |||
| 3174 | Ga0307413_10167609 | |||
| 3175 | Ga0307410_10147722 | |||
| 3176 | Ga0307410_10181137 | |||
| 3177 | Ga0307410_10222037 | |||
| 3178 | Ga0307410_10435769 | |||
| 3179 | Ga0307406_10031996 | |||
| 3180 | Ga0307406_10170919 | |||
| 3181 | Ga0307409_100109755 | |||
| 3182 | Ga0307409_100394241 | |||
| 3183 | Ga0307409_100395838 | |||
| 3184 | Ga0307416_100243039 | |||
| 3185 | Ga0307414_10008080 | |||
| 3186 | Ga0307414_10299504 | |||
| 3187 | Ga0307411_10120154 | |||
| 3188 | Ga0307411_10423843 | |||
| 3189 | Ga0307415_100033995 | |||
| 3190 | Ga0307415_100510014 | |||
| 3191 | Ga0316583_10007407 | |||
| 3192 | Ga0316585_10019994 | |||
| 3193 | Ga0316593_10005355 | |||
| 3194 | Ga0316593_10010568 | |||
| 3195 | Ga0316593_10013111 | |||
| 3196 | Ga0316593_10020510 | |||
| 3197 | Ga0316593_10057683 | |||
| 3198 | Ga0316593_10062211 | |||
| 3199 | Ga0316596_1011731 | |||
| 3200 | Ga0316596_1024299 | |||
| 3201 | Ga0373930_0011932 | |||
| 3202 | Ga0373941_0001589 | |||
| 3203 | Ga0373941_0037090 | |||
| 3204 | Ga0373945_0033785 | |||
| 3205 | Ga0373956_0387337 | |||
| 3206 | Ga0373943_0049967 | |||
| 3207 | Ga0373946_0093571 | |||
| 3208 | Ga0316574_0000439 | |||
| 3209 | Ga0316574_0017026 | |||
| 3210 | Ga0316574_0100775 | |||
| 3211 | Ga0373931_0040463 | |||
| 3212 | Ga0373931_0068199 | |||
| 3213 | Ga0373935_0037988 | |||
| 3214 | Ga0373935_0052142 | |||
| 3215 | Ga0373927_0044672 | |||
| 3216 | Ga0373937_0005450 | |||
| 3217 | Ga0373937_0047707 | |||
| 3218 | Ga0373937_0547774 | |||
| 3219 | Ga0316582_0020619 | |||
| 3220 | Ga0316582_0025596 | |||
| 3221 | Ga0316582_0053359 | |||
| 3222 | Ga0316582_0148054 | |||
| 3223 | Ga0316582_0318950 | |||
| 3224 | Ga0316582_0388358 | |||
| 3225 | Ga0316584_0001402 | |||
| 3226 | Ga0316584_0003289 | |||
| 3227 | Ga0316584_0003840 | |||
| 3228 | Ga0316584_0003883 | |||
| 3229 | Ga0316584_0011924 | |||
| 3230 | Ga0316584_0023348 | |||
| 3231 | Ga0316584_0023535 | |||
| 3232 | Ga0316584_0195144 | |||
| 3233 | Ga0316584_0562059 | |||
| 3234 | Ga0373925_0207428 | |||
| 3235 | Ga0373925_0222760 | |||
| 3236 | Ga0395899_0012908 | |||
| 3237 | Ga0395899_0070048 | |||
| 3238 | Ga0395899_0486162 | |||
| 3239 | Ga0395900_0025391 | |||
| 3240 | Ga0395900_0140129 | |||
| 3241 | Ga0395900_0181520 | |||
| 3242 | Ga0395900_0196989 | |||
| 3243 | Ga0395900_0415781 | |||
| 3244 | Ga0395900_0733914 | |||
| 3245 | Ga0395900_0836032 | |||
| 3246 | Ga0395898_0080689 | |||
| 3247 | Ga0395898_0125664 | |||
| 3248 | Ga0395898_0162225 | |||
| 3249 | Ga0395898_0193157 | |||
| 3250 | Ga0395898_0636552 | |||
| 3251 | Ga0395905_0000911 | |||
| 3252 | Ga0395905_0006827 | |||
| 3253 | Ga0395905_0008081 | |||
| 3254 | Ga0395905_0040992 | |||
| 3255 | Ga0395905_0052360 | |||
| 3256 | Ga0395905_0171218 | |||
| 3257 | Ga0395905_0227978 | |||
| 3258 | Ga0395905_0299862 | |||
| 3259 | Ga0395905_0316347 | |||
| 3260 | Ga0395905_0860694 | |||
| 3261 | Ga0316581_0004894 | |||
| 3262 | Ga0316581_0018084 | |||
| 3263 | Ga0436364_0003086 | |||
| 3264 | Ga0436364_0079644 | |||
| 3265 | Ga0436364_0207864 | |||
| 3266 | Ga0436364_0310410 | |||
| 3267 | Ga0436364_0374781 | |||
| 3268 | Ga0436364_0517934 | |||
| 3269 | Ga0436364_0545736 | |||
| 3270 | Ga0436364_0598581 | |||
| 3271 | Ga0436364_0635932 | |||
| 3272 | Ga0436364_0653298 | |||
| 3273 | Ga0436364_0935450 | |||
| 3274 | Ga0436364_1040205 | |||
| 3275 | Ga0436364_1113697 | |||
| 3276 | Ga0436364_1161322 | |||
| 3277 | Ga0436364_1291049 | |||
| 3278 | Ga0436364_1366309 | |||
| 3279 | Ga0395901_0006071 | |||
| 3280 | Ga0395901_0094751 | |||
| 3281 | Ga0395901_0109329 | |||
| 3282 | Ga0395901_0205365 | |||
| 3283 | Ga0395901_0695327 | |||
| 3284 | Ga0400484_42049 | |||
| 3285 | Ga0400490_04614 | |||
| 3286 | Ga0400490_13335 | |||
| 3287 | Ga0400486_07680 | |||
| 3288 | Ga0400483_195000 | |||
| 3289 | Ga0400483_278927 | |||
| 3290 | Ga0436365_0227260 | |||
| 3291 | Ga0436365_0283204 | |||
| 3292 | Ga0436365_0421852 | |||
| 3293 | Ga0436365_0426125 | |||
| 3294 | Ga0436365_0847170 | |||
