F496348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2071 | 823 | 4142 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10000735|Ga0105244_1000073514 |
| Length | 421 |
| Sequence | MGTSAHVETARRARQVASAPGTGRAFNVFLAHCEVPTPFAESGFGKGSSKVRAVTYEIEIGRGKRGRRAYSLDDIAIVPNRRTRDPKDVSVSWQIDAYKFDIPVIAAPMDSAMSPETAIALGRLGGLGVLDLEGLWTRYEDPQSVLDEISALAGETASPAVTRRMQDLYKAPIQPELITSRLAEIRASGVTVAGSLTPQRTQEHYKTVLAAGVDIFVIRGTTVSAEHVSKNHEPLNLKQFIYELDVPVIVGGAAGYTPALHLMRTGAAGVLVGFGALGIHSPMASAISDVAAARRDYLDESGGRYVHVIADGGMGASGDIVKAVAMGADAVMLGSALARAEEAPGKGWHWGQEAHHLELPRGDRVNVGTVGPLEEVLFGPGHHTNGTSNLIGALRRSMATTGYSDLKEFQRVDVVVSPYLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 111 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 142 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 232 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 233 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 234 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 245 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 246 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 248 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 264 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 267 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 268 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 269 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 292 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 293 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 301 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 302 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 306 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 307 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 308 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 309 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 310 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 316 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 317 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 318 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 319 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 320 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 321 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 322 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 323 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 324 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 325 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 326 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 327 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 328 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 329 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 330 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 338 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 339 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 340 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 341 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 342 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 343 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 427 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 428 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 429 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 430 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 431 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 432 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 435 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 436 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 437 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 438 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 439 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 440 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 441 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 442 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 443 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 444 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 445 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 446 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 447 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 448 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 449 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 450 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 451 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 488 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 489 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 500 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 503 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 506 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 507 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 508 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 509 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 510 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 511 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 513 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 514 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 515 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 519 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 520 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 523 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 524 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 525 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 527 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 530 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 531 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 532 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 533 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 534 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 535 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 536 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 537 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 538 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 539 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 540 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 541 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 542 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 543 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 544 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 545 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 546 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 547 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 548 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 549 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 550 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 551 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 552 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 553 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 554 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 555 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 556 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 557 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 558 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 559 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 560 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 561 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 562 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 563 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 564 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 565 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 566 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 567 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 568 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 569 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 570 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 571 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 572 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 573 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 574 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 575 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 576 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 577 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 578 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 579 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 580 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 581 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 582 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 583 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 584 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 585 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 586 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 587 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 588 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 589 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 590 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 591 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 592 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 593 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 594 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 595 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 596 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 597 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 598 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 599 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 600 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 601 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 602 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 603 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 604 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 605 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 606 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 607 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 608 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 609 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 610 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 611 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 612 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 613 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 614 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 615 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 616 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 617 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 618 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 619 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 620 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 621 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 622 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 623 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 624 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 625 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 626 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 627 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 628 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 629 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 630 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 631 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 632 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 633 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 634 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 635 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 636 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 637 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 638 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 639 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 640 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 641 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 642 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 643 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 644 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 645 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 646 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 647 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 648 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 649 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 650 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 651 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 652 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 653 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 654 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 655 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 656 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 657 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 658 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 659 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 660 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 661 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 662 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 663 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 664 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 665 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 666 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 667 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 668 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 669 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 670 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 671 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 672 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 673 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 674 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 675 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 676 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 677 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 678 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 679 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 680 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 681 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 682 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 683 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 684 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 685 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 686 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 687 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 688 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 689 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 690 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 691 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 692 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 693 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 694 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 695 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 696 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 697 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 698 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 699 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 700 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 701 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 702 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 703 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 704 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 705 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 706 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 707 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 708 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 709 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 710 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 711 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 712 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 713 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 714 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 715 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 716 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 717 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 718 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 719 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 720 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 721 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 722 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 723 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 724 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 725 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 726 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 727 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 728 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 729 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 730 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 731 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 732 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 733 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 734 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 735 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 736 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 737 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 738 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 739 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 740 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 741 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 742 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 743 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 744 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 745 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 746 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 747 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 748 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 749 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 750 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 751 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 752 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 753 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 754 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 755 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 756 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 757 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 758 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 759 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 760 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 761 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 762 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 763 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 764 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 765 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 766 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 767 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 768 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 769 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 770 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 771 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 772 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 773 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 774 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 775 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 776 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 777 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 778 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 779 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 780 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 781 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 782 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 783 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 784 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 785 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 786 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 787 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 788 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 789 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 790 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 791 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 792 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 793 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 794 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 795 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 796 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 797 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 798 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 799 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 800 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 801 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 802 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 803 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 804 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 805 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 806 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 807 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 808 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 809 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 810 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 811 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 812 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 813 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 814 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 815 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 816 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 817 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 818 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 819 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 820 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 821 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 822 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 823 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.36 |
| Metatranscriptomes | 1.5 |
| Isolates | 14.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0.14 |
| Rhizoplane | 6.08 |
| Rhizosphere | 75.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10000735 | 3300009036 | Bacteria | 28063 |
| 2 | LJQas_1000257 | 3300000549 | Bacteria | 9695 |
| 3 | LJQas_1000741 | 3300000549 | Bacteria | 5168 |
| 4 | JGI25154J39366_1003355 | 3300002738 | Bacteria | 3417 |
| 5 | JGI25152J39213_1000399 | 3300002773 | Bacteria | 26470 |
| 6 | JGI25406J46586_10001751 | 3300003203 | Bacteria | 10207 |
| 7 | JGI25160J50197_1014988 | 3300003354 | Bacteria | 2564 |
| 8 | Ga0006562J51391_1013439 | 3300003578 | Bacteria | 7730 |
| 9 | Ga0006562J51391_1013440 | 3300003578 | Bacteria | 4940 |
| 10 | Ga0006562J51391_1025688 | 3300003578 | Bacteria | 6307 |
| 11 | Ga0006562J51391_1025689 | 3300003578 | Bacteria | 4797 |
| 12 | Ga0006562J51391_1098594 | 3300003578 | Bacteria | 5598 |
| 13 | Ga0006562J51391_1098595 | 3300003578 | Bacteria | 5160 |
| 14 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 15 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 16 | Ga0055527_1000017 | 3300003760 | Bacteria | 242362 |
| 17 | Ga0055542_1000044 | 3300003762 | Bacteria | 206982 |
| 18 | Ga0055529_1000279 | 3300003763 | Bacteria | 60946 |
| 19 | Ga0055541_1008325 | 3300003841 | Bacteria | 1656 |
| 20 | Ga0065714_10104412 | 3300005288 | Bacteria | 1585 |
| 21 | Ga0070658_10000266 | 3300005327 | Bacteria | 46035 |
| 22 | Ga0070658_10013342 | 3300005327 | Bacteria | 6594 |
| 23 | Ga0070658_10031946 | 3300005327 | Bacteria | 4231 |
| 24 | Ga0070658_10035794 | 3300005327 | Bacteria | 3999 |
| 25 | Ga0070658_10043257 | 3300005327 | Bacteria | 3639 |
| 26 | Ga0070658_10219665 | 3300005327 | Bacteria | 1607 |
| 27 | Ga0070676_10045831 | 3300005328 | Bacteria | 2547 |
| 28 | Ga0070683_100019688 | 3300005329 | Bacteria | 5997 |
| 29 | Ga0070683_100048077 | 3300005329 | Bacteria | 3944 |
| 30 | Ga0070683_100058043 | 3300005329 | Bacteria | 3596 |
| 31 | Ga0070683_100225127 | 3300005329 | Bacteria | 1782 |
| 32 | Ga0070683_100257981 | 3300005329 | Bacteria | 1658 |
| 33 | Ga0070683_100323958 | 3300005329 | Bacteria | 1467 |
| 34 | Ga0070690_100059023 | 3300005330 | Bacteria | 2465 |
| 35 | Ga0068869_100099715 | 3300005334 | Bacteria | 2195 |
| 36 | Ga0070680_100000604 | 3300005336 | Bacteria | 24854 |
| 37 | Ga0070680_100040663 | 3300005336 | Bacteria | 3766 |
| 38 | Ga0070682_100100331 | 3300005337 | Bacteria | 1910 |
| 39 | Ga0070682_100142635 | 3300005337 | Bacteria | 1635 |
| 40 | Ga0070682_100195328 | 3300005337 | Bacteria | 1424 |
| 41 | Ga0068868_100022267 | 3300005338 | Bacteria | 4780 |
| 42 | Ga0070660_100081123 | 3300005339 | Bacteria | 2546 |
| 43 | Ga0070689_100095806 | 3300005340 | Bacteria | 2344 |
| 44 | Ga0070691_10120944 | 3300005341 | Bacteria | 1318 |
| 45 | Ga0070687_100056394 | 3300005343 | Bacteria | 2055 |
| 46 | Ga0070692_10019702 | 3300005345 | Bacteria | 3260 |
| 47 | Ga0070692_10052038 | 3300005345 | Bacteria | 2132 |
| 48 | Ga0070692_10076527 | 3300005345 | Bacteria | 1794 |
| 49 | Ga0070668_100088728 | 3300005347 | Bacteria | 2435 |
| 50 | Ga0070668_100215082 | 3300005347 | Bacteria | 1583 |
| 51 | Ga0070669_100022755 | 3300005353 | Bacteria | 4482 |
| 52 | Ga0070675_100005971 | 3300005354 | Bacteria | 9330 |
| 53 | Ga0070675_100032384 | 3300005354 | Bacteria | 4231 |
| 54 | Ga0070674_100019987 | 3300005356 | Bacteria | 4267 |
| 55 | Ga0070674_100078162 | 3300005356 | Bacteria | 2357 |
| 56 | Ga0070673_100038887 | 3300005364 | Bacteria | 3637 |
| 57 | Ga0070673_100058206 | 3300005364 | Bacteria | 3054 |
| 58 | Ga0070673_100171762 | 3300005364 | Bacteria | 1851 |
| 59 | Ga0070659_100053135 | 3300005366 | Bacteria | 3188 |
| 60 | Ga0070667_100021591 | 3300005367 | Bacteria | 5344 |
| 61 | Ga0070709_10000118 | 3300005434 | Bacteria | 53312 |
| 62 | Ga0070709_10003048 | 3300005434 | Bacteria | 8990 |
| 63 | Ga0070709_10004402 | 3300005434 | Bacteria | 7595 |
| 64 | Ga0070709_10036494 | 3300005434 | Bacteria | 2995 |
| 65 | Ga0070714_100001466 | 3300005435 | Bacteria | 17185 |
| 66 | Ga0070714_100005802 | 3300005435 | Bacteria | 9468 |
| 67 | Ga0070714_100030612 | 3300005435 | Bacteria | 4482 |
| 68 | Ga0070714_100066156 | 3300005435 | Bacteria | 3115 |