| 3295 | Ga0436365_0935686 | |||
| 3296 | Ga0436365_0994234 | |||
| 3297 | Ga0436365_1114212 | |||
| 3298 | Ga0436365_1132500 | |||
| 3299 | Ga0436365_1397674 | |||
| 3300 | Ga0436365_1422517 | |||
| 3301 | Ga0436365_1595370 | |||
| 3302 | Ga0436365_1779432 | |||
| 3303 | Ga0436360_0295164 | |||
| 3304 | Ga0436360_0355578 | |||
| 3305 | Ga0436360_0413033 | |||
| 3306 | Ga0436360_0459232 | |||
| 3307 | Ga0436360_0587385 | |||
| 3308 | Ga0436361_0073402 | |||
| 3309 | Ga0436363_0096334 | |||
| 3310 | Ga0436363_0162148 | |||
| 3311 | Ga0436363_0171561 | |||
| 3312 | Ga0436363_0222055 | |||
| 3313 | Ga0436363_0516425 | |||
| 3314 | Ga0436363_0550052 | |||
| 3315 | Ga0436363_0849922 | |||
| 3316 | Ga0436362_0315526 | |||
| 3317 | Ga0436362_0605469 | |||
| 3318 | Ga0436362_0735076 | |||
| 3319 | Ga0436362_0764253 | |||
| 3320 | Ga0436362_0808991 | |||
| 3321 | Ga0439433_0080256 | |||
| 3322 | Ga0439448_0015703 | |||
| 3323 | Ga0439458_0072768 | |||
| 3324 | Ga0439458_0126685 | |||
| 3325 | Ga0439434_0082002 | |||
| 3326 | Ga0451577_0001956 | |||
| 3327 | Ga0451577_0121152 | |||
| 3328 | Ga0451577_0175909 | |||
| 3329 | Ga0451577_0446006 | |||
| 3330 | Ga0451577_0710005 | |||
| 3331 | Ga0451577_0737711 | |||
| 3332 | Ga0466969_0006535 | |||
| 3333 | Ga0466972_0086629 | |||
| 3334 | Ga0453683_0000118 | |||
| 3335 | Ga0453683_0000280 | |||
| 3336 | Ga0453683_0000891 | |||
| 3337 | Ga0453683_0001047 | |||
| 3338 | Ga0453683_0005938 | |||
| 3339 | Ga0453683_0027559 | |||
| 3340 | Ga0453683_0075393 | |||
| 3341 | Ga0453683_0150042 | |||
| 3342 | Ga0453683_0256609 | |||
| 3343 | Ga0466966_0007455 | |||
| 3344 | Ga0466963_0075224 | |||
| 3345 | Ga0453684_0000829 | |||
| 3346 | Ga0453684_0005096 | |||
| 3347 | Ga0453684_0022082 | |||
| 3348 | Ga0453684_0028475 | |||
| 3349 | Ga0453684_0050873 | |||
| 3350 | Ga0453684_0052888 | |||
| 3351 | Ga0453684_0064823 | |||
| 3352 | Ga0453684_0073587 | |||
| 3353 | Ga0453684_0080822 | |||
| 3354 | Ga0453684_0084451 | |||
| 3355 | Ga0453684_0178157 | |||
| 3356 | Ga0453684_0196101 | |||
| 3357 | Ga0453684_0231434 | |||
| 3358 | Ga0453684_0291175 | |||
| 3359 | Ga0453684_0360342 | |||
| 3360 | Ga0453684_0523887 | |||
| 3361 | Ga0466971_0010408 | |||
| 3362 | Ga0466968_0211427 | |||
| 3363 | Ga0466970_0237370 | |||
| 3364 | Ga0466957_0001594 | |||
| 3365 | Ga0466957_0178423 | |||
| 3366 | Ga0466959_0007114 | |||
| 3367 | Ga0466959_0015161 | |||
| 3368 | Ga0451576_0000001 | |||
| 3369 | Ga0451576_0000019 | |||
| 3370 | Ga0451576_0000213 | |||
| 3371 | Ga0451576_0001202 | |||
| 3372 | Ga0451576_0012429 | |||
| 3373 | Ga0451576_0016088 | |||
| 3374 | Ga0451576_0024883 | |||
| 3375 | Ga0451576_0036606 | |||
| 3376 | Ga0451576_0094400 | |||
| 3377 | Ga0451576_0170485 | |||
| 3378 | Ga0451576_0775981 | |||
| 3379 | Ga0451576_0875787 | |||
| 3380 | Ga0451576_1066620 | |||
| 3381 | Ga0466958_0004041 | |||
| 3382 | Ga0466958_0010957 | |||
| 3383 | Ga0466967_0061444 | |||
| 3384 | Ga0466967_0353804 | |||
| 3385 | Ga0495627_000443 | |||
| 3386 | Ga0495592_0044537 | |||
| 3387 | Ga0495603_0047372 | |||
| 3388 | Ga0495629_0235070 | |||
| 3389 | Ga0495580_0193675 | |||
| 3390 | Ga0495662_0193291 | |||
| 3391 | Ga0495584_0011661 | |||
| 3392 | Ga0495583_0000020 | |||
| 3393 | Ga0495606_0037111 | |||
| 3394 | Ga0495608_0027558 | |||
| 3395 | Ga0495610_0040933 | |||
| 3396 | Ga0495618_0202566 | |||
| 3397 | Ga0495628_0288816 | |||
| 3398 | Ga0495630_0560077 | |||
| 3399 | Ga0495632_0015594 | |||
| 3400 | Ga0495643_0080866 | |||
| 3401 | Ga0495648_0101400 | |||
| 3402 | Ga0495640_0400802 | |||
| 3403 | Ga0495598_0007838 | |||
| 3404 | Ga0495621_0005527 | |||
| 3405 | Ga0495597_0048524 | |||
| 3406 | Ga0495645_0200046 | |||
| 3407 | Ga0495622_0002426 | |||
| 3408 | Ga0495633_0152475 | |||
| 3409 | Ga0495668_0209532 | |||
| 3410 | Ga0495625_0026301 | |||
| 3411 | Ga0495625_0403083 | |||
| 3412 | Ga0495599_0259220 | |||
| 3413 | Ga0495658_0429262 | |||
| 3414 | Ga0495669_0030631 | |||
| 3415 | Ga0495669_0158264 | |||
| 3416 | Ga0495670_0000265 | |||
| 3417 | Ga0495604_0187267 | |||
| 3418 | Ga0495636_0111664 | |||
| 3419 | Ga0495672_0071022 | |||
| 3420 | Ga0495683_0053018 | |||
| 3421 | Ga0495681_0011264 | |||
| 3422 | Ga0495684_0144711 | |||
| 3423 | Ga0495686_0170494 | |||
| 3424 | Ga0495593_0041920 | |||
| 3425 | Ga0495593_0066861 | |||
| 3426 | Ga0495602_0014256 | |||
| 3427 | Ga0496100_0039379 | |||
| 3428 | Ga0496100_0064222 | |||
| 3429 | Ga0496100_0136829 | |||
| 3430 | Ga0496100_0142886 | |||
| 3431 | Ga0496101_0005585 | |||
| 3432 | Ga0496101_0016841 | |||
| 3433 | Ga0496101_0113614 | |||
| 3434 | Ga0496101_0138124 | |||
| 3435 | Ga0496102_0002747 | |||
| 3436 | Ga0496102_0005255 | |||
| 3437 | Ga0496102_0033196 | |||
| 3438 | Ga0496102_0131609 | |||
| 3439 | Ga0496102_0260303 | |||
| 3440 | Ga0496102_0331589 | |||
| 3441 | Ga0496103_0002057 | |||
| 3442 | Ga0496103_0020842 | |||
| 3443 | Ga0496103_0027204 | |||
| 3444 | Ga0496104_0010951 | |||
| 3445 | Ga0496104_0017799 | |||
| 3446 | Ga0496104_0094192 | |||
| 3447 | Ga0496104_0149079 | |||
| 3448 | Ga0496104_0306260 | |||
| 3449 | Ga0496104_0351283 | |||
| 3450 | Ga0496104_0890781 | |||
| 3451 | Ga0496105_0008864 | |||
| 3452 | Ga0496105_0044390 | |||
| 3453 | Ga0496105_0172825 | |||
| 3454 | Ga0496105_0268040 | |||
| 3455 | Ga0496106_0004676 | |||
| 3456 | Ga0496106_0005250 | |||
| 3457 | Ga0496106_0020957 | |||
| 3458 | Ga0496106_0069286 | |||
| 3459 | Ga0496106_0133009 | |||
| 3460 | Ga0496106_0177142 | |||
| 3461 | Ga0496107_0001506 | |||
| 3462 | Ga0496107_0006946 | |||
| 3463 | Ga0496107_0055141 | |||
| 3464 | Ga0496107_0062331 | |||
| 3465 | Ga0496107_0128403 | |||
| 3466 | Ga0496107_0236291 | |||
| 3467 | Ga0496108_0013562 | |||
| 3468 | Ga0496108_0032831 | |||
| 3469 | Ga0496108_0037537 | |||
| 3470 | Ga0496108_0076730 | |||
| 3471 | Ga0496108_0098113 | |||
| 3472 | Ga0496108_0299570 | |||
| 3473 | Ga0496109_0006013 | |||
| 3474 | Ga0496109_0020848 | |||
| 3475 | Ga0496109_0027322 | |||
| 3476 | Ga0496109_0116835 | |||
| 3477 | Ga0496109_0151170 | |||
| 3478 | Ga0496109_0164906 | |||
| 3479 | Ga0496109_0533397 | |||
| 3480 | Ga0496110_0042694 | |||
| 3481 | Ga0496110_0087569 | |||
| 3482 | Ga0496110_0116341 | |||
| 3483 | Ga0496110_0168117 | |||
| 3484 | Ga0496110_0638853 | |||
| 3485 | Ga0496111_0000242 | |||
| 3486 | Ga0496111_0028631 | |||
| 3487 | Ga0496112_0001235 | |||
| 3488 | Ga0496112_0025166 | |||
| 3489 | Ga0496112_0031568 | |||
| 3490 | Ga0496112_0031888 | |||
| 3491 | Ga0496112_0332913 | |||
| 3492 | Ga0496112_0456462 | |||
| 3493 | Ga0496112_0583431 | |||
| 3494 | Ga0496113_0287318 | |||
| 3495 | Ga0496114_0036337 | |||
| 3496 | Ga0496114_0173980 | |||
| 3497 | Ga0496114_0205853 | |||
| 3498 | Ga0496114_0303375 | |||
| 3499 | Ga0496115_0052518 | |||
| 3500 | Ga0496115_0087400 | |||
| 3501 | Ga0496117_0003941 | |||
| 3502 | Ga0496118_0002145 | |||
| 3503 | Ga0496118_0084428 | |||
| 3504 | Ga0496119_0003925 | |||
| 3505 | Ga0496119_0020238 | |||
| 3506 | Ga0496119_0080829 | |||
| 3507 | Ga0496119_0103005 | |||
| 3508 | Ga0496119_0105036 | |||
| 3509 | Ga0496119_0199427 | |||
| 3510 | Ga0496120_0008156 | |||
| 3511 | Ga0496120_0102441 | |||
| 3512 | Ga0496121_0000009 | |||
| 3513 | Ga0496121_0000751 | |||
| 3514 | Ga0496121_0065751 | |||
| 3515 | Ga0496121_0269258 | |||
| 3516 | Ga0496122_0000025 | |||
| 3517 | Ga0496122_0034633 | |||
| 3518 | Ga0496122_0098694 | |||
| 3519 | Ga0496123_0000054 | |||
| 3520 | Ga0496123_0030694 | |||
| 3521 | Ga0496124_0036426 | |||
| 3522 | Ga0496124_0048353 | |||
| 3523 | Ga0496124_0080967 | |||
| 3524 | Ga0496125_0043147 | |||
| 3525 | Ga0496125_0047369 | |||
| 3526 | Ga0496125_0188098 | |||
| 3527 | Ga0496126_0073247 | |||
| 3528 | Ga0496126_0201568 | |||
| 3529 | Ga0501293_007669 | |||
| 3530 | Ga0501296_002969 | |||
| 3531 | Ga0501297_011866 | |||
| 3532 | Ga0501298_005636 | |||
| 3533 | Ga0501299_002465 | |||
| 3534 | Ga0501031_0005703 | |||
| 3535 | Ga0501031_0049069 | |||
| 3536 | Ga0501031_0103948 | |||
| 3537 | Ga0501031_0261108 | |||
| 3538 | Ga0501031_0262297 | |||