| 69 | Ga0070714_100073929 | 3300005435 | Bacteria | 2954 |
| 70 | Ga0070714_100085074 | 3300005435 | Bacteria | 2761 |
| 71 | Ga0070713_100001299 | 3300005436 | Bacteria | 15987 |
| 72 | Ga0070713_100015416 | 3300005436 | Bacteria | 5713 |
| 73 | Ga0070713_100018101 | 3300005436 | Bacteria | 5351 |
| 74 | Ga0070713_100026407 | 3300005436 | Bacteria | 4558 |
| 75 | Ga0070710_10000216 | 3300005437 | Bacteria | 26980 |
| 76 | Ga0070710_10000381 | 3300005437 | Bacteria | 20743 |
| 77 | Ga0070710_10001064 | 3300005437 | Bacteria | 13005 |
| 78 | Ga0070710_10024900 | 3300005437 | Bacteria | 3162 |
| 79 | Ga0070710_10054249 | 3300005437 | Bacteria | 2261 |
| 80 | Ga0070710_10075637 | 3300005437 | Bacteria | 1952 |
| 81 | Ga0070710_10113558 | 3300005437 | Bacteria | 1630 |
| 82 | Ga0070711_100000774 | 3300005439 | Bacteria | 16660 |
| 83 | Ga0070711_100001507 | 3300005439 | Bacteria | 12813 |
| 84 | Ga0070711_100011359 | 3300005439 | Bacteria | 5527 |
| 85 | Ga0070711_100052982 | 3300005439 | Bacteria | 2794 |
| 86 | Ga0070705_100027550 | 3300005440 | Bacteria | 3104 |
| 87 | Ga0070705_100143311 | 3300005440 | Bacteria | 1575 |
| 88 | Ga0070700_100018526 | 3300005441 | Bacteria | 4003 |
| 89 | Ga0070708_100042482 | 3300005445 | Bacteria | 3991 |
| 90 | Ga0070708_100114211 | 3300005445 | Bacteria | 2484 |
| 91 | Ga0070708_100282487 | 3300005445 | Bacteria | 1562 |
| 92 | Ga0070663_100165035 | 3300005455 | Bacteria | 1708 |
| 93 | Ga0070678_100059360 | 3300005456 | Bacteria | 2811 |
| 94 | Ga0070678_100082055 | 3300005456 | Bacteria | 2446 |
| 95 | Ga0070678_100216134 | 3300005456 | Bacteria | 1591 |
| 96 | Ga0070681_10037371 | 3300005458 | Bacteria | 4873 |
| 97 | Ga0070681_10076072 | 3300005458 | Bacteria | 3316 |
| 98 | Ga0070681_10113295 | 3300005458 | Bacteria | 2651 |
| 99 | Ga0070681_10314051 | 3300005458 | Bacteria | 1476 |
| 100 | Ga0068867_100277951 | 3300005459 | Bacteria | 1372 |
| 101 | Ga0070685_10017980 | 3300005466 | Bacteria | 3795 |
| 102 | Ga0070706_100002453 | 3300005467 | Bacteria | 18702 |
| 103 | Ga0070706_100007246 | 3300005467 | Bacteria | 10420 |
| 104 | Ga0070706_100013652 | 3300005467 | Bacteria | 7510 |
| 105 | Ga0070706_100019132 | 3300005467 | Bacteria | 6318 |
| 106 | Ga0070706_100029833 | 3300005467 | Bacteria | 5024 |
| 107 | Ga0070706_100030981 | 3300005467 | Bacteria | 4932 |
| 108 | Ga0070706_100048810 | 3300005467 | Bacteria | 3906 |
| 109 | Ga0070706_100238770 | 3300005467 | Bacteria | 1697 |
| 110 | Ga0070707_100000878 | 3300005468 | Bacteria | 29814 |
| 111 | Ga0070707_100016295 | 3300005468 | Bacteria | 6976 |
| 112 | Ga0070707_100017111 | 3300005468 | Bacteria | 6809 |
| 113 | Ga0070707_100027135 | 3300005468 | Bacteria | 5445 |
| 114 | Ga0070707_100043198 | 3300005468 | Bacteria | 4315 |
| 115 | Ga0070707_100063769 | 3300005468 | Bacteria | 3537 |
| 116 | Ga0070707_100120942 | 3300005468 | Bacteria | 2542 |
| 117 | Ga0070698_100000621 | 3300005471 | Bacteria | 38176 |
| 118 | Ga0070698_100001092 | 3300005471 | Bacteria | 29843 |
| 119 | Ga0070698_100017339 | 3300005471 | Bacteria | 7587 |
| 120 | Ga0070698_100017533 | 3300005471 | Bacteria | 7546 |
| 121 | Ga0070698_100018948 | 3300005471 | Bacteria | 7239 |
| 122 | Ga0070698_100029366 | 3300005471 | Bacteria | 5708 |
| 123 | Ga0070698_100035507 | 3300005471 | Bacteria | 5155 |
| 124 | Ga0070698_100132843 | 3300005471 | Bacteria | 2444 |
| 125 | Ga0070699_100298178 | 3300005518 | Bacteria | 1446 |
| 126 | Ga0070679_100054351 | 3300005530 | Bacteria | 3986 |
| 127 | Ga0070679_100105416 | 3300005530 | Bacteria | 2805 |
| 128 | Ga0070679_100127582 | 3300005530 | Bacteria | 2525 |
| 129 | Ga0070679_100140904 | 3300005530 | Bacteria | 2391 |
| 130 | Ga0070679_100184734 | 3300005530 | Bacteria | 2056 |
| 131 | Ga0070684_100029632 | 3300005535 | Bacteria | 4641 |
| 132 | Ga0070684_100122242 | 3300005535 | Bacteria | 2342 |
| 133 | Ga0070684_100274891 | 3300005535 | Bacteria | 1543 |
| 134 | Ga0070697_100025290 | 3300005536 | Bacteria | 4736 |
| 135 | Ga0070697_100045569 | 3300005536 | Bacteria | 3554 |
| 136 | Ga0068853_100074526 | 3300005539 | Bacteria | 2961 |
| 137 | Ga0068853_100185674 | 3300005539 | Bacteria | 1887 |
| 138 | Ga0068853_100258327 | 3300005539 | Bacteria | 1601 |
| 139 | Ga0070672_100013432 | 3300005543 | Bacteria | 5785 |
| 140 | Ga0070672_100015790 | 3300005543 | Bacteria | 5391 |
| 141 | Ga0070672_100021208 | 3300005543 | Bacteria | 4750 |
| 142 | Ga0070686_100164925 | 3300005544 | Bacteria | 1563 |
| 143 | Ga0070695_100058153 | 3300005545 | Bacteria | 2499 |
| 144 | Ga0070696_100048404 | 3300005546 | Bacteria | 2951 |
| 145 | Ga0070693_100032957 | 3300005547 | Bacteria | 2855 |
| 146 | Ga0070665_100006265 | 3300005548 | Bacteria | 12163 |
| 147 | Ga0070665_100178198 | 3300005548 | Bacteria | 2126 |
| 148 | Ga0070665_100215114 | 3300005548 | Bacteria | 1923 |
| 149 | Ga0070704_100145513 | 3300005549 | Bacteria | 1856 |
| 150 | Ga0068855_100022690 | 3300005563 | Bacteria | 7520 |
| 151 | Ga0068855_100043681 | 3300005563 | Bacteria | 5307 |
| 152 | Ga0068855_100119766 | 3300005563 | Bacteria | 3013 |
| 153 | Ga0068855_100177890 | 3300005563 | Bacteria | 2406 |
| 154 | Ga0070664_100076214 | 3300005564 | Bacteria | 2881 |
| 155 | Ga0068857_100050157 | 3300005577 | Bacteria | 3703 |
| 156 | Ga0068857_100204484 | 3300005577 | Bacteria | 1801 |
| 157 | Ga0068854_100051107 | 3300005578 | Bacteria | 2960 |
| 158 | Ga0068856_100091894 | 3300005614 | Bacteria | 3019 |
| 159 | Ga0068856_100103109 | 3300005614 | Bacteria | 2847 |
| 160 | Ga0068856_100115037 | 3300005614 | Bacteria | 2689 |
| 161 | Ga0068856_100288139 | 3300005614 | Bacteria | 1659 |
| 162 | Ga0068856_100329509 | 3300005614 | Bacteria | 1544 |
| 163 | Ga0068856_100368358 | 3300005614 | Bacteria | 1455 |
| 164 | Ga0070702_100000716 | 3300005615 | Bacteria | 12568 |
| 165 | Ga0070702_100046300 | 3300005615 | Bacteria | 2465 |
| 166 | Ga0070702_100077702 | 3300005615 | Bacteria | 1979 |
| 167 | Ga0068852_100012452 | 3300005616 | Bacteria | 6461 |
| 168 | Ga0068852_100063039 | 3300005616 | Bacteria | 3226 |
| 169 | Ga0068852_100188837 | 3300005616 | Bacteria | 1943 |
| 170 | Ga0068852_100201339 | 3300005616 | Bacteria | 1884 |
| 171 | Ga0068859_100078111 | 3300005617 | Bacteria | 3350 |
| 172 | Ga0068859_100106112 | 3300005617 | Bacteria | 2868 |
| 173 | Ga0068864_100037398 | 3300005618 | Bacteria | 4142 |
| 174 | Ga0068866_10129595 | 3300005718 | Bacteria | 1433 |
| 175 | Ga0068861_100025788 | 3300005719 | Bacteria | 4267 |
| 176 | Ga0068861_100173790 | 3300005719 | Bacteria | 1787 |
| 177 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 178 | Ga0068870_10043557 | 3300005840 | Bacteria | 2341 |
| 179 | Ga0068870_10092007 | 3300005840 | Bacteria | 1698 |
| 180 | Ga0068863_100000912 | 3300005841 | Bacteria | 29665 |
| 181 | Ga0068863_100027376 | 3300005841 | Bacteria | 5437 |
| 182 | Ga0068863_100121426 | 3300005841 | Bacteria | 2492 |
| 183 | Ga0068863_100188176 | 3300005841 | Bacteria | 1983 |
| 184 | Ga0068863_100413521 | 3300005841 | Bacteria | 1320 |
| 185 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 186 | Ga0068858_100090777 | 3300005842 | Bacteria | 2843 |
| 187 | Ga0068858_100183277 | 3300005842 | Bacteria | 1977 |
| 188 | Ga0068860_100022448 | 3300005843 | Bacteria | 6104 |
| 189 | Ga0068860_100240062 | 3300005843 | Bacteria | 1762 |
| 190 | Ga0081540_1001352 | 3300005983 | Bacteria | 21314 |
| 191 | Ga0081540_1002515 | 3300005983 | Bacteria | 14885 |
| 192 | Ga0081540_1002903 | 3300005983 | Bacteria | 13813 |
| 193 | Ga0081539_10001393 | 3300005985 | Bacteria | 41656 |
| 194 | Ga0081539_10019489 | 3300005985 | Bacteria | 4639 |
| 195 | Ga0070717_10000504 | 3300006028 | Bacteria | 24742 |
| 196 | Ga0070717_10055270 | 3300006028 | Bacteria | 3275 |
| 197 | Ga0070717_10058992 | 3300006028 | Bacteria | 3174 |
| 198 | Ga0070717_10112192 | 3300006028 | Bacteria | 2327 |
| 199 | Ga0070717_10120794 | 3300006028 | Bacteria | 2244 |
| 200 | Ga0070717_10140625 | 3300006028 | Bacteria | 2082 |
| 201 | Ga0070717_10191812 | 3300006028 | Bacteria | 1786 |
| 202 | Ga0070717_10210671 | 3300006028 | Bacteria | 1705 |
| 203 | Ga0075365_10017542 | 3300006038 | Bacteria | 4381 |
| 204 | Ga0075365_10022365 | 3300006038 | Bacteria | 3961 |
| 205 | Ga0075365_10046434 | 3300006038 | Bacteria | 2852 |
| 206 | Ga0075432_10000249 | 3300006058 | Bacteria | 14621 |
| 207 | Ga0075432_10001177 | 3300006058 | Bacteria | 8378 |
| 208 | Ga0075432_10023188 | 3300006058 | Bacteria | 2125 |
| 209 | Ga0075432_10039010 | 3300006058 | Bacteria | 1655 |
| 210 | Ga0070715_10003999 | 3300006163 | Bacteria | 4778 |
| 211 | Ga0070715_10008469 | 3300006163 | Bacteria | 3586 |
| 212 | Ga0070715_10086227 | 3300006163 | Bacteria | 1435 |
| 213 | Ga0070716_100039444 | 3300006173 | Bacteria | 2621 |
| 214 | Ga0070716_100068368 | 3300006173 | Bacteria | 2078 |
| 215 | Ga0070712_100006228 | 3300006175 | Bacteria | 7386 |
| 216 | Ga0070712_100009230 | 3300006175 | Bacteria | 6212 |
| 217 | Ga0070712_100049554 | 3300006175 | Bacteria | 2917 |
| 218 | Ga0070712_100060346 | 3300006175 | Bacteria | 2674 |
| 219 | Ga0070712_100135383 | 3300006175 | Bacteria | 1873 |
| 220 | Ga0075367_10025051 | 3300006178 | Bacteria | 3370 |
| 221 | Ga0075428_100023989 | 3300006844 | Bacteria | 6750 |
| 222 | Ga0075428_100106170 | 3300006844 | Bacteria | 3062 |
| 223 | Ga0075430_100190988 | 3300006846 | Bacteria | 1702 |
| 224 | Ga0075431_100005919 | 3300006847 | Bacteria | 12097 |
| 225 | Ga0075433_10000652 | 3300006852 | Bacteria | 23385 |
| 226 | Ga0075433_10001827 | 3300006852 | Bacteria | 15974 |
| 227 | Ga0075433_10007398 | 3300006852 | Bacteria | 8716 |
| 228 | Ga0075433_10028029 | 3300006852 | Bacteria | 4784 |
| 229 | Ga0075434_100000181 | 3300006871 | Bacteria | 40986 |
| 230 | Ga0075434_100018396 | 3300006871 | Bacteria | 6750 |
| 231 | Ga0075434_100038538 | 3300006871 | Bacteria | 4733 |
| 232 | Ga0075434_100060076 | 3300006871 | Bacteria | 3780 |
| 233 | Ga0075429_100038385 | 3300006880 | Bacteria | 4169 |
| 234 | Ga0075429_100038598 | 3300006880 | Bacteria | 4158 |
| 235 | Ga0075436_100010867 | 3300006914 | Bacteria | 6247 |
| 236 | Ga0075436_100047311 | 3300006914 | Bacteria | 2967 |
| 237 | Ga0075436_100132048 | 3300006914 | Bacteria | 1751 |
| 238 | Ga0097620_100078109 | 3300006931 | Bacteria | 3350 |
| 239 | Ga0097620_100106127 | 3300006931 | Bacteria | 2868 |
| 240 | Ga0075435_100068135 | 3300007076 | Bacteria | 2898 |
| 241 | Ga0075435_100108572 | 3300007076 | Bacteria | 2306 |
| 242 | Ga0105251_10004563 | 3300009011 | Bacteria | 9373 |
| 243 | Ga0105251_10006598 | 3300009011 | Bacteria | 7357 |
| 244 | Ga0105251_10011880 | 3300009011 | Bacteria | 4947 |
| 245 | Ga0105240_10155493 | 3300009093 | Bacteria | 2721 |
| 246 | Ga0111539_10000095 | 3300009094 | Bacteria | 93635 |
| 247 | Ga0111539_10010369 | 3300009094 | Bacteria | 11732 |
| 248 | Ga0111539_10165704 | 3300009094 | Bacteria | 2584 |
| 249 | Ga0105245_10013491 | 3300009098 | Bacteria | 7117 |
| 250 | Ga0105245_10036186 | 3300009098 | Bacteria | 4384 |
| 251 | Ga0105245_10039281 | 3300009098 | Bacteria | 4213 |
| 252 | Ga0105245_10144385 | 3300009098 | Bacteria | 2244 |
| 253 | Ga0105245_10202729 | 3300009098 | Bacteria | 1905 |
| 254 | Ga0105245_10319187 | 3300009098 | Bacteria | 1530 |
| 255 | Ga0105247_10070656 | 3300009101 | Bacteria | 2181 |
| 256 | Ga0114129_10008769 | 3300009147 | Bacteria | 14422 |
| 257 | Ga0114129_10014475 | 3300009147 | Bacteria | 11241 |
| 258 | Ga0114129_10027431 | 3300009147 | Bacteria | 8062 |
| 259 | Ga0114129_10053520 | 3300009147 | Bacteria | 5661 |
| 260 | Ga0114129_10280963 | 3300009147 | Bacteria | 2224 |
| 261 | Ga0105243_10149832 | 3300009148 | Bacteria | 2000 |
| 262 | Ga0105243_10228885 | 3300009148 | Bacteria | 1648 |
| 263 | Ga0105243_10332041 | 3300009148 | Bacteria | 1389 |
| 264 | Ga0105243_10335691 | 3300009148 | Bacteria | 1382 |
| 265 | Ga0105241_10004447 | 3300009174 | Bacteria | 10364 |
| 266 | Ga0105242_10010462 | 3300009176 | Bacteria | 7119 |
| 267 | Ga0105242_10020736 | 3300009176 | Bacteria | 5155 |
| 268 | Ga0105242_10033389 | 3300009176 | Bacteria | 4119 |
| 269 | Ga0105242_10113127 | 3300009176 | Bacteria | 2317 |
| 270 | Ga0105242_10251589 | 3300009176 | Bacteria | 1592 |
| 271 | Ga0105242_10274188 | 3300009176 | Bacteria | 1529 |
| 272 | Ga0105248_10000880 | 3300009177 | Bacteria | 33648 |
| 273 | Ga0105248_10091708 | 3300009177 | Bacteria | 3421 |
| 274 | Ga0105248_10173957 | 3300009177 | Bacteria | 2427 |
| 275 | Ga0105248_10246363 | 3300009177 | Bacteria | 2012 |
| 276 | Ga0105237_10006728 | 3300009545 | Bacteria | 12695 |
| 277 | Ga0105237_10064474 | 3300009545 | Bacteria | 3660 |
| 278 | Ga0105237_10166341 | 3300009545 | Bacteria | 2204 |
| 279 | Ga0105238_10002053 | 3300009551 | Bacteria | 20326 |
| 280 | Ga0105249_10065057 | 3300009553 | Bacteria | 3353 |
| 281 | Ga0105249_10109470 | 3300009553 | Bacteria | 2609 |
| 282 | Ga0105249_10152986 | 3300009553 | Bacteria | 2222 |
| 283 | Ga0105249_10175164 | 3300009553 | Bacteria | 2083 |
| 284 | Ga0105032_100683 | 3300009979 | Bacteria | 3310 |
| 285 | Ga0105033_101458 | 3300009986 | Bacteria | 1937 |
| 286 | Ga0105239_10112904 | 3300010375 | Bacteria | 3013 |
| 287 | Ga0105246_10000474 | 3300011119 | Bacteria | 21648 |
| 288 | Ga0105246_10030002 | 3300011119 | Bacteria | 3587 |
| 289 | Ga0157344_1000433 | 3300012476 | Bacteria | 1622 |
| 290 | Ga0157373_10091086 | 3300013100 | Bacteria | 2147 |
| 291 | Ga0157371_10071463 | 3300013102 | Bacteria | 2456 |
| 292 | Ga0157370_10001462 | 3300013104 | Bacteria | 29206 |
| 293 | Ga0157370_10161321 | 3300013104 | Bacteria | 2086 |
| 294 | Ga0157370_10171889 | 3300013104 | Bacteria | 2014 |
| 295 | Ga0157369_10028346 | 3300013105 | Bacteria | 6198 |
| 296 | Ga0157369_10031501 | 3300013105 | Bacteria | 5838 |
| 297 | Ga0157369_10050500 | 3300013105 | Bacteria | 4504 |
| 298 | Ga0157369_10054453 | 3300013105 | Bacteria | 4320 |
| 299 | Ga0157369_10064247 | 3300013105 | Bacteria | 3953 |
| 300 | Ga0157369_10077143 | 3300013105 | Bacteria | 3571 |
| 301 | Ga0157369_10088646 | 3300013105 | Bacteria | 3303 |
| 302 | Ga0157369_10282236 | 3300013105 | Bacteria | 1729 |
| 303 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 304 | Ga0157374_10024151 | 3300013296 | Bacteria | 5447 |
| 305 | Ga0157374_10042610 | 3300013296 | Bacteria | 4187 |
| 306 | Ga0157374_10191923 | 3300013296 | Bacteria | 1998 |
| 307 | Ga0163162_10017442 | 3300013306 | Bacteria | 7025 |
| 308 | Ga0163162_10098066 | 3300013306 | Bacteria | 3020 |
| 309 | Ga0157372_10115493 | 3300013307 | Bacteria | 3077 |
| 310 | Ga0157372_10117818 | 3300013307 | Bacteria | 3046 |
| 311 | Ga0157372_10389671 | 3300013307 | Bacteria | 1623 |
| 312 | Ga0157372_10435920 | 3300013307 | Bacteria | 1527 |
| 313 | Ga0157375_10104547 | 3300013308 | Bacteria | 2920 |
| 314 | Ga0157375_10222721 | 3300013308 | Bacteria | 2045 |
| 315 | Ga0157375_10483163 | 3300013308 | Bacteria | 1404 |
| 316 | Ga0157375_10538782 | 3300013308 | Bacteria | 1330 |
| 317 | Ga0157375_10583356 | 3300013308 | Bacteria | 1278 |
| 318 | Ga0163163_10008035 | 3300014325 | Bacteria | 9344 |
| 319 | Ga0163163_10177155 | 3300014325 | Bacteria | 2179 |
| 320 | Ga0163163_10245003 | 3300014325 | Bacteria | 1842 |
| 321 | Ga0163163_10393289 | 3300014325 | Bacteria | 1444 |
| 322 | Ga0157380_10018506 | 3300014326 | Bacteria | 5172 |
| 323 | Ga0157380_10177247 | 3300014326 | Bacteria | 1869 |
| 324 | Ga0182008_10000155 | 3300014497 | Bacteria | 54054 |
| 325 | Ga0157377_10011120 | 3300014745 | Bacteria | 4481 |
| 326 | Ga0157379_10006602 | 3300014968 | Bacteria | 10012 |
| 327 | Ga0157379_10007743 | 3300014968 | Bacteria | 9303 |
| 328 | Ga0157376_10102957 | 3300014969 | Bacteria | 2499 |
| 329 | Ga0157376_10177269 | 3300014969 | Bacteria | 1945 |
| 330 | Ga0157376_10311140 | 3300014969 | Bacteria | 1494 |
| 331 | Ga0182007_10006083 | 3300015262 | Bacteria | 5218 |
| 332 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 333 | Ga0163161_10022188 | 3300017792 | Bacteria | 4468 |
| 334 | Ga0163161_10064109 | 3300017792 | Bacteria | 2680 |
| 335 | Ga0197907_10254036 | 3300020069 | Bacteria | 2663 |
| 336 | Ga0197907_10622146 | 3300020069 | Bacteria | 1626 |
| 337 | Ga0206356_10718652 | 3300020070 | Bacteria | 3527 |
| 338 | Ga0206352_10797669 | 3300020078 | Bacteria | 3257 |
| 339 | Ga0206350_10773787 | 3300020080 | Bacteria | 2001 |
| 340 | Ga0206350_11125152 | 3300020080 | Bacteria | 2951 |
| 341 | Ga0206354_10351484 | 3300020081 | Bacteria | 1673 |
| 342 | Ga0206354_10556289 | 3300020081 | Bacteria | 2445 |
| 343 | Ga0206354_10679121 | 3300020081 | Bacteria | 4827 |
| 344 | Ga0206354_10854419 | 3300020081 | Bacteria | 2337 |
| 345 | Ga0206354_11188581 | 3300020081 | Bacteria | 8815 |
| 346 | Ga0206354_11707980 | 3300020081 | Bacteria | 1771 |
| 347 | Ga0206353_10410223 | 3300020082 | Bacteria | 6596 |
| 348 | Ga0206353_10645933 | 3300020082 | Bacteria | 12151 |
| 349 | Ga0206353_10842314 | 3300020082 | Bacteria | 3030 |
| 350 | Ga0206353_10849751 | 3300020082 | Bacteria | 2411 |
| 351 | Ga0206353_11875109 | 3300020082 | Bacteria | 2679 |
| 352 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 353 | Ga0213875_10000514 | 3300021388 | Bacteria | 32222 |
| 354 | Ga0213875_10117901 | 3300021388 | Bacteria | 1240 |
| 355 | Ga0224712_10002198 | 3300022467 | Bacteria | 4762 |
| 356 | Ga0224712_10002255 | 3300022467 | Bacteria | 4717 |
| 357 | Ga0224712_10021596 | 3300022467 | Bacteria | 2206 |
| 358 | Ga0224712_10037054 | 3300022467 | Bacteria | 1812 |
| 359 | Ga0224572_1000179 | 3300024225 | Bacteria | 5857 |
| 360 | Ga0224572_1000254 | 3300024225 | Bacteria | 5437 |
| 361 | Ga0209566_100053 | 3300025225 | Bacteria | 224436 |
| 362 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 363 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 364 | Ga0209147_101049 | 3300025229 | Bacteria | 11708 |
| 365 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 366 | Ga0209563_100766 | 3300025230 | Bacteria | 9765 |
| 367 | Ga0209646_1000088 | 3300025246 | Bacteria | 192345 |
| 368 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 369 | Ga0209677_100448 | 3300025253 | Bacteria | 23936 |
| 370 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 371 | Ga0209148_1004065 | 3300025254 | Bacteria | 3716 |
| 372 | Ga0209148_1004139 | 3300025254 | Bacteria | 3659 |
| 373 | Ga0209129_1000047 | 3300025258 | Bacteria | 270566 |
| 374 | Ga0209455_1000117 | 3300025272 | Bacteria | 176940 |
| 375 | Ga0209455_1003789 | 3300025272 | Bacteria | 5200 |
| 376 | Ga0209025_1000920 | 3300025294 | Bacteria | 45267 |
| 377 | Ga0209758_1002219 | 3300025297 | Bacteria | 20208 |
| 378 | Ga0207426_1005431 | 3300025302 | Bacteria | 5816 |
| 379 | Ga0209051_1003197 | 3300025303 | Bacteria | 10933 |
| 380 | Ga0209051_1013778 | 3300025303 | Bacteria | 3820 |
| 381 | Ga0207697_10001921 | 3300025315 | Bacteria | 11055 |
| 382 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 383 | Ga0207655_1006296 | 3300025728 | Bacteria | 7893 |
| 384 | Ga0207655_1015554 | 3300025728 | Bacteria | 4220 |
| 385 | Ga0207713_1051913 | 3300025735 | Bacteria | 1627 |
| 386 | Ga0207653_10006417 | 3300025885 | Bacteria | 3667 |
| 387 | Ga0207682_10001886 | 3300025893 | Bacteria | 9541 |
| 388 | Ga0207692_10000225 | 3300025898 | Bacteria | 19145 |
| 389 | Ga0207692_10009769 | 3300025898 | Bacteria | 4019 |
| 390 | Ga0207692_10049387 | 3300025898 | Bacteria | 2123 |
| 391 | Ga0207692_10051604 | 3300025898 | Bacteria | 2086 |
| 392 | Ga0207692_10134957 | 3300025898 | Bacteria | 1398 |
| 393 | Ga0207642_10011637 | 3300025899 | Bacteria | 3147 |
| 394 | Ga0207710_10033869 | 3300025900 | Bacteria | 2242 |
| 395 | Ga0207710_10052795 | 3300025900 | Bacteria | 1828 |
| 396 | Ga0207647_10009551 | 3300025904 | Bacteria | 6885 |
| 397 | Ga0207647_10091475 | 3300025904 | Bacteria | 1814 |
| 398 | Ga0207647_10135588 | 3300025904 | Bacteria | 1445 |
| 399 | Ga0207685_10000224 | 3300025905 | Bacteria | 8791 |
| 400 | Ga0207685_10030315 | 3300025905 | Bacteria | 1924 |
| 401 | Ga0207699_10000106 | 3300025906 | Bacteria | 58842 |
| 402 | Ga0207699_10004744 | 3300025906 | Bacteria | 6495 |
| 403 | Ga0207699_10005198 | 3300025906 | Bacteria | 6223 |
| 404 | Ga0207699_10007365 | 3300025906 | Bacteria | 5381 |
| 405 | Ga0207699_10008667 | 3300025906 | Bacteria | 5030 |
| 406 | Ga0207645_10016279 | 3300025907 | Bacteria | 4924 |
| 407 | Ga0207643_10015262 | 3300025908 | Bacteria | 4179 |
| 408 | Ga0207643_10132631 | 3300025908 | Bacteria | 1483 |
| 409 | Ga0207643_10135365 | 3300025908 | Bacteria | 1468 |
| 410 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 411 | Ga0207705_10009574 | 3300025909 | Bacteria | 7048 |
| 412 | Ga0207705_10014811 | 3300025909 | Bacteria | 5606 |
| 413 | Ga0207705_10099321 | 3300025909 | Bacteria | 2140 |
| 414 | Ga0207705_10139709 | 3300025909 | Bacteria | 1808 |
| 415 | Ga0207705_10145603 | 3300025909 | Bacteria | 1772 |
| 416 | Ga0207684_10002459 | 3300025910 | Bacteria | 18674 |
| 417 | Ga0207684_10006157 | 3300025910 | Bacteria | 10973 |
| 418 | Ga0207684_10013779 | 3300025910 | Bacteria | 6984 |
| 419 | Ga0207684_10026141 | 3300025910 | Bacteria | 4975 |
| 420 | Ga0207684_10031843 | 3300025910 | Bacteria | 4486 |
| 421 | Ga0207684_10032282 | 3300025910 | Bacteria | 4454 |
| 422 | Ga0207684_10032768 | 3300025910 | Bacteria | 4418 |
| 423 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 424 | Ga0207707_10003758 | 3300025912 | Bacteria | 13458 |
| 425 | Ga0207707_10303097 | 3300025912 | Bacteria | 1381 |
| 426 | Ga0207695_10005496 | 3300025913 | Bacteria | 16776 |
| 427 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 428 | Ga0207671_10177663 | 3300025914 | Bacteria | 1655 |
| 429 | Ga0207693_10002782 | 3300025915 | Bacteria | 15143 |
| 430 | Ga0207693_10003038 | 3300025915 | Bacteria | 14506 |
| 431 | Ga0207693_10007334 | 3300025915 | Bacteria | 9068 |
| 432 | Ga0207693_10008350 | 3300025915 | Bacteria | 8474 |
| 433 | Ga0207693_10045686 | 3300025915 | Bacteria | 3441 |
| 434 | Ga0207693_10072583 | 3300025915 | Bacteria | 2694 |
| 435 | Ga0207693_10087986 | 3300025915 | Bacteria | 2434 |
| 436 | Ga0207663_10005403 | 3300025916 | Bacteria | 6432 |
| 437 | Ga0207663_10021516 | 3300025916 | Bacteria | 3673 |
| 438 | Ga0207663_10034482 | 3300025916 | Bacteria | 3027 |
| 439 | Ga0207663_10091360 | 3300025916 | Bacteria | 2021 |
| 440 | Ga0207663_10188167 | 3300025916 | Bacteria | 1480 |
| 441 | Ga0207660_10000245 | 3300025917 | Bacteria | 35340 |
| 442 | Ga0207660_10104135 | 3300025917 | Bacteria | 2124 |
| 443 | Ga0207662_10002253 | 3300025918 | Bacteria | 9642 |
| 444 | Ga0207657_10018246 | 3300025919 | Bacteria | 6709 |
| 445 | Ga0207657_10045521 | 3300025919 | Bacteria | 3850 |
| 446 | Ga0207657_10080562 | 3300025919 | Bacteria | 2736 |
| 447 | Ga0207657_10086227 | 3300025919 | Bacteria | 2629 |
| 448 | Ga0207649_10053258 | 3300025920 | Bacteria | 2514 |
| 449 | Ga0207652_10000294 | 3300025921 | Bacteria | 51581 |
| 450 | Ga0207652_10068778 | 3300025921 | Bacteria | 3073 |
| 451 | Ga0207652_10118221 | 3300025921 | Bacteria | 2356 |
| 452 | Ga0207652_10149647 | 3300025921 | Bacteria | 2090 |
| 453 | Ga0207646_10001959 | 3300025922 | Bacteria | 24684 |
| 454 | Ga0207646_10004445 | 3300025922 | Bacteria | 15203 |
| 455 | Ga0207646_10020856 | 3300025922 | Bacteria | 6064 |
| 456 | Ga0207646_10053018 | 3300025922 | Bacteria | 3629 |
| 457 | Ga0207646_10111544 | 3300025922 | Bacteria | 2454 |
| 458 | Ga0207646_10117071 | 3300025922 | Bacteria | 2393 |
| 459 | Ga0207646_10312279 | 3300025922 | Bacteria | 1420 |
| 460 | Ga0207646_10345862 | 3300025922 | Bacteria | 1344 |
| 461 | Ga0207681_10042632 | 3300025923 | Bacteria | 3032 |
| 462 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 463 | Ga0207694_10100546 | 3300025924 | Bacteria | 2291 |
| 464 | Ga0207687_10013434 | 3300025927 | Bacteria | 5345 |
| 465 | Ga0207687_10043864 | 3300025927 | Bacteria | 3083 |
| 466 | Ga0207687_10045183 | 3300025927 | Bacteria | 3043 |
| 467 | Ga0207687_10144667 | 3300025927 | Bacteria | 1807 |
| 468 | Ga0207687_10240039 | 3300025927 | Bacteria | 1436 |
| 469 | Ga0207700_10000053 | 3300025928 | Bacteria | 75986 |
| 470 | Ga0207700_10002291 | 3300025928 | Bacteria | 10983 |
| 471 | Ga0207700_10008955 | 3300025928 | Bacteria | 6230 |
| 472 | Ga0207700_10011392 | 3300025928 | Bacteria | 5666 |
| 473 | Ga0207700_10014429 | 3300025928 | Bacteria | 5177 |
| 474 | Ga0207700_10016711 | 3300025928 | Bacteria | 4883 |
| 475 | Ga0207700_10018986 | 3300025928 | Bacteria | 4634 |
| 476 | Ga0207700_10034772 | 3300025928 | Bacteria | 3621 |
| 477 | Ga0207700_10062900 | 3300025928 | Bacteria | 2820 |
| 478 | Ga0207700_10065079 | 3300025928 | Bacteria | 2780 |
| 479 | Ga0207700_10114707 | 3300025928 | Bacteria | 2174 |
| 480 | Ga0207700_10162334 | 3300025928 | Bacteria | 1857 |
| 481 | Ga0207664_10000701 | 3300025929 | Bacteria | 22942 |
| 482 | Ga0207664_10000834 | 3300025929 | Bacteria | 20936 |
| 483 | Ga0207664_10002440 | 3300025929 | Bacteria | 12303 |
| 484 | Ga0207664_10002847 | 3300025929 | Bacteria | 11488 |
| 485 | Ga0207664_10002931 | 3300025929 | Bacteria | 11336 |
| 486 | Ga0207664_10005087 | 3300025929 | Bacteria | 8961 |
| 487 | Ga0207664_10005293 | 3300025929 | Bacteria | 8811 |
| 488 | Ga0207664_10014166 | 3300025929 | Bacteria | 5751 |
| 489 | Ga0207664_10035531 | 3300025929 | Bacteria | 3846 |
| 490 | Ga0207664_10067649 | 3300025929 | Bacteria | 2867 |
| 491 | Ga0207664_10076669 | 3300025929 | Bacteria | 2707 |
| 492 | Ga0207664_10096423 | 3300025929 | Bacteria | 2434 |
| 493 | Ga0207664_10111991 | 3300025929 | Bacteria | 2271 |
| 494 | Ga0207664_10178465 | 3300025929 | Bacteria | 1822 |
| 495 | Ga0207644_10011157 | 3300025931 | Bacteria | 5937 |
| 496 | Ga0207644_10283993 | 3300025931 | Bacteria | 1329 |
| 497 | Ga0207690_10040760 | 3300025932 | Bacteria | 3038 |
| 498 | Ga0207706_10010621 | 3300025933 | Bacteria | 8411 |
| 499 | Ga0207706_10022853 | 3300025933 | Bacteria | 5612 |
| 500 | Ga0207706_10024565 | 3300025933 | Bacteria | 5402 |
| 501 | Ga0207686_10157297 | 3300025934 | Bacteria | 1589 |
| 502 | Ga0207709_10031526 | 3300025935 | Bacteria | 3097 |
| 503 | Ga0207669_10131751 | 3300025937 | Bacteria | 1719 |
| 504 | Ga0207665_10000166 | 3300025939 | Bacteria | 44650 |
| 505 | Ga0207665_10002299 | 3300025939 | Bacteria | 12906 |
| 506 | Ga0207665_10011425 | 3300025939 | Bacteria | 5833 |
| 507 | Ga0207665_10012620 | 3300025939 | Bacteria | 5554 |
| 508 | Ga0207665_10026642 | 3300025939 | Bacteria | 3817 |
| 509 | Ga0207665_10041375 | 3300025939 | Bacteria | 3077 |
| 510 | Ga0207691_10001200 | 3300025940 | Bacteria | 25797 |
| 511 | Ga0207691_10067617 | 3300025940 | Bacteria | 3230 |
| 512 | Ga0207691_10165816 | 3300025940 | Bacteria | 1936 |
| 513 | Ga0207711_10005166 | 3300025941 | Bacteria | 11061 |
| 514 | Ga0207711_10098454 | 3300025941 | Bacteria | 2584 |