| 3539 | Ga0501032_0000064 | |||
| 3540 | Ga0501032_0001600 | |||
| 3541 | Ga0501032_0025086 | |||
| 3542 | Ga0501032_0031757 | |||
| 3543 | Ga0501032_0032937 | |||
| 3544 | Ga0501032_0068479 | |||
| 3545 | Ga0501032_0235317 | |||
| 3546 | Ga0501032_0489339 | |||
| 3547 | Ga0501033_0000286 | |||
| 3548 | Ga0501033_0002532 | |||
| 3549 | Ga0501033_0016268 | |||
| 3550 | Ga0501033_0020977 | |||
| 3551 | Ga0501033_0045254 | |||
| 3552 | Ga0501033_0088657 | |||
| 3553 | Ga0501033_0093339 | |||
| 3554 | Ga0501033_0116907 | |||
| 3555 | Ga0501033_0143786 | |||
| 3556 | Ga0501033_0192474 | |||
| 3557 | Ga0501033_0206863 | |||
| 3558 | Ga0501034_0000097 | |||
| 3559 | Ga0501034_0000174 | |||
| 3560 | Ga0501034_0002221 | |||
| 3561 | Ga0501034_0002380 | |||
| 3562 | Ga0501034_0022346 | |||
| 3563 | Ga0501034_0024404 | |||
| 3564 | Ga0501034_0076402 | |||
| 3565 | Ga0501034_0083319 | |||
| 3566 | Ga0501034_0107639 | |||
| 3567 | Ga0501034_0120131 | |||
| 3568 | Ga0501034_0134238 | |||
| 3569 | Ga0501034_0220435 | |||
| 3570 | Ga0501034_0233815 | |||
| 3571 | Ga0501034_0243812 | |||
| 3572 | Ga0501034_0254534 | |||
| 3573 | Ga0501034_0270112 | |||
| 3574 | Ga0501034_0592451 | |||
| 3575 | Ga0501034_0610149 | |||
| 3576 | Ga0501034_0668045 | |||
| 3577 | Ga0501036_0004998 | |||
| 3578 | Ga0501036_0054187 | |||
| 3579 | Ga0501036_0077234 | |||
| 3580 | Ga0501036_0182860 | |||
| 3581 | Ga0501036_0298455 | |||
| 3582 | Ga0501036_0488418 | |||
| 3583 | Ga0501036_0820233 | |||
| 3584 | Ga0501037_0000118 | |||
| 3585 | Ga0501037_0006091 | |||
| 3586 | Ga0501037_0053085 | |||
| 3587 | Ga0501037_0136640 | |||
| 3588 | Ga0501037_0155025 | |||
| 3589 | Ga0501037_0204238 | |||
| 3590 | Ga0501037_0483499 | |||
| 3591 | Ga0501038_0000031 | |||
| 3592 | Ga0501038_0003995 | |||
| 3593 | Ga0501038_0007946 | |||
| 3594 | Ga0501038_0028402 | |||
| 3595 | Ga0501038_0041630 | |||
| 3596 | Ga0501038_0041926 | |||
| 3597 | Ga0501038_0157169 | |||
| 3598 | Ga0501038_0165500 | |||
| 3599 | Ga0501038_0316604 | |||
| 3600 | Ga0501038_0498346 | |||
| 3601 | Ga0501039_0000057 | |||
| 3602 | Ga0501039_0017563 | |||
| 3603 | Ga0501039_0041392 | |||
| 3604 | Ga0501039_0047324 | |||
| 3605 | Ga0501039_0216886 | |||
| 3606 | Ga0501040_0001144 | |||
| 3607 | Ga0501040_0189556 | |||
| 3608 | Ga0501041_0042622 | |||
| 3609 | Ga0501043_0000048 | |||
| 3610 | Ga0501043_0054965 | |||
| 3611 | Ga0501043_0072840 | |||
| 3612 | Ga0501043_0103181 | |||
| 3613 | Ga0501043_0133472 | |||
| 3614 | Ga0501043_0156188 | |||
| 3615 | Ga0501043_0164505 | |||
| 3616 | Ga0501043_0238183 | |||
| 3617 | Ga0501043_0569552 | |||
| 3618 | Ga0501046_0010968 | |||
| 3619 | Ga0501046_0014309 | |||
| 3620 | Ga0501046_0026372 | |||
| 3621 | Ga0501046_0051871 | |||
| 3622 | Ga0501046_0204766 | |||
| 3623 | Ga0501046_0338445 | |||
| 3624 | Ga0501046_0368610 | |||
| 3625 | Ga0501046_0401988 | |||
| 3626 | Ga0501047_0003748 | |||
| 3627 | Ga0501047_0008494 | |||
| 3628 | Ga0501047_0048076 | |||
| 3629 | Ga0501047_0054470 | |||
| 3630 | Ga0501047_0062229 | |||
| 3631 | Ga0501047_0069524 | |||
| 3632 | Ga0501047_0152583 | |||
| 3633 | Ga0501047_0186826 | |||
| 3634 | Ga0501047_0252256 | |||
| 3635 | Ga0501047_0317678 | |||
| 3636 | Ga0501047_0442731 | |||
| 3637 | Ga0501047_0458236 | |||
| 3638 | Ga0501047_0478199 | |||
| 3639 | Ga0501047_0514213 | |||
| 3640 | Ga0501047_0591718 | |||
| 3641 | Ga0501048_0030793 | |||
| 3642 | Ga0501048_0057459 | |||
| 3643 | Ga0501048_0125816 | |||
| 3644 | Ga0501048_0186831 | |||
| 3645 | Ga0501067_0027568 | |||
| 3646 | Ga0501067_0051142 | |||
| 3647 | Ga0501067_0097648 | |||
| 3648 | Ga0501067_0121329 | |||
| 3649 | Ga0501067_0189576 | |||
| 3650 | Ga0501067_0242958 | |||
| 3651 | Ga0501067_0351840 | |||
| 3652 | Ga0501068_0035832 | |||
| 3653 | Ga0501068_0065095 | |||
| 3654 | Ga0501068_0085297 | |||
| 3655 | Ga0501068_0095279 | |||
| 3656 | Ga0501068_0294420 | |||
| 3657 | Ga0501069_0020534 | |||
| 3658 | Ga0501069_0047390 | |||
| 3659 | Ga0501069_0248398 | |||
| 3660 | Ga0501070_0029009 | |||
| 3661 | Ga0501070_0029317 | |||
| 3662 | Ga0501070_0039424 | |||
| 3663 | Ga0501070_0051500 | |||
| 3664 | Ga0501070_0052146 | |||
| 3665 | Ga0501070_0087469 | |||
| 3666 | Ga0501070_0318144 | |||
| 3667 | Ga0501071_0032763 | |||
| 3668 | Ga0501071_0039321 | |||
| 3669 | Ga0501071_0181489 | |||
| 3670 | Ga0501071_0222043 | |||
| 3671 | Ga0501072_0109972 | |||
| 3672 | Ga0501072_0110278 | |||
| 3673 | Ga0501072_0308239 | |||
| 3674 | Ga0501072_0496817 | |||
| 3675 | Ga0501072_0582490 | |||
| 3676 | Ga0501073_0014781 | |||
| 3677 | Ga0501073_0020495 | |||
| 3678 | Ga0501073_0089425 | |||
| 3679 | Ga0501073_0090002 | |||
| 3680 | Ga0501073_0108511 | |||
| 3681 | Ga0501073_0458198 | |||
| 3682 | Ga0501073_0531311 | |||
| 3683 | Ga0501074_0013095 | |||
| 3684 | Ga0501074_0023939 | |||
| 3685 | Ga0501074_0024895 | |||
| 3686 | Ga0501074_0057774 | |||
| 3687 | Ga0501074_0081104 | |||
| 3688 | Ga0501075_0005167 | |||
| 3689 | Ga0501075_0028092 | |||
| 3690 | Ga0501076_0006377 | |||
| 3691 | Ga0501076_0191194 | |||
| 3692 | Ga0501076_0321462 | |||
| 3693 | Ga0501077_0009579 | |||
| 3694 | Ga0501077_0098052 | |||
| 3695 | Ga0501202_023766 | |||
| 3696 | Ga0501202_039277 | |||
| 3697 | Ga0501217_081826 | |||
| 3698 | Ga0501223_001670 | |||
| 3699 | Ga0501233_006769 | |||
| 3700 | Ga0501235_003437 | |||
| 3701 | Ga0501235_016642 | |||
| 3702 | Ga0501249_042551 | |||
| 3703 | Ga0501255_020100 | |||
| 3704 | Ga0501261_013782 | |||
| 3705 | Ga0501225_0001550 | |||
| 3706 | Ga0501225_0044761 | |||
| 3707 | Ga0501234_002639 | |||
| 3708 | Ga0501079_0007423 | |||
| 3709 | Ga0501079_0035953 | |||
| 3710 | Ga0501079_0059738 | |||
| 3711 | Ga0501079_0201938 | |||
| 3712 | Ga0501079_0244124 | |||
| 3713 | Ga0501079_0410660 | |||
| 3714 | Ga0501080_0008721 | |||
| 3715 | Ga0501080_0009091 | |||
| 3716 | Ga0501080_0009451 | |||
| 3717 | Ga0501080_0051261 | |||
| 3718 | Ga0501080_0069725 | |||
| 3719 | Ga0501080_0115442 | |||
| 3720 | Ga0501080_0127479 | |||
| 3721 | Ga0501080_0156121 | |||
| 3722 | Ga0501080_0284471 | |||
| 3723 | Ga0501081_0001736 | |||
| 3724 | Ga0501081_0023556 | |||
| 3725 | Ga0501081_0149491 | |||
| 3726 | Ga0501083_0044651 | |||
| 3727 | Ga0501083_0049244 | |||
| 3728 | Ga0501083_0063763 | |||
| 3729 | Ga0501083_0243283 | |||
| 3730 | Ga0501083_0288918 | |||
| 3731 | Ga0501083_0429998 | |||
| 3732 | Ga0501270_007195 | |||
| 3733 | Ga0501283_000325 | |||
| 3734 | Ga0501035_0000118 | |||
| 3735 | Ga0501035_0003976 | |||
| 3736 | Ga0501035_0030120 | |||
| 3737 | Ga0501035_0059706 | |||
| 3738 | Ga0501035_0083249 | |||
| 3739 | Ga0501035_0096309 | |||
| 3740 | Ga0501035_0105131 | |||
| 3741 | Ga0501035_0290401 | |||
| 3742 | Ga0501035_0344252 | |||
| 3743 | Ga0501044_0000504 | |||
| 3744 | Ga0501044_0021869 | |||
| 3745 | Ga0501044_0056387 | |||
| 3746 | Ga0501044_0076395 | |||
| 3747 | Ga0501044_0079183 | |||
| 3748 | Ga0501044_0103067 | |||
| 3749 | Ga0501044_0165513 | |||
| 3750 | Ga0501044_0172041 | |||
| 3751 | Ga0501044_0213873 | |||
| 3752 | Ga0501044_0235427 | |||
| 3753 | Ga0501044_0265553 | |||
| 3754 | Ga0501044_0299120 | |||
| 3755 | Ga0501044_0318935 | |||
| 3756 | Ga0501044_0441433 | |||
| 3757 | Ga0501044_0589506 | |||
| 3758 | Ga0501045_0004800 | |||
| 3759 | Ga0501045_0473744 | |||
| 3760 | Ga0501226_005037 | |||
| 3761 | nmdc:mga03n38_226150_c1 | |||
| 3762 | nmdc:mga03n38_35806_c1 | |||
| 3763 | nmdc:mga00v17_276191_c1 | |||
| 3764 | nmdc:mga0yw44_18283_c1 | |||
| 3765 | nmdc:mga0yw44_21084_c1 | |||
| 3766 | nmdc:mga0yw44_398199_c1 | |||
| 3767 | nmdc:mga06z11_27303_c1 | |||
| 3768 | nmdc:mga04h51_19968_c1 | |||
| 3769 | nmdc:mga07m45_12880_c1 | |||
| 3770 | nmdc:mga07m45_20065_c1 | |||
| 3771 | nmdc:mga05p37_115286_c1 | |||
| 3772 | nmdc:mga05p37_1172521_c1 | |||
| 3773 | nmdc:mga05p37_285757_c1 | |||
| 3774 | nmdc:mga05p37_300144_c1 | |||
| 3775 | nmdc:mga05p37_31141_c1 | |||
| 3776 | nmdc:mga05p37_317055_c1 | |||
| 3777 | nmdc:mga05p37_329514_c1 | |||
| 3778 | nmdc:mga05p37_486728_c1 | |||
| 3779 | nmdc:mga05p37_734563_c1 | |||