| 515 | Ga0207689_10007084 | 3300025942 | Bacteria | 9858 |
| 516 | Ga0207661_10054298 | 3300025944 | Bacteria | 3209 |
| 517 | Ga0207661_10252596 | 3300025944 | Bacteria | 1568 |
| 518 | Ga0207661_10308762 | 3300025944 | Bacteria | 1419 |
| 519 | Ga0207679_10100044 | 3300025945 | Bacteria | 2265 |
| 520 | Ga0207679_10210222 | 3300025945 | Bacteria | 1631 |
| 521 | Ga0207667_10002042 | 3300025949 | Bacteria | 25307 |
| 522 | Ga0207667_10011034 | 3300025949 | Bacteria | 10527 |
| 523 | Ga0207667_10027457 | 3300025949 | Bacteria | 6195 |
| 524 | Ga0207667_10138396 | 3300025949 | Bacteria | 2507 |
| 525 | Ga0207712_10233207 | 3300025961 | Bacteria | 1479 |
| 526 | Ga0207668_10094646 | 3300025972 | Bacteria | 2203 |
| 527 | Ga0207668_10111826 | 3300025972 | Bacteria | 2051 |
| 528 | Ga0207658_10203354 | 3300025986 | Bacteria | 1655 |
| 529 | Ga0207677_10193109 | 3300026023 | Bacteria | 1612 |
| 530 | Ga0207703_10000345 | 3300026035 | Bacteria | 49953 |
| 531 | Ga0207639_10079767 | 3300026041 | Bacteria | 2588 |
| 532 | Ga0207639_10088644 | 3300026041 | Bacteria | 2470 |
| 533 | Ga0207678_10003794 | 3300026067 | Bacteria | 13585 |
| 534 | Ga0207678_10007006 | 3300026067 | Bacteria | 10007 |
| 535 | Ga0207678_10250368 | 3300026067 | Bacteria | 1517 |
| 536 | Ga0207708_10103770 | 3300026075 | Bacteria | 2202 |
| 537 | Ga0207702_10077147 | 3300026078 | Bacteria | 2881 |
| 538 | Ga0207702_10173137 | 3300026078 | Bacteria | 1981 |
| 539 | Ga0207702_10173323 | 3300026078 | Bacteria | 1980 |
| 540 | Ga0207641_10002332 | 3300026088 | Bacteria | 17607 |
| 541 | Ga0207648_10047554 | 3300026089 | Bacteria | 3760 |
| 542 | Ga0207648_10062162 | 3300026089 | Bacteria | 3256 |
| 543 | Ga0207676_10043731 | 3300026095 | Bacteria | 3450 |
| 544 | Ga0207676_10061345 | 3300026095 | Bacteria | 2977 |
| 545 | Ga0207674_10012372 | 3300026116 | Bacteria | 9539 |
| 546 | Ga0207674_10013065 | 3300026116 | Bacteria | 9245 |
| 547 | Ga0207674_10019331 | 3300026116 | Bacteria | 7379 |
| 548 | Ga0207674_10045712 | 3300026116 | Bacteria | 4501 |
| 549 | Ga0207675_100005332 | 3300026118 | Bacteria | 12354 |
| 550 | Ga0207675_100047486 | 3300026118 | Bacteria | 4008 |
| 551 | Ga0207675_100110508 | 3300026118 | Bacteria | 2593 |
| 552 | Ga0207683_10001303 | 3300026121 | Bacteria | 22540 |
| 553 | Ga0207683_10050682 | 3300026121 | Bacteria | 3637 |
| 554 | Ga0207683_10059997 | 3300026121 | Bacteria | 3342 |
| 555 | Ga0207683_10078958 | 3300026121 | Bacteria | 2917 |
| 556 | Ga0207683_10109649 | 3300026121 | Bacteria | 2471 |
| 557 | Ga0207683_10143628 | 3300026121 | Bacteria | 2151 |
| 558 | Ga0207698_10004794 | 3300026142 | Bacteria | 8280 |
| 559 | Ga0207698_10120534 | 3300026142 | Bacteria | 2219 |
| 560 | Ga0207698_10192526 | 3300026142 | Bacteria | 1818 |
| 561 | Ga0207428_10000102 | 3300027907 | Bacteria | 118940 |
| 562 | Ga0207428_10002614 | 3300027907 | Bacteria | 17980 |
| 563 | Ga0207428_10085407 | 3300027907 | Bacteria | 2457 |
| 564 | Ga0268265_10117329 | 3300028380 | Bacteria | 2186 |
| 565 | Ga0268264_10007965 | 3300028381 | Bacteria | 8817 |
| 566 | Ga0265337_1000031 | 3300028556 | Bacteria | 64194 |
| 567 | Ga0265319_1002342 | 3300028563 | Bacteria | 10430 |
| 568 | Ga0265334_10000091 | 3300028573 | Bacteria | 64750 |
| 569 | Ga0265334_10003140 | 3300028573 | Bacteria | 7541 |
| 570 | Ga0265323_10049795 | 3300028653 | Bacteria | 1490 |
| 571 | Ga0265322_10003185 | 3300028654 | Bacteria | 4986 |
| 572 | Ga0265336_10007606 | 3300028666 | Bacteria | 3848 |
| 573 | Ga0307517_10002777 | 3300028786 | Bacteria | 27845 |
| 574 | Ga0307517_10015795 | 3300028786 | Bacteria | 9994 |
| 575 | Ga0307515_10010875 | 3300028794 | Bacteria | 17364 |
| 576 | Ga0307515_10180353 | 3300028794 | Bacteria | 2064 |
| 577 | Ga0265338_10000233 | 3300028800 | Bacteria | 103593 |
| 578 | Ga0265338_10002443 | 3300028800 | Bacteria | 27876 |
| 579 | Ga0265338_10025625 | 3300028800 | Bacteria | 5977 |
| 580 | Ga0265338_10233416 | 3300028800 | Bacteria | 1367 |
| 581 | Ga0265324_10004717 | 3300029957 | Bacteria | 6041 |
| 582 | Ga0307511_10018996 | 3300030521 | Bacteria | 6550 |
| 583 | Ga0307511_10048418 | 3300030521 | Bacteria | 3458 |
| 584 | Ga0307511_10052434 | 3300030521 | Bacteria | 3250 |
| 585 | Ga0307512_10013114 | 3300030522 | Bacteria | 7789 |
| 586 | Ga0307512_10087803 | 3300030522 | Bacteria | 2187 |
| 587 | Ga0307512_10121776 | 3300030522 | Bacteria | 1672 |
| 588 | Ga0314311_1016886 | 3300030733 | Bacteria | 2903 |
| 589 | Ga0265332_10006014 | 3300031238 | Bacteria | 5548 |
| 590 | Ga0265320_10008863 | 3300031240 | Bacteria | 6116 |
| 591 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 592 | Ga0265316_10065002 | 3300031344 | Bacteria | 2825 |
| 593 | Ga0307513_10000936 | 3300031456 | Bacteria | 42211 |
| 594 | Ga0307513_10001197 | 3300031456 | Bacteria | 37689 |
| 595 | Ga0307513_10034204 | 3300031456 | Bacteria | 5705 |
| 596 | Ga0307513_10223828 | 3300031456 | Bacteria | 1700 |
| 597 | Ga0307509_10010025 | 3300031507 | Bacteria | 11694 |
| 598 | Ga0307509_10061631 | 3300031507 | Bacteria | 3958 |
| 599 | Ga0307509_10126821 | 3300031507 | Bacteria | 2516 |
| 600 | Ga0307408_100003074 | 3300031548 | Bacteria | 11504 |
| 601 | Ga0307408_100060781 | 3300031548 | Bacteria | 2755 |
| 602 | Ga0307408_100099817 | 3300031548 | Bacteria | 2209 |
| 603 | Ga0307408_100156051 | 3300031548 | Bacteria | 1807 |
| 604 | Ga0307408_100216733 | 3300031548 | Bacteria | 1559 |
| 605 | Ga0265313_10002825 | 3300031595 | Bacteria | 14617 |
| 606 | Ga0307508_10001583 | 3300031616 | Bacteria | 25403 |
| 607 | Ga0307508_10029203 | 3300031616 | Bacteria | 4986 |
| 608 | Ga0307508_10033651 | 3300031616 | Bacteria | 4625 |
| 609 | Ga0307514_10008438 | 3300031649 | Bacteria | 8780 |
| 610 | Ga0307514_10090774 | 3300031649 | Bacteria | 2227 |
| 611 | Ga0307514_10096465 | 3300031649 | Bacteria | 2136 |
| 612 | Ga0316575_10000668 | 3300031665 | Bacteria | 10159 |
| 613 | Ga0316575_10003717 | 3300031665 | Bacteria | 5296 |
| 614 | Ga0316575_10091932 | 3300031665 | Bacteria | 1229 |
| 615 | Ga0316579_10002190 | 3300031691 | Bacteria | 7356 |
| 616 | Ga0316579_10118321 | 3300031691 | Bacteria | 1272 |
| 617 | Ga0265314_10006509 | 3300031711 | Bacteria | 10322 |
| 618 | Ga0265342_10004101 | 3300031712 | Bacteria | 11614 |
| 619 | Ga0316576_10001465 | 3300031727 | Bacteria | 12677 |
| 620 | Ga0316576_10002319 | 3300031727 | Bacteria | 10792 |
| 621 | Ga0316576_10021064 | 3300031727 | Bacteria | 4502 |
| 622 | Ga0316576_10023914 | 3300031727 | Bacteria | 4262 |
| 623 | Ga0316578_10002782 | 3300031728 | Bacteria | 7792 |
| 624 | Ga0316578_10038070 | 3300031728 | Bacteria | 2772 |
| 625 | Ga0307516_10019845 | 3300031730 | Bacteria | 6950 |
| 626 | Ga0307516_10036778 | 3300031730 | Bacteria | 4898 |
| 627 | Ga0307405_10014792 | 3300031731 | Bacteria | 4207 |
| 628 | Ga0307405_10023043 | 3300031731 | Bacteria | 3532 |
| 629 | Ga0307405_10071150 | 3300031731 | Bacteria | 2237 |
| 630 | Ga0307405_10086782 | 3300031731 | Bacteria | 2060 |
| 631 | Ga0307405_10088812 | 3300031731 | Bacteria | 2040 |
| 632 | Ga0307413_10007992 | 3300031824 | Bacteria | 4959 |
| 633 | Ga0307413_10009243 | 3300031824 | Bacteria | 4709 |
| 634 | Ga0307413_10046827 | 3300031824 | Bacteria | 2575 |
| 635 | Ga0307413_10108539 | 3300031824 | Bacteria | 1852 |
| 636 | Ga0307518_10057070 | 3300031838 | Bacteria | 2836 |
| 637 | Ga0307410_10012152 | 3300031852 | Bacteria | 4962 |
| 638 | Ga0307410_10017054 | 3300031852 | Bacteria | 4349 |
| 639 | Ga0307410_10025171 | 3300031852 | Bacteria | 3729 |
| 640 | Ga0307410_10038935 | 3300031852 | Bacteria | 3118 |
| 641 | Ga0307410_10148707 | 3300031852 | Bacteria | 1741 |
| 642 | Ga0307410_10149908 | 3300031852 | Bacteria | 1735 |
| 643 | Ga0307410_10165544 | 3300031852 | Bacteria | 1661 |
| 644 | Ga0307410_10250384 | 3300031852 | Bacteria | 1377 |
| 645 | Ga0307406_10000104 | 3300031901 | Bacteria | 49152 |
| 646 | Ga0307406_10000932 | 3300031901 | Bacteria | 16339 |
| 647 | Ga0307406_10001566 | 3300031901 | Bacteria | 12607 |
| 648 | Ga0307406_10076440 | 3300031901 | Bacteria | 2212 |
| 649 | Ga0307407_10007739 | 3300031903 | Bacteria | 4884 |
| 650 | Ga0307407_10010003 | 3300031903 | Bacteria | 4450 |
| 651 | Ga0307407_10048355 | 3300031903 | Bacteria | 2420 |
| 652 | Ga0307407_10075390 | 3300031903 | Bacteria | 2022 |
| 653 | Ga0307407_10081179 | 3300031903 | Bacteria | 1962 |
| 654 | Ga0307407_10164226 | 3300031903 | Bacteria | 1456 |
| 655 | Ga0307412_10017272 | 3300031911 | Bacteria | 4316 |
| 656 | Ga0307412_10029651 | 3300031911 | Bacteria | 3436 |
| 657 | Ga0307412_10098355 | 3300031911 | Bacteria | 2063 |
| 658 | Ga0307412_10212449 | 3300031911 | Bacteria | 1477 |
| 659 | Ga0307409_100009644 | 3300031995 | Bacteria | 5946 |
| 660 | Ga0307409_100034809 | 3300031995 | Bacteria | 3684 |
| 661 | Ga0307409_100063923 | 3300031995 | Bacteria | 2888 |
| 662 | Ga0307409_100106542 | 3300031995 | Bacteria | 2340 |
| 663 | Ga0307409_100109373 | 3300031995 | Bacteria | 2314 |
| 664 | Ga0307409_100109684 | 3300031995 | Bacteria | 2311 |
| 665 | Ga0307409_100140908 | 3300031995 | Bacteria | 2077 |
| 666 | Ga0307409_100147804 | 3300031995 | Bacteria | 2035 |
| 667 | Ga0307409_100228942 | 3300031995 | Bacteria | 1683 |
| 668 | Ga0307409_100279486 | 3300031995 | Bacteria | 1542 |
| 669 | Ga0307409_100390846 | 3300031995 | Bacteria | 1325 |
| 670 | Ga0307416_100004847 | 3300032002 | Bacteria | 8187 |
| 671 | Ga0307416_100008600 | 3300032002 | Bacteria | 6602 |
| 672 | Ga0307416_100024975 | 3300032002 | Bacteria | 4372 |
| 673 | Ga0307416_100055367 | 3300032002 | Bacteria | 3194 |
| 674 | Ga0307416_100057924 | 3300032002 | Bacteria | 3138 |
| 675 | Ga0307416_100172596 | 3300032002 | Bacteria | 2015 |
| 676 | Ga0307416_100254176 | 3300032002 | Bacteria | 1713 |
| 677 | Ga0307416_100455599 | 3300032002 | Bacteria | 1333 |
| 678 | Ga0307414_10016958 | 3300032004 | Bacteria | 4445 |
| 679 | Ga0307414_10020103 | 3300032004 | Bacteria | 4154 |
| 680 | Ga0307414_10024236 | 3300032004 | Bacteria | 3866 |
| 681 | Ga0307414_10065704 | 3300032004 | Bacteria | 2589 |
| 682 | Ga0307414_10141928 | 3300032004 | Bacteria | 1882 |
| 683 | Ga0307411_10028720 | 3300032005 | Bacteria | 3387 |
| 684 | Ga0307411_10062908 | 3300032005 | Bacteria | 2478 |
| 685 | Ga0307411_10121414 | 3300032005 | Bacteria | 1891 |
| 686 | Ga0307411_10156076 | 3300032005 | Bacteria | 1703 |
| 687 | Ga0307411_10167669 | 3300032005 | Bacteria | 1652 |
| 688 | Ga0307415_100021173 | 3300032126 | Bacteria | 3990 |
| 689 | Ga0307415_100213319 | 3300032126 | Bacteria | 1542 |
| 690 | Ga0307415_100215722 | 3300032126 | Bacteria | 1534 |
| 691 | Ga0307415_100220758 | 3300032126 | Bacteria | 1519 |
| 692 | Ga0316583_10031886 | 3300032133 | Bacteria | 1875 |
| 693 | Ga0316585_10008431 | 3300032137 | Bacteria | 2991 |
| 694 | Ga0307507_10000024 | 3300033179 | Bacteria | 212340 |
| 695 | Ga0307507_10039031 | 3300033179 | Bacteria | 4799 |
| 696 | Ga0307510_10071034 | 3300033180 | Bacteria | 3471 |
| 697 | Ga0307510_10093196 | 3300033180 | Bacteria | 2845 |
| 698 | Ga0316212_1008686 | 3300033547 | Bacteria | 1459 |
| 699 | Ga0373938_0002225 | 3300034957 | Bacteria | 3115 |
| 700 | Ga0373926_0018060 | 3300035083 | Bacteria | 2424 |
| 701 | Ga0373926_0054436 | 3300035083 | Bacteria | 1449 |
| 702 | Ga0373934_0000060 | 3300035086 | Bacteria | 37064 |
| 703 | Ga0373934_0005753 | 3300035086 | Bacteria | 4593 |
| 704 | Ga0373934_0007765 | 3300035086 | Bacteria | 3985 |
| 705 | Ga0373934_0021948 | 3300035086 | Bacteria | 2460 |
| 706 | Ga0373940_0013993 | 3300035088 | Bacteria | 1951 |
| 707 | Ga0373944_0001496 | 3300035089 | Bacteria | 5909 |
| 708 | Ga0373944_0006615 | 3300035089 | Bacteria | 3078 |
| 709 | Ga0373923_0001412 | 3300035111 | Bacteria | 6861 |
| 710 | Ga0373923_0006524 | 3300035111 | Bacteria | 4041 |
| 711 | Ga0373923_0022397 | 3300035111 | Bacteria | 2477 |
| 712 | Ga0373923_0030949 | 3300035111 | Bacteria | 2154 |
| 713 | Ga0373932_0015193 | 3300035112 | Bacteria | 1948 |
| 714 | Ga0373936_0000847 | 3300035113 | Bacteria | 10892 |
| 715 | Ga0373936_0007777 | 3300035113 | Bacteria | 4026 |
| 716 | Ga0373936_0015652 | 3300035113 | Bacteria | 2907 |
| 717 | Ga0373936_0057553 | 3300035113 | Bacteria | 1581 |
| 718 | Ga0373945_0000182 | 3300035116 | Bacteria | 16849 |
| 719 | Ga0373953_0000277 | 3300035117 | Bacteria | 14136 |
| 720 | Ga0373953_0002414 | 3300035117 | Bacteria | 5643 |
| 721 | Ga0373953_0003904 | 3300035117 | Bacteria | 4697 |
| 722 | Ga0373953_0012377 | 3300035117 | Bacteria | 3020 |
| 723 | Ga0373954_0002950 | 3300035118 | Bacteria | 7178 |
| 724 | Ga0373954_0023130 | 3300035118 | Bacteria | 2823 |
| 725 | Ga0373954_0024959 | 3300035118 | Bacteria | 2728 |
| 726 | Ga0373954_0025004 | 3300035118 | Bacteria | 2726 |
| 727 | Ga0373954_0026765 | 3300035118 | Bacteria | 2645 |
| 728 | Ga0373956_0000422 | 3300035119 | Bacteria | 17238 |
| 729 | Ga0373956_0005349 | 3300035119 | Bacteria | 5137 |
| 730 | Ga0373956_0005512 | 3300035119 | Bacteria | 5066 |
| 731 | Ga0373956_0014937 | 3300035119 | Bacteria | 3247 |
| 732 | Ga0373956_0029433 | 3300035119 | Bacteria | 2395 |
| 733 | Ga0373956_0054191 | 3300035119 | Bacteria | 1806 |
| 734 | Ga0373957_0000077 | 3300035120 | Bacteria | 23677 |
| 735 | Ga0373957_0002673 | 3300035120 | Bacteria | 5117 |
| 736 | Ga0373957_0012834 | 3300035120 | Bacteria | 2828 |
| 737 | Ga0373957_0022802 | 3300035120 | Bacteria | 2233 |
| 738 | Ga0373957_0024157 | 3300035120 | Bacteria | 2180 |
| 739 | Ga0373957_0062286 | 3300035120 | Bacteria | 1447 |
| 740 | Ga0373946_0000651 | 3300035171 | Bacteria | 11638 |
| 741 | Ga0373946_0007865 | 3300035171 | Bacteria | 3914 |
| 742 | Ga0373946_0059149 | 3300035171 | Bacteria | 1626 |
| 743 | Ga0373955_0000013 | 3300035172 | Bacteria | 73449 |
| 744 | Ga0373955_0027994 | 3300035172 | Bacteria | 2918 |
| 745 | Ga0373955_0094242 | 3300035172 | Bacteria | 1710 |
| 746 | Ga0373961_0013919 | 3300035241 | Bacteria | 2035 |
| 747 | Ga0316574_0015485 | 3300035398 | Bacteria | 4425 |
| 748 | Ga0316574_0076927 | 3300035398 | Bacteria | 2114 |
| 749 | Ga0373924_0000936 | 3300035410 | Bacteria | 9209 |
| 750 | Ga0373924_0009894 | 3300035410 | Bacteria | 3507 |
| 751 | Ga0373935_0007297 | 3300035692 | Bacteria | 6609 |
| 752 | Ga0373935_0037830 | 3300035692 | Bacteria | 3020 |
| 753 | Ga0373935_0131404 | 3300035692 | Bacteria | 1682 |
| 754 | Ga0373927_0012605 | 3300035695 | Bacteria | 5624 |
| 755 | Ga0373927_0015053 | 3300035695 | Bacteria | 5113 |
| 756 | Ga0373927_0144016 | 3300035695 | Bacteria | 1559 |
| 757 | Ga0373933_0000139 | 3300035724 | Bacteria | 46756 |
| 758 | Ga0373933_0001396 | 3300035724 | Bacteria | 14183 |
| 759 | Ga0373933_0013994 | 3300035724 | Bacteria | 4451 |
| 760 | Ga0373933_0044507 | 3300035724 | Bacteria | 2629 |
| 761 | Ga0373947_0007347 | 3300035725 | Bacteria | 6378 |
| 762 | Ga0373947_0123178 | 3300035725 | Bacteria | 1649 |
| 763 | Ga0373947_0131535 | 3300035725 | Bacteria | 1598 |
| 764 | Ga0373937_0000112 | 3300036401 | Bacteria | 77473 |
| 765 | Ga0373937_0008701 | 3300036401 | Bacteria | 8819 |
| 766 | Ga0373937_0010609 | 3300036401 | Bacteria | 8049 |
| 767 | Ga0373937_0037477 | 3300036401 | Bacteria | 4418 |
| 768 | Ga0373937_0193865 | 3300036401 | Bacteria | 1909 |
| 769 | Ga0373937_0208875 | 3300036401 | Bacteria | 1836 |
| 770 | Ga0372808_001746 | 3300036459 | Bacteria | 2349 |
| 771 | Ga0316582_0004467 | 3300036647 | Bacteria | 7080 |
| 772 | Ga0316582_0039405 | 3300036647 | Bacteria | 2942 |
| 773 | Ga0316584_0003649 | 3300036712 | Bacteria | 10076 |
| 774 | Ga0316584_0005041 | 3300036712 | Bacteria | 8802 |
| 775 | Ga0316584_0012623 | 3300036712 | Bacteria | 5960 |
| 776 | Ga0316584_0016410 | 3300036712 | Bacteria | 5309 |
| 777 | Ga0316584_0030549 | 3300036712 | Bacteria | 3978 |
| 778 | Ga0373925_0000008 | 3300037068 | Bacteria | 249158 |
| 779 | Ga0373925_0002037 | 3300037068 | Bacteria | 16694 |
| 780 | Ga0373925_0003433 | 3300037068 | Bacteria | 12260 |
| 781 | Ga0373925_0007151 | 3300037068 | Bacteria | 8159 |
| 782 | Ga0373925_0147876 | 3300037068 | Bacteria | 1842 |
| 783 | Ga0395899_0005583 | 3300037312 | Bacteria | 9756 |
| 784 | Ga0395899_0017225 | 3300037312 | Bacteria | 5505 |
| 785 | Ga0395899_0032197 | 3300037312 | Bacteria | 3939 |
| 786 | Ga0395899_0038763 | 3300037312 | Bacteria | 3567 |
| 787 | Ga0395899_0040320 | 3300037312 | Bacteria | 3493 |
| 788 | Ga0395899_0076971 | 3300037312 | Bacteria | 2434 |
| 789 | Ga0395899_0110727 | 3300037312 | Bacteria | 1975 |
| 790 | Ga0395899_0184253 | 3300037312 | Bacteria | 1464 |
| 791 | Ga0395900_0011102 | 3300037418 | Bacteria | 9206 |
| 792 | Ga0395900_0093930 | 3300037418 | Bacteria | 3081 |
| 793 | Ga0395900_0102603 | 3300037418 | Bacteria | 2938 |
| 794 | Ga0395900_0209796 | 3300037418 | Bacteria | 1967 |
| 795 | Ga0395900_0407188 | 3300037418 | Bacteria | 1323 |
| 796 | Ga0395898_0000381 | 3300037466 | Bacteria | 97274 |
| 797 | Ga0395898_0001626 | 3300037466 | Bacteria | 30485 |
| 798 | Ga0395898_0006252 | 3300037466 | Bacteria | 12744 |
| 799 | Ga0395898_0016357 | 3300037466 | Bacteria | 7592 |
| 800 | Ga0395898_0020646 | 3300037466 | Bacteria | 6689 |
| 801 | Ga0395898_0027833 | 3300037466 | Bacteria | 5668 |
| 802 | Ga0395898_0031520 | 3300037466 | Bacteria | 5296 |
| 803 | Ga0395898_0057057 | 3300037466 | Bacteria | 3805 |
| 804 | Ga0395898_0070700 | 3300037466 | Bacteria | 3373 |
| 805 | Ga0395898_0089016 | 3300037466 | Bacteria | 2971 |
| 806 | Ga0395898_0346841 | 3300037466 | Bacteria | 1416 |
| 807 | Ga0395898_0367269 | 3300037466 | Bacteria | 1372 |
| 808 | Ga0436364_0160104 | 3300037853 | Bacteria | 3213 |
| 809 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 810 | Ga0436364_0464514 | 3300037853 | Bacteria | 2581 |
| 811 | Ga0436364_0964211 | 3300037853 | Bacteria | 1702 |
| 812 | Ga0436364_1096374 | 3300037853 | Bacteria | 1783 |
| 813 | Ga0436364_1261806 | 3300037853 | Bacteria | 5053 |
| 814 | Ga0436364_1274663 | 3300037853 | Bacteria | 8091 |
| 815 | Ga0436364_1379988 | 3300037853 | Bacteria | 24630 |
| 816 | Ga0436364_1399659 | 3300037853 | Bacteria | 2774 |
| 817 | Ga0395901_0036787 | 3300038443 | Bacteria | 5061 |
| 818 | Ga0395901_0071477 | 3300038443 | Bacteria | 3616 |
| 819 | Ga0395901_0079374 | 3300038443 | Bacteria | 3427 |
| 820 | Ga0395901_0111329 | 3300038443 | Bacteria | 2875 |
| 821 | Ga0395901_0131820 | 3300038443 | Bacteria | 2626 |
| 822 | Ga0395901_0135263 | 3300038443 | Bacteria | 2591 |
| 823 | Ga0395901_0145256 | 3300038443 | Bacteria | 2493 |
| 824 | Ga0395901_0240809 | 3300038443 | Bacteria | 1887 |
| 825 | Ga0395901_0272956 | 3300038443 | Bacteria | 1758 |
| 826 | Ga0395901_0486909 | 3300038443 | Bacteria | 1257 |
| 827 | Ga0400485_14348 | 3300038735 | Bacteria | 15612 |
| 828 | Ga0400488_19742 | 3300038741 | Bacteria | 1306 |
| 829 | Ga0400486_32183 | 3300038742 | Bacteria | 37185 |
| 830 | Ga0436365_1516734 | 3300039437 | Bacteria | 2369 |
| 831 | Ga0436360_1265940 | 3300039438 | Bacteria | 1838 |
| 832 | Ga0439436_0001906 | 3300041404 | Bacteria | 6173 |
| 833 | Ga0439436_0004852 | 3300041404 | Bacteria | 4127 |
| 834 | Ga0439436_0012938 | 3300041404 | Bacteria | 2528 |
| 835 | Ga0439436_0020025 | 3300041404 | Bacteria | 1993 |
| 836 | Ga0439436_0037014 | 3300041404 | Bacteria | 1406 |
| 837 | Ga0439438_052622 | 3300041405 | Bacteria | 1032 |
| 838 | Ga0439439_0001108 | 3300041406 | Bacteria | 5147 |
| 839 | Ga0439439_0002397 | 3300041406 | Bacteria | 3975 |
| 840 | Ga0439447_016639 | 3300041407 | Bacteria | 2015 |
| 841 | Ga0439466_0004226 | 3300041411 | Bacteria | 5546 |
| 842 | Ga0439466_0004258 | 3300041411 | Bacteria | 5522 |
| 843 | Ga0451791_0795391 | 3300041451 | Bacteria | 1382 |
| 844 | Ga0451791_1067624 | 3300041451 | Bacteria | 5132 |
| 845 | Ga0451793_0283208 | 3300041452 | Bacteria | 5544 |
| 846 | Ga0451797_0921282 | 3300041453 | Bacteria | 2572 |
| 847 | Ga0451802_0199680 | 3300041460 | Bacteria | 2116 |
| 848 | Ga0451807_0181894 | 3300041486 | Bacteria | 2199 |
| 849 | Ga0451833_1396629 | 3300041491 | Bacteria | 1597 |
| 850 | Ga0451837_1299351 | 3300041494 | Bacteria | 1455 |
| 851 | Ga0451839_1074799 | 3300041496 | Bacteria | 3420 |
| 852 | Ga0451853_0509641 | 3300041512 | Bacteria | 3460 |
| 853 | Ga0451853_2323682 | 3300041512 | Bacteria | 3405 |
| 854 | Ga0439433_0000156 | 3300041999 | Bacteria | 10531 |
| 855 | Ga0439433_0000220 | 3300041999 | Bacteria | 9358 |
| 856 | Ga0439442_000012 | 3300042002 | Bacteria | 49187 |
| 857 | Ga0439442_000083 | 3300042002 | Bacteria | 22714 |
| 858 | Ga0439442_000162 | 3300042002 | Bacteria | 16792 |
| 859 | Ga0439442_004696 | 3300042002 | Bacteria | 2716 |
| 860 | Ga0439442_009119 | 3300042002 | Bacteria | 2005 |
| 861 | Ga0439449_0000984 | 3300042007 | Bacteria | 11198 |
| 862 | Ga0439449_0029595 | 3300042007 | Bacteria | 2041 |
| 863 | Ga0439452_007207 | 3300042010 | Bacteria | 3421 |
| 864 | Ga0439457_000027 | 3300042014 | Bacteria | 29657 |
| 865 | Ga0439457_003698 | 3300042014 | Bacteria | 4122 |
| 866 | Ga0439457_004957 | 3300042014 | Bacteria | 3405 |
| 867 | Ga0439462_0041974 | 3300042015 | Bacteria | 1222 |
| 868 | Ga0439462_0057144 | 3300042015 | Bacteria | 1053 |
| 869 | Ga0450894_000043 | 3300042131 | Bacteria | 18761 |
| 870 | Ga0450907_000265 | 3300042146 | Bacteria | 17745 |
| 871 | Ga0450907_005873 | 3300042146 | Bacteria | 2060 |
| 872 | Ga0439458_0001450 | 3300042157 | Bacteria | 5973 |
| 873 | Ga0450909_000182 | 3300042185 | Bacteria | 7060 |
| 874 | Ga0439434_0000031 | 3300042435 | Bacteria | 33054 |
| 875 | Ga0439434_0003626 | 3300042435 | Bacteria | 4515 |
| 876 | Ga0439434_0013610 | 3300042435 | Bacteria | 2416 |
| 877 | Ga0450918_000950 | 3300042531 | Bacteria | 6051 |
| 878 | Ga0450918_003686 | 3300042531 | Bacteria | 2836 |
| 879 | Ga0466969_0019697 | 3300044656 | Bacteria | 3503 |
| 880 | Ga0466969_0030935 | 3300044656 | Bacteria | 2725 |
| 881 | Ga0466969_0037022 | 3300044656 | Bacteria | 2462 |
| 882 | Ga0466972_0004584 | 3300044658 | Bacteria | 6926 |
| 883 | Ga0466972_0035044 | 3300044658 | Bacteria | 2457 |
| 884 | Ga0466972_0047412 | 3300044658 | Bacteria | 2078 |
| 885 | Ga0466972_0059802 | 3300044658 | Bacteria | 1828 |
| 886 | Ga0466965_0000038 | 3300044683 | Bacteria | 47424 |
| 887 | Ga0466965_0013448 | 3300044683 | Bacteria | 3861 |
| 888 | Ga0466965_0034551 | 3300044683 | Bacteria | 2473 |
| 889 | Ga0466965_0046392 | 3300044683 | Bacteria | 2151 |
| 890 | Ga0466966_0032573 | 3300044684 | Bacteria | 3377 |
| 891 | Ga0466966_0058359 | 3300044684 | Bacteria | 2439 |
| 892 | Ga0466966_0189110 | 3300044684 | Bacteria | 1248 |
| 893 | Ga0466961_0000630 | 3300044693 | Bacteria | 22090 |
| 894 | Ga0466961_0004359 | 3300044693 | Bacteria | 8866 |
| 895 | Ga0466961_0004420 | 3300044693 | Bacteria | 8800 |
| 896 | Ga0466961_0031022 | 3300044693 | Bacteria | 3435 |
| 897 | Ga0466961_0048035 | 3300044693 | Bacteria | 2728 |
| 898 | Ga0466961_0072229 | 3300044693 | Bacteria | 2189 |
| 899 | Ga0466963_0000611 | 3300044694 | Bacteria | 17115 |
| 900 | Ga0466963_0002295 | 3300044694 | Bacteria | 10636 |
| 901 | Ga0466963_0074190 | 3300044694 | Bacteria | 2294 |
| 902 | Ga0466963_0191155 | 3300044694 | Bacteria | 1430 |
| 903 | Ga0466963_0255975 | 3300044694 | Bacteria | 1229 |
| 904 | Ga0466971_0000512 | 3300044719 | Bacteria | 15294 |
| 905 | Ga0466971_0001195 | 3300044719 | Bacteria | 10780 |
| 906 | Ga0466971_0001379 | 3300044719 | Bacteria | 10183 |
| 907 | Ga0466971_0084173 | 3300044719 | Bacteria | 1452 |
| 908 | Ga0466968_0010980 | 3300044735 | Bacteria | 3521 |
| 909 | Ga0466970_0000322 | 3300044765 | Bacteria | 23272 |
| 910 | Ga0466970_0002564 | 3300044765 | Bacteria | 8766 |
| 911 | Ga0466970_0004093 | 3300044765 | Bacteria | 7170 |
| 912 | Ga0466970_0013270 | 3300044765 | Bacteria | 4223 |
| 913 | Ga0466970_0020549 | 3300044765 | Bacteria | 3432 |
| 914 | Ga0466970_0027254 | 3300044765 | Bacteria | 2997 |
| 915 | Ga0466970_0044803 | 3300044765 | Bacteria | 2355 |
| 916 | Ga0466970_0057628 | 3300044765 | Bacteria | 2077 |
| 917 | Ga0466957_0000143 | 3300044842 | Bacteria | 30758 |
| 918 | Ga0466957_0108661 | 3300044842 | Bacteria | 1757 |
| 919 | Ga0466960_0009565 | 3300044901 | Bacteria | 4000 |
| 920 | Ga0466960_0012316 | 3300044901 | Bacteria | 3605 |
| 921 | Ga0466960_0029449 | 3300044901 | Bacteria | 2520 |
| 922 | Ga0466960_0029531 | 3300044901 | Bacteria | 2516 |
| 923 | Ga0466960_0118455 | 3300044901 | Bacteria | 1384 |
| 924 | Ga0466959_0005248 | 3300045049 | Bacteria | 8845 |
| 925 | Ga0466959_0051206 | 3300045049 | Bacteria | 3030 |
| 926 | Ga0466959_0059799 | 3300045049 | Bacteria | 2773 |
| 927 | Ga0466959_0196100 | 3300045049 | Bacteria | 1407 |
| 928 | Ga0466958_0003353 | 3300045836 | Bacteria | 8302 |
| 929 | Ga0466958_0017403 | 3300045836 | Bacteria | 4154 |
| 930 | Ga0466958_0047464 | 3300045836 | Bacteria | 2593 |
| 931 | Ga0466958_0071467 | 3300045836 | Bacteria | 2125 |
| 932 | Ga0466958_0111387 | 3300045836 | Bacteria | 1709 |
| 933 | Ga0466958_0172368 | 3300045836 | Bacteria | 1370 |
| 934 | Ga0466967_0009414 | 3300045976 | Bacteria | 7245 |
| 935 | Ga0466967_0027218 | 3300045976 | Bacteria | 4753 |
| 936 | Ga0466967_0053667 | 3300045976 | Bacteria | 3544 |
| 937 | Ga0466967_0080891 | 3300045976 | Bacteria | 2933 |
| 938 | Ga0466967_0546302 | 3300045976 | Bacteria | 1140 |
| 939 | Ga0495627_001457 | 3300046453 | Bacteria | 13875 |
| 940 | Ga0495627_033005 | 3300046453 | Bacteria | 1625 |
| 941 | Ga0495592_0000094 | 3300046454 | Bacteria | 78801 |
| 942 | Ga0495592_0000481 | 3300046454 | Bacteria | 29134 |
| 943 | Ga0495592_0008825 | 3300046454 | Bacteria | 7571 |
| 944 | Ga0495592_0032917 | 3300046454 | Bacteria | 3910 |
| 945 | Ga0495592_0086011 | 3300046454 | Bacteria | 2265 |
| 946 | Ga0495592_0103099 | 3300046454 | Bacteria | 2030 |
| 947 | Ga0495592_0110410 | 3300046454 | Bacteria | 1946 |
| 948 | Ga0495592_0121173 | 3300046454 | Bacteria | 1840 |
| 949 | Ga0495603_0001779 | 3300046455 | Bacteria | 12705 |
| 950 | Ga0495603_0006149 | 3300046455 | Bacteria | 7176 |
| 951 | Ga0495603_0012191 | 3300046455 | Bacteria | 5205 |
| 952 | Ga0495603_0167868 | 3300046455 | Bacteria | 1271 |
| 953 | Ga0495590_0000094 | 3300046457 | Bacteria | 54669 |
| 954 | Ga0495590_0010180 | 3300046457 | Bacteria | 3543 |
| 955 | Ga0495629_0002238 | 3300046459 | Bacteria | 14917 |
| 956 | Ga0495629_0004014 | 3300046459 | Bacteria | 11058 |
| 957 | Ga0495629_0005922 | 3300046459 | Bacteria | 9112 |
| 958 | Ga0495629_0017611 | 3300046459 | Bacteria | 5121 |
| 959 | Ga0495629_0079132 | 3300046459 | Bacteria | 2295 |
| 960 | Ga0495638_0024022 | 3300046460 | Bacteria | 3979 |
| 961 | Ga0495638_0183544 | 3300046460 | Bacteria | 1192 |
| 962 | Ga0495641_0007164 | 3300046461 | Bacteria | 7040 |
| 963 | Ga0495641_0014070 | 3300046461 | Bacteria | 4349 |
| 964 | Ga0495641_0016263 | 3300046461 | Bacteria | 3926 |
| 965 | Ga0495641_0040202 | 3300046461 | Bacteria | 2176 |