| 3780 | nmdc:mga09592_23768_c1 | |||
| 3781 | nmdc:mga0qj67_72848_c1 | |||
| 3782 | nmdc:mga06r32_12560_c1 | |||
| 3783 | nmdc:mga06r32_433336_c1 | |||
| 3784 | nmdc:mga06r32_976_c1 | |||
| 3785 | nmdc:mga08y16_1009107_c1 | |||
| 3786 | nmdc:mga08y16_226482_c1 | |||
| 3787 | nmdc:mga08y16_278776_c1 | |||
| 3788 | nmdc:mga08y16_292919_c1 | |||
| 3789 | nmdc:mga08y16_72419_c1 | |||
| 3790 | nmdc:mga08y16_75051_c1 | |||
| 3791 | nmdc:mga08y16_86150_c1 | |||
| 3792 | nmdc:mga0n895_129906_c1 | |||
| 3793 | nmdc:mga0n895_141334_c1 | |||
| 3794 | nmdc:mga0n895_226829_c1 | |||
| 3795 | nmdc:mga0n895_240226_c1 | |||
| 3796 | nmdc:mga0n895_2522_c1 | |||
| 3797 | nmdc:mga0n895_594604_c1 | |||
| 3798 | nmdc:mga0n895_89055_c1 | |||
| 3799 | nmdc:mga0rr50_10031_c1 | |||
| 3800 | nmdc:mga0rr50_137562_c1 | |||
| 3801 | nmdc:mga0rr50_169_c1 | |||
| 3802 | nmdc:mga08x19_26_c1 | |||
| 3803 | nmdc:mga0a205_132190_c1 | |||
| 3804 | nmdc:mga0a205_289709_c1 | |||
| 3805 | nmdc:mga0a205_323773_c1 | |||
| 3806 | nmdc:mga0a205_347774_c1 | |||
| 3807 | nmdc:mga0a205_460169_c1 | |||
| 3808 | nmdc:mga0a205_72336_c1 | |||
| 3809 | nmdc:mga0a205_84763_c1 | |||
| 3810 | Ga0495601_0000235 | |||
| 3811 | Ga0500610_0168365 | |||
| 3812 | Ga0500635_0000302 | |||
| 3813 | Ga0500635_0001280 | |||
| 3814 | Ga0495655_0011188 | |||
| 3815 | Ga0495595_0017221 | |||
| 3816 | Ga0495619_0035488 | |||
| 3817 | Ga0495619_0117877 | |||
| 3818 | Ga0495619_0351034 | |||
| 3819 | Ga0500578_0140706 | |||
| 3820 | Ga0500647_0026024 | |||
| 3821 | Ga0500651_0016713 | |||
| 3822 | Ga0500566_0041234 | |||
| 3823 | Ga0500641_0003377 | |||
| 3824 | Ga0500641_0005166 | |||
| 3825 | Ga0500562_003232 | |||
| 3826 | Ga0500593_000013 | |||
| 3827 | Ga0500595_006840 | |||
| 3828 | Ga0500608_000573 | |||
| 3829 | Ga0500614_001562 | |||
| 3830 | Ga0500618_002996 | |||
| 3831 | Ga0500618_003083 | |||
| 3832 | Ga0500618_036011 | |||
| 3833 | Ga0500655_015690 | |||
| 3834 | Ga0500559_0084876 | |||
| 3835 | Ga0500559_0182351 | |||
| 3836 | Ga0500564_158915 | |||
| 3837 | Ga0500573_0000008 | |||
| 3838 | Ga0500573_0077380 | |||
| 3839 | Ga0500577_0006420 | |||
| 3840 | Ga0500577_0025434 | |||
| 3841 | Ga0500616_0000250 | |||
| 3842 | Ga0500616_0000797 | |||
| 3843 | Ga0500616_0004513 | |||
| 3844 | Ga0500616_0032743 | |||
| 3845 | Ga0500620_000225 | |||
| 3846 | Ga0500620_107336 | |||
| 3847 | Ga0500622_0037248 | |||
| 3848 | Ga0500627_0095586 | |||
| 3849 | Ga0500638_166041 | |||
| 3850 | Ga0500639_040789 | |||
| 3851 | Ga0500636_0010526 | |||
| 3852 | Ga0500637_0010845 | |||
| 3853 | Ga0500637_0187572 | |||
| 3854 | Ga0500625_088391 | |||
| 3855 | Ga0500645_022384 | |||
| 3856 | Ga0500645_069379 | |||
| 3857 | Ga0500596_003174 | |||
| 3858 | Ga0501084_0000137 | |||
| 3859 | Ga0501084_0001317 | |||
| 3860 | Ga0501084_0016901 | |||
| 3861 | Ga0501084_0023706 | |||
| 3862 | Ga0501084_0036990 | |||
| 3863 | Ga0501084_0061753 | |||
| 3864 | Ga0501084_0226380 | |||
| 3865 | Ga0501084_0240168 | |||
| 3866 | Ga0501084_0425019 | |||
| 3867 | Ga0501084_0514318 | |||
| 3868 | Ga0501082_0004024 | |||
| 3869 | Ga0501082_0006081 | |||
| 3870 | Ga0501082_0015392 | |||
| 3871 | Ga0501082_0100996 | |||
| 3872 | Ga0501082_0388232 | |||
| 3873 | Ga0501082_0721415 | |||
| 3874 | Ga0466962_0005568 | |||
| 3875 | Ga0466962_0005965 | |||
| 3876 | Ga0466962_0063868 | |||
| 3877 | Ga0530510_0003542 | |||
| 3878 | Ga0530510_0007842 | |||
| 3879 | 2503202330 | |||
| 3880 | 2509370432 | |||
| 3881 | 2510317396 | |||
| 3882 | 2512930770 | |||
| 3883 | 2512958499 | |||
| 3884 | 2513609818 | |||
| 3885 | 2514035088 | |||
| 3886 | 2523107326 | |||
| 3887 | 2524536916 | |||
| 3888 | 2538427084 | |||
| 3889 | 2561468298 | |||
| 3890 | 2588516432 | |||
| 3891 | 2599720883 | |||
| 3892 | 2599940040 | |||
| 3893 | 2643775671 | |||
| 3894 | 2643794118 | |||
| 3895 | 2643988106 | |||
| 3896 | 2644155281 | |||
| 3897 | 2673167664 | |||
| 3898 | 2688070184 | |||
| 3899 | 2688599312 | |||
| 3900 | 2692316460 | |||
| 3901 | 2694632106 | |||
| 3902 | 2694634487 | |||
| 3903 | 2707100829 | |||
| 3904 | 2715500121 | |||
| 3905 | 2756675784 | |||
| 3906 | 2792581223 | |||
| 3907 | 2792623229 | |||
| 3908 | 2792626993 | |||
| 3909 | 2792745993 | |||
| 3910 | 2793281495 | |||
| 3911 | 2819688596 | |||
| 3912 | 2821127798 | |||
| 3913 | 2828309680 | |||
| 3914 | 2834578651 | |||
| 3915 | 2838738222 | |||
| 3916 | 2841841408 | |||
| 3917 | 2841859422 | |||
| 3918 | 2842141186 | |||
| 3919 | 2842516206 | |||
| 3920 | 2844006554 | |||
| 3921 | 2844014595 | |||
| 3922 | 2847418474 | |||
| 3923 | 2847670720 | |||
| 3924 | 2847693055 | |||
| 3925 | 2848993452 | |||
| 3926 | 2852104164 | |||
| 3927 | 2854604223 | |||
| 3928 | 2855199189 | |||
| 3929 | 2855873363 | |||
| 3930 | 2856316176 | |||
| 3931 | 2856325988 | |||
| 3932 | 2856330435 | |||
| 3933 | 2856340521 | |||
| 3934 | 2856368938 | |||
| 3935 | 2857349514 | |||
| 3936 | 2857370737 | |||
| 3937 | 2857534461 | |||
| 3938 | 2857732589 | |||
| 3939 | 2858468106 | |||
| 3940 | 2869170140 | |||
| 3941 | 2869239750 | |||
| 3942 | 2869248441 | |||
| 3943 | 2869250070 | |||
| 3944 | 2869258256 | |||
| 3945 | 2869270969 | |||
| 3946 | 2869272585 | |||
| 3947 | 2869278745 | |||
| 3948 | 2869291457 | |||
| 3949 | 2871276570 | |||
| 3950 | 2871284836 | |||
| 3951 | 2871433737 | |||
| 3952 | 2871442259 | |||
| 3953 | 2871455440 | |||
| 3954 | 2871461625 | |||
| 3955 | 2871484452 | |||
| 3956 | 2871500638 | |||
| 3957 | 2874103493 | |||
| 3958 | 2874116192 | |||
| 3959 | 2874117189 | |||
| 3960 | 2874133731 | |||
| 3961 | 2874145330 | |||
| 3962 | 2874153314 | |||
| 3963 | 2874160579 | |||
| 3964 | 2874165777 | |||
| 3965 | 2874176346 | |||
| 3966 | 2876365559 | |||
| 3967 | 2876384962 | |||
| 3968 | 2876391333 | |||
| 3969 | 2876395080 | |||
| 3970 | 2876403161 | |||
| 3971 | 2876412434 | |||
| 3972 | 2876419605 | |||
| 3973 | 2876425387 | |||
| 3974 | 2878041500 | |||
| 3975 | 2878737053 | |||
| 3976 | 2878743578 | |||
| 3977 | 2878751348 | |||
| 3978 | 2878764727 | |||
| 3979 | 2878771828 | |||
| 3980 | 2878778322 | |||
| 3981 | 2878787922 | |||
| 3982 | 2881152749 | |||
| 3983 | 2881168447 | |||
| 3984 | 2884965065 | |||
| 3985 | 2885310422 | |||
| 3986 | 2885331659 | |||
| 3987 | 2885338486 | |||
| 3988 | 2888340263 | |||
| 3989 | 2888356690 | |||
| 3990 | 2889011566 | |||
| 3991 | 2889023328 | |||
| 3992 | 2889420872 | |||
| 3993 | 2894818949 | |||
| 3994 | 2900055063 | |||
| 3995 | 2903455725 | |||
| 3996 | 2903501864 | |||
| 3997 | 2903517899 | |||
| 3998 | 2903522915 | |||
| 3999 | 2903533105 | |||
| 4000 | 2903545451 | |||
| 4001 | 2904509211 | |||
| 4002 | 2904661711 | |||
| 4003 | 2906313265 | |||
| 4004 | 2906325976 | |||
| 4005 | 2906335164 | |||
| 4006 | 2906368027 | |||
| 4007 | 2906375860 | |||
| 4008 | 2906379095 | |||
| 4009 | 2906389644 | |||
| 4010 | 2906397538 | |||
| 4011 | 2906405968 | |||
| 4012 | 2906412756 | |||
| 4013 | 2906416313 | |||
| 4014 | 2908743378 | |||
| 4015 | 2917557072 | |||
| 4016 | 2919680938 | |||
| 4017 | 2920110133 | |||
| 4018 | 2922137271 | |||
| 4019 | 2922153453 | |||
| 4020 | 2922164208 | |||
| 4021 | 2922174153 | |||
| 4022 | 2922182209 | |||
| 4023 | 2922186504 | |||
| 4024 | 2924713233 | |||
| 4025 | 2924726342 | |||
| 4026 | 2924728209 | |||
| 4027 | 2924735925 | |||
| 4028 | 2924746576 | |||
| 4029 | 2924768866 | |||
| 4030 | 2924781390 | |||
| 4031 | 2928122931 | |||
| 4032 | 2935633614 | |||
| 4033 | 2937820585 | |||
| 4034 | 2937827171 | |||
| 4035 | 2937853856 | |||
| 4036 | 2937864342 | |||
| 4037 | 2937879101 | |||
| 4038 | 2937898304 | |||
| 4039 | 2937975153 | |||
| 4040 | 2937985267 | |||
| 4041 | 2937999301 | |||
| 4042 | 2958034861 | |||
| 4043 | 2958043010 | |||
| 4044 | 2958067105 | |||
| 4045 | 2958086275 | |||
| 4046 | 2958104572 | |||
| 4047 | 2958109233 | |||
| 4048 | 2958122358 | |||
| 4049 | 2958129193 | |||
| 4050 | 2958135856 | |||
| 4051 | 2958151130 | |||
| 4052 | 2958161519 | |||
| 4053 | 2958169775 | |||
| 4054 | 2958177564 | |||
| 4055 | 2958185323 | |||
| 4056 | 2961083590 | |||
| 4057 | 2961116864 | |||