| 966 | Ga0495651_0000041 | 3300046462 | Bacteria | 94160 |
| 967 | Ga0495651_0002291 | 3300046462 | Bacteria | 14763 |
| 968 | Ga0495651_0009757 | 3300046462 | Bacteria | 7383 |
| 969 | Ga0495651_0013168 | 3300046462 | Bacteria | 6392 |
| 970 | Ga0495651_0042337 | 3300046462 | Bacteria | 3536 |
| 971 | Ga0495651_0042569 | 3300046462 | Bacteria | 3525 |
| 972 | Ga0495651_0068071 | 3300046462 | Bacteria | 2714 |
| 973 | Ga0495651_0073357 | 3300046462 | Bacteria | 2598 |
| 974 | Ga0495651_0077794 | 3300046462 | Bacteria | 2510 |
| 975 | Ga0495651_0081622 | 3300046462 | Bacteria | 2440 |
| 976 | Ga0495651_0084716 | 3300046462 | Bacteria | 2388 |
| 977 | Ga0495653_0002267 | 3300046463 | Bacteria | 15220 |
| 978 | Ga0495653_0006276 | 3300046463 | Bacteria | 9755 |
| 979 | Ga0495653_0007658 | 3300046463 | Bacteria | 8837 |
| 980 | Ga0495653_0026502 | 3300046463 | Bacteria | 4646 |
| 981 | Ga0495653_0039274 | 3300046463 | Bacteria | 3708 |
| 982 | Ga0495653_0045800 | 3300046463 | Bacteria | 3389 |
| 983 | Ga0495653_0137825 | 3300046463 | Bacteria | 1719 |
| 984 | Ga0495650_0016212 | 3300046471 | Bacteria | 3783 |
| 985 | Ga0495650_0060587 | 3300046471 | Bacteria | 1519 |
| 986 | Ga0495580_0016321 | 3300046472 | Bacteria | 5577 |
| 987 | Ga0495580_0023584 | 3300046472 | Bacteria | 4515 |
| 988 | Ga0495580_0044397 | 3300046472 | Bacteria | 3161 |
| 989 | Ga0495580_0078078 | 3300046472 | Bacteria | 2309 |
| 990 | Ga0495582_0001614 | 3300046473 | Bacteria | 12697 |
| 991 | Ga0495582_0015676 | 3300046473 | Bacteria | 4159 |
| 992 | Ga0495582_0070053 | 3300046473 | Bacteria | 1939 |
| 993 | Ga0495582_0120796 | 3300046473 | Bacteria | 1476 |
| 994 | Ga0495605_0021869 | 3300046474 | Bacteria | 3382 |
| 995 | Ga0495639_0001608 | 3300046475 | Bacteria | 10058 |
| 996 | Ga0495639_0006034 | 3300046475 | Bacteria | 5205 |
| 997 | Ga0495662_0000490 | 3300046476 | Bacteria | 18037 |
| 998 | Ga0495662_0001269 | 3300046476 | Bacteria | 12479 |
| 999 | Ga0495662_0006654 | 3300046476 | Bacteria | 5764 |
| 1000 | Ga0495662_0015157 | 3300046476 | Bacteria | 3745 |
| 1001 | Ga0495662_0017624 | 3300046476 | Bacteria | 3457 |
| 1002 | Ga0495662_0022376 | 3300046476 | Bacteria | 3052 |
| 1003 | Ga0495662_0098602 | 3300046476 | Bacteria | 1429 |
| 1004 | Ga0495664_0000351 | 3300046477 | Bacteria | 22346 |
| 1005 | Ga0495664_0002132 | 3300046477 | Bacteria | 10569 |
| 1006 | Ga0495664_0012658 | 3300046477 | Bacteria | 4778 |
| 1007 | Ga0495664_0013992 | 3300046477 | Bacteria | 4545 |
| 1008 | Ga0495664_0014416 | 3300046477 | Bacteria | 4481 |
| 1009 | Ga0495664_0023780 | 3300046477 | Bacteria | 3557 |
| 1010 | Ga0495664_0045484 | 3300046477 | Bacteria | 2603 |
| 1011 | Ga0495664_0095689 | 3300046477 | Bacteria | 1787 |
| 1012 | Ga0495664_0121248 | 3300046477 | Bacteria | 1581 |
| 1013 | Ga0495584_0011675 | 3300046491 | Bacteria | 4496 |
| 1014 | Ga0495585_0002304 | 3300046492 | Bacteria | 13754 |
| 1015 | Ga0495594_0008762 | 3300046499 | Bacteria | 5215 |
| 1016 | Ga0495594_0025952 | 3300046499 | Bacteria | 3151 |
| 1017 | Ga0495594_0044164 | 3300046499 | Bacteria | 2444 |
| 1018 | Ga0495594_0117357 | 3300046499 | Bacteria | 1503 |
| 1019 | Ga0495596_0024389 | 3300046500 | Bacteria | 2448 |
| 1020 | Ga0495607_0129690 | 3300046501 | Bacteria | 1313 |
| 1021 | Ga0495608_0000081 | 3300046511 | Bacteria | 69898 |
| 1022 | Ga0495608_0005238 | 3300046511 | Bacteria | 9265 |
| 1023 | Ga0495608_0005899 | 3300046511 | Bacteria | 8712 |
| 1024 | Ga0495608_0009160 | 3300046511 | Bacteria | 6919 |
| 1025 | Ga0495608_0012635 | 3300046511 | Bacteria | 5859 |
| 1026 | Ga0495608_0015039 | 3300046511 | Bacteria | 5368 |
| 1027 | Ga0495608_0022768 | 3300046511 | Bacteria | 4298 |
| 1028 | Ga0495608_0038030 | 3300046511 | Bacteria | 3234 |
| 1029 | Ga0495616_0008848 | 3300046513 | Bacteria | 5924 |
| 1030 | Ga0495618_0007735 | 3300046514 | Bacteria | 6501 |
| 1031 | Ga0495618_0016327 | 3300046514 | Bacteria | 4540 |
| 1032 | Ga0495618_0087836 | 3300046514 | Bacteria | 1988 |
| 1033 | Ga0495618_0108606 | 3300046514 | Bacteria | 1776 |
| 1034 | Ga0495618_0126501 | 3300046514 | Bacteria | 1636 |
| 1035 | Ga0495620_0020344 | 3300046515 | Bacteria | 3242 |
| 1036 | Ga0495628_0000164 | 3300046516 | Bacteria | 57810 |
| 1037 | Ga0495628_0017977 | 3300046516 | Bacteria | 5865 |
| 1038 | Ga0495628_0027448 | 3300046516 | Bacteria | 4632 |
| 1039 | Ga0495628_0038786 | 3300046516 | Bacteria | 3811 |
| 1040 | Ga0495628_0067706 | 3300046516 | Bacteria | 2787 |
| 1041 | Ga0495628_0069623 | 3300046516 | Bacteria | 2744 |
| 1042 | Ga0495628_0112235 | 3300046516 | Bacteria | 2095 |
| 1043 | Ga0495628_0112763 | 3300046516 | Bacteria | 2090 |
| 1044 | Ga0495628_0134712 | 3300046516 | Bacteria | 1888 |
| 1045 | Ga0495628_0138633 | 3300046516 | Bacteria | 1857 |
| 1046 | Ga0495630_0026724 | 3300046517 | Bacteria | 4275 |
| 1047 | Ga0495630_0049619 | 3300046517 | Bacteria | 3141 |
| 1048 | Ga0495630_0118189 | 3300046517 | Bacteria | 2010 |
| 1049 | Ga0495630_0172843 | 3300046517 | Bacteria | 1646 |
| 1050 | Ga0495631_0004932 | 3300046518 | Bacteria | 7033 |
| 1051 | Ga0495631_0025816 | 3300046518 | Bacteria | 2702 |
| 1052 | Ga0495632_0085526 | 3300046519 | Bacteria | 1500 |
| 1053 | Ga0495637_0051577 | 3300046520 | Bacteria | 1721 |
| 1054 | Ga0495643_0001347 | 3300046522 | Bacteria | 23107 |
| 1055 | Ga0495643_0056504 | 3300046522 | Bacteria | 2095 |
| 1056 | Ga0495663_0025093 | 3300046525 | Bacteria | 1737 |
| 1057 | Ga0495652_0000289 | 3300046529 | Bacteria | 59692 |
| 1058 | Ga0495652_0020655 | 3300046529 | Bacteria | 5854 |
| 1059 | Ga0495652_0026494 | 3300046529 | Bacteria | 5122 |
| 1060 | Ga0495652_0069294 | 3300046529 | Bacteria | 2953 |
| 1061 | Ga0495652_0080266 | 3300046529 | Bacteria | 2695 |
| 1062 | Ga0495652_0102644 | 3300046529 | Bacteria | 2316 |
| 1063 | Ga0495652_0122654 | 3300046529 | Bacteria | 2069 |
| 1064 | Ga0495652_0162901 | 3300046529 | Bacteria | 1729 |
| 1065 | Ga0495654_0023227 | 3300046530 | Bacteria | 3213 |
| 1066 | Ga0495665_0001175 | 3300046531 | Bacteria | 13940 |
| 1067 | Ga0495665_0002775 | 3300046531 | Bacteria | 9454 |
| 1068 | Ga0495665_0003528 | 3300046531 | Bacteria | 8493 |
| 1069 | Ga0495665_0026611 | 3300046531 | Bacteria | 3106 |
| 1070 | Ga0495665_0101074 | 3300046531 | Bacteria | 1513 |
| 1071 | Ga0495640_0013085 | 3300046533 | Bacteria | 6318 |
| 1072 | Ga0495640_0022205 | 3300046533 | Bacteria | 4643 |
| 1073 | Ga0495640_0026527 | 3300046533 | Bacteria | 4185 |
| 1074 | Ga0495640_0040085 | 3300046533 | Bacteria | 3281 |
| 1075 | Ga0495640_0045928 | 3300046533 | Bacteria | 3029 |
| 1076 | Ga0495640_0050900 | 3300046533 | Bacteria | 2850 |
| 1077 | Ga0495640_0125465 | 3300046533 | Bacteria | 1665 |
| 1078 | Ga0495586_0005989 | 3300046535 | Bacteria | 6503 |
| 1079 | Ga0495586_0017800 | 3300046535 | Bacteria | 3781 |
| 1080 | Ga0495586_0035870 | 3300046535 | Bacteria | 2663 |
| 1081 | Ga0495586_0040418 | 3300046535 | Bacteria | 2509 |
| 1082 | Ga0495586_0070150 | 3300046535 | Bacteria | 1913 |
| 1083 | Ga0495586_0081510 | 3300046535 | Bacteria | 1778 |
| 1084 | Ga0495586_0114722 | 3300046535 | Bacteria | 1501 |
| 1085 | Ga0495587_0000038 | 3300046536 | Bacteria | 116118 |
| 1086 | Ga0495587_0002540 | 3300046536 | Bacteria | 12202 |
| 1087 | Ga0495587_0003607 | 3300046536 | Bacteria | 10300 |
| 1088 | Ga0495587_0004772 | 3300046536 | Bacteria | 8900 |
| 1089 | Ga0495587_0006829 | 3300046536 | Bacteria | 7428 |
| 1090 | Ga0495587_0011078 | 3300046536 | Bacteria | 5719 |
| 1091 | Ga0495587_0042335 | 3300046536 | Bacteria | 2716 |
| 1092 | Ga0495587_0259725 | 3300046536 | Bacteria | 976 |
| 1093 | Ga0495609_0027336 | 3300046538 | Bacteria | 2608 |
| 1094 | Ga0495609_0043122 | 3300046538 | Bacteria | 2025 |
| 1095 | Ga0495597_0011805 | 3300046542 | Bacteria | 4229 |
| 1096 | Ga0495645_0002826 | 3300046543 | Bacteria | 11777 |
| 1097 | Ga0495645_0004680 | 3300046543 | Bacteria | 9340 |
| 1098 | Ga0495645_0017922 | 3300046543 | Bacteria | 5081 |
| 1099 | Ga0495645_0031690 | 3300046543 | Bacteria | 3852 |
| 1100 | Ga0495645_0032889 | 3300046543 | Bacteria | 3783 |
| 1101 | Ga0495645_0056280 | 3300046543 | Bacteria | 2855 |
| 1102 | Ga0495645_0078459 | 3300046543 | Bacteria | 2373 |
| 1103 | Ga0495645_0107550 | 3300046543 | Bacteria | 1977 |
| 1104 | Ga0495645_0124372 | 3300046543 | Bacteria | 1813 |
| 1105 | Ga0495645_0150757 | 3300046543 | Bacteria | 1615 |
| 1106 | Ga0495645_0180555 | 3300046543 | Bacteria | 1446 |
| 1107 | Ga0495622_0006569 | 3300046557 | Bacteria | 5392 |
| 1108 | Ga0495667_0000070 | 3300046559 | Bacteria | 78776 |
| 1109 | Ga0495667_0003737 | 3300046559 | Bacteria | 10240 |
| 1110 | Ga0495667_0038072 | 3300046559 | Bacteria | 3203 |
| 1111 | Ga0495667_0052664 | 3300046559 | Bacteria | 2680 |
| 1112 | Ga0495667_0067051 | 3300046559 | Bacteria | 2345 |
| 1113 | Ga0495667_0087278 | 3300046559 | Bacteria | 2023 |
| 1114 | Ga0495667_0119304 | 3300046559 | Bacteria | 1703 |
| 1115 | Ga0495667_0173174 | 3300046559 | Bacteria | 1386 |
| 1116 | Ga0495634_0002454 | 3300046642 | Bacteria | 15402 |
| 1117 | Ga0495634_0028577 | 3300046642 | Bacteria | 3869 |
| 1118 | Ga0495634_0041285 | 3300046642 | Bacteria | 3134 |
| 1119 | Ga0495634_0098856 | 3300046642 | Bacteria | 1887 |
| 1120 | Ga0495611_0026253 | 3300046648 | Bacteria | 2540 |
| 1121 | Ga0495625_0010712 | 3300046660 | Bacteria | 7549 |
| 1122 | Ga0495635_0002501 | 3300046663 | Bacteria | 12559 |
| 1123 | Ga0495635_0007697 | 3300046663 | Bacteria | 7515 |
| 1124 | Ga0495635_0016282 | 3300046663 | Bacteria | 5191 |
| 1125 | Ga0495635_0032208 | 3300046663 | Bacteria | 3637 |
| 1126 | Ga0495635_0032458 | 3300046663 | Bacteria | 3622 |
| 1127 | Ga0495635_0045447 | 3300046663 | Bacteria | 3030 |
| 1128 | Ga0495635_0078795 | 3300046663 | Bacteria | 2255 |
| 1129 | Ga0495659_0006157 | 3300046664 | Bacteria | 3792 |
| 1130 | Ga0495588_0054453 | 3300046674 | Bacteria | 2064 |
| 1131 | Ga0495588_0074525 | 3300046674 | Bacteria | 1767 |
| 1132 | Ga0495657_0000192 | 3300046675 | Bacteria | 55017 |
| 1133 | Ga0495657_0001801 | 3300046675 | Bacteria | 18344 |
| 1134 | Ga0495657_0007863 | 3300046675 | Bacteria | 8184 |
| 1135 | Ga0495657_0017701 | 3300046675 | Bacteria | 5169 |
| 1136 | Ga0495657_0019259 | 3300046675 | Bacteria | 4926 |
| 1137 | Ga0495657_0034064 | 3300046675 | Bacteria | 3540 |
| 1138 | Ga0495657_0034170 | 3300046675 | Bacteria | 3533 |
| 1139 | Ga0495657_0062590 | 3300046675 | Bacteria | 2457 |
| 1140 | Ga0495657_0114737 | 3300046675 | Bacteria | 1702 |
| 1141 | Ga0495657_0116754 | 3300046675 | Bacteria | 1684 |
| 1142 | Ga0495599_0000100 | 3300046678 | Bacteria | 60814 |
| 1143 | Ga0495599_0007362 | 3300046678 | Bacteria | 6671 |
| 1144 | Ga0495599_0018592 | 3300046678 | Bacteria | 4329 |
| 1145 | Ga0495599_0028460 | 3300046678 | Bacteria | 3503 |
| 1146 | Ga0495599_0050021 | 3300046678 | Bacteria | 2619 |
| 1147 | Ga0495623_0000409 | 3300046679 | Bacteria | 28354 |
| 1148 | Ga0495623_0002698 | 3300046679 | Bacteria | 11725 |
| 1149 | Ga0495623_0016055 | 3300046679 | Bacteria | 4839 |
| 1150 | Ga0495623_0040737 | 3300046679 | Bacteria | 2965 |
| 1151 | Ga0495623_0047715 | 3300046679 | Bacteria | 2718 |
| 1152 | Ga0495623_0060152 | 3300046679 | Bacteria | 2384 |
| 1153 | Ga0495623_0094606 | 3300046679 | Bacteria | 1827 |
| 1154 | Ga0495646_0005300 | 3300046680 | Bacteria | 8141 |
| 1155 | Ga0495646_0046110 | 3300046680 | Bacteria | 2659 |
| 1156 | Ga0495646_0051293 | 3300046680 | Bacteria | 2497 |
| 1157 | Ga0495647_0003185 | 3300046681 | Bacteria | 5254 |
| 1158 | Ga0495647_0011635 | 3300046681 | Bacteria | 3017 |
| 1159 | Ga0495658_0002514 | 3300046683 | Bacteria | 9224 |
| 1160 | Ga0495658_0038925 | 3300046683 | Bacteria | 2635 |
| 1161 | Ga0495658_0087508 | 3300046683 | Bacteria | 1840 |
| 1162 | Ga0495613_0004118 | 3300046689 | Bacteria | 10875 |
| 1163 | Ga0495613_0005121 | 3300046689 | Bacteria | 9835 |
| 1164 | Ga0495613_0007805 | 3300046689 | Bacteria | 7963 |
| 1165 | Ga0495613_0017497 | 3300046689 | Bacteria | 5336 |
| 1166 | Ga0495613_0043432 | 3300046689 | Bacteria | 3325 |
| 1167 | Ga0495613_0222982 | 3300046689 | Bacteria | 1323 |
| 1168 | Ga0495624_0006182 | 3300046690 | Bacteria | 8513 |
| 1169 | Ga0495624_0022253 | 3300046690 | Bacteria | 4194 |
| 1170 | Ga0495624_0046417 | 3300046690 | Bacteria | 2761 |
| 1171 | Ga0495624_0049837 | 3300046690 | Bacteria | 2654 |
| 1172 | Ga0495624_0092011 | 3300046690 | Bacteria | 1870 |
| 1173 | Ga0495670_0023417 | 3300046691 | Bacteria | 3048 |
| 1174 | Ga0495670_0071207 | 3300046691 | Bacteria | 1760 |
| 1175 | Ga0495671_0005333 | 3300046692 | Bacteria | 7543 |
| 1176 | Ga0495589_0022703 | 3300046794 | Bacteria | 3200 |
| 1177 | Ga0495600_0001188 | 3300046809 | Bacteria | 14237 |
| 1178 | Ga0495600_0004237 | 3300046809 | Bacteria | 8567 |
| 1179 | Ga0495600_0005804 | 3300046809 | Bacteria | 7460 |
| 1180 | Ga0495600_0009346 | 3300046809 | Bacteria | 6054 |
| 1181 | Ga0495600_0013174 | 3300046809 | Bacteria | 5188 |
| 1182 | Ga0495600_0035019 | 3300046809 | Bacteria | 3260 |
| 1183 | Ga0495600_0041537 | 3300046809 | Bacteria | 2997 |
| 1184 | Ga0495600_0051307 | 3300046809 | Bacteria | 2693 |
| 1185 | Ga0495600_0140257 | 3300046809 | Bacteria | 1568 |
| 1186 | Ga0495600_0172600 | 3300046809 | Bacteria | 1395 |
| 1187 | Ga0495660_0006238 | 3300046810 | Bacteria | 7074 |
| 1188 | Ga0495581_0003354 | 3300047315 | Bacteria | 9191 |
| 1189 | Ga0495581_0044659 | 3300047315 | Bacteria | 2562 |
| 1190 | Ga0495581_0059541 | 3300047315 | Bacteria | 2207 |
| 1191 | Ga0495581_0076501 | 3300047315 | Bacteria | 1936 |
| 1192 | Ga0495581_0110107 | 3300047315 | Bacteria | 1601 |
| 1193 | Ga0495581_0112287 | 3300047315 | Bacteria | 1585 |
| 1194 | Ga0495604_0000061 | 3300047317 | Bacteria | 94158 |
| 1195 | Ga0495604_0002802 | 3300047317 | Bacteria | 13991 |
| 1196 | Ga0495604_0026075 | 3300047317 | Bacteria | 4654 |
| 1197 | Ga0495604_0033094 | 3300047317 | Bacteria | 4093 |
| 1198 | Ga0495604_0033445 | 3300047317 | Bacteria | 4070 |
| 1199 | Ga0495604_0050839 | 3300047317 | Bacteria | 3216 |
| 1200 | Ga0495604_0141761 | 3300047317 | Bacteria | 1716 |
| 1201 | Ga0495604_0223403 | 3300047317 | Bacteria | 1295 |
| 1202 | Ga0495636_0002194 | 3300047318 | Bacteria | 7493 |
| 1203 | Ga0495636_0032486 | 3300047318 | Bacteria | 2141 |
| 1204 | Ga0495674_0019179 | 3300047319 | Bacteria | 6353 |
| 1205 | Ga0495674_0027638 | 3300047319 | Bacteria | 5182 |
| 1206 | Ga0495674_0037963 | 3300047319 | Bacteria | 4327 |
| 1207 | Ga0495674_0048001 | 3300047319 | Bacteria | 3781 |
| 1208 | Ga0495674_0070377 | 3300047319 | Bacteria | 3023 |
| 1209 | Ga0495674_0083559 | 3300047319 | Bacteria | 2736 |
| 1210 | Ga0495674_0148901 | 3300047319 | Bacteria | 1963 |
| 1211 | Ga0495674_0278225 | 3300047319 | Bacteria | 1372 |
| 1212 | Ga0495672_0015842 | 3300047320 | Bacteria | 5103 |
| 1213 | Ga0495676_0024813 | 3300047321 | Bacteria | 5181 |
| 1214 | Ga0495676_0028997 | 3300047321 | Bacteria | 4718 |
| 1215 | Ga0495676_0035758 | 3300047321 | Bacteria | 4152 |
| 1216 | Ga0495676_0071092 | 3300047321 | Bacteria | 2676 |
| 1217 | Ga0495676_0116781 | 3300047321 | Bacteria | 1947 |
| 1218 | Ga0495680_0000099 | 3300047322 | Bacteria | 78801 |
| 1219 | Ga0495680_0005688 | 3300047322 | Bacteria | 11668 |
| 1220 | Ga0495680_0005926 | 3300047322 | Bacteria | 11419 |
| 1221 | Ga0495680_0011978 | 3300047322 | Bacteria | 7654 |
| 1222 | Ga0495680_0011998 | 3300047322 | Bacteria | 7646 |
| 1223 | Ga0495680_0017923 | 3300047322 | Bacteria | 6025 |
| 1224 | Ga0495680_0023854 | 3300047322 | Bacteria | 5083 |
| 1225 | Ga0495680_0029389 | 3300047322 | Bacteria | 4500 |
| 1226 | Ga0495680_0030570 | 3300047322 | Bacteria | 4396 |
| 1227 | Ga0495680_0069758 | 3300047322 | Bacteria | 2680 |
| 1228 | Ga0495680_0170421 | 3300047322 | Bacteria | 1576 |
| 1229 | Ga0495680_0173768 | 3300047322 | Bacteria | 1559 |
| 1230 | Ga0495687_002575 | 3300047443 | Bacteria | 14296 |
| 1231 | Ga0495687_026770 | 3300047443 | Bacteria | 2709 |
| 1232 | Ga0495675_0005606 | 3300047444 | Bacteria | 7664 |
| 1233 | Ga0495675_0014263 | 3300047444 | Bacteria | 5023 |
| 1234 | Ga0495675_0017765 | 3300047444 | Bacteria | 4510 |
| 1235 | Ga0495675_0018969 | 3300047444 | Bacteria | 4368 |
| 1236 | Ga0495675_0019565 | 3300047444 | Bacteria | 4301 |
| 1237 | Ga0495675_0020983 | 3300047444 | Bacteria | 4159 |
| 1238 | Ga0495675_0052338 | 3300047444 | Bacteria | 2592 |
| 1239 | Ga0495675_0101922 | 3300047444 | Bacteria | 1796 |
| 1240 | Ga0495685_000277 | 3300047447 | Bacteria | 17201 |
| 1241 | Ga0495673_0084402 | 3300047469 | Bacteria | 1309 |
| 1242 | Ga0495681_0000289 | 3300047470 | Bacteria | 40161 |
| 1243 | Ga0495681_0077508 | 3300047470 | Bacteria | 1491 |
| 1244 | Ga0495684_0002552 | 3300047471 | Bacteria | 14487 |
| 1245 | Ga0495684_0002952 | 3300047471 | Bacteria | 13389 |
| 1246 | Ga0495684_0013883 | 3300047471 | Bacteria | 6195 |
| 1247 | Ga0495684_0016318 | 3300047471 | Bacteria | 5718 |
| 1248 | Ga0495684_0027440 | 3300047471 | Bacteria | 4371 |
| 1249 | Ga0495684_0039709 | 3300047471 | Bacteria | 3608 |
| 1250 | Ga0495684_0089962 | 3300047471 | Bacteria | 2325 |
| 1251 | Ga0495684_0128301 | 3300047471 | Bacteria | 1906 |
| 1252 | Ga0495684_0154148 | 3300047471 | Bacteria | 1716 |
| 1253 | Ga0495684_0193289 | 3300047471 | Bacteria | 1503 |
| 1254 | Ga0495684_0221305 | 3300047471 | Bacteria | 1388 |
| 1255 | Ga0495593_0001682 | 3300047673 | Bacteria | 13119 |
| 1256 | Ga0495593_0007995 | 3300047673 | Bacteria | 6157 |
| 1257 | Ga0495593_0016042 | 3300047673 | Bacteria | 4228 |
| 1258 | Ga0495593_0031017 | 3300047673 | Bacteria | 2922 |
| 1259 | Ga0495602_0000649 | 3300048088 | Bacteria | 32571 |
| 1260 | Ga0495602_0021967 | 3300048088 | Bacteria | 6258 |
| 1261 | Ga0495602_0022801 | 3300048088 | Bacteria | 6120 |
| 1262 | Ga0495602_0046525 | 3300048088 | Bacteria | 3918 |
| 1263 | Ga0495602_0077403 | 3300048088 | Bacteria | 2814 |
| 1264 | Ga0495602_0108079 | 3300048088 | Bacteria | 2265 |
| 1265 | Ga0495602_0177044 | 3300048088 | Bacteria | 1649 |
| 1266 | Ga0495602_0207241 | 3300048088 | Bacteria | 1491 |
| 1267 | Ga0495614_0000245 | 3300048089 | Bacteria | 21228 |
| 1268 | Ga0495626_0004415 | 3300048091 | Bacteria | 8647 |
| 1269 | Ga0496100_0007737 | 3300048903 | Bacteria | 5951 |
| 1270 | Ga0496100_0016444 | 3300048903 | Bacteria | 4345 |
| 1271 | Ga0496100_0029003 | 3300048903 | Bacteria | 3418 |
| 1272 | Ga0496100_0037110 | 3300048903 | Bacteria | 3078 |
| 1273 | Ga0496100_0097033 | 3300048903 | Bacteria | 2023 |
| 1274 | Ga0496101_0007337 | 3300048904 | Bacteria | 7137 |
| 1275 | Ga0496101_0028405 | 3300048904 | Bacteria | 3904 |
| 1276 | Ga0496101_0050988 | 3300048904 | Bacteria | 2980 |
| 1277 | Ga0496101_0103857 | 3300048904 | Bacteria | 2130 |
| 1278 | Ga0496101_0158675 | 3300048904 | Bacteria | 1734 |
| 1279 | Ga0496101_0174961 | 3300048904 | Bacteria | 1650 |
| 1280 | Ga0496101_0278620 | 3300048904 | Bacteria | 1307 |
| 1281 | Ga0496101_0286128 | 3300048904 | Bacteria | 1289 |
| 1282 | Ga0496102_0000236 | 3300048905 | Bacteria | 72601 |
| 1283 | Ga0496102_0006337 | 3300048905 | Bacteria | 10088 |
| 1284 | Ga0496102_0012264 | 3300048905 | Bacteria | 7412 |
| 1285 | Ga0496102_0013702 | 3300048905 | Bacteria | 7029 |
| 1286 | Ga0496102_0046015 | 3300048905 | Bacteria | 3962 |
| 1287 | Ga0496102_0058240 | 3300048905 | Bacteria | 3530 |
| 1288 | Ga0496102_0128630 | 3300048905 | Bacteria | 2369 |
| 1289 | Ga0496102_0357919 | 3300048905 | Bacteria | 1374 |
| 1290 | Ga0496102_0375764 | 3300048905 | Bacteria | 1337 |
| 1291 | Ga0496103_0000185 | 3300048906 | Bacteria | 62838 |
| 1292 | Ga0496103_0008811 | 3300048906 | Bacteria | 5984 |
| 1293 | Ga0496103_0018888 | 3300048906 | Bacteria | 4139 |
| 1294 | Ga0496103_0033020 | 3300048906 | Bacteria | 3161 |
| 1295 | Ga0496103_0042282 | 3300048906 | Bacteria | 2803 |
| 1296 | Ga0496103_0070949 | 3300048906 | Bacteria | 2179 |
| 1297 | Ga0496103_0118362 | 3300048906 | Bacteria | 1686 |
| 1298 | Ga0496104_0000836 | 3300048907 | Bacteria | 26568 |
| 1299 | Ga0496104_0004654 | 3300048907 | Bacteria | 11937 |
| 1300 | Ga0496104_0006197 | 3300048907 | Bacteria | 10503 |
| 1301 | Ga0496104_0006329 | 3300048907 | Bacteria | 10415 |
| 1302 | Ga0496104_0021598 | 3300048907 | Bacteria | 5911 |
| 1303 | Ga0496104_0095950 | 3300048907 | Bacteria | 2837 |
| 1304 | Ga0496104_0315250 | 3300048907 | Bacteria | 1477 |
| 1305 | Ga0496104_0349905 | 3300048907 | Bacteria | 1390 |
| 1306 | Ga0496105_0001152 | 3300048908 | Bacteria | 18424 |
| 1307 | Ga0496105_0006003 | 3300048908 | Bacteria | 9277 |
| 1308 | Ga0496105_0009146 | 3300048908 | Bacteria | 7731 |
| 1309 | Ga0496105_0025178 | 3300048908 | Bacteria | 4840 |
| 1310 | Ga0496105_0039651 | 3300048908 | Bacteria | 3883 |
| 1311 | Ga0496105_0041449 | 3300048908 | Bacteria | 3795 |
| 1312 | Ga0496105_0061154 | 3300048908 | Bacteria | 3107 |
| 1313 | Ga0496105_0094807 | 3300048908 | Bacteria | 2465 |
| 1314 | Ga0496105_0142604 | 3300048908 | Bacteria | 1971 |
| 1315 | Ga0496105_0147804 | 3300048908 | Bacteria | 1932 |
| 1316 | Ga0496105_0163629 | 3300048908 | Bacteria | 1826 |
| 1317 | Ga0496105_0203627 | 3300048908 | Bacteria | 1615 |
| 1318 | Ga0496105_0262892 | 3300048908 | Bacteria | 1395 |
| 1319 | Ga0496106_0004056 | 3300048909 | Bacteria | 10928 |
| 1320 | Ga0496106_0050284 | 3300048909 | Bacteria | 3141 |
| 1321 | Ga0496106_0213560 | 3300048909 | Bacteria | 1537 |
| 1322 | Ga0496107_0010945 | 3300048910 | Bacteria | 6311 |
| 1323 | Ga0496107_0039784 | 3300048910 | Bacteria | 3373 |
| 1324 | Ga0496107_0076637 | 3300048910 | Bacteria | 2435 |
| 1325 | Ga0496107_0142423 | 3300048910 | Bacteria | 1772 |
| 1326 | Ga0496108_0002269 | 3300048911 | Bacteria | 15405 |
| 1327 | Ga0496108_0006606 | 3300048911 | Bacteria | 9405 |
| 1328 | Ga0496108_0020362 | 3300048911 | Bacteria | 5452 |
| 1329 | Ga0496108_0071227 | 3300048911 | Bacteria | 2933 |
| 1330 | Ga0496108_0086847 | 3300048911 | Bacteria | 2656 |
| 1331 | Ga0496108_0099231 | 3300048911 | Bacteria | 2482 |
| 1332 | Ga0496108_0141913 | 3300048911 | Bacteria | 2070 |
| 1333 | Ga0496108_0311417 | 3300048911 | Bacteria | 1372 |
| 1334 | Ga0496108_0332564 | 3300048911 | Bacteria | 1325 |
| 1335 | Ga0496109_0001771 | 3300048912 | Bacteria | 17933 |
| 1336 | Ga0496109_0043541 | 3300048912 | Bacteria | 4069 |
| 1337 | Ga0496109_0093261 | 3300048912 | Bacteria | 2786 |
| 1338 | Ga0496109_0109774 | 3300048912 | Bacteria | 2564 |
| 1339 | Ga0496109_0189008 | 3300048912 | Bacteria | 1935 |
| 1340 | Ga0496109_0278913 | 3300048912 | Bacteria | 1575 |
| 1341 | Ga0496110_0000402 | 3300048913 | Bacteria | 29301 |
| 1342 | Ga0496110_0040056 | 3300048913 | Bacteria | 4082 |
| 1343 | Ga0496110_0064159 | 3300048913 | Bacteria | 3245 |
| 1344 | Ga0496110_0067588 | 3300048913 | Bacteria | 3162 |
| 1345 | Ga0496110_0110730 | 3300048913 | Bacteria | 2467 |
| 1346 | Ga0496110_0139127 | 3300048913 | Bacteria | 2195 |
| 1347 | Ga0496110_0171369 | 3300048913 | Bacteria | 1969 |
| 1348 | Ga0496110_0180304 | 3300048913 | Bacteria | 1918 |
| 1349 | Ga0496110_0237305 | 3300048913 | Bacteria | 1659 |
| 1350 | Ga0496110_0263563 | 3300048913 | Bacteria | 1568 |
| 1351 | Ga0496111_0008549 | 3300048914 | Bacteria | 6782 |
| 1352 | Ga0496111_0192563 | 3300048914 | Bacteria | 1516 |
| 1353 | Ga0496111_0209079 | 3300048914 | Bacteria | 1449 |
| 1354 | Ga0496112_0003674 | 3300048915 | Bacteria | 12790 |
| 1355 | Ga0496112_0004882 | 3300048915 | Bacteria | 11467 |
| 1356 | Ga0496112_0057931 | 3300048915 | Bacteria | 3814 |
| 1357 | Ga0496112_0100835 | 3300048915 | Bacteria | 2857 |
| 1358 | Ga0496112_0166035 | 3300048915 | Bacteria | 2173 |
| 1359 | Ga0496112_0256377 | 3300048915 | Bacteria | 1699 |
| 1360 | Ga0496112_0412491 | 3300048915 | Bacteria | 1290 |
| 1361 | Ga0496113_0015524 | 3300048916 | Bacteria | 5238 |
| 1362 | Ga0496113_0017024 | 3300048916 | Bacteria | 5036 |
| 1363 | Ga0496113_0029029 | 3300048916 | Bacteria | 3988 |
| 1364 | Ga0496113_0048554 | 3300048916 | Bacteria | 3158 |
| 1365 | Ga0496113_0071819 | 3300048916 | Bacteria | 2633 |
| 1366 | Ga0496113_0074984 | 3300048916 | Bacteria | 2580 |
| 1367 | Ga0496113_0469384 | 3300048916 | Bacteria | 1011 |
| 1368 | Ga0496114_0003907 | 3300048917 | Bacteria | 11495 |
| 1369 | Ga0496114_0010520 | 3300048917 | Bacteria | 7362 |
| 1370 | Ga0496114_0021323 | 3300048917 | Bacteria | 5270 |
| 1371 | Ga0496114_0028070 | 3300048917 | Bacteria | 4615 |
| 1372 | Ga0496114_0028689 | 3300048917 | Bacteria | 4568 |
| 1373 | Ga0496114_0081784 | 3300048917 | Bacteria | 2729 |
| 1374 | Ga0496114_0106929 | 3300048917 | Bacteria | 2394 |
| 1375 | Ga0496114_0129495 | 3300048917 | Bacteria | 2178 |
| 1376 | Ga0496114_0130696 | 3300048917 | Bacteria | 2168 |
| 1377 | Ga0496114_0167237 | 3300048917 | Bacteria | 1915 |
| 1378 | Ga0496114_0176625 | 3300048917 | Bacteria | 1863 |
| 1379 | Ga0496114_0242881 | 3300048917 | Bacteria | 1584 |
| 1380 | Ga0496115_0004890 | 3300048918 | Bacteria | 9727 |
| 1381 | Ga0496115_0006411 | 3300048918 | Bacteria | 8621 |
| 1382 | Ga0496115_0006671 | 3300048918 | Bacteria | 8470 |
| 1383 | Ga0496115_0012610 | 3300048918 | Bacteria | 6366 |
| 1384 | Ga0496115_0030355 | 3300048918 | Bacteria | 4251 |
| 1385 | Ga0496115_0049791 | 3300048918 | Bacteria | 3354 |
| 1386 | Ga0496115_0081938 | 3300048918 | Bacteria | 2628 |
| 1387 | Ga0496115_0133557 | 3300048918 | Bacteria | 2046 |
| 1388 | Ga0496116_0000340 | 3300048919 | Bacteria | 74829 |
| 1389 | Ga0496117_0000387 | 3300048920 | Bacteria | 75589 |
| 1390 | Ga0496117_0000738 | 3300048920 | Bacteria | 51389 |
| 1391 | Ga0496117_0000791 | 3300048920 | Bacteria | 49611 |
| 1392 | Ga0496117_0000986 | 3300048920 | Bacteria | 43574 |
| 1393 | Ga0496117_0001718 | 3300048920 | Bacteria | 30310 |
| 1394 | Ga0496117_0012087 | 3300048920 | Bacteria | 7661 |
| 1395 | Ga0496117_0012943 | 3300048920 | Bacteria | 7310 |
| 1396 | Ga0496117_0023293 | 3300048920 | Bacteria | 4941 |
| 1397 | Ga0496117_0041758 | 3300048920 | Bacteria | 3355 |
| 1398 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 1399 | Ga0496118_0000610 | 3300048921 | Bacteria | 58893 |
| 1400 | Ga0496118_0002673 | 3300048921 | Bacteria | 23562 |
| 1401 | Ga0496118_0006467 | 3300048921 | Bacteria | 12869 |
| 1402 | Ga0496118_0009795 | 3300048921 | Bacteria | 9604 |
| 1403 | Ga0496118_0016454 | 3300048921 | Bacteria | 6784 |
| 1404 | Ga0496118_0033164 | 3300048921 | Bacteria | 4242 |
| 1405 | Ga0496118_0042203 | 3300048921 | Bacteria | 3601 |
| 1406 | Ga0496118_0091107 | 3300048921 | Bacteria | 2098 |
| 1407 | Ga0496118_0115595 | 3300048921 | Bacteria | 1765 |
| 1408 | Ga0496119_0000340 | 3300048922 | Bacteria | 65290 |
| 1409 | Ga0496119_0000437 | 3300048922 | Bacteria | 57106 |
| 1410 | Ga0496119_0001355 | 3300048922 | Bacteria | 29948 |
| 1411 | Ga0496119_0002632 | 3300048922 | Bacteria | 19477 |
| 1412 | Ga0496119_0004459 | 3300048922 | Bacteria | 13932 |
| 1413 | Ga0496119_0005146 | 3300048922 | Bacteria | 12660 |
| 1414 | Ga0496119_0009558 | 3300048922 | Bacteria | 8295 |
| 1415 | Ga0496119_0018646 | 3300048922 | Bacteria | 5152 |
| 1416 | Ga0496119_0041849 | 3300048922 | Bacteria | 2912 |
| 1417 | Ga0496119_0061246 | 3300048922 | Bacteria | 2249 |
| 1418 | Ga0496119_0063300 | 3300048922 | Bacteria | 2201 |
| 1419 | Ga0496119_0065003 | 3300048922 | Bacteria | 2163 |
| 1420 | Ga0496119_0123262 | 3300048922 | Bacteria | 1421 |
| 1421 | Ga0496120_0001932 | 3300048923 | Bacteria | 22779 |
| 1422 | Ga0496120_0005677 | 3300048923 | Bacteria | 9856 |
| 1423 | Ga0496120_0006725 | 3300048923 | Bacteria | 8743 |
| 1424 | Ga0496120_0006917 | 3300048923 | Bacteria | 8556 |
| 1425 | Ga0496120_0022515 | 3300048923 | Bacteria | 3962 |
| 1426 | Ga0496120_0023496 | 3300048923 | Bacteria | 3859 |
| 1427 | Ga0496120_0031483 | 3300048923 | Bacteria | 3211 |
| 1428 | Ga0496120_0039950 | 3300048923 | Bacteria | 2762 |
| 1429 | Ga0496121_0000015 | 3300048924 | Bacteria | 571958 |
| 1430 | Ga0496121_0080853 | 3300048924 | Bacteria | 2574 |
| 1431 | Ga0496121_0169373 | 3300048924 | Bacteria | 1588 |
| 1432 | Ga0496121_0219052 | 3300048924 | Bacteria | 1342 |
| 1433 | Ga0496122_0000020 | 3300048925 | Bacteria | 401675 |
| 1434 | Ga0496122_0001218 | 3300048925 | Bacteria | 43657 |
| 1435 | Ga0496122_0005902 | 3300048925 | Bacteria | 14341 |
| 1436 | Ga0496122_0005965 | 3300048925 | Bacteria | 14259 |
| 1437 | Ga0496122_0009445 | 3300048925 | Bacteria | 10275 |
| 1438 | Ga0496122_0011256 | 3300048925 | Bacteria | 9090 |
| 1439 | Ga0496122_0062094 | 3300048925 | Bacteria | 2737 |
| 1440 | Ga0496122_0070148 | 3300048925 | Bacteria | 2506 |
| 1441 | Ga0496122_0086360 | 3300048925 | Bacteria | 2160 |
| 1442 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 1443 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 1444 | Ga0496123_0000922 | 3300048926 | Bacteria | 46092 |
| 1445 | Ga0496123_0003978 | 3300048926 | Bacteria | 16006 |
| 1446 | Ga0496123_0028382 | 3300048926 | Bacteria | 4144 |
| 1447 | Ga0496123_0039255 | 3300048926 | Bacteria | 3314 |
| 1448 | Ga0496123_0078797 | 3300048926 | Bacteria | 2016 |
| 1449 | Ga0496124_0000135 | 3300048927 | Bacteria | 152458 |
| 1450 | Ga0496124_0002352 | 3300048927 | Bacteria | 24959 |
| 1451 | Ga0496124_0002908 | 3300048927 | Bacteria | 21592 |
| 1452 | Ga0496124_0005711 | 3300048927 | Bacteria | 13865 |
| 1453 | Ga0496124_0039133 | 3300048927 | Bacteria | 4113 |
| 1454 | Ga0496124_0078730 | 3300048927 | Bacteria | 2716 |
| 1455 | Ga0496124_0105592 | 3300048927 | Bacteria | 2275 |
| 1456 | Ga0496125_0000086 | 3300048928 | Bacteria | 216489 |
| 1457 | Ga0496125_0000209 | 3300048928 | Bacteria | 122267 |
| 1458 | Ga0496125_0001608 | 3300048928 | Bacteria | 31895 |
| 1459 | Ga0496125_0005451 | 3300048928 | Bacteria | 14135 |
| 1460 | Ga0496125_0006238 | 3300048928 | Bacteria | 12963 |
| 1461 | Ga0496125_0012012 | 3300048928 | Bacteria | 8623 |
| 1462 | Ga0496125_0036438 | 3300048928 | Bacteria | 4295 |
| 1463 | Ga0496125_0040583 | 3300048928 | Bacteria | 3990 |
| 1464 | Ga0496125_0080753 | 3300048928 | Bacteria | 2487 |
| 1465 | Ga0496126_0000547 | 3300048929 | Bacteria | 72557 |
| 1466 | Ga0496126_0002060 | 3300048929 | Bacteria | 28225 |
| 1467 | Ga0496126_0007345 | 3300048929 | Bacteria | 12101 |
| 1468 | Ga0496126_0030861 | 3300048929 | Bacteria | 5073 |
| 1469 | Ga0496126_0038893 | 3300048929 | Bacteria | 4421 |
| 1470 | Ga0496126_0053780 | 3300048929 | Bacteria | 3651 |
| 1471 | Ga0496126_0069828 | 3300048929 | Bacteria | 3132 |
| 1472 | Ga0496126_0083544 | 3300048929 | Bacteria | 2818 |
| 1473 | Ga0496126_0118501 | 3300048929 | Bacteria | 2298 |
| 1474 | Ga0496126_0281447 | 3300048929 | Bacteria | 1378 |
| 1475 | Ga0501318_003946 | 3300049534 | Bacteria | 1395 |
| 1476 | Ga0501321_002166 | 3300049537 | Bacteria | 1668 |
| 1477 | Ga0501031_0002231 | 3300049568 | Bacteria | 12253 |
| 1478 | Ga0501031_0005538 | 3300049568 | Bacteria | 8221 |
| 1479 | Ga0501031_0006771 | 3300049568 | Bacteria | 7477 |
| 1480 | Ga0501031_0008520 | 3300049568 | Bacteria | 6673 |
| 1481 | Ga0501031_0028733 | 3300049568 | Bacteria | 3625 |
| 1482 | Ga0501032_0001733 | 3300049569 | Bacteria | 17251 |
| 1483 | Ga0501032_0006740 | 3300049569 | Bacteria | 8430 |
| 1484 | Ga0501032_0007901 | 3300049569 | Bacteria | 7744 |
| 1485 | Ga0501032_0010914 | 3300049569 | Bacteria | 6530 |
| 1486 | Ga0501032_0012689 | 3300049569 | Bacteria | 6007 |
| 1487 | Ga0501032_0015179 | 3300049569 | Bacteria | 5439 |
| 1488 | Ga0501032_0017903 | 3300049569 | Bacteria | 4971 |
| 1489 | Ga0501032_0020302 | 3300049569 | Bacteria | 4629 |
| 1490 | Ga0501032_0038963 | 3300049569 | Bacteria | 3234 |
| 1491 | Ga0501032_0043425 | 3300049569 | Bacteria | 3045 |
| 1492 | Ga0501032_0057119 | 3300049569 | Bacteria | 2622 |
| 1493 | Ga0501032_0123968 | 3300049569 | Bacteria | 1707 |
| 1494 | Ga0501032_0143916 | 3300049569 | Bacteria | 1569 |
| 1495 | Ga0501033_0001533 | 3300049570 | Bacteria | 20408 |
| 1496 | Ga0501033_0006784 | 3300049570 | Bacteria | 8937 |
| 1497 | Ga0501033_0016453 | 3300049570 | Bacteria | 5602 |
| 1498 | Ga0501033_0037448 | 3300049570 | Bacteria | 3630 |
| 1499 | Ga0501033_0047280 | 3300049570 | Bacteria | 3199 |
| 1500 | Ga0501033_0075075 | 3300049570 | Bacteria | 2481 |
| 1501 | Ga0501033_0099379 | 3300049570 | Bacteria | 2125 |
| 1502 | Ga0501033_0163489 | 3300049570 | Bacteria | 1601 |
| 1503 | Ga0501034_0000079 | 3300049571 | Bacteria | 171105 |
| 1504 | Ga0501034_0000910 | 3300049571 | Bacteria | 43164 |
| 1505 | Ga0501034_0004451 | 3300049571 | Bacteria | 15576 |
| 1506 | Ga0501034_0004610 | 3300049571 | Bacteria | 15275 |
| 1507 | Ga0501034_0005584 | 3300049571 | Bacteria | 13698 |
| 1508 | Ga0501034_0007328 | 3300049571 | Bacteria | 11752 |
| 1509 | Ga0501034_0016939 | 3300049571 | Bacteria | 7472 |
| 1510 | Ga0501034_0022103 | 3300049571 | Bacteria | 6479 |
| 1511 | Ga0501034_0024475 | 3300049571 | Bacteria | 6142 |
| 1512 | Ga0501034_0032998 | 3300049571 | Bacteria | 5257 |
| 1513 | Ga0501034_0060038 | 3300049571 | Bacteria | 3820 |
| 1514 | Ga0501034_0062895 | 3300049571 | Bacteria | 3726 |
| 1515 | Ga0501034_0069979 | 3300049571 | Bacteria | 3520 |
| 1516 | Ga0501034_0095490 | 3300049571 | Bacteria | 2969 |
| 1517 | Ga0501034_0130331 | 3300049571 | Bacteria | 2498 |
| 1518 | Ga0501034_0172223 | 3300049571 | Bacteria | 2131 |
| 1519 | Ga0501034_0174071 | 3300049571 | Bacteria | 2119 |
| 1520 | Ga0501034_0278830 | 3300049571 | Bacteria | 1611 |
| 1521 | Ga0501036_0002124 | 3300049572 | Bacteria | 15470 |
| 1522 | Ga0501036_0003126 | 3300049572 | Bacteria | 13212 |
| 1523 | Ga0501036_0010468 | 3300049572 | Bacteria | 7662 |
| 1524 | Ga0501036_0026255 | 3300049572 | Bacteria | 4914 |
| 1525 | Ga0501036_0061367 | 3300049572 | Bacteria | 3184 |
| 1526 | Ga0501036_0065461 | 3300049572 | Bacteria | 3076 |
| 1527 | Ga0501036_0070904 | 3300049572 | Bacteria | 2947 |
| 1528 | Ga0501036_0082954 | 3300049572 | Bacteria | 2709 |
| 1529 | Ga0501036_0084430 | 3300049572 | Bacteria | 2684 |
| 1530 | Ga0501036_0304735 | 3300049572 | Bacteria | 1332 |
| 1531 | Ga0501037_0003940 | 3300049573 | Bacteria | 10766 |
| 1532 | Ga0501037_0005417 | 3300049573 | Bacteria | 9292 |
| 1533 | Ga0501037_0005558 | 3300049573 | Bacteria | 9194 |
| 1534 | Ga0501037_0012804 | 3300049573 | Bacteria | 6181 |
| 1535 | Ga0501037_0013780 | 3300049573 | Bacteria | 5958 |
| 1536 | Ga0501037_0018305 | 3300049573 | Bacteria | 5161 |
| 1537 | Ga0501037_0019639 | 3300049573 | Bacteria | 4985 |
| 1538 | Ga0501037_0056598 | 3300049573 | Bacteria | 2863 |
| 1539 | Ga0501037_0073269 | 3300049573 | Bacteria | 2490 |
| 1540 | Ga0501037_0088732 | 3300049573 | Bacteria | 2238 |
| 1541 | Ga0501037_0119303 | 3300049573 | Bacteria | 1897 |
| 1542 | Ga0501037_0170277 | 3300049573 | Bacteria | 1548 |
| 1543 | Ga0501038_0002793 | 3300049574 | Bacteria | 16244 |
| 1544 | Ga0501038_0009522 | 3300049574 | Bacteria | 8913 |
| 1545 | Ga0501038_0014812 | 3300049574 | Bacteria | 7101 |
| 1546 | Ga0501038_0019259 | 3300049574 | Bacteria | 6156 |
| 1547 | Ga0501038_0019392 | 3300049574 | Bacteria | 6132 |
| 1548 | Ga0501038_0035681 | 3300049574 | Bacteria | 4365 |
| 1549 | Ga0501038_0036093 | 3300049574 | Bacteria | 4338 |
| 1550 | Ga0501038_0038913 | 3300049574 | Bacteria | 4162 |
| 1551 | Ga0501038_0061045 | 3300049574 | Bacteria | 3224 |
| 1552 | Ga0501038_0073378 | 3300049574 | Bacteria | 2898 |
| 1553 | Ga0501038_0075649 | 3300049574 | Bacteria | 2846 |
| 1554 | Ga0501038_0079053 | 3300049574 | Bacteria | 2774 |
| 1555 | Ga0501038_0125533 | 3300049574 | Bacteria | 2112 |
| 1556 | Ga0501039_0001345 | 3300049575 | Bacteria | 17992 |
| 1557 | Ga0501039_0012049 | 3300049575 | Bacteria | 6590 |
| 1558 | Ga0501039_0014554 | 3300049575 | Bacteria | 6024 |
| 1559 | Ga0501039_0134070 | 3300049575 | Bacteria | 1944 |
| 1560 | Ga0501040_0006755 | 3300049576 | Bacteria | 7445 |
| 1561 | Ga0501040_0019206 | 3300049576 | Bacteria | 4545 |
| 1562 | Ga0501041_0000510 | 3300049577 | Bacteria | 19990 |
| 1563 | Ga0501042_0002946 | 3300049578 | Bacteria | 10571 |
| 1564 | Ga0501042_0005797 | 3300049578 | Bacteria | 7975 |
| 1565 | Ga0501042_0006620 | 3300049578 | Bacteria | 7540 |
| 1566 | Ga0501042_0044551 | 3300049578 | Bacteria | 3161 |
| 1567 | Ga0501042_0144041 | 3300049578 | Bacteria | 1718 |
| 1568 | Ga0501043_0002325 | 3300049579 | Bacteria | 16099 |
| 1569 | Ga0501043_0003130 | 3300049579 | Bacteria | 13723 |
| 1570 | Ga0501043_0008228 | 3300049579 | Bacteria | 8219 |
| 1571 | Ga0501043_0008953 | 3300049579 | Bacteria | 7878 |
| 1572 | Ga0501043_0010184 | 3300049579 | Bacteria | 7370 |
| 1573 | Ga0501043_0010272 | 3300049579 | Bacteria | 7336 |
| 1574 | Ga0501043_0015132 | 3300049579 | Bacteria | 6036 |
| 1575 | Ga0501043_0043814 | 3300049579 | Bacteria | 3517 |
| 1576 | Ga0501043_0091786 | 3300049579 | Bacteria | 2388 |
| 1577 | Ga0501043_0119796 | 3300049579 | Bacteria | 2064 |
| 1578 | Ga0501043_0157809 | 3300049579 | Bacteria | 1774 |
| 1579 | Ga0501043_0160239 | 3300049579 | Bacteria | 1758 |
| 1580 | Ga0501046_0004180 | 3300049580 | Bacteria | 13143 |
| 1581 | Ga0501046_0007136 | 3300049580 | Bacteria | 9828 |
| 1582 | Ga0501046_0009635 | 3300049580 | Bacteria | 8328 |
| 1583 | Ga0501046_0016221 | 3300049580 | Bacteria | 6244 |
| 1584 | Ga0501046_0121181 | 3300049580 | Bacteria | 1990 |
| 1585 | Ga0501047_0000005 | 3300049581 | Bacteria | 456524 |
| 1586 | Ga0501047_0003756 | 3300049581 | Bacteria | 14301 |
| 1587 | Ga0501047_0010901 | 3300049581 | Bacteria | 8596 |
| 1588 | Ga0501047_0018642 | 3300049581 | Bacteria | 6655 |
| 1589 | Ga0501047_0021174 | 3300049581 | Bacteria | 6244 |
| 1590 | Ga0501047_0023128 | 3300049581 | Bacteria | 5966 |
| 1591 | Ga0501047_0032440 | 3300049581 | Bacteria | 5041 |
| 1592 | Ga0501047_0050684 | 3300049581 | Bacteria | 4009 |
| 1593 | Ga0501047_0051285 | 3300049581 | Bacteria | 3986 |
| 1594 | Ga0501047_0082245 | 3300049581 | Bacteria | 3095 |
| 1595 | Ga0501047_0239018 | 3300049581 | Bacteria | 1667 |
| 1596 | Ga0501047_0371310 | 3300049581 | Bacteria | 1265 |
| 1597 | Ga0501048_0001322 | 3300049582 | Bacteria | 18775 |
| 1598 | Ga0501048_0004371 | 3300049582 | Bacteria | 10759 |
| 1599 | Ga0501048_0008906 | 3300049582 | Bacteria | 7555 |
| 1600 | Ga0501048_0010033 | 3300049582 | Bacteria | 7086 |
| 1601 | Ga0501048_0101153 | 3300049582 | Bacteria | 2033 |
| 1602 | Ga0501048_0188471 | 3300049582 | Bacteria | 1462 |
| 1603 | Ga0501048_0236991 | 3300049582 | Bacteria | 1295 |
| 1604 | Ga0501067_0001107 | 3300049583 | Bacteria | 14551 |
| 1605 | Ga0501067_0020188 | 3300049583 | Bacteria | 3686 |
| 1606 | Ga0501067_0083786 | 3300049583 | Bacteria | 1769 |
| 1607 | Ga0501068_0004355 | 3300049584 | Bacteria | 7696 |
| 1608 | Ga0501068_0030431 | 3300049584 | Bacteria | 3202 |
| 1609 | Ga0501068_0165979 | 3300049584 | Bacteria | 1393 |
| 1610 | Ga0501069_0042811 | 3300049585 | Bacteria | 2506 |
| 1611 | Ga0501070_0002352 | 3300049586 | Bacteria | 16602 |
| 1612 | Ga0501070_0003420 | 3300049586 | Bacteria | 13767 |
| 1613 | Ga0501070_0009355 | 3300049586 | Bacteria | 8287 |
| 1614 | Ga0501070_0010098 | 3300049586 | Bacteria | 7990 |
| 1615 | Ga0501070_0015896 | 3300049586 | Bacteria | 6326 |
| 1616 | Ga0501070_0018990 | 3300049586 | Bacteria | 5765 |
| 1617 | Ga0501070_0033611 | 3300049586 | Bacteria | 4292 |
| 1618 | Ga0501070_0038905 | 3300049586 | Bacteria | 3969 |
| 1619 | Ga0501070_0039125 | 3300049586 | Bacteria | 3956 |
| 1620 | Ga0501070_0095003 | 3300049586 | Bacteria | 2467 |
| 1621 | Ga0501070_0204631 | 3300049586 | Bacteria | 1621 |
| 1622 | Ga0501070_0236002 | 3300049586 | Bacteria | 1498 |
| 1623 | Ga0501071_0001275 | 3300049587 | Bacteria | 14303 |
| 1624 | Ga0501071_0002509 | 3300049587 | Bacteria | 11169 |
| 1625 | Ga0501071_0061566 | 3300049587 | Bacteria | 2718 |
| 1626 | Ga0501072_0033937 | 3300049588 | Bacteria | 3998 |
| 1627 | Ga0501072_0104825 | 3300049588 | Bacteria | 2248 |
| 1628 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 1629 | Ga0501073_0113310 | 3300049589 | Bacteria | 1881 |
| 1630 | Ga0501074_0004495 | 3300049590 | Bacteria | 9984 |
| 1631 | Ga0501074_0008723 | 3300049590 | Bacteria | 7349 |
| 1632 | Ga0501074_0089288 | 3300049590 | Bacteria | 2207 |
| 1633 | Ga0501075_0008628 | 3300049591 | Bacteria | 7105 |
| 1634 | Ga0501076_0049185 | 3300049592 | Bacteria | 3333 |
| 1635 | Ga0501076_0175451 | 3300049592 | Bacteria | 1747 |
| 1636 | Ga0501077_0021191 | 3300049593 | Bacteria | 4113 |
| 1637 | Ga0501077_0036848 | 3300049593 | Bacteria | 3116 |
| 1638 | Ga0501079_0001632 | 3300049741 | Bacteria | 15976 |
| 1639 | Ga0501079_0025872 | 3300049741 | Bacteria | 4501 |
| 1640 | Ga0501080_0000023 | 3300049742 | Bacteria | 90345 |
| 1641 | Ga0501080_0042141 | 3300049742 | Bacteria | 4252 |
| 1642 | Ga0501080_0056997 | 3300049742 | Bacteria | 3638 |
| 1643 | Ga0501080_0064971 | 3300049742 | Bacteria | 3394 |
| 1644 | Ga0501080_0071502 | 3300049742 | Bacteria | 3227 |
| 1645 | Ga0501080_0093219 | 3300049742 | Bacteria | 2797 |
| 1646 | Ga0501080_0273742 | 3300049742 | Bacteria | 1536 |
| 1647 | Ga0501081_0012816 | 3300049743 | Bacteria | 5513 |
| 1648 | Ga0501083_0000059 | 3300049744 | Bacteria | 78374 |
| 1649 | Ga0501083_0004256 | 3300049744 | Bacteria | 10074 |
| 1650 | Ga0501083_0004565 | 3300049744 | Bacteria | 9779 |
| 1651 | Ga0501083_0031451 | 3300049744 | Bacteria | 3643 |
| 1652 | Ga0501083_0315342 | 3300049744 | Bacteria | 1017 |
| 1653 | Ga0501279_006874 | 3300049775 | Bacteria | 1506 |
| 1654 | Ga0501035_0002846 | 3300049822 | Bacteria | 16722 |
| 1655 | Ga0501035_0006735 | 3300049822 | Bacteria | 10739 |
| 1656 | Ga0501035_0007884 | 3300049822 | Bacteria | 9947 |
| 1657 | Ga0501035_0008420 | 3300049822 | Bacteria | 9603 |
| 1658 | Ga0501035_0013293 | 3300049822 | Bacteria | 7595 |
| 1659 | Ga0501035_0015593 | 3300049822 | Bacteria | 7011 |
| 1660 | Ga0501035_0017656 | 3300049822 | Bacteria | 6581 |
| 1661 | Ga0501035_0017981 | 3300049822 | Bacteria | 6519 |
| 1662 | Ga0501035_0024286 | 3300049822 | Bacteria | 5559 |
| 1663 | Ga0501035_0029166 | 3300049822 | Bacteria | 5032 |
| 1664 | Ga0501035_0031513 | 3300049822 | Bacteria | 4827 |
| 1665 | Ga0501035_0050317 | 3300049822 | Bacteria | 3734 |
| 1666 | Ga0501044_0003414 | 3300049823 | Bacteria | 17900 |
| 1667 | Ga0501044_0010052 | 3300049823 | Bacteria | 10282 |
| 1668 | Ga0501044_0012278 | 3300049823 | Bacteria | 9273 |
| 1669 | Ga0501044_0013325 | 3300049823 | Bacteria | 8898 |
| 1670 | Ga0501044_0015296 | 3300049823 | Bacteria | 8263 |
| 1671 | Ga0501044_0015324 | 3300049823 | Bacteria | 8256 |
| 1672 | Ga0501044_0033710 | 3300049823 | Bacteria | 5377 |
| 1673 | Ga0501044_0088361 | 3300049823 | Bacteria | 3128 |
| 1674 | Ga0501044_0104368 | 3300049823 | Bacteria | 2848 |
| 1675 | Ga0501044_0167162 | 3300049823 | Bacteria | 2173 |
| 1676 | Ga0501044_0175285 | 3300049823 | Bacteria | 2113 |
| 1677 | Ga0501044_0230097 | 3300049823 | Bacteria | 1801 |
| 1678 | Ga0501045_0047819 | 3300049824 | Bacteria | 3116 |
| 1679 | Ga0501045_0100124 | 3300049824 | Bacteria | 2145 |
| 1680 | nmdc:mga00v17_10676_c1 | 3300050491 | Bacteria | 5025 |
| 1681 | nmdc:mga0yw44_109474_c1 | 3300050492 | Bacteria | 1769 |
| 1682 | nmdc:mga0yw44_16446_c1 | 3300050492 | Bacteria | 3996 |
| 1683 | nmdc:mga0yw44_7068_c1 | 3300050492 | Bacteria | 5494 |
| 1684 | nmdc:mga06z11_29345_c1 | 3300050494 | Bacteria | 2649 |
| 1685 | nmdc:mga05p37_408632_c1 | 3300050507 | Bacteria | 1583 |
| 1686 | nmdc:mga05p37_9690_c1 | 3300050507 | Bacteria | 11418 |
| 1687 | nmdc:mga05p37_9984_c1 | 3300050507 | Bacteria | 11274 |
| 1688 | nmdc:mga09592_110175_c1 | 3300050508 | Bacteria | 2362 |
| 1689 | nmdc:mga09592_97806_c1 | 3300050508 | Bacteria | 2512 |
| 1690 | nmdc:mga0qj67_176290_c1 | 3300050509 | Bacteria | 1736 |
| 1691 | nmdc:mga06r32_202_c5 | 3300050510 | Bacteria | 10484 |
| 1692 | nmdc:mga08y16_116201_c1 | 3300050511 | Bacteria | 2785 |
| 1693 | nmdc:mga08y16_14541_c1 | 3300050511 | Bacteria | 8278 |
| 1694 | nmdc:mga08y16_24871_c1 | 3300050511 | Bacteria | 6317 |
| 1695 | nmdc:mga08y16_47659_c1 | 3300050511 | Bacteria | 4485 |
| 1696 | nmdc:mga0n895_12260_c1 | 3300050512 | Bacteria | 7684 |
| 1697 | nmdc:mga0n895_27126_c1 | 3300050512 | Bacteria | 5438 |
| 1698 | nmdc:mga0n895_313887_c1 | 3300050512 | Bacteria | 1589 |
| 1699 | nmdc:mga0n895_64173_c1 | 3300050512 | Bacteria | 3633 |
| 1700 | nmdc:mga0rr50_128236_c1 | 3300050513 | Bacteria | 2028 |
| 1701 | nmdc:mga0rr50_3162_c1 | 3300050513 | Bacteria | 9412 |
| 1702 | nmdc:mga0rr50_4142_c2 | 3300050513 | Bacteria | 4312 |
| 1703 | nmdc:mga0rr50_95002_c1 | 3300050513 | Bacteria | 2329 |
| 1704 | nmdc:mga08x19_33654_c1 | 3300050514 | Bacteria | 3235 |
| 1705 | nmdc:mga08x19_34607_c1 | 3300050514 | Bacteria | 3194 |
| 1706 | nmdc:mga0a205_3224_c1 | 3300050515 | Bacteria | 14510 |
| 1707 | nmdc:mga0sz30_11075_c1 | 3300050516 | Bacteria | 3470 |
| 1708 | Ga0495601_0013029 | 3300053077 | Bacteria | 4996 |
| 1709 | Ga0495601_0015770 | 3300053077 | Bacteria | 4572 |
| 1710 | Ga0495601_0030603 | 3300053077 | Bacteria | 3342 |
| 1711 | Ga0495601_0032437 | 3300053077 | Bacteria | 3252 |
| 1712 | Ga0495612_0001130 | 3300053078 | Bacteria | 10953 |
| 1713 | Ga0495612_0010468 | 3300053078 | Bacteria | 3750 |
| 1714 | Ga0495612_0010525 | 3300053078 | Bacteria | 3739 |
| 1715 | Ga0495612_0024452 | 3300053078 | Bacteria | 2425 |
| 1716 | Ga0495612_0045980 | 3300053078 | Bacteria | 1787 |
| 1717 | Ga0495612_0060823 | 3300053078 | Bacteria | 1564 |
| 1718 | Ga0500635_0000664 | 3300053080 | Bacteria | 8729 |
| 1719 | Ga0495595_0001495 | 3300053084 | Bacteria | 9132 |
| 1720 | Ga0495595_0020681 | 3300053084 | Bacteria | 2866 |
| 1721 | Ga0495595_0036502 | 3300053084 | Bacteria | 2230 |
| 1722 | Ga0495619_0010408 | 3300053085 | Bacteria | 5853 |
| 1723 | Ga0495619_0021908 | 3300053085 | Bacteria | 4084 |
| 1724 | Ga0495619_0083432 | 3300053085 | Bacteria | 2155 |
| 1725 | Ga0495619_0132743 | 3300053085 | Bacteria | 1712 |
| 1726 | Ga0500578_0014632 | 3300053086 | Bacteria | 5044 |
| 1727 | Ga0500643_000191 | 3300053087 | Bacteria | 58540 |
| 1728 | Ga0500583_0103117 | 3300053092 | Bacteria | 1399 |
| 1729 | Ga0500651_0003063 | 3300053093 | Bacteria | 9045 |
| 1730 | Ga0500640_001744 | 3300053095 | Bacteria | 6801 |
| 1731 | Ga0500641_0056548 | 3300053096 | Bacteria | 1626 |
| 1732 | Ga0500556_0000115 | 3300053104 | Bacteria | 69837 |
| 1733 | Ga0500556_0000426 | 3300053104 | Bacteria | 30343 |
| 1734 | Ga0500560_009842 | 3300053107 | Bacteria | 2367 |
| 1735 | Ga0500560_012532 | 3300053107 | Bacteria | 2201 |
| 1736 | Ga0500562_000183 | 3300053108 | Bacteria | 16987 |
| 1737 | Ga0500593_001772 | 3300053117 | Bacteria | 7763 |
| 1738 | Ga0500658_0004371 | 3300053134 | Bacteria | 5294 |
| 1739 | Ga0500559_0000050 | 3300053136 | Bacteria | 93262 |
| 1740 | Ga0500559_0000800 | 3300053136 | Bacteria | 20562 |
| 1741 | Ga0500559_0042277 | 3300053136 | Bacteria | 1988 |
| 1742 | Ga0500568_0000038 | 3300053139 | Bacteria | 134267 |
| 1743 | Ga0500568_0000117 | 3300053139 | Bacteria | 71510 |
| 1744 | Ga0500568_0001933 | 3300053139 | Bacteria | 12699 |
| 1745 | Ga0500568_0007501 | 3300053139 | Bacteria | 5345 |
| 1746 | Ga0500568_0013939 | 3300053139 | Bacteria | 3648 |
| 1747 | Ga0500573_0000014 | 3300053140 | Bacteria | 193353 |
| 1748 | Ga0500573_0006418 | 3300053140 | Bacteria | 6366 |
| 1749 | Ga0500573_0013932 | 3300053140 | Bacteria | 4542 |
| 1750 | Ga0500573_0014968 | 3300053140 | Bacteria | 4392 |
| 1751 | Ga0500577_0004479 | 3300053142 | Bacteria | 3697 |
| 1752 | Ga0500577_0016903 | 3300053142 | Bacteria | 2311 |
| 1753 | Ga0500577_0020950 | 3300053142 | Bacteria | 2148 |
| 1754 | Ga0500590_013523 | 3300053148 | Bacteria | 4191 |
| 1755 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 1756 | Ga0500616_0000117 | 3300053153 | Bacteria | 145655 |
| 1757 | Ga0500616_0000620 | 3300053153 | Bacteria | 43119 |
| 1758 | Ga0500616_0011539 | 3300053153 | Bacteria | 5210 |
| 1759 | Ga0500616_0061798 | 3300053153 | Bacteria | 1937 |
| 1760 | Ga0500620_000082 | 3300053155 | Bacteria | 18227 |
| 1761 | Ga0500624_002275 | 3300053157 | Bacteria | 2632 |
| 1762 | Ga0500634_0003371 | 3300053161 | Bacteria | 7073 |
| 1763 | Ga0501084_0011942 | 3300054114 | Bacteria | 7191 |
| 1764 | Ga0501084_0042709 | 3300054114 | Bacteria | 3792 |
| 1765 | Ga0590075_003544 | 3300059424 | Bacteria | 3706 |
| 1766 | Ga0587072_000110 | 3300059643 | Bacteria | 6592 |
| 1767 | Ga0501082_0011737 | 3300060353 | Bacteria | 7531 |
| 1768 | Ga0501082_0021746 | 3300060353 | Bacteria | 5530 |
| 1769 | Ga0501082_0024215 | 3300060353 | Bacteria | 5235 |
| 1770 | Ga0501082_0053825 | 3300060353 | Bacteria | 3469 |
| 1771 | Ga0466962_0001145 | 3300061719 | Bacteria | 12247 |
| 1772 | Ga0466962_0001217 | 3300061719 | Bacteria | 11836 |
| 1773 | Ga0466962_0005385 | 3300061719 | Bacteria | 6156 |
| 1774 | Ga0466962_0012085 | 3300061719 | Bacteria | 4152 |
| 1775 | Ga0466962_0057982 | 3300061719 | Bacteria | 1849 |
| 1776 | Ga0530510_0002078 | 3300061734 | Bacteria | 13753 |
| 1777 | Ga0530510_0113870 | 3300061734 | Bacteria | 1982 |
| 1778 | Ga0530510_0142274 | 3300061734 | Bacteria | 1768 |
| 1779 | 2523384565 | 2523231044 | Bacteria | 6434991 |
| 1780 | 2537898248 | 2537561592 | Bacteria | 4348607 |
| 1781 | 2552105984 | 2551306166 | Bacteria | 9731570 |
| 1782 | 2554256717 | 2554235005 | Bacteria | 6457341 |
| 1783 | 2555228741 | 2554235227 | Bacteria | 3637389 |
| 1784 | 2585295996 | 2582581312 | Bacteria | 7308206 |
| 1785 | 2585306288 | 2582581313 | Bacteria | 10042643 |
| 1786 | 2585320272 | 2582581314 | Bacteria | 11452267 |
| 1787 | 2588106927 | 2585428157 | Bacteria | 3018951 |
| 1788 | 2616696701 | 2616644814 | Bacteria | 11555299 |
| 1789 | 2616903179 | 2616644941 | Bacteria | 8510691 |
| 1790 | 2643734866 | 2643221542 | Bacteria | 3563959 |
| 1791 | 2643753782 | 2643221546 | Bacteria | 2910897 |
| 1792 | 2643764695 | 2643221548 | Bacteria | 8053412 |
| 1793 | 2643768564 | 2643221549 | Bacteria | 4042819 |
| 1794 | 2643783527 | 2643221553 | Bacteria | 3544260 |
| 1795 | 2643847848 | 2643221566 | Bacteria | 3460379 |
| 1796 | 2643852653 | 2643221567 | Bacteria | 4163945 |
| 1797 | 2643888218 | 2643221575 | Bacteria | 4022601 |
| 1798 | 2643903027 | 2643221578 | Bacteria | 9213798 |
| 1799 | 2643941919 | 2643221587 | Bacteria | 7586415 |
| 1800 | 2643994890 | 2643221597 | Bacteria | 3347721 |
| 1801 | 2644082324 | 2643221613 | Bacteria | 4622396 |
| 1802 | 2644111941 | 2643221619 | Bacteria | 4158469 |
| 1803 | 2644135161 | 2643221624 | Bacteria | 4384879 |
| 1804 | 2644173026 | 2643221630 | Bacteria | 3601215 |
| 1805 | 2644175828 | 2643221631 | Bacteria | 8168043 |
| 1806 | 2644182446 | 2643221632 | Bacteria | 3406696 |
| 1807 | 2644197898 | 2643221635 | Bacteria | 2632343 |
| 1808 | 2644261510 | 2643221647 | Bacteria | 10741251 |
| 1809 | 2644277737 | 2643221649 | Bacteria | 3867359 |
| 1810 | 2644389541 | 2643221670 | Bacteria | 6497041 |
| 1811 | 2644404463 | 2643221673 | Bacteria | 9196637 |
| 1812 | 2644429002 | 2643221677 | Bacteria | 7584031 |
| 1813 | 2644439410 | 2643221678 | Bacteria | 9540101 |
| 1814 | 2644445480 | 2643221679 | Bacteria | 3839507 |
| 1815 | 2644462080 | 2643221682 | Bacteria | 6743283 |
| 1816 | 2644502903 | 2643221690 | Bacteria | 4654705 |
| 1817 | 2644515240 | 2643221692 | Bacteria | 7282860 |
| 1818 | 2644525268 | 2643221694 | Bacteria | 4392972 |
| 1819 | 2644610808 | 2643221711 | Bacteria | 4865335 |
| 1820 | 2644667053 | 2643221721 | Bacteria | 4486924 |
| 1821 | 2644669353 | 2643221722 | Bacteria | 4247614 |
| 1822 | 2644679225 | 2643221724 | Bacteria | 3593515 |
| 1823 | 2655033208 | 2654587600 | Bacteria | 3911798 |
| 1824 | 2676494524 | 2675903060 | Bacteria | 10051191 |
| 1825 | 2691514725 | 2690315906 | Bacteria | 4517044 |
| 1826 | 2723643100 | 2721755702 | Bacteria | 4373124 |
| 1827 | 2729906622 | 2728369276 | Bacteria | 5610032 |
| 1828 | 2730228728 | 2728369380 | Bacteria | 3620317 |
| 1829 | 2731908986 | 2731639228 | Bacteria | 4187555 |
| 1830 | 2738693731 | 2738541272 | Bacteria | 6848551 |
| 1831 | 2739328110 | 2738543027 | Bacteria | 6409078 |
| 1832 | 2739602919 | 2739367653 | Bacteria | 2780952 |
| 1833 | 2739607439 | 2739367654 | Bacteria | 6049412 |
| 1834 | 2747953169 | 2747842429 | Bacteria | 3914386 |
| 1835 | 2753037991 | 2751185725 | Bacteria | 5740550 |
| 1836 | 2753303633 | 2751185788 | Bacteria | 4541048 |
| 1837 | 2753325859 | 2751185792 | Bacteria | 5739090 |
| 1838 | 2758224676 | 2757320536 | Bacteria | 3629334 |
| 1839 | 2760304659 | 2758568522 | Bacteria | 5953541 |
| 1840 | 2760621530 | 2758568621 | Bacteria | 5967089 |
| 1841 | 2768643577 | 2767802112 | Bacteria | 6465194 |
| 1842 | 2774378827 | 2773857758 | Bacteria | 3592392 |
| 1843 | 2774383431 | 2773857759 | Bacteria | 2963774 |
| 1844 | 2774400613 | 2773857763 | Bacteria | 4180068 |
| 1845 | 2775654939 | 2775506735 | Bacteria | 4556596 |
| 1846 | 2784472905 | 2784132109 | Bacteria | 3141763 |
| 1847 | 2784589814 | 2784132148 | Bacteria | 8627943 |
| 1848 | 2785341790 | 2784746763 | Bacteria | 9783172 |
| 1849 | 2785370856 | 2784746768 | Bacteria | 10036182 |
| 1850 | 2786672035 | 2786546132 | Bacteria | 10419719 |
| 1851 | 2793981347 | 2791355406 | Bacteria | 11364898 |
| 1852 | 2804845461 | 2802429296 | Bacteria | 7227771 |
| 1853 | 2808628693 | 2808606306 | Bacteria | 3608896 |
| 1854 | 2808827838 | 2808606357 | Bacteria | 4466944 |
| 1855 | 2808843413 | 2808606359 | Bacteria | 9866990 |
| 1856 | 2808853190 | 2808606360 | Bacteria | 4404006 |
| 1857 | 2808875457 | 2808606365 | Bacteria | 4301966 |
| 1858 | 2808878308 | 2808606366 | Bacteria | 4415912 |
| 1859 | 2808884818 | 2808606368 | Bacteria | 3174172 |
| 1860 | 2808892081 | 2808606370 | Bacteria | 4942454 |
| 1861 | 2808897186 | 2808606371 | Bacteria | 4251511 |
| 1862 | 2808912998 | 2808606375 | Bacteria | 9466072 |
| 1863 | 2809026317 | 2808606394 | Bacteria | 6248540 |
| 1864 | 2809226524 | 2808606447 | Bacteria | 3572005 |
| 1865 | 2809233483 | 2808606448 | Bacteria | 8656184 |
| 1866 | 2810364339 | 2808606700 | Bacteria | 3482157 |
| 1867 | 2811845029 | 2808606982 | Bacteria | 7791042 |
| 1868 | 2812320401 | 2811994871 | Bacteria | 4497550 |
| 1869 | 2812322197 | 2811994872 | Bacteria | 4121241 |
| 1870 | 2812356628 | 2811994879 | Bacteria | 9313447 |
| 1871 | 2812364422 | 2811994880 | Bacteria | 4147780 |
| 1872 | 2812375766 | 2811994882 | Bacteria | 4688362 |
| 1873 | 2812479336 | 2811994917 | Bacteria | 7761064 |
| 1874 | 2816505500 | 2816332139 | Bacteria | 9138787 |
| 1875 | 2817508571 | 2816332305 | Bacteria | 2697803 |
| 1876 | 2819424663 | 2818991318 | Bacteria | 5266538 |
| 1877 | 2819667002 | 2818991458 | Bacteria | 4794049 |
| 1878 | 2819690356 | 2818991462 | Bacteria | 4320267 |
| 1879 | 2819695159 | 2818991463 | Bacteria | 7948711 |
| 1880 | 2819728382 | 2818991469 | Bacteria | 4644110 |
| 1881 | 2819742314 | 2818991472 | Bacteria | 10089953 |
| 1882 | 2821269128 | 2821268502 | Bacteria | 3750023 |
| 1883 | 2833710011 | 2833709550 | Bacteria | 4008291 |
| 1884 | 2835189079 | 2835188231 | Bacteria | 3476928 |
| 1885 | 2839989113 | 2839986021 | Bacteria | 3685650 |
| 1886 | 2844843321 | 2844841374 | Bacteria | 3917147 |
| 1887 | 2844849700 | 2844849076 | Bacteria | 4091819 |
| 1888 | 2844854372 | 2844852863 | Bacteria | 3849151 |
| 1889 | 2848551703 | 2848551377 | Bacteria | 3720646 |
| 1890 | 2852632770 | 2852632344 | Bacteria | 3463163 |
| 1891 | 2852642776 | 2852635781 | Bacteria | 8251373 |
| 1892 | 2852644397 | 2852643534 | Bacteria | 3013378 |
| 1893 | 2852646538 | 2852646457 | Bacteria | 3408613 |
| 1894 | 2852665830 | 2852663356 | Bacteria | 4090475 |
| 1895 | 2856746564 | 2856741275 | Bacteria | 8096094 |
| 1896 | 2857480484 | 2857479173 | Bacteria | 2469263 |
| 1897 | 2857633705 | 2857632687 | Bacteria | 2448521 |
| 1898 | 2857712593 | 2857710386 | Bacteria | 3186771 |
| 1899 | 2857722181 | 2857720070 | Bacteria | 3189373 |
| 1900 | 2857724667 | 2857723135 | Bacteria | 4217853 |
| 1901 | 2857729262 | 2857727296 | Bacteria | 2745552 |
| 1902 | 2857730614 | 2857729791 | Bacteria | 4040535 |
| 1903 | 2857734492 | 2857733635 | Bacteria | 3532004 |
| 1904 | 2857739751 | 2857737099 | Bacteria | 3104305 |
| 1905 | 2857741167 | 2857740372 | Bacteria | 4782044 |
| 1906 | 2862185244 | 2862178590 | Bacteria | 8583590 |
| 1907 | 2862287082 | 2862281513 | Bacteria | 9621493 |
| 1908 | 2862292054 | 2862290372 | Bacteria | 7471434 |
| 1909 | 2862385302 | 2862382967 | Bacteria | 10317375 |
| 1910 | 2862511968 | 2862507626 | Bacteria | 9425308 |
| 1911 | 2862578110 | 2862574272 | Bacteria | 10567477 |
| 1912 | 2862709676 | 2862705112 | Bacteria | 6563286 |
| 1913 | 2863411483 | 2863404153 | Bacteria | 9672205 |
| 1914 | 2867349841 | 2867346516 | Bacteria | 7608576 |
| 1915 | 2867373302 | 2867369537 | Bacteria | 6501581 |
| 1916 | 2867434122 | 2867428634 | Bacteria | 9590268 |
| 1917 | 2867478680 | 2867475112 | Bacteria | 6909112 |
| 1918 | 2870622239 | 2870622029 | Bacteria | 3643329 |
| 1919 | 2870629522 | 2870628048 | Bacteria | 3696012 |
| 1920 | 2870801986 | 2870801768 | Bacteria | 2710986 |
| 1921 | 2870806376 | 2870804320 | Bacteria | 2552467 |
| 1922 | 2873154636 | 2873151551 | Bacteria | 8625867 |
| 1923 | 2873322080 | 2873314349 | Bacteria | 8512634 |
| 1924 | 2875396116 | 2875391855 | Bacteria | 7600475 |
| 1925 | 2877679721 | 2877676314 | Bacteria | 9512378 |
| 1926 | 2884694879 | 2884693830 | Bacteria | 11273186 |
| 1927 | 2884996381 | 2884994152 | Bacteria | 4492978 |
| 1928 | 2887447131 | 2887443736 | Bacteria | 4426037 |
| 1929 | 2891331433 | 2891326441 | Bacteria | 6439512 |
| 1930 | 2891401853 | 2891395885 | Bacteria | 9251614 |
| 1931 | 2891560593 | 2891554331 | Bacteria | 8812224 |
| 1932 | 2891566160 | 2891562705 | Bacteria | 8039471 |
| 1933 | 2893685140 | 2893684298 | Bacteria | 2897960 |
| 1934 | 2895432642 | 2895427314 | Bacteria | 13147766 |
| 1935 | 2895446426 | 2895442618 | Bacteria | 11027144 |
| 1936 | 2904432440 | 2904430863 | Bacteria | 3486923 |
| 1937 | 2904500400 | 2904497146 | Bacteria | 4731781 |
| 1938 | 2904501765 | 2904501621 | Bacteria | 3401437 |
| 1939 | 2904510287 | 2904509784 | Bacteria | 3520416 |
| 1940 | 2904776799 | 2904776348 | Bacteria | 4658726 |
| 1941 | 2905927870 | 2905926851 | Bacteria | 4423176 |
| 1942 | 2906801637 | 2906799679 | Bacteria | 4031749 |
| 1943 | 2908676181 | 2908674828 | Bacteria | 3382763 |
| 1944 | 2908678498 | 2908678064 | Bacteria | 3482747 |
| 1945 | 2909077060 | 2909074476 | Bacteria | 3436050 |
| 1946 | 2910810674 | 2910809715 | Bacteria | 4982797 |
| 1947 | 2912718358 | 2912715099 | Bacteria | 9460473 |
| 1948 | 2912730710 | 2912723979 | Bacteria | 8557534 |
| 1949 | 2912762198 | 2912757875 | Bacteria | 7940295 |
| 1950 | 2915359603 | 2915358134 | Bacteria | 6050864 |
| 1951 | 2918505904 | 2918501144 | Bacteria | 8668083 |
| 1952 | 2919036344 | 2919034639 | Bacteria | 4763403 |
| 1953 | 2919041800 | 2919039151 | Bacteria | 3391018 |
| 1954 | 2919043240 | 2919042368 | Bacteria | 3905917 |
| 1955 | 2919054468 | 2919051321 | Bacteria | 4210889 |
| 1956 | 2919058802 | 2919055335 | Bacteria | 3875751 |
| 1957 | 2919059646 | 2919059106 | Bacteria | 4991624 |
| 1958 | 2919070819 | 2919069694 | Bacteria | 3622919 |
| 1959 | 2919391597 | 2919391150 | Bacteria | 4884741 |
| 1960 | 2919397768 | 2919395869 | Bacteria | 3704152 |
| 1961 | 2919445606 | 2919443155 | Bacteria | 4072969 |
| 1962 | 2919447880 | 2919446982 | Bacteria | 3994487 |
| 1963 | 2919470311 | 2919468124 | Bacteria | 9133025 |
| 1964 | 2919525379 | 2919523602 | Bacteria | 3788128 |
| 1965 | 2919540794 | 2919538618 | Bacteria | 4677069 |
| 1966 | 2920882720 | 2920879853 | Bacteria | 4216831 |
| 1967 | 2928090944 | 2928090899 | Bacteria | 3158267 |
| 1968 | 2928105537 | 2928104781 | Bacteria | 3877447 |
| 1969 | 2928121418 | 2928121344 | Bacteria | 3972376 |
| 1970 | 2928153459 | 2928153084 | Bacteria | 4020257 |
| 1971 | 2928500943 | 2928500415 | Bacteria | 3384541 |
| 1972 | 2932426928 | 2932426870 | Bacteria | 4547726 |
| 1973 | 2932432256 | 2932431166 | Bacteria | 4215299 |
| 1974 | 2933419565 | 2933418574 | Bacteria | 4476724 |
| 1975 | 2935395278 | 2935390628 | Bacteria | 7043367 |
| 1976 | 2935412172 | 2935409751 | Bacteria | 4179611 |
| 1977 | 2935893553 | 2935890801 | Bacteria | 4593001 |
| 1978 | 2939598807 | 2939598168 | Bacteria | 4687164 |
| 1979 | 2939650045 | 2939647034 | Bacteria | 4681660 |
| 1980 | 2939677490 | 2939674588 | Bacteria | 4844420 |
| 1981 | 2945918156 | 2945916053 | Bacteria | 4555517 |
| 1982 | 2945921554 | 2945920336 | Bacteria | 4501603 |
| 1983 | 2945942223 | 2945941187 | Bacteria | 4682474 |
| 1984 | 2945960001 | 2945956166 | Bacteria | 5110334 |
| 1985 | 2945970886 | 2945968032 | Bacteria | 4111363 |
| 1986 | 2946005488 | 2946003308 | Bacteria | 3857229 |
| 1987 | 2946026599 | 2946024296 | Bacteria | 3508095 |
| 1988 | 2946034682 | 2946033335 | Bacteria | 3835514 |
| 1989 | 2946038203 | 2946037020 | Bacteria | 4900426 |
| 1990 | 2946043203 | 2946041624 | Bacteria | 4191385 |
| 1991 | 2946048504 | 2946045630 | Bacteria | 8527308 |
| 1992 | 2946062002 | 2946059875 | Bacteria | 4386623 |
| 1993 | 2946069240 | 2946064051 | Bacteria | 8957905 |
| 1994 | 2946077189 | 2946072368 | Bacteria | 8999607 |
| 1995 | 2946081800 | 2946080515 | Bacteria | 4310960 |
| 1996 | 2947227685 | 2947224130 | Bacteria | 9938529 |
| 1997 | 2953999481 | 2953998280 | Bacteria | 4812144 |
| 1998 | 2954004828 | 2954002825 | Bacteria | 9173742 |
| 1999 | 2954384633 | 2954380949 | Bacteria | 10050426 |
| 2000 | 2954678307 | 2954673503 | Bacteria | 9685905 |
| 2001 | 2954685850 | 2954682443 | Bacteria | 9862841 |
| 2002 | 2954695489 | 2954691527 | Bacteria | 10720516 |
| 2003 | 2954710682 | 2954701450 | Bacteria | 10834262 |
| 2004 | 2954714920 | 2954711539 | Bacteria | 10867210 |
| 2005 | 2954724863 | 2954721474 | Bacteria | 10456478 |
| 2006 | 2954736955 | 2954731030 | Bacteria | 10243860 |
| 2007 | 2954743789 | 2954740390 | Bacteria | 10229294 |
| 2008 | 2954755805 | 2954749733 | Bacteria | 10366972 |
| 2009 | 2954762741 | 2954759201 | Bacteria | 9358192 |
| 2010 | 2956941033 | 2956939328 | Bacteria | 3474458 |
| 2011 | 2964328524 | 2964326757 | Bacteria | 3290868 |
| 2012 | 2966601376 | 2966598605 | Bacteria | 7676064 |
| 2013 | 2966926590 | 2966924647 | Bacteria | 3268643 |
| 2014 | 2974298324 | 2974294766 | Bacteria | 3767688 |
| 2015 | 2974306186 | 2974302888 | Bacteria | 4369871 |
| 2016 | 2974325447 | 2974324384 | Bacteria | 3750535 |
| 2017 | 2977230392 | 2977228692 | Bacteria | 3450105 |
| 2018 | 2977239195 | 2977236895 | Bacteria | 3569373 |
| 2019 | 2977252073 | 2977251589 | Bacteria | 2952848 |
| 2020 | 2977265623 | 2977264416 | Bacteria | 3750737 |
| 2021 | 2984543021 | 2984542743 | Bacteria | 3569378 |
| 2022 | 2984551932 | 2984551494 | Bacteria | 3877562 |
| 2023 | 2984582301 | 2984580707 | Bacteria | 3351387 |
| 2024 | 2990044890 | 2990044586 | Bacteria | 6603797 |
| 2025 | 2990060988 | 2990059506 | Bacteria | 9321252 |
| 2026 | 2990093261 | 2990088156 | Bacteria | 6657676 |
| 2027 | 2995728402 | 2995726249 | Bacteria | 3470435 |
| 2028 | 2997458291 | 2997451912 | Bacteria | 8492419 |
| 2029 | 2997601414 | 2997600082 | Bacteria | 9896405 |
| 2030 | 3001120725 | 3001119090 | Bacteria | 3449530 |
| 2031 | 3001892153 | 3001889506 | Bacteria | 2975194 |
| 2032 | 3006326633 | 3006321560 | Bacteria | 8247479 |
| 2033 | 3006397840 | 3006393351 | Bacteria | 6615579 |
| 2034 | 3006429828 | 3006425503 | Bacteria | 6491253 |
| 2035 | 3006493413 | 3006486233 | Bacteria | 8157040 |
| 2036 | 3006498897 | 3006493962 | Bacteria | 8825450 |
| 2037 | 8002811619 | 8002811521 | Bacteria | 2942897 |
| 2038 | 8004021608 | 8004021418 | Bacteria | 4313954 |
| 2039 | 8004027974 | 8004025490 | Bacteria | 4327753 |
| 2040 | 8004183588 | 8004182704 | Bacteria | 3391155 |
| 2041 | 8004213407 | 8004212874 | Bacteria | 2861420 |
| 2042 | 8008490555 | 8008485437 | Bacteria | 7198341 |
| 2043 | 8008566634 | 8008558824 | Bacteria | 10610750 |
| 2044 | 8008577735 | 8008574985 | Bacteria | 7815457 |
| 2045 | 8016254998 | 8016254467 | Bacteria | 3797036 |
| 2046 | 8023627007 | 8023623736 | Bacteria | 8593882 |
| 2047 | 8025417166 | 8025413630 | Bacteria | 7014048 |
| 2048 | 8025479533 | 8025478263 | Bacteria | 8209203 |
| 2049 | 8025529857 | 8025524527 | Bacteria | 7197316 |
| 2050 | 8025532243 | 8025530807 | Bacteria | 8495698 |
| 2051 | 8033687274 | 8033684223 | Bacteria | 6906479 |
| 2052 | 8045832305 | 8045830549 | Bacteria | 4444727 |
| 2053 | 8047896896 | 8047893842 | Bacteria | 11723082 |
| 2054 | 8048362054 | 8048356638 | Bacteria | 11044339 |
| 2055 | 8048373881 | 8048369669 | Bacteria | 11666822 |
| 2056 | 8048384347 | 8048379754 | Bacteria | 11877923 |
| 2057 | 8048413751 | 8048406513 | Bacteria | 8936924 |
| 2058 | 8054108427 | 8054107350 | Bacteria | 5022511 |
| 2059 | 8054164200 | 8054160619 | Bacteria | 7783213 |
| 2060 | 8054475838 | 8054472261 | Bacteria | 7464355 |
| 2061 | 8055035349 | 8055034563 | Bacteria | 3562128 |
| 2062 | 8055038962 | 8055037949 | Bacteria | 3337834 |
| 2063 | 8055073949 | 8055066027 | Bacteria | 9479577 |
| 2064 | 8055179018 | 8055172936 | Bacteria | 9305943 |
| 2065 | 8056039332 | 8056037122 | Bacteria | 3854319 |
| 2066 | 8056063837 | 8056060235 | Bacteria | 7259403 |
| 2067 | 8056448512 | 8056447290 | Bacteria | 7680491 |
| 2068 | 8056583246 | 8056579771 | Bacteria | 5840325 |
| 2069 | 8056672849 | 8056667051 | Bacteria | 6953971 |
| 2070 | 8056837541 | 8056829672 | Bacteria | 9045328 |
| 2071 | 8057347458 | 8057345674 | Bacteria | 4160394 |
| 2072 | Ga0105244_10000735 | |||
| 2073 | LJQas_1000257 | |||
| 2074 | LJQas_1000741 | |||
| 2075 | JGI25154J39366_1003355 | |||
| 2076 | JGI25152J39213_1000399 | |||
| 2077 | JGI25406J46586_10001751 | |||
| 2078 | JGI25160J50197_1014988 | |||
| 2079 | Ga0006562J51391_1013439 | |||
| 2080 | Ga0006562J51391_1013440 | |||
| 2081 | Ga0006562J51391_1025688 | |||
| 2082 | Ga0006562J51391_1025689 | |||
| 2083 | Ga0006562J51391_1098594 | |||
| 2084 | Ga0006562J51391_1098595 | |||
| 2085 | Ga0055539_1000005 | |||
| 2086 | Ga0055533_1000001 | |||
| 2087 | Ga0055527_1000017 | |||
| 2088 | Ga0055542_1000044 | |||
| 2089 | Ga0055529_1000279 | |||
| 2090 | Ga0055541_1008325 | |||
| 2091 | Ga0065714_10104412 | |||
| 2092 | Ga0070658_10000266 | |||
| 2093 | Ga0070658_10013342 | |||
| 2094 | Ga0070658_10031946 | |||
| 2095 | Ga0070658_10035794 | |||
| 2096 | Ga0070658_10043257 | |||
| 2097 | Ga0070658_10219665 | |||
| 2098 | Ga0070676_10045831 | |||
| 2099 | Ga0070683_100019688 | |||
| 2100 | Ga0070683_100048077 | |||
| 2101 | Ga0070683_100058043 | |||
| 2102 | Ga0070683_100225127 | |||
| 2103 | Ga0070683_100257981 | |||
| 2104 | Ga0070683_100323958 | |||
| 2105 | Ga0070690_100059023 | |||
| 2106 | Ga0068869_100099715 | |||
| 2107 | Ga0070680_100000604 | |||
| 2108 | Ga0070680_100040663 | |||
| 2109 | Ga0070682_100100331 | |||
| 2110 | Ga0070682_100142635 | |||
| 2111 | Ga0070682_100195328 | |||
| 2112 | Ga0068868_100022267 | |||
| 2113 | Ga0070660_100081123 | |||
| 2114 | Ga0070689_100095806 | |||
| 2115 | Ga0070691_10120944 | |||
| 2116 | Ga0070687_100056394 | |||
| 2117 | Ga0070692_10019702 | |||
| 2118 | Ga0070692_10052038 | |||
| 2119 | Ga0070692_10076527 | |||
| 2120 | Ga0070668_100088728 | |||
| 2121 | Ga0070668_100215082 | |||
| 2122 | Ga0070669_100022755 | |||
| 2123 | Ga0070675_100005971 | |||
| 2124 | Ga0070675_100032384 | |||
| 2125 | Ga0070674_100019987 | |||
| 2126 | Ga0070674_100078162 | |||
| 2127 | Ga0070673_100038887 | |||
| 2128 | Ga0070673_100058206 | |||
| 2129 | Ga0070673_100171762 | |||
| 2130 | Ga0070659_100053135 | |||
| 2131 | Ga0070667_100021591 | |||
| 2132 | Ga0070709_10000118 | |||
| 2133 | Ga0070709_10003048 | |||
| 2134 | Ga0070709_10004402 | |||
| 2135 | Ga0070709_10036494 | |||
| 2136 | Ga0070714_100001466 | |||
| 2137 | Ga0070714_100005802 | |||
| 2138 | Ga0070714_100030612 | |||
| 2139 | Ga0070714_100066156 | |||
| 2140 | Ga0070714_100073929 | |||
| 2141 | Ga0070714_100085074 | |||
| 2142 | Ga0070713_100001299 | |||
| 2143 | Ga0070713_100015416 | |||
| 2144 | Ga0070713_100018101 | |||
| 2145 | Ga0070713_100026407 | |||
| 2146 | Ga0070710_10000216 | |||
| 2147 | Ga0070710_10000381 | |||
| 2148 | Ga0070710_10001064 | |||
| 2149 | Ga0070710_10024900 | |||
| 2150 | Ga0070710_10054249 | |||
| 2151 | Ga0070710_10075637 | |||
| 2152 | Ga0070710_10113558 | |||
| 2153 | Ga0070711_100000774 | |||
| 2154 | Ga0070711_100001507 | |||
| 2155 | Ga0070711_100011359 | |||
| 2156 | Ga0070711_100052982 | |||
| 2157 | Ga0070705_100027550 | |||
| 2158 | Ga0070705_100143311 | |||
| 2159 | Ga0070700_100018526 | |||
| 2160 | Ga0070708_100042482 | |||
| 2161 | Ga0070708_100114211 | |||
| 2162 | Ga0070708_100282487 | |||
| 2163 | Ga0070663_100165035 | |||
| 2164 | Ga0070678_100059360 | |||
| 2165 | Ga0070678_100082055 | |||
| 2166 | Ga0070678_100216134 | |||
| 2167 | Ga0070681_10037371 | |||
| 2168 | Ga0070681_10076072 | |||
| 2169 | Ga0070681_10113295 | |||
| 2170 | Ga0070681_10314051 | |||
| 2171 | Ga0068867_100277951 | |||
| 2172 | Ga0070685_10017980 | |||
| 2173 | Ga0070706_100002453 | |||
| 2174 | Ga0070706_100007246 | |||
| 2175 | Ga0070706_100013652 | |||
| 2176 | Ga0070706_100019132 | |||
| 2177 | Ga0070706_100029833 | |||
| 2178 | Ga0070706_100030981 | |||
| 2179 | Ga0070706_100048810 | |||
| 2180 | Ga0070706_100238770 | |||
| 2181 | Ga0070707_100000878 | |||
| 2182 | Ga0070707_100016295 | |||
| 2183 | Ga0070707_100017111 | |||
| 2184 | Ga0070707_100027135 | |||
| 2185 | Ga0070707_100043198 | |||
| 2186 | Ga0070707_100063769 | |||
| 2187 | Ga0070707_100120942 | |||
| 2188 | Ga0070698_100000621 | |||
| 2189 | Ga0070698_100001092 | |||
| 2190 | Ga0070698_100017339 | |||
| 2191 | Ga0070698_100017533 | |||
| 2192 | Ga0070698_100018948 | |||
| 2193 | Ga0070698_100029366 | |||
| 2194 | Ga0070698_100035507 | |||
| 2195 | Ga0070698_100132843 | |||
| 2196 | Ga0070699_100298178 | |||
| 2197 | Ga0070679_100054351 | |||
| 2198 | Ga0070679_100105416 | |||
| 2199 | Ga0070679_100127582 | |||
| 2200 | Ga0070679_100140904 | |||
| 2201 | Ga0070679_100184734 | |||
| 2202 | Ga0070684_100029632 | |||
| 2203 | Ga0070684_100122242 | |||
| 2204 | Ga0070684_100274891 | |||
| 2205 | Ga0070697_100025290 | |||
| 2206 | Ga0070697_100045569 | |||
| 2207 | Ga0068853_100074526 | |||
| 2208 | Ga0068853_100185674 | |||
| 2209 | Ga0068853_100258327 | |||
| 2210 | Ga0070672_100013432 | |||
| 2211 | Ga0070672_100015790 | |||
| 2212 | Ga0070672_100021208 | |||
| 2213 | Ga0070686_100164925 | |||
| 2214 | Ga0070695_100058153 | |||
| 2215 | Ga0070696_100048404 | |||
| 2216 | Ga0070693_100032957 | |||
| 2217 | Ga0070665_100006265 | |||
| 2218 | Ga0070665_100178198 | |||
| 2219 | Ga0070665_100215114 | |||
| 2220 | Ga0070704_100145513 | |||
| 2221 | Ga0068855_100022690 | |||
| 2222 | Ga0068855_100043681 | |||
| 2223 | Ga0068855_100119766 | |||
| 2224 | Ga0068855_100177890 | |||
| 2225 | Ga0070664_100076214 | |||
| 2226 | Ga0068857_100050157 | |||
| 2227 | Ga0068857_100204484 | |||
| 2228 | Ga0068854_100051107 | |||
| 2229 | Ga0068856_100091894 | |||
| 2230 | Ga0068856_100103109 | |||
| 2231 | Ga0068856_100115037 | |||
| 2232 | Ga0068856_100288139 | |||
| 2233 | Ga0068856_100329509 | |||
| 2234 | Ga0068856_100368358 | |||
| 2235 | Ga0070702_100000716 | |||
| 2236 | Ga0070702_100046300 | |||
| 2237 | Ga0070702_100077702 | |||
| 2238 | Ga0068852_100012452 | |||
| 2239 | Ga0068852_100063039 | |||
| 2240 | Ga0068852_100188837 | |||
| 2241 | Ga0068852_100201339 | |||
| 2242 | Ga0068859_100078111 | |||
| 2243 | Ga0068859_100106112 | |||
| 2244 | Ga0068864_100037398 | |||
| 2245 | Ga0068866_10129595 | |||
| 2246 | Ga0068861_100025788 | |||
| 2247 | Ga0068861_100173790 | |||
| 2248 | Ga0068851_10000022 | |||
| 2249 | Ga0068870_10043557 | |||
| 2250 | Ga0068870_10092007 | |||
| 2251 | Ga0068863_100000912 | |||
| 2252 | Ga0068863_100027376 | |||
| 2253 | Ga0068863_100121426 | |||
| 2254 | Ga0068863_100188176 | |||
| 2255 | Ga0068863_100413521 | |||
| 2256 | Ga0068858_100000016 | |||
| 2257 | Ga0068858_100090777 | |||
| 2258 | Ga0068858_100183277 | |||
| 2259 | Ga0068860_100022448 | |||
| 2260 | Ga0068860_100240062 | |||
| 2261 | Ga0081540_1001352 | |||
| 2262 | Ga0081540_1002515 | |||
| 2263 | Ga0081540_1002903 | |||
| 2264 | Ga0081539_10001393 | |||
| 2265 | Ga0081539_10019489 | |||
| 2266 | Ga0070717_10000504 | |||
| 2267 | Ga0070717_10055270 | |||
| 2268 | Ga0070717_10058992 | |||
| 2269 | Ga0070717_10112192 | |||
| 2270 | Ga0070717_10120794 | |||
| 2271 | Ga0070717_10140625 | |||
| 2272 | Ga0070717_10191812 | |||
| 2273 | Ga0070717_10210671 | |||
| 2274 | Ga0075365_10017542 | |||
| 2275 | Ga0075365_10022365 | |||
| 2276 | Ga0075365_10046434 | |||
| 2277 | Ga0075432_10000249 | |||
| 2278 | Ga0075432_10001177 | |||
| 2279 | Ga0075432_10023188 | |||
| 2280 | Ga0075432_10039010 | |||
| 2281 | Ga0070715_10003999 | |||
| 2282 | Ga0070715_10008469 | |||
| 2283 | Ga0070715_10086227 | |||
| 2284 | Ga0070716_100039444 | |||
| 2285 | Ga0070716_100068368 | |||
| 2286 | Ga0070712_100006228 | |||
| 2287 | Ga0070712_100009230 | |||
| 2288 | Ga0070712_100049554 | |||
| 2289 | Ga0070712_100060346 | |||
| 2290 | Ga0070712_100135383 | |||
| 2291 | Ga0075367_10025051 | |||
| 2292 | Ga0075428_100023989 | |||
| 2293 | Ga0075428_100106170 | |||
| 2294 | Ga0075430_100190988 | |||
| 2295 | Ga0075431_100005919 | |||
| 2296 | Ga0075433_10000652 | |||
| 2297 | Ga0075433_10001827 | |||
| 2298 | Ga0075433_10007398 | |||
| 2299 | Ga0075433_10028029 | |||
| 2300 | Ga0075434_100000181 | |||
| 2301 | Ga0075434_100018396 | |||
| 2302 | Ga0075434_100038538 | |||
| 2303 | Ga0075434_100060076 | |||
| 2304 | Ga0075429_100038385 | |||
| 2305 | Ga0075429_100038598 | |||
| 2306 | Ga0075436_100010867 | |||
| 2307 | Ga0075436_100047311 | |||
| 2308 | Ga0075436_100132048 | |||
| 2309 | Ga0097620_100078109 | |||
| 2310 | Ga0097620_100106127 | |||
| 2311 | Ga0075435_100068135 | |||
| 2312 | Ga0075435_100108572 | |||
| 2313 | Ga0105251_10004563 | |||
| 2314 | Ga0105251_10006598 | |||
| 2315 | Ga0105251_10011880 | |||
| 2316 | Ga0105240_10155493 | |||
| 2317 | Ga0111539_10000095 | |||
| 2318 | Ga0111539_10010369 | |||
| 2319 | Ga0111539_10165704 | |||
| 2320 | Ga0105245_10013491 | |||
| 2321 | Ga0105245_10036186 | |||
| 2322 | Ga0105245_10039281 | |||
| 2323 | Ga0105245_10144385 | |||
| 2324 | Ga0105245_10202729 | |||
| 2325 | Ga0105245_10319187 | |||
| 2326 | Ga0105247_10070656 | |||
| 2327 | Ga0114129_10008769 | |||
| 2328 | Ga0114129_10014475 | |||
| 2329 | Ga0114129_10027431 | |||
| 2330 | Ga0114129_10053520 | |||
| 2331 | Ga0114129_10280963 | |||
| 2332 | Ga0105243_10149832 | |||
| 2333 | Ga0105243_10228885 | |||
| 2334 | Ga0105243_10332041 | |||
| 2335 | Ga0105243_10335691 | |||
| 2336 | Ga0105241_10004447 | |||
| 2337 | Ga0105242_10010462 | |||
| 2338 | Ga0105242_10020736 | |||
| 2339 | Ga0105242_10033389 | |||
| 2340 | Ga0105242_10113127 | |||
| 2341 | Ga0105242_10251589 | |||
| 2342 | Ga0105242_10274188 | |||
| 2343 | Ga0105248_10000880 | |||
| 2344 | Ga0105248_10091708 | |||
| 2345 | Ga0105248_10173957 | |||
| 2346 | Ga0105248_10246363 | |||
| 2347 | Ga0105237_10006728 | |||
| 2348 | Ga0105237_10064474 | |||
| 2349 | Ga0105237_10166341 | |||
| 2350 | Ga0105238_10002053 | |||
| 2351 | Ga0105249_10065057 | |||
| 2352 | Ga0105249_10109470 | |||
| 2353 | Ga0105249_10152986 | |||
| 2354 | Ga0105249_10175164 | |||
| 2355 | Ga0105032_100683 | |||
| 2356 | Ga0105033_101458 | |||
| 2357 | Ga0105239_10112904 | |||
| 2358 | Ga0105246_10000474 | |||
| 2359 | Ga0105246_10030002 | |||
| 2360 | Ga0157344_1000433 | |||
| 2361 | Ga0157373_10091086 | |||
| 2362 | Ga0157371_10071463 | |||
| 2363 | Ga0157370_10001462 | |||
| 2364 | Ga0157370_10161321 | |||
| 2365 | Ga0157370_10171889 | |||
| 2366 | Ga0157369_10028346 | |||
| 2367 | Ga0157369_10031501 | |||
| 2368 | Ga0157369_10050500 | |||
| 2369 | Ga0157369_10054453 | |||
| 2370 | Ga0157369_10064247 | |||
| 2371 | Ga0157369_10077143 | |||
| 2372 | Ga0157369_10088646 | |||
| 2373 | Ga0157369_10282236 | |||
| 2374 | Ga0171462_1001 | |||
| 2375 | Ga0157374_10024151 | |||
| 2376 | Ga0157374_10042610 | |||
| 2377 | Ga0157374_10191923 | |||
| 2378 | Ga0163162_10017442 | |||
| 2379 | Ga0163162_10098066 | |||
| 2380 | Ga0157372_10115493 | |||
| 2381 | Ga0157372_10117818 | |||
| 2382 | Ga0157372_10389671 | |||
| 2383 | Ga0157372_10435920 | |||
| 2384 | Ga0157375_10104547 | |||
| 2385 | Ga0157375_10222721 | |||
| 2386 | Ga0157375_10483163 | |||
| 2387 | Ga0157375_10538782 | |||
| 2388 | Ga0157375_10583356 | |||
| 2389 | Ga0163163_10008035 | |||
| 2390 | Ga0163163_10177155 | |||
| 2391 | Ga0163163_10245003 | |||
| 2392 | Ga0163163_10393289 | |||
| 2393 | Ga0157380_10018506 | |||
| 2394 | Ga0157380_10177247 | |||
| 2395 | Ga0182008_10000155 | |||
| 2396 | Ga0157377_10011120 | |||
| 2397 | Ga0157379_10006602 | |||
| 2398 | Ga0157379_10007743 | |||
| 2399 | Ga0157376_10102957 | |||
| 2400 | Ga0157376_10177269 | |||
| 2401 | Ga0157376_10311140 | |||
| 2402 | Ga0182007_10006083 | |||
| 2403 | Ga0183367_1002 | |||
| 2404 | Ga0163161_10022188 | |||
| 2405 | Ga0163161_10064109 | |||
| 2406 | Ga0197907_10254036 | |||
| 2407 | Ga0197907_10622146 | |||
| 2408 | Ga0206356_10718652 | |||
| 2409 | Ga0206352_10797669 | |||
| 2410 | Ga0206350_10773787 | |||
| 2411 | Ga0206350_11125152 | |||
| 2412 | Ga0206354_10351484 | |||
| 2413 | Ga0206354_10556289 | |||
| 2414 | Ga0206354_10679121 | |||
| 2415 | Ga0206354_10854419 | |||
| 2416 | Ga0206354_11188581 | |||
| 2417 | Ga0206354_11707980 | |||
| 2418 | Ga0206353_10410223 | |||
| 2419 | Ga0206353_10645933 | |||
| 2420 | Ga0206353_10842314 | |||
| 2421 | Ga0206353_10849751 | |||
| 2422 | Ga0206353_11875109 | |||
| 2423 | Ga0213875_10000250 | |||
| 2424 | Ga0213875_10000514 | |||
| 2425 | Ga0213875_10117901 | |||
| 2426 | Ga0224712_10002198 | |||
| 2427 | Ga0224712_10002255 | |||
| 2428 | Ga0224712_10021596 | |||
| 2429 | Ga0224712_10037054 | |||
| 2430 | Ga0224572_1000179 | |||
| 2431 | Ga0224572_1000254 | |||
| 2432 | Ga0209566_100053 | |||
| 2433 | Ga0209674_100001 | |||
| 2434 | Ga0209672_100039 | |||
| 2435 | Ga0209147_101049 | |||
| 2436 | Ga0209563_100001 | |||
| 2437 | Ga0209563_100766 | |||
| 2438 | Ga0209646_1000088 | |||
| 2439 | Ga0209677_100001 | |||
| 2440 | Ga0209677_100448 | |||
| 2441 | Ga0209148_1000004 | |||
| 2442 | Ga0209148_1004065 | |||
| 2443 | Ga0209148_1004139 | |||
| 2444 | Ga0209129_1000047 | |||
| 2445 | Ga0209455_1000117 | |||
| 2446 | Ga0209455_1003789 | |||
| 2447 | Ga0209025_1000920 | |||
| 2448 | Ga0209758_1002219 | |||
| 2449 | Ga0207426_1005431 | |||
| 2450 | Ga0209051_1003197 | |||
| 2451 | Ga0209051_1013778 | |||
| 2452 | Ga0207697_10001921 | |||
| 2453 | Ga0207656_10000005 | |||
| 2454 | Ga0207655_1006296 | |||
| 2455 | Ga0207655_1015554 | |||
| 2456 | Ga0207713_1051913 | |||
| 2457 | Ga0207653_10006417 | |||
| 2458 | Ga0207682_10001886 | |||
| 2459 | Ga0207692_10000225 | |||
| 2460 | Ga0207692_10009769 | |||
| 2461 | Ga0207692_10049387 | |||
| 2462 | Ga0207692_10051604 | |||
| 2463 | Ga0207692_10134957 | |||
| 2464 | Ga0207642_10011637 | |||
| 2465 | Ga0207710_10033869 | |||
| 2466 | Ga0207710_10052795 | |||
| 2467 | Ga0207647_10009551 | |||
| 2468 | Ga0207647_10091475 | |||
| 2469 | Ga0207647_10135588 | |||
| 2470 | Ga0207685_10000224 | |||
| 2471 | Ga0207685_10030315 | |||
| 2472 | Ga0207699_10000106 | |||
| 2473 | Ga0207699_10004744 | |||
| 2474 | Ga0207699_10005198 | |||
| 2475 | Ga0207699_10007365 | |||
| 2476 | Ga0207699_10008667 | |||
| 2477 | Ga0207645_10016279 | |||
| 2478 | Ga0207643_10015262 | |||
| 2479 | Ga0207643_10132631 | |||
| 2480 | Ga0207643_10135365 | |||
| 2481 | Ga0207705_10000001 | |||
| 2482 | Ga0207705_10009574 | |||
| 2483 | Ga0207705_10014811 | |||
| 2484 | Ga0207705_10099321 | |||
| 2485 | Ga0207705_10139709 | |||
| 2486 | Ga0207705_10145603 | |||
| 2487 | Ga0207684_10002459 | |||
| 2488 | Ga0207684_10006157 | |||
| 2489 | Ga0207684_10013779 | |||
| 2490 | Ga0207684_10026141 | |||
| 2491 | Ga0207684_10031843 | |||
| 2492 | Ga0207684_10032282 | |||
| 2493 | Ga0207684_10032768 | |||
| 2494 | Ga0207654_10000001 | |||
| 2495 | Ga0207707_10003758 | |||
| 2496 | Ga0207707_10303097 | |||
| 2497 | Ga0207695_10005496 | |||
| 2498 | Ga0207671_10000016 | |||
| 2499 | Ga0207671_10177663 | |||
| 2500 | Ga0207693_10002782 | |||
| 2501 | Ga0207693_10003038 | |||
| 2502 | Ga0207693_10007334 | |||
| 2503 | Ga0207693_10008350 | |||
| 2504 | Ga0207693_10045686 | |||
| 2505 | Ga0207693_10072583 | |||
| 2506 | Ga0207693_10087986 | |||
| 2507 | Ga0207663_10005403 | |||
| 2508 | Ga0207663_10021516 | |||
| 2509 | Ga0207663_10034482 | |||
| 2510 | Ga0207663_10091360 | |||
| 2511 | Ga0207663_10188167 | |||
| 2512 | Ga0207660_10000245 | |||
| 2513 | Ga0207660_10104135 | |||
| 2514 | Ga0207662_10002253 | |||
| 2515 | Ga0207657_10018246 | |||
| 2516 | Ga0207657_10045521 | |||
| 2517 | Ga0207657_10080562 | |||
| 2518 | Ga0207657_10086227 | |||
| 2519 | Ga0207649_10053258 | |||
| 2520 | Ga0207652_10000294 | |||
| 2521 | Ga0207652_10068778 | |||
| 2522 | Ga0207652_10118221 | |||
| 2523 | Ga0207652_10149647 | |||
| 2524 | Ga0207646_10001959 | |||
| 2525 | Ga0207646_10004445 | |||
| 2526 | Ga0207646_10020856 | |||
| 2527 | Ga0207646_10053018 | |||
| 2528 | Ga0207646_10111544 | |||
| 2529 | Ga0207646_10117071 | |||
| 2530 | Ga0207646_10312279 | |||
| 2531 | Ga0207646_10345862 | |||
| 2532 | Ga0207681_10042632 | |||
| 2533 | Ga0207694_10000057 | |||
| 2534 | Ga0207694_10100546 | |||
| 2535 | Ga0207687_10013434 | |||
| 2536 | Ga0207687_10043864 | |||
| 2537 | Ga0207687_10045183 | |||
| 2538 | Ga0207687_10144667 | |||
| 2539 | Ga0207687_10240039 | |||
| 2540 | Ga0207700_10000053 | |||
| 2541 | Ga0207700_10002291 | |||
| 2542 | Ga0207700_10008955 | |||
| 2543 | Ga0207700_10011392 | |||
| 2544 | Ga0207700_10014429 | |||
| 2545 | Ga0207700_10016711 | |||
| 2546 | Ga0207700_10018986 | |||
| 2547 | Ga0207700_10034772 | |||
| 2548 | Ga0207700_10062900 | |||
| 2549 | Ga0207700_10065079 | |||
| 2550 | Ga0207700_10114707 | |||
| 2551 | Ga0207700_10162334 | |||
| 2552 | Ga0207664_10000701 | |||
| 2553 | Ga0207664_10000834 | |||
| 2554 | Ga0207664_10002440 | |||
| 2555 | Ga0207664_10002847 | |||
| 2556 | Ga0207664_10002931 | |||
| 2557 | Ga0207664_10005087 | |||
| 2558 | Ga0207664_10005293 | |||
| 2559 | Ga0207664_10014166 | |||
| 2560 | Ga0207664_10035531 | |||
| 2561 | Ga0207664_10067649 | |||
| 2562 | Ga0207664_10076669 | |||
| 2563 | Ga0207664_10096423 | |||
| 2564 | Ga0207664_10111991 | |||
| 2565 | Ga0207664_10178465 | |||
| 2566 | Ga0207644_10011157 | |||
| 2567 | Ga0207644_10283993 | |||
| 2568 | Ga0207690_10040760 | |||
| 2569 | Ga0207706_10010621 | |||
| 2570 | Ga0207706_10022853 | |||
| 2571 | Ga0207706_10024565 | |||
| 2572 | Ga0207686_10157297 | |||
| 2573 | Ga0207709_10031526 | |||
| 2574 | Ga0207669_10131751 | |||
| 2575 | Ga0207665_10000166 | |||
| 2576 | Ga0207665_10002299 | |||
| 2577 | Ga0207665_10011425 | |||
| 2578 | Ga0207665_10012620 | |||
| 2579 | Ga0207665_10026642 | |||
| 2580 | Ga0207665_10041375 | |||
| 2581 | Ga0207691_10001200 | |||
| 2582 | Ga0207691_10067617 | |||
| 2583 | Ga0207691_10165816 | |||
| 2584 | Ga0207711_10005166 | |||
| 2585 | Ga0207711_10098454 | |||
| 2586 | Ga0207689_10007084 | |||
| 2587 | Ga0207661_10054298 | |||
| 2588 | Ga0207661_10252596 | |||
| 2589 | Ga0207661_10308762 | |||
| 2590 | Ga0207679_10100044 | |||
| 2591 | Ga0207679_10210222 | |||
| 2592 | Ga0207667_10002042 | |||
| 2593 | Ga0207667_10011034 | |||
| 2594 | Ga0207667_10027457 | |||
| 2595 | Ga0207667_10138396 | |||
| 2596 | Ga0207712_10233207 | |||
| 2597 | Ga0207668_10094646 | |||
| 2598 | Ga0207668_10111826 | |||
| 2599 | Ga0207658_10203354 | |||
| 2600 | Ga0207677_10193109 | |||
| 2601 | Ga0207703_10000345 | |||
| 2602 | Ga0207639_10079767 | |||
| 2603 | Ga0207639_10088644 | |||
| 2604 | Ga0207678_10003794 | |||
| 2605 | Ga0207678_10007006 | |||
| 2606 | Ga0207678_10250368 | |||
| 2607 | Ga0207708_10103770 | |||
| 2608 | Ga0207702_10077147 | |||
| 2609 | Ga0207702_10173137 | |||
| 2610 | Ga0207702_10173323 | |||
| 2611 | Ga0207641_10002332 | |||
| 2612 | Ga0207648_10047554 | |||
| 2613 | Ga0207648_10062162 | |||
| 2614 | Ga0207676_10043731 | |||
| 2615 | Ga0207676_10061345 | |||
| 2616 | Ga0207674_10012372 | |||
| 2617 | Ga0207674_10013065 | |||
| 2618 | Ga0207674_10019331 | |||
| 2619 | Ga0207674_10045712 | |||
| 2620 | Ga0207675_100005332 | |||
| 2621 | Ga0207675_100047486 | |||
| 2622 | Ga0207675_100110508 | |||
| 2623 | Ga0207683_10001303 | |||
| 2624 | Ga0207683_10050682 | |||
| 2625 | Ga0207683_10059997 | |||
| 2626 | Ga0207683_10078958 | |||
| 2627 | Ga0207683_10109649 | |||
| 2628 | Ga0207683_10143628 | |||
| 2629 | Ga0207698_10004794 | |||
| 2630 | Ga0207698_10120534 | |||
| 2631 | Ga0207698_10192526 | |||
| 2632 | Ga0207428_10000102 | |||
| 2633 | Ga0207428_10002614 | |||
| 2634 | Ga0207428_10085407 | |||
| 2635 | Ga0268265_10117329 | |||
| 2636 | Ga0268264_10007965 | |||
| 2637 | Ga0265337_1000031 | |||
| 2638 | Ga0265319_1002342 | |||
| 2639 | Ga0265334_10000091 | |||
| 2640 | Ga0265334_10003140 | |||
| 2641 | Ga0265323_10049795 | |||
| 2642 | Ga0265322_10003185 | |||
| 2643 | Ga0265336_10007606 | |||
| 2644 | Ga0307517_10002777 | |||
| 2645 | Ga0307517_10015795 | |||
| 2646 | Ga0307515_10010875 | |||
| 2647 | Ga0307515_10180353 | |||
| 2648 | Ga0265338_10000233 | |||
| 2649 | Ga0265338_10002443 | |||
| 2650 | Ga0265338_10025625 | |||
| 2651 | Ga0265338_10233416 | |||
| 2652 | Ga0265324_10004717 | |||
| 2653 | Ga0307511_10018996 | |||
| 2654 | Ga0307511_10048418 | |||
| 2655 | Ga0307511_10052434 | |||
| 2656 | Ga0307512_10013114 | |||
| 2657 | Ga0307512_10087803 | |||
| 2658 | Ga0307512_10121776 | |||
| 2659 | Ga0314311_1016886 | |||
| 2660 | Ga0265332_10006014 | |||
| 2661 | Ga0265320_10008863 | |||
| 2662 | Ga0265327_10000019 | |||
| 2663 | Ga0265316_10065002 | |||
| 2664 | Ga0307513_10000936 | |||
| 2665 | Ga0307513_10001197 | |||
| 2666 | Ga0307513_10034204 | |||
| 2667 | Ga0307513_10223828 | |||
| 2668 | Ga0307509_10010025 | |||
| 2669 | Ga0307509_10061631 | |||
| 2670 | Ga0307509_10126821 | |||
| 2671 | Ga0307408_100003074 | |||
| 2672 | Ga0307408_100060781 | |||
| 2673 | Ga0307408_100099817 | |||
| 2674 | Ga0307408_100156051 | |||
| 2675 | Ga0307408_100216733 | |||
| 2676 | Ga0265313_10002825 | |||
| 2677 | Ga0307508_10001583 | |||
| 2678 | Ga0307508_10029203 | |||
| 2679 | Ga0307508_10033651 | |||
| 2680 | Ga0307514_10008438 | |||
| 2681 | Ga0307514_10090774 | |||
| 2682 | Ga0307514_10096465 | |||
| 2683 | Ga0316575_10000668 | |||
| 2684 | Ga0316575_10003717 | |||
| 2685 | Ga0316575_10091932 | |||
| 2686 | Ga0316579_10002190 | |||
| 2687 | Ga0316579_10118321 | |||
| 2688 | Ga0265314_10006509 | |||
| 2689 | Ga0265342_10004101 | |||
| 2690 | Ga0316576_10001465 | |||
| 2691 | Ga0316576_10002319 | |||
| 2692 | Ga0316576_10021064 | |||
| 2693 | Ga0316576_10023914 | |||
| 2694 | Ga0316578_10002782 | |||
| 2695 | Ga0316578_10038070 | |||
| 2696 | Ga0307516_10019845 | |||
| 2697 | Ga0307516_10036778 | |||
| 2698 | Ga0307405_10014792 | |||
| 2699 | Ga0307405_10023043 | |||
| 2700 | Ga0307405_10071150 | |||
| 2701 | Ga0307405_10086782 | |||
| 2702 | Ga0307405_10088812 | |||
| 2703 | Ga0307413_10007992 | |||
| 2704 | Ga0307413_10009243 | |||
| 2705 | Ga0307413_10046827 | |||
| 2706 | Ga0307413_10108539 | |||
| 2707 | Ga0307518_10057070 | |||
| 2708 | Ga0307410_10012152 | |||
| 2709 | Ga0307410_10017054 | |||
| 2710 | Ga0307410_10025171 | |||
| 2711 | Ga0307410_10038935 | |||
| 2712 | Ga0307410_10148707 | |||
| 2713 | Ga0307410_10149908 | |||
| 2714 | Ga0307410_10165544 | |||
| 2715 | Ga0307410_10250384 | |||
| 2716 | Ga0307406_10000104 | |||
| 2717 | Ga0307406_10000932 | |||
| 2718 | Ga0307406_10001566 | |||
| 2719 | Ga0307406_10076440 | |||
| 2720 | Ga0307407_10007739 | |||
| 2721 | Ga0307407_10010003 | |||
| 2722 | Ga0307407_10048355 | |||
| 2723 | Ga0307407_10075390 | |||
| 2724 | Ga0307407_10081179 | |||
| 2725 | Ga0307407_10164226 | |||
| 2726 | Ga0307412_10017272 | |||
| 2727 | Ga0307412_10029651 | |||
| 2728 | Ga0307412_10098355 | |||
| 2729 | Ga0307412_10212449 | |||
| 2730 | Ga0307409_100009644 | |||
| 2731 | Ga0307409_100034809 | |||
| 2732 | Ga0307409_100063923 | |||
| 2733 | Ga0307409_100106542 | |||
| 2734 | Ga0307409_100109373 | |||
| 2735 | Ga0307409_100109684 | |||
| 2736 | Ga0307409_100140908 | |||
| 2737 | Ga0307409_100147804 | |||
| 2738 | Ga0307409_100228942 | |||
| 2739 | Ga0307409_100279486 | |||
| 2740 | Ga0307409_100390846 | |||
| 2741 | Ga0307416_100004847 | |||
| 2742 | Ga0307416_100008600 | |||
| 2743 | Ga0307416_100024975 | |||
| 2744 | Ga0307416_100055367 | |||
| 2745 | Ga0307416_100057924 | |||
| 2746 | Ga0307416_100172596 | |||
| 2747 | Ga0307416_100254176 | |||
| 2748 | Ga0307416_100455599 | |||
| 2749 | Ga0307414_10016958 | |||
| 2750 | Ga0307414_10020103 | |||
| 2751 | Ga0307414_10024236 | |||
| 2752 | Ga0307414_10065704 | |||
| 2753 | Ga0307414_10141928 | |||
| 2754 | Ga0307411_10028720 | |||
| 2755 | Ga0307411_10062908 | |||
| 2756 | Ga0307411_10121414 | |||
| 2757 | Ga0307411_10156076 | |||
| 2758 | Ga0307411_10167669 | |||
| 2759 | Ga0307415_100021173 | |||
| 2760 | Ga0307415_100213319 | |||
| 2761 | Ga0307415_100215722 | |||
| 2762 | Ga0307415_100220758 | |||
| 2763 | Ga0316583_10031886 | |||
| 2764 | Ga0316585_10008431 | |||
| 2765 | Ga0307507_10000024 | |||
| 2766 | Ga0307507_10039031 | |||
| 2767 | Ga0307510_10071034 | |||
| 2768 | Ga0307510_10093196 | |||
| 2769 | Ga0316212_1008686 | |||
| 2770 | Ga0373938_0002225 | |||
| 2771 | Ga0373926_0018060 | |||
| 2772 | Ga0373926_0054436 | |||
| 2773 | Ga0373934_0000060 | |||
| 2774 | Ga0373934_0005753 | |||
| 2775 | Ga0373934_0007765 | |||
| 2776 | Ga0373934_0021948 | |||
| 2777 | Ga0373940_0013993 | |||
| 2778 | Ga0373944_0001496 | |||
| 2779 | Ga0373944_0006615 | |||
| 2780 | Ga0373923_0001412 | |||
| 2781 | Ga0373923_0006524 | |||
| 2782 | Ga0373923_0022397 | |||
| 2783 | Ga0373923_0030949 | |||
| 2784 | Ga0373932_0015193 | |||
| 2785 | Ga0373936_0000847 | |||
| 2786 | Ga0373936_0007777 | |||
| 2787 | Ga0373936_0015652 | |||
| 2788 | Ga0373936_0057553 | |||
| 2789 | Ga0373945_0000182 | |||
| 2790 | Ga0373953_0000277 | |||
| 2791 | Ga0373953_0002414 | |||
| 2792 | Ga0373953_0003904 | |||
| 2793 | Ga0373953_0012377 | |||
| 2794 | Ga0373954_0002950 | |||
| 2795 | Ga0373954_0023130 | |||
| 2796 | Ga0373954_0024959 | |||
| 2797 | Ga0373954_0025004 | |||
| 2798 | Ga0373954_0026765 | |||
| 2799 | Ga0373956_0000422 | |||
| 2800 | Ga0373956_0005349 | |||
| 2801 | Ga0373956_0005512 | |||
| 2802 | Ga0373956_0014937 | |||
| 2803 | Ga0373956_0029433 | |||
| 2804 | Ga0373956_0054191 | |||
| 2805 | Ga0373957_0000077 | |||
| 2806 | Ga0373957_0002673 | |||
| 2807 | Ga0373957_0012834 | |||
| 2808 | Ga0373957_0022802 | |||
| 2809 | Ga0373957_0024157 | |||
| 2810 | Ga0373957_0062286 | |||
| 2811 | Ga0373946_0000651 | |||
| 2812 | Ga0373946_0007865 | |||
| 2813 | Ga0373946_0059149 | |||
| 2814 | Ga0373955_0000013 | |||
| 2815 | Ga0373955_0027994 | |||
| 2816 | Ga0373955_0094242 | |||
| 2817 | Ga0373961_0013919 | |||
| 2818 | Ga0316574_0015485 | |||
| 2819 | Ga0316574_0076927 | |||
| 2820 | Ga0373924_0000936 | |||
| 2821 | Ga0373924_0009894 | |||
| 2822 | Ga0373935_0007297 | |||
| 2823 | Ga0373935_0037830 | |||
| 2824 | Ga0373935_0131404 | |||
| 2825 | Ga0373927_0012605 | |||
| 2826 | Ga0373927_0015053 | |||
| 2827 | Ga0373927_0144016 | |||
| 2828 | Ga0373933_0000139 | |||
| 2829 | Ga0373933_0001396 | |||
| 2830 | Ga0373933_0013994 | |||
| 2831 | Ga0373933_0044507 | |||
| 2832 | Ga0373947_0007347 | |||
| 2833 | Ga0373947_0123178 | |||
| 2834 | Ga0373947_0131535 | |||
| 2835 | Ga0373937_0000112 | |||
| 2836 | Ga0373937_0008701 | |||
| 2837 | Ga0373937_0010609 | |||
| 2838 | Ga0373937_0037477 | |||
| 2839 | Ga0373937_0193865 | |||
| 2840 | Ga0373937_0208875 | |||
| 2841 | Ga0372808_001746 | |||
| 2842 | Ga0316582_0004467 | |||
| 2843 | Ga0316582_0039405 | |||
| 2844 | Ga0316584_0003649 | |||
| 2845 | Ga0316584_0005041 | |||
| 2846 | Ga0316584_0012623 | |||
| 2847 | Ga0316584_0016410 | |||
| 2848 | Ga0316584_0030549 | |||
| 2849 | Ga0373925_0000008 | |||
| 2850 | Ga0373925_0002037 | |||
| 2851 | Ga0373925_0003433 | |||
| 2852 | Ga0373925_0007151 | |||
| 2853 | Ga0373925_0147876 | |||
| 2854 | Ga0395899_0005583 | |||
| 2855 | Ga0395899_0017225 | |||
| 2856 | Ga0395899_0032197 | |||
| 2857 | Ga0395899_0038763 | |||
| 2858 | Ga0395899_0040320 | |||
| 2859 | Ga0395899_0076971 | |||
| 2860 | Ga0395899_0110727 | |||
| 2861 | Ga0395899_0184253 | |||
| 2862 | Ga0395900_0011102 | |||
| 2863 | Ga0395900_0093930 | |||
| 2864 | Ga0395900_0102603 | |||
| 2865 | Ga0395900_0209796 | |||
| 2866 | Ga0395900_0407188 | |||
| 2867 | Ga0395898_0000381 | |||
| 2868 | Ga0395898_0001626 | |||
| 2869 | Ga0395898_0006252 | |||
| 2870 | Ga0395898_0016357 | |||
| 2871 | Ga0395898_0020646 | |||
| 2872 | Ga0395898_0027833 | |||
| 2873 | Ga0395898_0031520 | |||
| 2874 | Ga0395898_0057057 | |||
| 2875 | Ga0395898_0070700 | |||
| 2876 | Ga0395898_0089016 | |||
| 2877 | Ga0395898_0346841 | |||
| 2878 | Ga0395898_0367269 | |||
| 2879 | Ga0436364_0160104 | |||
| 2880 | Ga0436364_0287407 | |||
| 2881 | Ga0436364_0464514 | |||
| 2882 | Ga0436364_0964211 | |||
| 2883 | Ga0436364_1096374 | |||
| 2884 | Ga0436364_1261806 | |||
| 2885 | Ga0436364_1274663 | |||
| 2886 | Ga0436364_1379988 | |||
| 2887 | Ga0436364_1399659 | |||
| 2888 | Ga0395901_0036787 | |||
| 2889 | Ga0395901_0071477 | |||
| 2890 | Ga0395901_0079374 | |||
| 2891 | Ga0395901_0111329 | |||
| 2892 | Ga0395901_0131820 | |||
| 2893 | Ga0395901_0135263 | |||
| 2894 | Ga0395901_0145256 | |||
| 2895 | Ga0395901_0240809 | |||
| 2896 | Ga0395901_0272956 | |||
| 2897 | Ga0395901_0486909 | |||
| 2898 | Ga0400485_14348 | |||
| 2899 | Ga0400488_19742 | |||
| 2900 | Ga0400486_32183 | |||
| 2901 | Ga0436365_1516734 | |||
| 2902 | Ga0436360_1265940 | |||
| 2903 | Ga0439436_0001906 | |||
| 2904 | Ga0439436_0004852 | |||
| 2905 | Ga0439436_0012938 | |||
| 2906 | Ga0439436_0020025 | |||
| 2907 | Ga0439436_0037014 | |||
| 2908 | Ga0439438_052622 | |||
| 2909 | Ga0439439_0001108 | |||
| 2910 | Ga0439439_0002397 | |||
| 2911 | Ga0439447_016639 | |||
| 2912 | Ga0439466_0004226 | |||
| 2913 | Ga0439466_0004258 | |||
| 2914 | Ga0451791_0795391 | |||
| 2915 | Ga0451791_1067624 | |||
| 2916 | Ga0451793_0283208 | |||
| 2917 | Ga0451797_0921282 | |||
| 2918 | Ga0451802_0199680 | |||
| 2919 | Ga0451807_0181894 | |||
| 2920 | Ga0451833_1396629 | |||
| 2921 | Ga0451837_1299351 | |||
| 2922 | Ga0451839_1074799 | |||
| 2923 | Ga0451853_0509641 | |||
| 2924 | Ga0451853_2323682 | |||
| 2925 | Ga0439433_0000156 | |||
| 2926 | Ga0439433_0000220 | |||
| 2927 | Ga0439442_000012 | |||
| 2928 | Ga0439442_000083 | |||
| 2929 | Ga0439442_000162 | |||
| 2930 | Ga0439442_004696 | |||
| 2931 | Ga0439442_009119 | |||
| 2932 | Ga0439449_0000984 | |||
| 2933 | Ga0439449_0029595 | |||
| 2934 | Ga0439452_007207 | |||
| 2935 | Ga0439457_000027 | |||
| 2936 | Ga0439457_003698 | |||
| 2937 | Ga0439457_004957 | |||
| 2938 | Ga0439462_0041974 | |||
| 2939 | Ga0439462_0057144 | |||
| 2940 | Ga0450894_000043 | |||
| 2941 | Ga0450907_000265 | |||
| 2942 | Ga0450907_005873 | |||
| 2943 | Ga0439458_0001450 | |||
| 2944 | Ga0450909_000182 | |||
| 2945 | Ga0439434_0000031 | |||
| 2946 | Ga0439434_0003626 | |||
| 2947 | Ga0439434_0013610 | |||
| 2948 | Ga0450918_000950 | |||
| 2949 | Ga0450918_003686 | |||
| 2950 | Ga0466969_0019697 | |||
| 2951 | Ga0466969_0030935 | |||
| 2952 | Ga0466969_0037022 | |||
| 2953 | Ga0466972_0004584 | |||
| 2954 | Ga0466972_0035044 | |||
| 2955 | Ga0466972_0047412 | |||
| 2956 | Ga0466972_0059802 | |||
| 2957 | Ga0466965_0000038 | |||
| 2958 | Ga0466965_0013448 | |||
| 2959 | Ga0466965_0034551 | |||
| 2960 | Ga0466965_0046392 | |||
| 2961 | Ga0466966_0032573 | |||
| 2962 | Ga0466966_0058359 | |||
| 2963 | Ga0466966_0189110 | |||
| 2964 | Ga0466961_0000630 | |||
| 2965 | Ga0466961_0004359 | |||
| 2966 | Ga0466961_0004420 | |||
| 2967 | Ga0466961_0031022 | |||
| 2968 | Ga0466961_0048035 | |||
| 2969 | Ga0466961_0072229 | |||
| 2970 | Ga0466963_0000611 | |||
| 2971 | Ga0466963_0002295 | |||
| 2972 | Ga0466963_0074190 | |||
| 2973 | Ga0466963_0191155 | |||
| 2974 | Ga0466963_0255975 | |||
| 2975 | Ga0466971_0000512 | |||
| 2976 | Ga0466971_0001195 | |||
| 2977 | Ga0466971_0001379 | |||
| 2978 | Ga0466971_0084173 | |||
| 2979 | Ga0466968_0010980 | |||
| 2980 | Ga0466970_0000322 | |||
| 2981 | Ga0466970_0002564 | |||
| 2982 | Ga0466970_0004093 | |||
| 2983 | Ga0466970_0013270 | |||
| 2984 | Ga0466970_0020549 | |||
| 2985 | Ga0466970_0027254 | |||
| 2986 | Ga0466970_0044803 | |||
| 2987 | Ga0466970_0057628 | |||
| 2988 | Ga0466957_0000143 | |||
| 2989 | Ga0466957_0108661 | |||
| 2990 | Ga0466960_0009565 | |||
| 2991 | Ga0466960_0012316 | |||
| 2992 | Ga0466960_0029449 | |||
| 2993 | Ga0466960_0029531 | |||
| 2994 | Ga0466960_0118455 | |||
| 2995 | Ga0466959_0005248 | |||
| 2996 | Ga0466959_0051206 | |||
| 2997 | Ga0466959_0059799 | |||
| 2998 | Ga0466959_0196100 | |||
| 2999 | Ga0466958_0003353 | |||
| 3000 | Ga0466958_0017403 | |||
| 3001 | Ga0466958_0047464 | |||
| 3002 | Ga0466958_0071467 | |||
| 3003 | Ga0466958_0111387 | |||
| 3004 | Ga0466958_0172368 | |||
| 3005 | Ga0466967_0009414 | |||
| 3006 | Ga0466967_0027218 | |||
| 3007 | Ga0466967_0053667 | |||
| 3008 | Ga0466967_0080891 | |||
| 3009 | Ga0466967_0546302 | |||
| 3010 | Ga0495627_001457 | |||
| 3011 | Ga0495627_033005 | |||
| 3012 | Ga0495592_0000094 | |||
| 3013 | Ga0495592_0000481 | |||
| 3014 | Ga0495592_0008825 | |||
| 3015 | Ga0495592_0032917 | |||
| 3016 | Ga0495592_0086011 | |||
| 3017 | Ga0495592_0103099 | |||
| 3018 | Ga0495592_0110410 | |||
| 3019 | Ga0495592_0121173 | |||
| 3020 | Ga0495603_0001779 | |||
| 3021 | Ga0495603_0006149 | |||
| 3022 | Ga0495603_0012191 | |||
| 3023 | Ga0495603_0167868 | |||
| 3024 | Ga0495590_0000094 | |||
| 3025 | Ga0495590_0010180 | |||
| 3026 | Ga0495629_0002238 | |||
| 3027 | Ga0495629_0004014 | |||
| 3028 | Ga0495629_0005922 | |||
| 3029 | Ga0495629_0017611 | |||
| 3030 | Ga0495629_0079132 | |||
| 3031 | Ga0495638_0024022 | |||
| 3032 | Ga0495638_0183544 | |||
| 3033 | Ga0495641_0007164 | |||
| 3034 | Ga0495641_0014070 | |||
| 3035 | Ga0495641_0016263 | |||
| 3036 | Ga0495641_0040202 | |||
| 3037 | Ga0495651_0000041 | |||
| 3038 | Ga0495651_0002291 | |||
| 3039 | Ga0495651_0009757 | |||
| 3040 | Ga0495651_0013168 | |||
| 3041 | Ga0495651_0042337 | |||
| 3042 | Ga0495651_0042569 | |||
| 3043 | Ga0495651_0068071 | |||
| 3044 | Ga0495651_0073357 | |||
| 3045 | Ga0495651_0077794 | |||
| 3046 | Ga0495651_0081622 | |||
| 3047 | Ga0495651_0084716 | |||
| 3048 | Ga0495653_0002267 | |||
| 3049 | Ga0495653_0006276 | |||
| 3050 | Ga0495653_0007658 | |||
| 3051 | Ga0495653_0026502 | |||
| 3052 | Ga0495653_0039274 | |||
| 3053 | Ga0495653_0045800 | |||
| 3054 | Ga0495653_0137825 | |||
| 3055 | Ga0495650_0016212 | |||
| 3056 | Ga0495650_0060587 | |||
| 3057 | Ga0495580_0016321 | |||
| 3058 | Ga0495580_0023584 | |||
| 3059 | Ga0495580_0044397 | |||
| 3060 | Ga0495580_0078078 | |||
| 3061 | Ga0495582_0001614 | |||
| 3062 | Ga0495582_0015676 | |||
| 3063 | Ga0495582_0070053 | |||
| 3064 | Ga0495582_0120796 | |||
| 3065 | Ga0495605_0021869 | |||
| 3066 | Ga0495639_0001608 | |||
| 3067 | Ga0495639_0006034 | |||
| 3068 | Ga0495662_0000490 | |||
| 3069 | Ga0495662_0001269 | |||
| 3070 | Ga0495662_0006654 | |||
| 3071 | Ga0495662_0015157 | |||
| 3072 | Ga0495662_0017624 | |||
| 3073 | Ga0495662_0022376 | |||
| 3074 | Ga0495662_0098602 | |||
| 3075 | Ga0495664_0000351 | |||
| 3076 | Ga0495664_0002132 | |||
| 3077 | Ga0495664_0012658 | |||
| 3078 | Ga0495664_0013992 | |||
| 3079 | Ga0495664_0014416 | |||
| 3080 | Ga0495664_0023780 | |||
| 3081 | Ga0495664_0045484 | |||
| 3082 | Ga0495664_0095689 | |||
| 3083 | Ga0495664_0121248 | |||
| 3084 | Ga0495584_0011675 | |||
| 3085 | Ga0495585_0002304 | |||
| 3086 | Ga0495594_0008762 | |||
| 3087 | Ga0495594_0025952 | |||
| 3088 | Ga0495594_0044164 | |||
| 3089 | Ga0495594_0117357 | |||
| 3090 | Ga0495596_0024389 | |||
| 3091 | Ga0495607_0129690 | |||
| 3092 | Ga0495608_0000081 | |||
| 3093 | Ga0495608_0005238 | |||
| 3094 | Ga0495608_0005899 | |||
| 3095 | Ga0495608_0009160 | |||
| 3096 | Ga0495608_0012635 | |||
| 3097 | Ga0495608_0015039 | |||
| 3098 | Ga0495608_0022768 | |||
| 3099 | Ga0495608_0038030 | |||
| 3100 | Ga0495616_0008848 | |||
| 3101 | Ga0495618_0007735 | |||
| 3102 | Ga0495618_0016327 | |||
| 3103 | Ga0495618_0087836 | |||
| 3104 | Ga0495618_0108606 | |||
| 3105 | Ga0495618_0126501 | |||
| 3106 | Ga0495620_0020344 | |||
| 3107 | Ga0495628_0000164 | |||
| 3108 | Ga0495628_0017977 | |||
| 3109 | Ga0495628_0027448 | |||
| 3110 | Ga0495628_0038786 | |||
| 3111 | Ga0495628_0067706 | |||
| 3112 | Ga0495628_0069623 | |||
| 3113 | Ga0495628_0112235 | |||
| 3114 | Ga0495628_0112763 | |||
| 3115 | Ga0495628_0134712 | |||
| 3116 | Ga0495628_0138633 | |||
| 3117 | Ga0495630_0026724 | |||
| 3118 | Ga0495630_0049619 | |||
| 3119 | Ga0495630_0118189 | |||
| 3120 | Ga0495630_0172843 | |||
| 3121 | Ga0495631_0004932 | |||
| 3122 | Ga0495631_0025816 | |||
| 3123 | Ga0495632_0085526 | |||
| 3124 | Ga0495637_0051577 | |||
| 3125 | Ga0495643_0001347 | |||
| 3126 | Ga0495643_0056504 | |||
| 3127 | Ga0495663_0025093 | |||
| 3128 | Ga0495652_0000289 | |||
| 3129 | Ga0495652_0020655 | |||
| 3130 | Ga0495652_0026494 | |||
| 3131 | Ga0495652_0069294 | |||
| 3132 | Ga0495652_0080266 | |||
| 3133 | Ga0495652_0102644 | |||
| 3134 | Ga0495652_0122654 | |||
| 3135 | Ga0495652_0162901 | |||
| 3136 | Ga0495654_0023227 | |||
| 3137 | Ga0495665_0001175 | |||
| 3138 | Ga0495665_0002775 | |||
| 3139 | Ga0495665_0003528 | |||
| 3140 | Ga0495665_0026611 | |||
| 3141 | Ga0495665_0101074 | |||
| 3142 | Ga0495640_0013085 | |||
| 3143 | Ga0495640_0022205 | |||
| 3144 | Ga0495640_0026527 | |||
| 3145 | Ga0495640_0040085 | |||
| 3146 | Ga0495640_0045928 | |||
| 3147 | Ga0495640_0050900 | |||
| 3148 | Ga0495640_0125465 | |||
| 3149 | Ga0495586_0005989 | |||
| 3150 | Ga0495586_0017800 | |||
| 3151 | Ga0495586_0035870 | |||
| 3152 | Ga0495586_0040418 | |||
| 3153 | Ga0495586_0070150 | |||
| 3154 | Ga0495586_0081510 | |||
| 3155 | Ga0495586_0114722 | |||
| 3156 | Ga0495587_0000038 | |||
| 3157 | Ga0495587_0002540 | |||
| 3158 | Ga0495587_0003607 | |||
| 3159 | Ga0495587_0004772 | |||
| 3160 | Ga0495587_0006829 | |||
| 3161 | Ga0495587_0011078 | |||
| 3162 | Ga0495587_0042335 | |||
| 3163 | Ga0495587_0259725 | |||
| 3164 | Ga0495609_0027336 | |||
| 3165 | Ga0495609_0043122 | |||
| 3166 | Ga0495597_0011805 | |||
| 3167 | Ga0495645_0002826 | |||
| 3168 | Ga0495645_0004680 | |||
| 3169 | Ga0495645_0017922 | |||
| 3170 | Ga0495645_0031690 | |||
| 3171 | Ga0495645_0032889 | |||
| 3172 | Ga0495645_0056280 | |||
| 3173 | Ga0495645_0078459 | |||
| 3174 | Ga0495645_0107550 | |||
| 3175 | Ga0495645_0124372 | |||
| 3176 | Ga0495645_0150757 | |||
| 3177 | Ga0495645_0180555 | |||
| 3178 | Ga0495622_0006569 | |||
| 3179 | Ga0495667_0000070 | |||
| 3180 | Ga0495667_0003737 | |||
| 3181 | Ga0495667_0038072 | |||
| 3182 | Ga0495667_0052664 | |||
| 3183 | Ga0495667_0067051 | |||
| 3184 | Ga0495667_0087278 | |||
| 3185 | Ga0495667_0119304 | |||
| 3186 | Ga0495667_0173174 | |||
| 3187 | Ga0495634_0002454 | |||
| 3188 | Ga0495634_0028577 | |||
| 3189 | Ga0495634_0041285 | |||
| 3190 | Ga0495634_0098856 | |||
| 3191 | Ga0495611_0026253 | |||
| 3192 | Ga0495625_0010712 | |||
| 3193 | Ga0495635_0002501 | |||
| 3194 | Ga0495635_0007697 | |||
| 3195 | Ga0495635_0016282 | |||
| 3196 | Ga0495635_0032208 | |||
| 3197 | Ga0495635_0032458 | |||
| 3198 | Ga0495635_0045447 | |||
| 3199 | Ga0495635_0078795 | |||
| 3200 | Ga0495659_0006157 | |||
| 3201 | Ga0495588_0054453 | |||
| 3202 | Ga0495588_0074525 | |||
| 3203 | Ga0495657_0000192 | |||
| 3204 | Ga0495657_0001801 | |||
| 3205 | Ga0495657_0007863 | |||
| 3206 | Ga0495657_0017701 | |||
| 3207 | Ga0495657_0019259 | |||
| 3208 | Ga0495657_0034064 | |||
| 3209 | Ga0495657_0034170 | |||
| 3210 | Ga0495657_0062590 | |||
| 3211 | Ga0495657_0114737 | |||
| 3212 | Ga0495657_0116754 | |||
| 3213 | Ga0495599_0000100 | |||
| 3214 | Ga0495599_0007362 | |||
| 3215 | Ga0495599_0018592 | |||
| 3216 | Ga0495599_0028460 | |||
| 3217 | Ga0495599_0050021 | |||
| 3218 | Ga0495623_0000409 | |||
| 3219 | Ga0495623_0002698 | |||
| 3220 | Ga0495623_0016055 | |||
| 3221 | Ga0495623_0040737 | |||
| 3222 | Ga0495623_0047715 | |||
| 3223 | Ga0495623_0060152 | |||
| 3224 | Ga0495623_0094606 | |||
| 3225 | Ga0495646_0005300 | |||
| 3226 | Ga0495646_0046110 | |||
| 3227 | Ga0495646_0051293 | |||
| 3228 | Ga0495647_0003185 | |||
| 3229 | Ga0495647_0011635 | |||
| 3230 | Ga0495658_0002514 | |||
| 3231 | Ga0495658_0038925 | |||
| 3232 | Ga0495658_0087508 | |||
| 3233 | Ga0495613_0004118 | |||
| 3234 | Ga0495613_0005121 | |||
| 3235 | Ga0495613_0007805 | |||
| 3236 | Ga0495613_0017497 | |||
| 3237 | Ga0495613_0043432 | |||
| 3238 | Ga0495613_0222982 | |||
| 3239 | Ga0495624_0006182 | |||
| 3240 | Ga0495624_0022253 | |||
| 3241 | Ga0495624_0046417 | |||
| 3242 | Ga0495624_0049837 | |||
| 3243 | Ga0495624_0092011 | |||
| 3244 | Ga0495670_0023417 | |||
| 3245 | Ga0495670_0071207 | |||
| 3246 | Ga0495671_0005333 | |||
| 3247 | Ga0495589_0022703 | |||
| 3248 | Ga0495600_0001188 | |||
| 3249 | Ga0495600_0004237 | |||
| 3250 | Ga0495600_0005804 | |||
| 3251 | Ga0495600_0009346 | |||
| 3252 | Ga0495600_0013174 | |||
| 3253 | Ga0495600_0035019 | |||
| 3254 | Ga0495600_0041537 | |||
| 3255 | Ga0495600_0051307 | |||
| 3256 | Ga0495600_0140257 | |||
| 3257 | Ga0495600_0172600 | |||
| 3258 | Ga0495660_0006238 | |||
| 3259 | Ga0495581_0003354 | |||
| 3260 | Ga0495581_0044659 | |||
| 3261 | Ga0495581_0059541 | |||
| 3262 | Ga0495581_0076501 | |||
| 3263 | Ga0495581_0110107 | |||
| 3264 | Ga0495581_0112287 | |||
| 3265 | Ga0495604_0000061 | |||
| 3266 | Ga0495604_0002802 | |||
| 3267 | Ga0495604_0026075 | |||
| 3268 | Ga0495604_0033094 | |||
| 3269 | Ga0495604_0033445 | |||
| 3270 | Ga0495604_0050839 | |||
| 3271 | Ga0495604_0141761 | |||
| 3272 | Ga0495604_0223403 | |||
| 3273 | Ga0495636_0002194 | |||
| 3274 | Ga0495636_0032486 | |||
| 3275 | Ga0495674_0019179 | |||
| 3276 | Ga0495674_0027638 | |||
| 3277 | Ga0495674_0037963 | |||
| 3278 | Ga0495674_0048001 | |||
| 3279 | Ga0495674_0070377 | |||
| 3280 | Ga0495674_0083559 | |||
| 3281 | Ga0495674_0148901 | |||
| 3282 | Ga0495674_0278225 | |||
| 3283 | Ga0495672_0015842 | |||
| 3284 | Ga0495676_0024813 | |||
| 3285 | Ga0495676_0028997 | |||
| 3286 | Ga0495676_0035758 | |||
| 3287 | Ga0495676_0071092 | |||
| 3288 | Ga0495676_0116781 | |||
| 3289 | Ga0495680_0000099 | |||
| 3290 | Ga0495680_0005688 | |||
| 3291 | Ga0495680_0005926 | |||
| 3292 | Ga0495680_0011978 | |||
| 3293 | Ga0495680_0011998 | |||
| 3294 | Ga0495680_0017923 | |||
| 3295 | Ga0495680_0023854 | |||
| 3296 | Ga0495680_0029389 | |||
| 3297 | Ga0495680_0030570 | |||
| 3298 | Ga0495680_0069758 | |||
| 3299 | Ga0495680_0170421 | |||
| 3300 | Ga0495680_0173768 | |||
| 3301 | Ga0495687_002575 | |||
| 3302 | Ga0495687_026770 | |||
| 3303 | Ga0495675_0005606 | |||
| 3304 | Ga0495675_0014263 | |||
| 3305 | Ga0495675_0017765 | |||
| 3306 | Ga0495675_0018969 | |||
| 3307 | Ga0495675_0019565 | |||
| 3308 | Ga0495675_0020983 | |||
| 3309 | Ga0495675_0052338 | |||
| 3310 | Ga0495675_0101922 | |||
| 3311 | Ga0495685_000277 | |||
| 3312 | Ga0495673_0084402 | |||
| 3313 | Ga0495681_0000289 | |||
| 3314 | Ga0495681_0077508 | |||
| 3315 | Ga0495684_0002552 | |||
| 3316 | Ga0495684_0002952 | |||
| 3317 | Ga0495684_0013883 | |||
| 3318 | Ga0495684_0016318 | |||
| 3319 | Ga0495684_0027440 | |||
| 3320 | Ga0495684_0039709 | |||
| 3321 | Ga0495684_0089962 | |||
| 3322 | Ga0495684_0128301 | |||
| 3323 | Ga0495684_0154148 | |||
| 3324 | Ga0495684_0193289 | |||
| 3325 | Ga0495684_0221305 | |||
| 3326 | Ga0495593_0001682 | |||
| 3327 | Ga0495593_0007995 | |||
| 3328 | Ga0495593_0016042 | |||
| 3329 | Ga0495593_0031017 | |||
| 3330 | Ga0495602_0000649 | |||
| 3331 | Ga0495602_0021967 | |||
| 3332 | Ga0495602_0022801 | |||
| 3333 | Ga0495602_0046525 | |||
| 3334 | Ga0495602_0077403 | |||
| 3335 | Ga0495602_0108079 | |||
| 3336 | Ga0495602_0177044 | |||
| 3337 | Ga0495602_0207241 | |||
| 3338 | Ga0495614_0000245 | |||
| 3339 | Ga0495626_0004415 | |||
| 3340 | Ga0496100_0007737 | |||
| 3341 | Ga0496100_0016444 | |||
| 3342 | Ga0496100_0029003 | |||
| 3343 | Ga0496100_0037110 | |||
| 3344 | Ga0496100_0097033 | |||
| 3345 | Ga0496101_0007337 | |||
| 3346 | Ga0496101_0028405 | |||
| 3347 | Ga0496101_0050988 | |||
| 3348 | Ga0496101_0103857 | |||
| 3349 | Ga0496101_0158675 | |||
| 3350 | Ga0496101_0174961 | |||
| 3351 | Ga0496101_0278620 | |||
| 3352 | Ga0496101_0286128 | |||
| 3353 | Ga0496102_0000236 | |||
| 3354 | Ga0496102_0006337 | |||
| 3355 | Ga0496102_0012264 | |||
| 3356 | Ga0496102_0013702 | |||
| 3357 | Ga0496102_0046015 | |||
| 3358 | Ga0496102_0058240 | |||
| 3359 | Ga0496102_0128630 | |||
| 3360 | Ga0496102_0357919 | |||
| 3361 | Ga0496102_0375764 | |||
| 3362 | Ga0496103_0000185 | |||
| 3363 | Ga0496103_0008811 | |||
| 3364 | Ga0496103_0018888 | |||
| 3365 | Ga0496103_0033020 | |||
| 3366 | Ga0496103_0042282 | |||
| 3367 | Ga0496103_0070949 | |||
| 3368 | Ga0496103_0118362 | |||
| 3369 | Ga0496104_0000836 | |||
| 3370 | Ga0496104_0004654 | |||
| 3371 | Ga0496104_0006197 | |||
| 3372 | Ga0496104_0006329 | |||
| 3373 | Ga0496104_0021598 | |||
| 3374 | Ga0496104_0095950 | |||
| 3375 | Ga0496104_0315250 | |||
| 3376 | Ga0496104_0349905 | |||
| 3377 | Ga0496105_0001152 | |||
| 3378 | Ga0496105_0006003 | |||
| 3379 | Ga0496105_0009146 | |||
| 3380 | Ga0496105_0025178 | |||
| 3381 | Ga0496105_0039651 | |||
| 3382 | Ga0496105_0041449 | |||
| 3383 | Ga0496105_0061154 | |||
| 3384 | Ga0496105_0094807 | |||
| 3385 | Ga0496105_0142604 | |||
| 3386 | Ga0496105_0147804 | |||
| 3387 | Ga0496105_0163629 | |||
| 3388 | Ga0496105_0203627 | |||
| 3389 | Ga0496105_0262892 | |||
| 3390 | Ga0496106_0004056 | |||
| 3391 | Ga0496106_0050284 | |||
| 3392 | Ga0496106_0213560 | |||
| 3393 | Ga0496107_0010945 | |||
| 3394 | Ga0496107_0039784 | |||
| 3395 | Ga0496107_0076637 | |||
| 3396 | Ga0496107_0142423 | |||
| 3397 | Ga0496108_0002269 | |||
| 3398 | Ga0496108_0006606 | |||
| 3399 | Ga0496108_0020362 | |||
| 3400 | Ga0496108_0071227 | |||
| 3401 | Ga0496108_0086847 | |||
| 3402 | Ga0496108_0099231 | |||
| 3403 | Ga0496108_0141913 | |||
| 3404 | Ga0496108_0311417 | |||
| 3405 | Ga0496108_0332564 | |||
| 3406 | Ga0496109_0001771 | |||
| 3407 | Ga0496109_0043541 | |||
| 3408 | Ga0496109_0093261 | |||
| 3409 | Ga0496109_0109774 | |||
| 3410 | Ga0496109_0189008 | |||
| 3411 | Ga0496109_0278913 | |||
| 3412 | Ga0496110_0000402 | |||
| 3413 | Ga0496110_0040056 | |||
| 3414 | Ga0496110_0064159 | |||
| 3415 | Ga0496110_0067588 | |||
| 3416 | Ga0496110_0110730 | |||
| 3417 | Ga0496110_0139127 | |||
| 3418 | Ga0496110_0171369 | |||
| 3419 | Ga0496110_0180304 | |||
| 3420 | Ga0496110_0237305 | |||
| 3421 | Ga0496110_0263563 | |||
| 3422 | Ga0496111_0008549 | |||
| 3423 | Ga0496111_0192563 | |||
| 3424 | Ga0496111_0209079 | |||
| 3425 | Ga0496112_0003674 | |||
| 3426 | Ga0496112_0004882 | |||
| 3427 | Ga0496112_0057931 | |||
| 3428 | Ga0496112_0100835 | |||
| 3429 | Ga0496112_0166035 | |||
| 3430 | Ga0496112_0256377 | |||
| 3431 | Ga0496112_0412491 | |||
| 3432 | Ga0496113_0015524 | |||
| 3433 | Ga0496113_0017024 | |||
| 3434 | Ga0496113_0029029 | |||
| 3435 | Ga0496113_0048554 | |||
| 3436 | Ga0496113_0071819 | |||
| 3437 | Ga0496113_0074984 | |||
| 3438 | Ga0496113_0469384 | |||
| 3439 | Ga0496114_0003907 | |||
| 3440 | Ga0496114_0010520 | |||
| 3441 | Ga0496114_0021323 | |||
| 3442 | Ga0496114_0028070 | |||
| 3443 | Ga0496114_0028689 | |||
| 3444 | Ga0496114_0081784 | |||
| 3445 | Ga0496114_0106929 | |||
| 3446 | Ga0496114_0129495 | |||
| 3447 | Ga0496114_0130696 | |||
| 3448 | Ga0496114_0167237 | |||
| 3449 | Ga0496114_0176625 | |||
| 3450 | Ga0496114_0242881 | |||
| 3451 | Ga0496115_0004890 | |||
| 3452 | Ga0496115_0006411 | |||
| 3453 | Ga0496115_0006671 | |||
| 3454 | Ga0496115_0012610 | |||
| 3455 | Ga0496115_0030355 | |||
| 3456 | Ga0496115_0049791 | |||
| 3457 | Ga0496115_0081938 | |||
| 3458 | Ga0496115_0133557 | |||
| 3459 | Ga0496116_0000340 | |||
| 3460 | Ga0496117_0000387 | |||
| 3461 | Ga0496117_0000738 | |||
| 3462 | Ga0496117_0000791 | |||
| 3463 | Ga0496117_0000986 | |||
| 3464 | Ga0496117_0001718 | |||
| 3465 | Ga0496117_0012087 | |||
| 3466 | Ga0496117_0012943 | |||
| 3467 | Ga0496117_0023293 | |||
| 3468 | Ga0496117_0041758 | |||
| 3469 | Ga0496118_0000096 | |||
| 3470 | Ga0496118_0000610 | |||
| 3471 | Ga0496118_0002673 | |||
| 3472 | Ga0496118_0006467 | |||
| 3473 | Ga0496118_0009795 | |||
| 3474 | Ga0496118_0016454 | |||
| 3475 | Ga0496118_0033164 | |||
| 3476 | Ga0496118_0042203 | |||
| 3477 | Ga0496118_0091107 | |||
| 3478 | Ga0496118_0115595 | |||
| 3479 | Ga0496119_0000340 | |||
| 3480 | Ga0496119_0000437 | |||
| 3481 | Ga0496119_0001355 | |||
| 3482 | Ga0496119_0002632 | |||
| 3483 | Ga0496119_0004459 | |||
| 3484 | Ga0496119_0005146 | |||
| 3485 | Ga0496119_0009558 | |||
| 3486 | Ga0496119_0018646 | |||
| 3487 | Ga0496119_0041849 | |||
| 3488 | Ga0496119_0061246 | |||
| 3489 | Ga0496119_0063300 | |||
| 3490 | Ga0496119_0065003 | |||
| 3491 | Ga0496119_0123262 | |||
| 3492 | Ga0496120_0001932 | |||
| 3493 | Ga0496120_0005677 | |||
| 3494 | Ga0496120_0006725 | |||
| 3495 | Ga0496120_0006917 | |||
| 3496 | Ga0496120_0022515 | |||
| 3497 | Ga0496120_0023496 | |||
| 3498 | Ga0496120_0031483 | |||
| 3499 | Ga0496120_0039950 | |||
| 3500 | Ga0496121_0000015 | |||
| 3501 | Ga0496121_0080853 | |||
| 3502 | Ga0496121_0169373 | |||
| 3503 | Ga0496121_0219052 | |||
| 3504 | Ga0496122_0000020 | |||
| 3505 | Ga0496122_0001218 | |||
| 3506 | Ga0496122_0005902 | |||
| 3507 | Ga0496122_0005965 | |||
| 3508 | Ga0496122_0009445 | |||
| 3509 | Ga0496122_0011256 | |||
| 3510 | Ga0496122_0062094 | |||
| 3511 | Ga0496122_0070148 | |||
| 3512 | Ga0496122_0086360 | |||
| 3513 | Ga0496123_0000003 | |||
| 3514 | Ga0496123_0000009 | |||
| 3515 | Ga0496123_0000922 | |||
| 3516 | Ga0496123_0003978 | |||
| 3517 | Ga0496123_0028382 | |||
| 3518 | Ga0496123_0039255 | |||
| 3519 | Ga0496123_0078797 | |||
| 3520 | Ga0496124_0000135 | |||
| 3521 | Ga0496124_0002352 | |||
| 3522 | Ga0496124_0002908 | |||
| 3523 | Ga0496124_0005711 | |||
| 3524 | Ga0496124_0039133 | |||
| 3525 | Ga0496124_0078730 | |||
| 3526 | Ga0496124_0105592 | |||
| 3527 | Ga0496125_0000086 | |||
| 3528 | Ga0496125_0000209 | |||
| 3529 | Ga0496125_0001608 | |||
| 3530 | Ga0496125_0005451 | |||
| 3531 | Ga0496125_0006238 | |||
| 3532 | Ga0496125_0012012 | |||
| 3533 | Ga0496125_0036438 | |||
| 3534 | Ga0496125_0040583 | |||
| 3535 | Ga0496125_0080753 | |||
| 3536 | Ga0496126_0000547 | |||
| 3537 | Ga0496126_0002060 | |||
| 3538 | Ga0496126_0007345 | |||
| 3539 | Ga0496126_0030861 | |||
| 3540 | Ga0496126_0038893 | |||
| 3541 | Ga0496126_0053780 | |||
| 3542 | Ga0496126_0069828 | |||
| 3543 | Ga0496126_0083544 | |||
| 3544 | Ga0496126_0118501 | |||
| 3545 | Ga0496126_0281447 | |||
| 3546 | Ga0501318_003946 | |||
| 3547 | Ga0501321_002166 | |||
| 3548 | Ga0501031_0002231 | |||
| 3549 | Ga0501031_0005538 | |||
| 3550 | Ga0501031_0006771 | |||
| 3551 | Ga0501031_0008520 | |||
| 3552 | Ga0501031_0028733 | |||
| 3553 | Ga0501032_0001733 | |||
| 3554 | Ga0501032_0006740 | |||
| 3555 | Ga0501032_0007901 | |||
| 3556 | Ga0501032_0010914 | |||
| 3557 | Ga0501032_0012689 | |||
| 3558 | Ga0501032_0015179 | |||
| 3559 | Ga0501032_0017903 | |||
| 3560 | Ga0501032_0020302 | |||
| 3561 | Ga0501032_0038963 | |||
| 3562 | Ga0501032_0043425 | |||
| 3563 | Ga0501032_0057119 | |||
| 3564 | Ga0501032_0123968 | |||
| 3565 | Ga0501032_0143916 | |||
| 3566 | Ga0501033_0001533 | |||
| 3567 | Ga0501033_0006784 | |||
| 3568 | Ga0501033_0016453 | |||
| 3569 | Ga0501033_0037448 | |||
| 3570 | Ga0501033_0047280 | |||
| 3571 | Ga0501033_0075075 | |||
| 3572 | Ga0501033_0099379 | |||
| 3573 | Ga0501033_0163489 | |||
| 3574 | Ga0501034_0000079 | |||
| 3575 | Ga0501034_0000910 | |||
| 3576 | Ga0501034_0004451 | |||
| 3577 | Ga0501034_0004610 | |||
| 3578 | Ga0501034_0005584 | |||
| 3579 | Ga0501034_0007328 | |||
| 3580 | Ga0501034_0016939 | |||
| 3581 | Ga0501034_0022103 | |||
| 3582 | Ga0501034_0024475 | |||
| 3583 | Ga0501034_0032998 | |||
| 3584 | Ga0501034_0060038 | |||
| 3585 | Ga0501034_0062895 | |||
| 3586 | Ga0501034_0069979 | |||
| 3587 | Ga0501034_0095490 | |||
| 3588 | Ga0501034_0130331 | |||
| 3589 | Ga0501034_0172223 | |||
| 3590 | Ga0501034_0174071 | |||
| 3591 | Ga0501034_0278830 | |||
| 3592 | Ga0501036_0002124 | |||
| 3593 | Ga0501036_0003126 | |||
| 3594 | Ga0501036_0010468 | |||
| 3595 | Ga0501036_0026255 | |||
| 3596 | Ga0501036_0061367 | |||
| 3597 | Ga0501036_0065461 | |||
| 3598 | Ga0501036_0070904 | |||
| 3599 | Ga0501036_0082954 | |||
| 3600 | Ga0501036_0084430 | |||
| 3601 | Ga0501036_0304735 | |||
| 3602 | Ga0501037_0003940 | |||
| 3603 | Ga0501037_0005417 | |||
| 3604 | Ga0501037_0005558 | |||
| 3605 | Ga0501037_0012804 | |||
| 3606 | Ga0501037_0013780 | |||
| 3607 | Ga0501037_0018305 | |||
| 3608 | Ga0501037_0019639 | |||
| 3609 | Ga0501037_0056598 | |||
| 3610 | Ga0501037_0073269 | |||
| 3611 | Ga0501037_0088732 | |||
| 3612 | Ga0501037_0119303 | |||
| 3613 | Ga0501037_0170277 | |||
| 3614 | Ga0501038_0002793 | |||
| 3615 | Ga0501038_0009522 | |||
| 3616 | Ga0501038_0014812 | |||
| 3617 | Ga0501038_0019259 | |||
| 3618 | Ga0501038_0019392 | |||
| 3619 | Ga0501038_0035681 | |||
| 3620 | Ga0501038_0036093 | |||
| 3621 | Ga0501038_0038913 | |||
| 3622 | Ga0501038_0061045 | |||
| 3623 | Ga0501038_0073378 | |||
| 3624 | Ga0501038_0075649 | |||
| 3625 | Ga0501038_0079053 | |||
| 3626 | Ga0501038_0125533 | |||
| 3627 | Ga0501039_0001345 | |||
| 3628 | Ga0501039_0012049 | |||
| 3629 | Ga0501039_0014554 | |||
| 3630 | Ga0501039_0134070 | |||
| 3631 | Ga0501040_0006755 | |||
| 3632 | Ga0501040_0019206 | |||
| 3633 | Ga0501041_0000510 | |||
| 3634 | Ga0501042_0002946 | |||
| 3635 | Ga0501042_0005797 | |||
| 3636 | Ga0501042_0006620 | |||
| 3637 | Ga0501042_0044551 | |||
| 3638 | Ga0501042_0144041 | |||
| 3639 | Ga0501043_0002325 | |||
| 3640 | Ga0501043_0003130 | |||
| 3641 | Ga0501043_0008228 | |||
| 3642 | Ga0501043_0008953 | |||
| 3643 | Ga0501043_0010184 | |||
| 3644 | Ga0501043_0010272 | |||
| 3645 | Ga0501043_0015132 | |||
| 3646 | Ga0501043_0043814 | |||
| 3647 | Ga0501043_0091786 | |||
| 3648 | Ga0501043_0119796 | |||
| 3649 | Ga0501043_0157809 | |||
| 3650 | Ga0501043_0160239 | |||
| 3651 | Ga0501046_0004180 | |||
| 3652 | Ga0501046_0007136 | |||
| 3653 | Ga0501046_0009635 | |||
| 3654 | Ga0501046_0016221 | |||
| 3655 | Ga0501046_0121181 | |||
| 3656 | Ga0501047_0000005 | |||
| 3657 | Ga0501047_0003756 | |||
| 3658 | Ga0501047_0010901 | |||
| 3659 | Ga0501047_0018642 | |||
| 3660 | Ga0501047_0021174 | |||
| 3661 | Ga0501047_0023128 | |||
| 3662 | Ga0501047_0032440 | |||
| 3663 | Ga0501047_0050684 | |||
| 3664 | Ga0501047_0051285 | |||
| 3665 | Ga0501047_0082245 | |||
| 3666 | Ga0501047_0239018 | |||
| 3667 | Ga0501047_0371310 | |||
| 3668 | Ga0501048_0001322 | |||
| 3669 | Ga0501048_0004371 | |||
| 3670 | Ga0501048_0008906 | |||
| 3671 | Ga0501048_0010033 | |||
| 3672 | Ga0501048_0101153 | |||
| 3673 | Ga0501048_0188471 | |||
| 3674 | Ga0501048_0236991 | |||
| 3675 | Ga0501067_0001107 | |||
| 3676 | Ga0501067_0020188 | |||
| 3677 | Ga0501067_0083786 | |||
| 3678 | Ga0501068_0004355 | |||
| 3679 | Ga0501068_0030431 | |||
| 3680 | Ga0501068_0165979 | |||
| 3681 | Ga0501069_0042811 | |||
| 3682 | Ga0501070_0002352 | |||
| 3683 | Ga0501070_0003420 | |||
| 3684 | Ga0501070_0009355 | |||
| 3685 | Ga0501070_0010098 | |||
| 3686 | Ga0501070_0015896 | |||
| 3687 | Ga0501070_0018990 | |||
| 3688 | Ga0501070_0033611 | |||
| 3689 | Ga0501070_0038905 | |||
| 3690 | Ga0501070_0039125 | |||
| 3691 | Ga0501070_0095003 | |||
| 3692 | Ga0501070_0204631 | |||
| 3693 | Ga0501070_0236002 | |||
| 3694 | Ga0501071_0001275 | |||
| 3695 | Ga0501071_0002509 | |||
| 3696 | Ga0501071_0061566 | |||
| 3697 | Ga0501072_0033937 | |||
| 3698 | Ga0501072_0104825 | |||
| 3699 | Ga0501073_0000030 | |||
| 3700 | Ga0501073_0113310 | |||
| 3701 | Ga0501074_0004495 | |||
| 3702 | Ga0501074_0008723 | |||
| 3703 | Ga0501074_0089288 | |||
| 3704 | Ga0501075_0008628 | |||
| 3705 | Ga0501076_0049185 | |||
| 3706 | Ga0501076_0175451 | |||
| 3707 | Ga0501077_0021191 | |||
| 3708 | Ga0501077_0036848 | |||
| 3709 | Ga0501079_0001632 | |||
| 3710 | Ga0501079_0025872 | |||
| 3711 | Ga0501080_0000023 | |||
| 3712 | Ga0501080_0042141 | |||
| 3713 | Ga0501080_0056997 | |||
| 3714 | Ga0501080_0064971 | |||
| 3715 | Ga0501080_0071502 | |||
| 3716 | Ga0501080_0093219 | |||
| 3717 | Ga0501080_0273742 | |||
| 3718 | Ga0501081_0012816 | |||
| 3719 | Ga0501083_0000059 | |||
| 3720 | Ga0501083_0004256 | |||
| 3721 | Ga0501083_0004565 | |||
| 3722 | Ga0501083_0031451 | |||
| 3723 | Ga0501083_0315342 | |||
| 3724 | Ga0501279_006874 | |||
| 3725 | Ga0501035_0002846 | |||
| 3726 | Ga0501035_0006735 | |||
| 3727 | Ga0501035_0007884 | |||
| 3728 | Ga0501035_0008420 | |||
| 3729 | Ga0501035_0013293 | |||
| 3730 | Ga0501035_0015593 | |||
| 3731 | Ga0501035_0017656 | |||
| 3732 | Ga0501035_0017981 | |||
| 3733 | Ga0501035_0024286 | |||
| 3734 | Ga0501035_0029166 | |||
| 3735 | Ga0501035_0031513 | |||
| 3736 | Ga0501035_0050317 | |||
| 3737 | Ga0501044_0003414 | |||
| 3738 | Ga0501044_0010052 | |||
| 3739 | Ga0501044_0012278 | |||
| 3740 | Ga0501044_0013325 | |||
| 3741 | Ga0501044_0015296 | |||
| 3742 | Ga0501044_0015324 | |||
| 3743 | Ga0501044_0033710 | |||
| 3744 | Ga0501044_0088361 | |||
| 3745 | Ga0501044_0104368 | |||
| 3746 | Ga0501044_0167162 | |||
| 3747 | Ga0501044_0175285 | |||
| 3748 | Ga0501044_0230097 | |||
| 3749 | Ga0501045_0047819 | |||
| 3750 | Ga0501045_0100124 | |||
| 3751 | nmdc:mga00v17_10676_c1 | |||
| 3752 | nmdc:mga0yw44_109474_c1 | |||
| 3753 | nmdc:mga0yw44_16446_c1 | |||
| 3754 | nmdc:mga0yw44_7068_c1 | |||
| 3755 | nmdc:mga06z11_29345_c1 | |||
| 3756 | nmdc:mga05p37_408632_c1 | |||
| 3757 | nmdc:mga05p37_9690_c1 | |||
| 3758 | nmdc:mga05p37_9984_c1 | |||
| 3759 | nmdc:mga09592_110175_c1 | |||
| 3760 | nmdc:mga09592_97806_c1 | |||
| 3761 | nmdc:mga0qj67_176290_c1 | |||
| 3762 | nmdc:mga06r32_202_c5 | |||
| 3763 | nmdc:mga08y16_116201_c1 | |||
| 3764 | nmdc:mga08y16_14541_c1 | |||
| 3765 | nmdc:mga08y16_24871_c1 | |||
| 3766 | nmdc:mga08y16_47659_c1 | |||
| 3767 | nmdc:mga0n895_12260_c1 | |||
| 3768 | nmdc:mga0n895_27126_c1 | |||
| 3769 | nmdc:mga0n895_313887_c1 | |||
| 3770 | nmdc:mga0n895_64173_c1 | |||
| 3771 | nmdc:mga0rr50_128236_c1 | |||
| 3772 | nmdc:mga0rr50_3162_c1 | |||
| 3773 | nmdc:mga0rr50_4142_c2 | |||
| 3774 | nmdc:mga0rr50_95002_c1 | |||
| 3775 | nmdc:mga08x19_33654_c1 | |||
| 3776 | nmdc:mga08x19_34607_c1 | |||
| 3777 | nmdc:mga0a205_3224_c1 | |||
| 3778 | nmdc:mga0sz30_11075_c1 | |||
| 3779 | Ga0495601_0013029 | |||
| 3780 | Ga0495601_0015770 | |||
| 3781 | Ga0495601_0030603 | |||
| 3782 | Ga0495601_0032437 | |||
| 3783 | Ga0495612_0001130 | |||
| 3784 | Ga0495612_0010468 | |||
| 3785 | Ga0495612_0010525 | |||
| 3786 | Ga0495612_0024452 | |||
| 3787 | Ga0495612_0045980 | |||
| 3788 | Ga0495612_0060823 | |||
| 3789 | Ga0500635_0000664 | |||
| 3790 | Ga0495595_0001495 | |||
| 3791 | Ga0495595_0020681 | |||
| 3792 | Ga0495595_0036502 | |||
| 3793 | Ga0495619_0010408 | |||
| 3794 | Ga0495619_0021908 | |||
| 3795 | Ga0495619_0083432 | |||
| 3796 | Ga0495619_0132743 | |||
| 3797 | Ga0500578_0014632 | |||
| 3798 | Ga0500643_000191 | |||
| 3799 | Ga0500583_0103117 | |||
| 3800 | Ga0500651_0003063 | |||
| 3801 | Ga0500640_001744 | |||
| 3802 | Ga0500641_0056548 | |||
| 3803 | Ga0500556_0000115 | |||
| 3804 | Ga0500556_0000426 | |||
| 3805 | Ga0500560_009842 | |||
| 3806 | Ga0500560_012532 | |||
| 3807 | Ga0500562_000183 | |||
| 3808 | Ga0500593_001772 | |||
| 3809 | Ga0500658_0004371 | |||
| 3810 | Ga0500559_0000050 | |||
| 3811 | Ga0500559_0000800 | |||
| 3812 | Ga0500559_0042277 | |||
| 3813 | Ga0500568_0000038 | |||
| 3814 | Ga0500568_0000117 | |||
| 3815 | Ga0500568_0001933 | |||
| 3816 | Ga0500568_0007501 | |||
| 3817 | Ga0500568_0013939 | |||
| 3818 | Ga0500573_0000014 | |||
| 3819 | Ga0500573_0006418 | |||
| 3820 | Ga0500573_0013932 | |||
| 3821 | Ga0500573_0014968 | |||
| 3822 | Ga0500577_0004479 | |||
| 3823 | Ga0500577_0016903 | |||
| 3824 | Ga0500577_0020950 | |||
| 3825 | Ga0500590_013523 | |||
| 3826 | Ga0500616_0000027 | |||
| 3827 | Ga0500616_0000117 | |||
| 3828 | Ga0500616_0000620 | |||
| 3829 | Ga0500616_0011539 | |||
| 3830 | Ga0500616_0061798 | |||
| 3831 | Ga0500620_000082 | |||
| 3832 | Ga0500624_002275 | |||
| 3833 | Ga0500634_0003371 | |||
| 3834 | Ga0501084_0011942 | |||
| 3835 | Ga0501084_0042709 | |||
| 3836 | Ga0590075_003544 | |||
| 3837 | Ga0587072_000110 | |||
| 3838 | Ga0501082_0011737 | |||
| 3839 | Ga0501082_0021746 | |||
| 3840 | Ga0501082_0024215 | |||
| 3841 | Ga0501082_0053825 | |||
| 3842 | Ga0466962_0001145 | |||
| 3843 | Ga0466962_0001217 | |||
| 3844 | Ga0466962_0005385 | |||
| 3845 | Ga0466962_0012085 | |||
| 3846 | Ga0466962_0057982 | |||
| 3847 | Ga0530510_0002078 | |||
| 3848 | Ga0530510_0113870 | |||
| 3849 | Ga0530510_0142274 | |||
| 3850 | 2523384565 | |||
| 3851 | 2537898248 | |||
| 3852 | 2552105984 | |||
| 3853 | 2554256717 | |||
| 3854 | 2555228741 | |||
| 3855 | 2585295996 | |||
| 3856 | 2585306288 | |||
| 3857 | 2585320272 | |||
| 3858 | 2588106927 | |||
| 3859 | 2616696701 | |||
| 3860 | 2616903179 | |||
| 3861 | 2643734866 | |||
| 3862 | 2643753782 | |||
| 3863 | 2643764695 | |||
| 3864 | 2643768564 | |||
| 3865 | 2643783527 | |||
| 3866 | 2643847848 | |||
| 3867 | 2643852653 | |||
| 3868 | 2643888218 | |||
| 3869 | 2643903027 | |||
| 3870 | 2643941919 | |||
| 3871 | 2643994890 | |||
| 3872 | 2644082324 | |||
| 3873 | 2644111941 | |||
| 3874 | 2644135161 | |||
| 3875 | 2644173026 | |||
| 3876 | 2644175828 | |||
| 3877 | 2644182446 | |||
| 3878 | 2644197898 | |||
| 3879 | 2644261510 | |||
| 3880 | 2644277737 | |||
| 3881 | 2644389541 | |||
| 3882 | 2644404463 | |||
| 3883 | 2644429002 | |||
| 3884 | 2644439410 | |||
| 3885 | 2644445480 | |||
| 3886 | 2644462080 | |||
| 3887 | 2644502903 | |||
| 3888 | 2644515240 | |||
| 3889 | 2644525268 | |||
| 3890 | 2644610808 | |||
| 3891 | 2644667053 | |||
| 3892 | 2644669353 | |||
| 3893 | 2644679225 | |||
| 3894 | 2655033208 | |||
| 3895 | 2676494524 | |||
| 3896 | 2691514725 | |||
| 3897 | 2723643100 | |||
| 3898 | 2729906622 | |||
| 3899 | 2730228728 | |||
| 3900 | 2731908986 | |||
| 3901 | 2738693731 | |||
| 3902 | 2739328110 | |||
| 3903 | 2739602919 | |||
| 3904 | 2739607439 | |||
| 3905 | 2747953169 | |||
| 3906 | 2753037991 | |||
| 3907 | 2753303633 | |||
| 3908 | 2753325859 | |||
| 3909 | 2758224676 | |||
| 3910 | 2760304659 | |||
| 3911 | 2760621530 | |||
| 3912 | 2768643577 | |||
| 3913 | 2774378827 | |||
| 3914 | 2774383431 | |||
| 3915 | 2774400613 | |||
| 3916 | 2775654939 | |||
| 3917 | 2784472905 | |||
| 3918 | 2784589814 | |||
| 3919 | 2785341790 | |||
| 3920 | 2785370856 | |||
| 3921 | 2786672035 | |||
| 3922 | 2793981347 | |||
| 3923 | 2804845461 | |||
| 3924 | 2808628693 | |||
| 3925 | 2808827838 | |||
| 3926 | 2808843413 | |||
| 3927 | 2808853190 | |||
| 3928 | 2808875457 | |||
| 3929 | 2808878308 | |||
| 3930 | 2808884818 | |||
| 3931 | 2808892081 | |||
| 3932 | 2808897186 | |||
| 3933 | 2808912998 | |||
| 3934 | 2809026317 | |||
| 3935 | 2809226524 | |||
| 3936 | 2809233483 | |||
| 3937 | 2810364339 | |||
| 3938 | 2811845029 | |||
| 3939 | 2812320401 | |||
| 3940 | 2812322197 | |||
| 3941 | 2812356628 | |||
| 3942 | 2812364422 | |||
| 3943 | 2812375766 | |||
| 3944 | 2812479336 | |||
| 3945 | 2816505500 | |||
| 3946 | 2817508571 | |||
| 3947 | 2819424663 | |||
| 3948 | 2819667002 | |||
| 3949 | 2819690356 | |||
| 3950 | 2819695159 | |||
| 3951 | 2819728382 | |||
| 3952 | 2819742314 | |||
| 3953 | 2821269128 | |||
| 3954 | 2833710011 | |||
| 3955 | 2835189079 | |||
| 3956 | 2839989113 | |||
| 3957 | 2844843321 | |||
| 3958 | 2844849700 | |||
| 3959 | 2844854372 | |||
| 3960 | 2848551703 | |||
| 3961 | 2852632770 | |||
| 3962 | 2852642776 | |||
| 3963 | 2852644397 | |||
| 3964 | 2852646538 | |||
| 3965 | 2852665830 | |||
| 3966 | 2856746564 | |||
| 3967 | 2857480484 | |||
| 3968 | 2857633705 | |||
| 3969 | 2857712593 | |||
| 3970 | 2857722181 | |||
| 3971 | 2857724667 | |||
| 3972 | 2857729262 | |||
| 3973 | 2857730614 | |||
| 3974 | 2857734492 | |||
| 3975 | 2857739751 | |||
| 3976 | 2857741167 | |||
| 3977 | 2862185244 | |||
| 3978 | 2862287082 | |||
| 3979 | 2862292054 | |||
| 3980 | 2862385302 | |||
| 3981 | 2862511968 | |||
| 3982 | 2862578110 | |||
| 3983 | 2862709676 | |||
| 3984 | 2863411483 | |||
| 3985 | 2867349841 | |||
| 3986 | 2867373302 | |||
| 3987 | 2867434122 | |||
| 3988 | 2867478680 | |||
| 3989 | 2870622239 | |||
| 3990 | 2870629522 | |||
| 3991 | 2870801986 | |||
| 3992 | 2870806376 | |||
| 3993 | 2873154636 | |||
| 3994 | 2873322080 | |||
| 3995 | 2875396116 | |||
| 3996 | 2877679721 | |||
| 3997 | 2884694879 | |||
| 3998 | 2884996381 | |||
| 3999 | 2887447131 | |||
| 4000 | 2891331433 | |||
| 4001 | 2891401853 | |||
| 4002 | 2891560593 | |||
| 4003 | 2891566160 | |||
| 4004 | 2893685140 | |||
| 4005 | 2895432642 | |||
| 4006 | 2895446426 | |||
| 4007 | 2904432440 | |||
| 4008 | 2904500400 | |||
| 4009 | 2904501765 | |||
| 4010 | 2904510287 | |||
| 4011 | 2904776799 | |||
| 4012 | 2905927870 | |||
| 4013 | 2906801637 | |||
| 4014 | 2908676181 | |||
| 4015 | 2908678498 | |||
| 4016 | 2909077060 | |||
| 4017 | 2910810674 | |||
| 4018 | 2912718358 | |||
| 4019 | 2912730710 | |||
| 4020 | 2912762198 | |||
| 4021 | 2915359603 | |||
| 4022 | 2918505904 | |||
| 4023 | 2919036344 | |||
| 4024 | 2919041800 | |||
| 4025 | 2919043240 | |||
| 4026 | 2919054468 | |||
| 4027 | 2919058802 | |||
| 4028 | 2919059646 | |||
| 4029 | 2919070819 | |||
| 4030 | 2919391597 | |||
| 4031 | 2919397768 | |||
| 4032 | 2919445606 | |||
| 4033 | 2919447880 | |||
| 4034 | 2919470311 | |||
| 4035 | 2919525379 | |||
| 4036 | 2919540794 | |||
| 4037 | 2920882720 | |||
| 4038 | 2928090944 | |||
| 4039 | 2928105537 | |||
| 4040 | 2928121418 | |||
| 4041 | 2928153459 | |||
| 4042 | 2928500943 | |||
| 4043 | 2932426928 | |||
| 4044 | 2932432256 | |||
| 4045 | 2933419565 | |||
| 4046 | 2935395278 | |||
| 4047 | 2935412172 | |||
| 4048 | 2935893553 | |||
| 4049 | 2939598807 | |||
| 4050 | 2939650045 | |||
| 4051 | 2939677490 | |||
| 4052 | 2945918156 | |||
| 4053 | 2945921554 | |||
| 4054 | 2945942223 | |||
| 4055 | 2945960001 | |||
| 4056 | 2945970886 | |||
| 4057 | 2946005488 | |||
| 4058 | 2946026599 | |||
| 4059 | 2946034682 | |||
| 4060 | 2946038203 | |||
| 4061 | 2946043203 | |||
| 4062 | 2946048504 | |||
| 4063 | 2946062002 | |||
| 4064 | 2946069240 | |||
| 4065 | 2946077189 | |||
| 4066 | 2946081800 | |||
| 4067 | 2947227685 | |||
| 4068 | 2953999481 | |||
| 4069 | 2954004828 | |||
| 4070 | 2954384633 | |||
| 4071 | 2954678307 | |||
| 4072 | 2954685850 | |||
| 4073 | 2954695489 | |||
| 4074 | 2954710682 | |||
| 4075 | 2954714920 | |||
| 4076 | 2954724863 | |||
| 4077 | 2954736955 | |||
| 4078 | 2954743789 | |||
| 4079 | 2954755805 | |||
| 4080 | 2954762741 | |||
| 4081 | 2956941033 | |||
| 4082 | 2964328524 | |||
| 4083 | 2966601376 | |||
| 4084 | 2966926590 | |||
| 4085 | 2974298324 | |||
| 4086 | 2974306186 | |||
| 4087 | 2974325447 | |||
| 4088 | 2977230392 | |||
| 4089 | 2977239195 | |||
| 4090 | 2977252073 | |||
| 4091 | 2977265623 | |||
| 4092 | 2984543021 | |||
| 4093 | 2984551932 | |||
| 4094 | 2984582301 | |||
| 4095 | 2990044890 | |||
| 4096 | 2990060988 | |||
| 4097 | 2990093261 | |||
| 4098 | 2995728402 | |||
| 4099 | 2997458291 | |||
| 4100 | 2997601414 | |||
| 4101 | 3001120725 | |||
| 4102 | 3001892153 | |||
| 4103 | 3006326633 | |||
| 4104 | 3006397840 | |||
| 4105 | 3006429828 | |||
| 4106 | 3006493413 | |||
| 4107 | 3006498897 | |||
| 4108 | 8002811619 | |||
| 4109 | 8004021608 | |||
| 4110 | 8004027974 | |||
| 4111 | 8004183588 | |||
| 4112 | 8004213407 | |||
| 4113 | 8008490555 | |||
| 4114 | 8008566634 | |||
| 4115 | 8008577735 | |||
| 4116 | 8016254998 | |||
| 4117 | 8023627007 | |||
| 4118 | 8025417166 | |||
| 4119 | 8025479533 | |||
| 4120 | 8025529857 | |||
| 4121 | 8025532243 | |||
| 4122 | 8033687274 | |||
| 4123 | 8045832305 | |||
| 4124 | 8047896896 | |||
| 4125 | 8048362054 | |||
| 4126 | 8048373881 | |||
| 4127 | 8048384347 | |||
| 4128 | 8048413751 | |||
| 4129 | 8054108427 | |||
| 4130 | 8054164200 | |||
| 4131 | 8054475838 | |||
| 4132 | 8055035349 | |||
| 4133 | 8055038962 | |||
| 4134 | 8055073949 | |||
| 4135 | 8055179018 | |||
| 4136 | 8056039332 | |||
| 4137 | 8056063837 | |||
| 4138 | 8056448512 | |||
| 4139 | 8056583246 | |||
| 4140 | 8056672849 | |||
| 4141 | 8056837541 | |||
| 4142 | 8057347458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qr6-assembly1.cif.gz_A | crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution | 0.9483 | 4 | 364 |
| 2qr6-assembly1.cif.gz_A | crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution | 0.9256 | 4 | 364 |
| 4qq3-assembly1.cif.gz_A | inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp | 0.8494 | 6 | 363 |
| 4qq3-assembly1.cif.gz_A | inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp | 0.8364 | 6 | 363 |
| 6mgu-assembly1.cif.gz_A | crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with inhibitor oxanosine monophosphate | 0.8355 | 14 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qr6A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.944 | 17 | 364 | 3.20.20.70 |
| 2qr6A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9386 | 17 | 364 | 3.20.20.70 |
| 4qq3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.847 | 6 | 363 | 3.20.20.70 |
| 4qq3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.834 | 6 | 363 | 3.20.20.70 |
| af_B4F8B4_8_338_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7927 | 47 | 290 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3P5WU28-F1-model_v4 | Putative oxidoreductase/MSMEI_1564 (EC 1.-.-.-) | 0.987 | 1 | 368 |
GO:0003938
GO:0006183 |
| AF-H0QRD3-F1-model_v4 | IMP dehydrogenase family protein | 0.9869 | 1 | 369 |
GO:0003938
GO:0006183 |
| AF-A0A1G5PLG8-F1-model_v4 | IMP dehydrogenase | 0.9869 | 1 | 369 |
GO:0003938
GO:0006183 |
| AF-K2M477-F1-model_v4 | deleted | 0.9866 | 15 | 222 |
|
| AF-A0A7G6WMW6-F1-model_v4 | GuaB3 family IMP dehydrogenase-related protein | 0.9863 | 1 | 369 |
GO:0003938
GO:0006183 |