| 4058 | 2961143907 | |||
| 4059 | 2961168235 | |||
| 4060 | 2961187387 | |||
| 4061 | 2963648456 | |||
| 4062 | 2965023054 | |||
| 4063 | 2965029412 | |||
| 4064 | 2965036658 | |||
| 4065 | 2965045426 | |||
| 4066 | 2965051761 | |||
| 4067 | 2965068400 | |||
| 4068 | 2965122262 | |||
| 4069 | 2968017730 | |||
| 4070 | 2968084970 | |||
| 4071 | 2968091901 | |||
| 4072 | 2968099405 | |||
| 4073 | 2968112771 | |||
| 4074 | 2968122993 | |||
| 4075 | 2968129962 | |||
| 4076 | 2968140158 | |||
| 4077 | 2968176635 | |||
| 4078 | 2970472095 | |||
| 4079 | 2970495933 | |||
| 4080 | 2970516441 | |||
| 4081 | 2970535548 | |||
| 4082 | 2970548212 | |||
| 4083 | 2970559574 | |||
| 4084 | 2970593341 | |||
| 4085 | 2970624037 | |||
| 4086 | 2970633962 | |||
| 4087 | 2977848883 | |||
| 4088 | 2977851986 | |||
| 4089 | 2977861855 | |||
| 4090 | 2977867554 | |||
| 4091 | 2977877940 | |||
| 4092 | 2977906076 | |||
| 4093 | 2977917864 | |||
| 4094 | 2977928986 | |||
| 4095 | 2977941519 | |||
| 4096 | 2977947047 | |||
| 4097 | 2977957422 | |||
| 4098 | 2977958780 | |||
| 4099 | 2977978591 | |||
| 4100 | 2979711814 | |||
| 4101 | 2979752058 | |||
| 4102 | 2979769689 | |||
| 4103 | 2979777917 | |||
| 4104 | 2979786103 | |||
| 4105 | 2979797597 | |||
| 4106 | 2987645421 | |||
| 4107 | 2987649830 | |||
| 4108 | 2987658290 | |||
| 4109 | 2987664249 | |||
| 4110 | 2987670544 | |||
| 4111 | 2987677347 | |||
| 4112 | 2995728088 | |||
| 4113 | 2996348394 | |||
| 4114 | 2996351027 | |||
| 4115 | 2996392675 | |||
| 4116 | 3000018694 | |||
| 4117 | 3003933368 | |||
| 4118 | 3004169703 | |||
| 4119 | 3004193304 | |||
| 4120 | 3004206328 | |||
| 4121 | 3004241853 | |||
| 4122 | 3004254174 | |||
| 4123 | 3004275307 | |||
| 4124 | 3004277725 | |||
| 4125 | 3004296135 | |||
| 4126 | 3004340875 | |||
| 4127 | 637073816 | |||
| 4128 | 649873817 | |||
| 4129 | 8004304783 | |||
| 4130 | 8004366751 | |||
| 4131 | 8004393988 | |||
| 4132 | 8004447230 | |||
| 4133 | 8004646830 | |||
| 4134 | 8004713792 | |||
| 4135 | 8004719521 | |||
| 4136 | 8004730442 | |||
| 4137 | 8006941435 | |||
| 4138 | 8006981148 | |||
| 4139 | 8049294366 | |||
| 4140 | 8054565037 | |||
| 4141 | 8055035903 | |||
| 4142 | 8055038543 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b9b-assembly1.cif.gz_B | triosephosphate isomerase of thermotoga maritima | 0.9824 | 1 | 240 |
| 4y8f-assembly1.cif.gz_A-2 | crystal structure of triosephosphate isomerase from clostridium perfringens | 0.9807 | 1 | 239 |
| 4y96-assembly1.cif.gz_A | crystal structure of triosephosphate isomerase from gemmata obscuriglobus | 0.9796 | 1 | 241 |
| 1btm-assembly1.cif.gz_B | triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid | 0.9759 | 1 | 239 |
| 6nlh-assembly4.cif.gz_H | structure of human triose phosphate isomerase r189a | 0.9718 | 1 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y96A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9796 | 1 | 241 | 3.20.20.70 |
| af_P17751_41_299_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9779 | 29 | 241 | 3.20.20.70 |
| af_P17751_41_299_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9687 | 29 | 241 | 3.20.20.70 |
| af_P0A858_1_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.968 | 1 | 239 | 3.20.20.70 |
| 4y96A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9676 | 1 | 241 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S4TA46-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9995 | 114 | 238 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A351UNB1-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9992 | 79 | 237 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7S0CIF1-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9971 | 107 | 238 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A645DQY7-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9961 | 84 | 239 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A660REK8-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.996 | 81 | 239 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |