F496348

General Info

Members Datasets Scaffolds Average Seq Length
2071 823 4142 372

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000735|Ga0105244_1000073514
Length 421
Sequence MGTSAHVETARRARQVASAPGTGRAFNVFLAHCEVPTPFAESGFGKGSSKVRAVTYEIEIGRGKRGRRAYSLDDIAIVPNRRTRDPKDVSVSWQIDAYKFDIPVIAAPMDSAMSPETAIALGRLGGLGVLDLEGLWTRYEDPQSVLDEISALAGETASPAVTRRMQDLYKAPIQPELITSRLAEIRASGVTVAGSLTPQRTQEHYKTVLAAGVDIFVIRGTTVSAEHVSKNHEPLNLKQFIYELDVPVIVGGAAGYTPALHLMRTGAAGVLVGFGALGIHSPMASAISDVAAARRDYLDESGGRYVHVIADGGMGASGDIVKAVAMGADAVMLGSALARAEEAPGKGWHWGQEAHHLELPRGDRVNVGTVGPLEEVLFGPGHHTNGTSNLIGALRRSMATTGYSDLKEFQRVDVVVSPYLG

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
111 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
142 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
225 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
226 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
231 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
232 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
235 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
236 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
237 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
245 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
246 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
247 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
248 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
273 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
292 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
293 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
301 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
302 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
303 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
306 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
307 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
308 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
309 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
310 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
311 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
312 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
313 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
314 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
315 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
316 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
317 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
320 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
321 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
322 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
323 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
324 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
325 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
326 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
327 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
328 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
329 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
330 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
338 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
339 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
340 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
341 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
342 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
346 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
347 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
355 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
356 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
357 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
358 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
359 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
360 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
364 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
365 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
366 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
377 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
378 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
379 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
380 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
381 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
384 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
385 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
388 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
389 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
390 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
391 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
392 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
399 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
400 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
401 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
402 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
403 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
404 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
405 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
406 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
407 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
410 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
411 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
412 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
413 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
414 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
415 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
416 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
417 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
418 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
419 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
420 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
421 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
422 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
423 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
424 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
425 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
426 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
427 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
428 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
429 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
430 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
431 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
432 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
433 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
436 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
437 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
438 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
439 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
440 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
441 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
444 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
469 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
470 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
471 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
472 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
473 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
474 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
475 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
476 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
477 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
478 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
479 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
480 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
481 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
482 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
483 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
488 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
489 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
490 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
491 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
492 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
493 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
494 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
495 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
496 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
497 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
498 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
499 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
500 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
501 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
502 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
503 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
504 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
505 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
506 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
507 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
508 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
509 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
510 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
511 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
512 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
513 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
514 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
515 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
516 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
517 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
518 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
519 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
520 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
523 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
524 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
527 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
529 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
530 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
531 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
532 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
533 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
534 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
535 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
536 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
537 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
538 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
539 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
540 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
541 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
542 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
543 2643221546 Microbacterium sp. Root53 Isolate Unclassified
544 2643221548 Streptomyces sp. Root55 Isolate Unclassified
545 2643221549 Agromyces sp. Root1464 Isolate Unclassified
546 2643221553 Microbacterium sp. Root553 Isolate Unclassified
547 2643221566 Microbacterium sp. Root166 Isolate Unclassified
548 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
549 2643221575 Microbacterium sp. Root61 Isolate Unclassified
550 2643221578 Streptomyces sp. Root63 Isolate Unclassified
551 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
552 2643221597 Microbacterium sp. Root180 Isolate Unclassified
553 2643221613 Oerskovia sp. Root22 Isolate Unclassified
554 2643221619 Agromyces sp. Root81 Isolate Unclassified
555 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
556 2643221630 Microbacterium sp. Root322 Isolate Unclassified
557 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
558 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
559 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
560 2643221647 Streptomyces sp. Root369 Isolate Unclassified
561 2643221649 Leifsonia sp. Root4 Isolate Unclassified
562 2643221670 Streptomyces sp. Root431 Isolate Unclassified
563 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
564 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
565 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
566 2643221679 Angustibacter sp. Root456 Isolate Unclassified
567 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
568 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
569 2643221692 Nocardia sp. Root136 Isolate Unclassified
570 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
571 2643221711 Terrabacter sp. Root85 Isolate Unclassified
572 2643221721 Oerskovia sp. Root918 Isolate Unclassified
573 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
574 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
575 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
576 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
577 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
578 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
579 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
580 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
581 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
582 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
583 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
584 2739367653 Kocuria sp. OV113 Isolate Unclassified
585 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
586 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
587 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
588 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
589 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
590 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
591 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
592 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
593 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
594 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
595 2773857759 Microbacterium sp. 1294 Isolate Unclassified
596 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
597 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
598 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
599 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
600 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
601 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
602 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
603 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
604 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
605 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
606 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
607 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
608 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
609 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
610 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
611 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
612 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
613 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
614 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
615 2808606394 Promicromonospora sp. C35 Isolate Unclassified
616 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
617 2808606448 Streptomyces sp. 193411 Isolate Unclassified
618 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
619 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
620 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
621 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
622 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
623 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
624 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
625 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
626 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
627 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
628 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
629 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
630 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
631 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
632 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
633 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
634 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
635 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
636 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
637 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
638 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
639 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
640 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
641 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
642 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
643 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
644 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
645 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
646 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
647 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
648 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
649 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
650 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
651 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
652 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
653 2857727296 Kocuria sp. R-72562 Isolate Unclassified
654 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
655 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
656 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
657 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
658 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
659 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
660 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
661 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
662 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
663 2862574272 Streptomyces sp. AcE210 Isolate Nodule
664 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
665 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
666 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
667 2867369537 Streptomyces sp. Z26 Isolate Unclassified
668 2867428634 Streptomyces sp. RP5T Isolate Unclassified
669 2867475112 Streptomyces sp. TM32 Isolate Unclassified
670 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
671 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
672 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
673 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
674 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
675 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
676 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
677 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
678 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
679 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
680 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
681 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
682 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
683 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
684 2891562705 Microbispora tritici MT50 Isolate Unclassified
685 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
686 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
687 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
688 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
689 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
690 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
691 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
692 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
693 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
694 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
695 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
696 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
697 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
698 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
699 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
700 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
701 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
702 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
703 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
704 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
705 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
706 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
707 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
708 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
709 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
710 2919069694 Microbacterium sp. 1154 Isolate Unclassified
711 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
712 2919395869 Microbacterium resistens 2980 Isolate Unclassified
713 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
714 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
715 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
716 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
717 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
718 2920879853 Kocuria salina CV6 Isolate Unclassified
719 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
720 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
721 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
722 2928153084 Leifsonia sp. 563 Isolate Unclassified
723 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
724 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
725 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
726 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
727 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
728 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
729 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
730 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
731 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
732 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
733 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
734 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
735 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
736 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
737 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
738 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
739 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
740 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
741 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
742 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
743 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
744 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
745 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
746 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
747 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
748 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
749 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
750 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
751 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
752 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
753 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
754 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
755 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
756 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
757 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
758 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
759 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
760 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
761 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
762 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
763 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
764 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
765 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
766 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
767 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
768 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
769 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
770 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
771 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
772 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
773 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
774 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
775 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
776 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
777 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
778 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
779 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
780 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
781 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
782 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
783 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
784 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
785 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
786 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
787 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
788 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
789 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
790 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
791 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
792 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
793 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
794 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
795 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
796 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
797 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
798 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
799 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
800 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
801 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
802 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
803 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
804 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
805 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
806 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
807 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
808 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
809 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
810 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
811 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
812 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
813 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
814 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
815 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
816 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
817 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
818 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
819 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
820 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
821 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
822 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
823 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.36
Metatranscriptomes 1.5
Isolates 14.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 3.62
Nodule 0.14
Rhizoplane 6.08
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10000735 3300009036 Bacteria 28063
2 LJQas_1000257 3300000549 Bacteria 9695
3 LJQas_1000741 3300000549 Bacteria 5168
4 JGI25154J39366_1003355 3300002738 Bacteria 3417
5 JGI25152J39213_1000399 3300002773 Bacteria 26470
6 JGI25406J46586_10001751 3300003203 Bacteria 10207
7 JGI25160J50197_1014988 3300003354 Bacteria 2564
8 Ga0006562J51391_1013439 3300003578 Bacteria 7730
9 Ga0006562J51391_1013440 3300003578 Bacteria 4940
10 Ga0006562J51391_1025688 3300003578 Bacteria 6307
11 Ga0006562J51391_1025689 3300003578 Bacteria 4797
12 Ga0006562J51391_1098594 3300003578 Bacteria 5598
13 Ga0006562J51391_1098595 3300003578 Bacteria 5160
14 Ga0055539_1000005 3300003752 Bacteria 609598
15 Ga0055533_1000001 3300003756 Bacteria 1863437
16 Ga0055527_1000017 3300003760 Bacteria 242362
17 Ga0055542_1000044 3300003762 Bacteria 206982
18 Ga0055529_1000279 3300003763 Bacteria 60946
19 Ga0055541_1008325 3300003841 Bacteria 1656
20 Ga0065714_10104412 3300005288 Bacteria 1585
21 Ga0070658_10000266 3300005327 Bacteria 46035
22 Ga0070658_10013342 3300005327 Bacteria 6594
23 Ga0070658_10031946 3300005327 Bacteria 4231
24 Ga0070658_10035794 3300005327 Bacteria 3999
25 Ga0070658_10043257 3300005327 Bacteria 3639
26 Ga0070658_10219665 3300005327 Bacteria 1607
27 Ga0070676_10045831 3300005328 Bacteria 2547
28 Ga0070683_100019688 3300005329 Bacteria 5997
29 Ga0070683_100048077 3300005329 Bacteria 3944
30 Ga0070683_100058043 3300005329 Bacteria 3596
31 Ga0070683_100225127 3300005329 Bacteria 1782
32 Ga0070683_100257981 3300005329 Bacteria 1658
33 Ga0070683_100323958 3300005329 Bacteria 1467
34 Ga0070690_100059023 3300005330 Bacteria 2465
35 Ga0068869_100099715 3300005334 Bacteria 2195
36 Ga0070680_100000604 3300005336 Bacteria 24854
37 Ga0070680_100040663 3300005336 Bacteria 3766
38 Ga0070682_100100331 3300005337 Bacteria 1910
39 Ga0070682_100142635 3300005337 Bacteria 1635
40 Ga0070682_100195328 3300005337 Bacteria 1424
41 Ga0068868_100022267 3300005338 Bacteria 4780
42 Ga0070660_100081123 3300005339 Bacteria 2546
43 Ga0070689_100095806 3300005340 Bacteria 2344
44 Ga0070691_10120944 3300005341 Bacteria 1318
45 Ga0070687_100056394 3300005343 Bacteria 2055
46 Ga0070692_10019702 3300005345 Bacteria 3260
47 Ga0070692_10052038 3300005345 Bacteria 2132
48 Ga0070692_10076527 3300005345 Bacteria 1794
49 Ga0070668_100088728 3300005347 Bacteria 2435
50 Ga0070668_100215082 3300005347 Bacteria 1583
51 Ga0070669_100022755 3300005353 Bacteria 4482
52 Ga0070675_100005971 3300005354 Bacteria 9330
53 Ga0070675_100032384 3300005354 Bacteria 4231
54 Ga0070674_100019987 3300005356 Bacteria 4267
55 Ga0070674_100078162 3300005356 Bacteria 2357
56 Ga0070673_100038887 3300005364 Bacteria 3637
57 Ga0070673_100058206 3300005364 Bacteria 3054
58 Ga0070673_100171762 3300005364 Bacteria 1851
59 Ga0070659_100053135 3300005366 Bacteria 3188
60 Ga0070667_100021591 3300005367 Bacteria 5344
61 Ga0070709_10000118 3300005434 Bacteria 53312
62 Ga0070709_10003048 3300005434 Bacteria 8990
63 Ga0070709_10004402 3300005434 Bacteria 7595
64 Ga0070709_10036494 3300005434 Bacteria 2995
65 Ga0070714_100001466 3300005435 Bacteria 17185
66 Ga0070714_100005802 3300005435 Bacteria 9468
67 Ga0070714_100030612 3300005435 Bacteria 4482
68 Ga0070714_100066156 3300005435 Bacteria 3115
69 Ga0070714_100073929 3300005435 Bacteria 2954
70 Ga0070714_100085074 3300005435 Bacteria 2761
71 Ga0070713_100001299 3300005436 Bacteria 15987
72 Ga0070713_100015416 3300005436 Bacteria 5713
73 Ga0070713_100018101 3300005436 Bacteria 5351
74 Ga0070713_100026407 3300005436 Bacteria 4558
75 Ga0070710_10000216 3300005437 Bacteria 26980
76 Ga0070710_10000381 3300005437 Bacteria 20743
77 Ga0070710_10001064 3300005437 Bacteria 13005
78 Ga0070710_10024900 3300005437 Bacteria 3162
79 Ga0070710_10054249 3300005437 Bacteria 2261
80 Ga0070710_10075637 3300005437 Bacteria 1952
81 Ga0070710_10113558 3300005437 Bacteria 1630
82 Ga0070711_100000774 3300005439 Bacteria 16660
83 Ga0070711_100001507 3300005439 Bacteria 12813
84 Ga0070711_100011359 3300005439 Bacteria 5527
85 Ga0070711_100052982 3300005439 Bacteria 2794
86 Ga0070705_100027550 3300005440 Bacteria 3104
87 Ga0070705_100143311 3300005440 Bacteria 1575
88 Ga0070700_100018526 3300005441 Bacteria 4003
89 Ga0070708_100042482 3300005445 Bacteria 3991
90 Ga0070708_100114211 3300005445 Bacteria 2484
91 Ga0070708_100282487 3300005445 Bacteria 1562
92 Ga0070663_100165035 3300005455 Bacteria 1708
93 Ga0070678_100059360 3300005456 Bacteria 2811
94 Ga0070678_100082055 3300005456 Bacteria 2446
95 Ga0070678_100216134 3300005456 Bacteria 1591
96 Ga0070681_10037371 3300005458 Bacteria 4873
97 Ga0070681_10076072 3300005458 Bacteria 3316
98 Ga0070681_10113295 3300005458 Bacteria 2651
99 Ga0070681_10314051 3300005458 Bacteria 1476
100 Ga0068867_100277951 3300005459 Bacteria 1372
101 Ga0070685_10017980 3300005466 Bacteria 3795
102 Ga0070706_100002453 3300005467 Bacteria 18702
103 Ga0070706_100007246 3300005467 Bacteria 10420
104 Ga0070706_100013652 3300005467 Bacteria 7510
105 Ga0070706_100019132 3300005467 Bacteria 6318
106 Ga0070706_100029833 3300005467 Bacteria 5024
107 Ga0070706_100030981 3300005467 Bacteria 4932
108 Ga0070706_100048810 3300005467 Bacteria 3906
109 Ga0070706_100238770 3300005467 Bacteria 1697
110 Ga0070707_100000878 3300005468 Bacteria 29814
111 Ga0070707_100016295 3300005468 Bacteria 6976
112 Ga0070707_100017111 3300005468 Bacteria 6809
113 Ga0070707_100027135 3300005468 Bacteria 5445
114 Ga0070707_100043198 3300005468 Bacteria 4315
115 Ga0070707_100063769 3300005468 Bacteria 3537
116 Ga0070707_100120942 3300005468 Bacteria 2542
117 Ga0070698_100000621 3300005471 Bacteria 38176
118 Ga0070698_100001092 3300005471 Bacteria 29843
119 Ga0070698_100017339 3300005471 Bacteria 7587
120 Ga0070698_100017533 3300005471 Bacteria 7546
121 Ga0070698_100018948 3300005471 Bacteria 7239
122 Ga0070698_100029366 3300005471 Bacteria 5708
123 Ga0070698_100035507 3300005471 Bacteria 5155
124 Ga0070698_100132843 3300005471 Bacteria 2444
125 Ga0070699_100298178 3300005518 Bacteria 1446
126 Ga0070679_100054351 3300005530 Bacteria 3986
127 Ga0070679_100105416 3300005530 Bacteria 2805
128 Ga0070679_100127582 3300005530 Bacteria 2525
129 Ga0070679_100140904 3300005530 Bacteria 2391
130 Ga0070679_100184734 3300005530 Bacteria 2056
131 Ga0070684_100029632 3300005535 Bacteria 4641
132 Ga0070684_100122242 3300005535 Bacteria 2342
133 Ga0070684_100274891 3300005535 Bacteria 1543
134 Ga0070697_100025290 3300005536 Bacteria 4736
135 Ga0070697_100045569 3300005536 Bacteria 3554
136 Ga0068853_100074526 3300005539 Bacteria 2961
137 Ga0068853_100185674 3300005539 Bacteria 1887
138 Ga0068853_100258327 3300005539 Bacteria 1601
139 Ga0070672_100013432 3300005543 Bacteria 5785
140 Ga0070672_100015790 3300005543 Bacteria 5391
141 Ga0070672_100021208 3300005543 Bacteria 4750
142 Ga0070686_100164925 3300005544 Bacteria 1563
143 Ga0070695_100058153 3300005545 Bacteria 2499
144 Ga0070696_100048404 3300005546 Bacteria 2951
145 Ga0070693_100032957 3300005547 Bacteria 2855
146 Ga0070665_100006265 3300005548 Bacteria 12163
147 Ga0070665_100178198 3300005548 Bacteria 2126
148 Ga0070665_100215114 3300005548 Bacteria 1923
149 Ga0070704_100145513 3300005549 Bacteria 1856
150 Ga0068855_100022690 3300005563 Bacteria 7520
151 Ga0068855_100043681 3300005563 Bacteria 5307
152 Ga0068855_100119766 3300005563 Bacteria 3013
153 Ga0068855_100177890 3300005563 Bacteria 2406
154 Ga0070664_100076214 3300005564 Bacteria 2881
155 Ga0068857_100050157 3300005577 Bacteria 3703
156 Ga0068857_100204484 3300005577 Bacteria 1801
157 Ga0068854_100051107 3300005578 Bacteria 2960
158 Ga0068856_100091894 3300005614 Bacteria 3019
159 Ga0068856_100103109 3300005614 Bacteria 2847
160 Ga0068856_100115037 3300005614 Bacteria 2689
161 Ga0068856_100288139 3300005614 Bacteria 1659
162 Ga0068856_100329509 3300005614 Bacteria 1544
163 Ga0068856_100368358 3300005614 Bacteria 1455
164 Ga0070702_100000716 3300005615 Bacteria 12568
165 Ga0070702_100046300 3300005615 Bacteria 2465
166 Ga0070702_100077702 3300005615 Bacteria 1979
167 Ga0068852_100012452 3300005616 Bacteria 6461
168 Ga0068852_100063039 3300005616 Bacteria 3226
169 Ga0068852_100188837 3300005616 Bacteria 1943
170 Ga0068852_100201339 3300005616 Bacteria 1884
171 Ga0068859_100078111 3300005617 Bacteria 3350
172 Ga0068859_100106112 3300005617 Bacteria 2868
173 Ga0068864_100037398 3300005618 Bacteria 4142
174 Ga0068866_10129595 3300005718 Bacteria 1433
175 Ga0068861_100025788 3300005719 Bacteria 4267
176 Ga0068861_100173790 3300005719 Bacteria 1787
177 Ga0068851_10000022 3300005834 Bacteria 129607
178 Ga0068870_10043557 3300005840 Bacteria 2341
179 Ga0068870_10092007 3300005840 Bacteria 1698
180 Ga0068863_100000912 3300005841 Bacteria 29665
181 Ga0068863_100027376 3300005841 Bacteria 5437
182 Ga0068863_100121426 3300005841 Bacteria 2492
183 Ga0068863_100188176 3300005841 Bacteria 1983
184 Ga0068863_100413521 3300005841 Bacteria 1320
185 Ga0068858_100000016 3300005842 Bacteria 193130
186 Ga0068858_100090777 3300005842 Bacteria 2843
187 Ga0068858_100183277 3300005842 Bacteria 1977
188 Ga0068860_100022448 3300005843 Bacteria 6104
189 Ga0068860_100240062 3300005843 Bacteria 1762
190 Ga0081540_1001352 3300005983 Bacteria 21314
191 Ga0081540_1002515 3300005983 Bacteria 14885
192 Ga0081540_1002903 3300005983 Bacteria 13813
193 Ga0081539_10001393 3300005985 Bacteria 41656
194 Ga0081539_10019489 3300005985 Bacteria 4639
195 Ga0070717_10000504 3300006028 Bacteria 24742
196 Ga0070717_10055270 3300006028 Bacteria 3275
197 Ga0070717_10058992 3300006028 Bacteria 3174
198 Ga0070717_10112192 3300006028 Bacteria 2327
199 Ga0070717_10120794 3300006028 Bacteria 2244
200 Ga0070717_10140625 3300006028 Bacteria 2082
201 Ga0070717_10191812 3300006028 Bacteria 1786
202 Ga0070717_10210671 3300006028 Bacteria 1705
203 Ga0075365_10017542 3300006038 Bacteria 4381
204 Ga0075365_10022365 3300006038 Bacteria 3961
205 Ga0075365_10046434 3300006038 Bacteria 2852
206 Ga0075432_10000249 3300006058 Bacteria 14621
207 Ga0075432_10001177 3300006058 Bacteria 8378
208 Ga0075432_10023188 3300006058 Bacteria 2125
209 Ga0075432_10039010 3300006058 Bacteria 1655
210 Ga0070715_10003999 3300006163 Bacteria 4778
211 Ga0070715_10008469 3300006163 Bacteria 3586
212 Ga0070715_10086227 3300006163 Bacteria 1435
213 Ga0070716_100039444 3300006173 Bacteria 2621
214 Ga0070716_100068368 3300006173 Bacteria 2078
215 Ga0070712_100006228 3300006175 Bacteria 7386
216 Ga0070712_100009230 3300006175 Bacteria 6212
217 Ga0070712_100049554 3300006175 Bacteria 2917
218 Ga0070712_100060346 3300006175 Bacteria 2674
219 Ga0070712_100135383 3300006175 Bacteria 1873
220 Ga0075367_10025051 3300006178 Bacteria 3370
221 Ga0075428_100023989 3300006844 Bacteria 6750
222 Ga0075428_100106170 3300006844 Bacteria 3062
223 Ga0075430_100190988 3300006846 Bacteria 1702
224 Ga0075431_100005919 3300006847 Bacteria 12097
225 Ga0075433_10000652 3300006852 Bacteria 23385
226 Ga0075433_10001827 3300006852 Bacteria 15974
227 Ga0075433_10007398 3300006852 Bacteria 8716
228 Ga0075433_10028029 3300006852 Bacteria 4784
229 Ga0075434_100000181 3300006871 Bacteria 40986
230 Ga0075434_100018396 3300006871 Bacteria 6750
231 Ga0075434_100038538 3300006871 Bacteria 4733
232 Ga0075434_100060076 3300006871 Bacteria 3780
233 Ga0075429_100038385 3300006880 Bacteria 4169
234 Ga0075429_100038598 3300006880 Bacteria 4158
235 Ga0075436_100010867 3300006914 Bacteria 6247
236 Ga0075436_100047311 3300006914 Bacteria 2967
237 Ga0075436_100132048 3300006914 Bacteria 1751
238 Ga0097620_100078109 3300006931 Bacteria 3350
239 Ga0097620_100106127 3300006931 Bacteria 2868
240 Ga0075435_100068135 3300007076 Bacteria 2898
241 Ga0075435_100108572 3300007076 Bacteria 2306
242 Ga0105251_10004563 3300009011 Bacteria 9373
243 Ga0105251_10006598 3300009011 Bacteria 7357
244 Ga0105251_10011880 3300009011 Bacteria 4947
245 Ga0105240_10155493 3300009093 Bacteria 2721
246 Ga0111539_10000095 3300009094 Bacteria 93635
247 Ga0111539_10010369 3300009094 Bacteria 11732
248 Ga0111539_10165704 3300009094 Bacteria 2584
249 Ga0105245_10013491 3300009098 Bacteria 7117
250 Ga0105245_10036186 3300009098 Bacteria 4384
251 Ga0105245_10039281 3300009098 Bacteria 4213
252 Ga0105245_10144385 3300009098 Bacteria 2244
253 Ga0105245_10202729 3300009098 Bacteria 1905
254 Ga0105245_10319187 3300009098 Bacteria 1530
255 Ga0105247_10070656 3300009101 Bacteria 2181
256 Ga0114129_10008769 3300009147 Bacteria 14422
257 Ga0114129_10014475 3300009147 Bacteria 11241
258 Ga0114129_10027431 3300009147 Bacteria 8062
259 Ga0114129_10053520 3300009147 Bacteria 5661
260 Ga0114129_10280963 3300009147 Bacteria 2224
261 Ga0105243_10149832 3300009148 Bacteria 2000
262 Ga0105243_10228885 3300009148 Bacteria 1648
263 Ga0105243_10332041 3300009148 Bacteria 1389
264 Ga0105243_10335691 3300009148 Bacteria 1382
265 Ga0105241_10004447 3300009174 Bacteria 10364
266 Ga0105242_10010462 3300009176 Bacteria 7119
267 Ga0105242_10020736 3300009176 Bacteria 5155
268 Ga0105242_10033389 3300009176 Bacteria 4119
269 Ga0105242_10113127 3300009176 Bacteria 2317
270 Ga0105242_10251589 3300009176 Bacteria 1592
271 Ga0105242_10274188 3300009176 Bacteria 1529
272 Ga0105248_10000880 3300009177 Bacteria 33648
273 Ga0105248_10091708 3300009177 Bacteria 3421
274 Ga0105248_10173957 3300009177 Bacteria 2427
275 Ga0105248_10246363 3300009177 Bacteria 2012
276 Ga0105237_10006728 3300009545 Bacteria 12695
277 Ga0105237_10064474 3300009545 Bacteria 3660
278 Ga0105237_10166341 3300009545 Bacteria 2204
279 Ga0105238_10002053 3300009551 Bacteria 20326
280 Ga0105249_10065057 3300009553 Bacteria 3353
281 Ga0105249_10109470 3300009553 Bacteria 2609
282 Ga0105249_10152986 3300009553 Bacteria 2222
283 Ga0105249_10175164 3300009553 Bacteria 2083
284 Ga0105032_100683 3300009979 Bacteria 3310
285 Ga0105033_101458 3300009986 Bacteria 1937
286 Ga0105239_10112904 3300010375 Bacteria 3013
287 Ga0105246_10000474 3300011119 Bacteria 21648
288 Ga0105246_10030002 3300011119 Bacteria 3587
289 Ga0157344_1000433 3300012476 Bacteria 1622
290 Ga0157373_10091086 3300013100 Bacteria 2147
291 Ga0157371_10071463 3300013102 Bacteria 2456
292 Ga0157370_10001462 3300013104 Bacteria 29206
293 Ga0157370_10161321 3300013104 Bacteria 2086
294 Ga0157370_10171889 3300013104 Bacteria 2014
295 Ga0157369_10028346 3300013105 Bacteria 6198
296 Ga0157369_10031501 3300013105 Bacteria 5838
297 Ga0157369_10050500 3300013105 Bacteria 4504
298 Ga0157369_10054453 3300013105 Bacteria 4320
299 Ga0157369_10064247 3300013105 Bacteria 3953
300 Ga0157369_10077143 3300013105 Bacteria 3571
301 Ga0157369_10088646 3300013105 Bacteria 3303
302 Ga0157369_10282236 3300013105 Bacteria 1729
303 Ga0171462_1001 3300013250 Bacteria 1135406
304 Ga0157374_10024151 3300013296 Bacteria 5447
305 Ga0157374_10042610 3300013296 Bacteria 4187
306 Ga0157374_10191923 3300013296 Bacteria 1998
307 Ga0163162_10017442 3300013306 Bacteria 7025
308 Ga0163162_10098066 3300013306 Bacteria 3020
309 Ga0157372_10115493 3300013307 Bacteria 3077
310 Ga0157372_10117818 3300013307 Bacteria 3046
311 Ga0157372_10389671 3300013307 Bacteria 1623
312 Ga0157372_10435920 3300013307 Bacteria 1527
313 Ga0157375_10104547 3300013308 Bacteria 2920
314 Ga0157375_10222721 3300013308 Bacteria 2045
315 Ga0157375_10483163 3300013308 Bacteria 1404
316 Ga0157375_10538782 3300013308 Bacteria 1330
317 Ga0157375_10583356 3300013308 Bacteria 1278
318 Ga0163163_10008035 3300014325 Bacteria 9344
319 Ga0163163_10177155 3300014325 Bacteria 2179
320 Ga0163163_10245003 3300014325 Bacteria 1842
321 Ga0163163_10393289 3300014325 Bacteria 1444
322 Ga0157380_10018506 3300014326 Bacteria 5172
323 Ga0157380_10177247 3300014326 Bacteria 1869
324 Ga0182008_10000155 3300014497 Bacteria 54054
325 Ga0157377_10011120 3300014745 Bacteria 4481
326 Ga0157379_10006602 3300014968 Bacteria 10012
327 Ga0157379_10007743 3300014968 Bacteria 9303
328 Ga0157376_10102957 3300014969 Bacteria 2499
329 Ga0157376_10177269 3300014969 Bacteria 1945
330 Ga0157376_10311140 3300014969 Bacteria 1494
331 Ga0182007_10006083 3300015262 Bacteria 5218
332 Ga0183367_1002 3300015688 Bacteria 1101531
333 Ga0163161_10022188 3300017792 Bacteria 4468
334 Ga0163161_10064109 3300017792 Bacteria 2680
335 Ga0197907_10254036 3300020069 Bacteria 2663
336 Ga0197907_10622146 3300020069 Bacteria 1626
337 Ga0206356_10718652 3300020070 Bacteria 3527
338 Ga0206352_10797669 3300020078 Bacteria 3257
339 Ga0206350_10773787 3300020080 Bacteria 2001
340 Ga0206350_11125152 3300020080 Bacteria 2951
341 Ga0206354_10351484 3300020081 Bacteria 1673
342 Ga0206354_10556289 3300020081 Bacteria 2445
343 Ga0206354_10679121 3300020081 Bacteria 4827
344 Ga0206354_10854419 3300020081 Bacteria 2337
345 Ga0206354_11188581 3300020081 Bacteria 8815
346 Ga0206354_11707980 3300020081 Bacteria 1771
347 Ga0206353_10410223 3300020082 Bacteria 6596
348 Ga0206353_10645933 3300020082 Bacteria 12151
349 Ga0206353_10842314 3300020082 Bacteria 3030
350 Ga0206353_10849751 3300020082 Bacteria 2411
351 Ga0206353_11875109 3300020082 Bacteria 2679
352 Ga0213875_10000250 3300021388 Bacteria 54123
353 Ga0213875_10000514 3300021388 Bacteria 32222
354 Ga0213875_10117901 3300021388 Bacteria 1240
355 Ga0224712_10002198 3300022467 Bacteria 4762
356 Ga0224712_10002255 3300022467 Bacteria 4717
357 Ga0224712_10021596 3300022467 Bacteria 2206
358 Ga0224712_10037054 3300022467 Bacteria 1812
359 Ga0224572_1000179 3300024225 Bacteria 5857
360 Ga0224572_1000254 3300024225 Bacteria 5437
361 Ga0209566_100053 3300025225 Bacteria 224436
362 Ga0209674_100001 3300025226 Bacteria 4013750
363 Ga0209672_100039 3300025228 Bacteria 283064
364 Ga0209147_101049 3300025229 Bacteria 11708
365 Ga0209563_100001 3300025230 Bacteria 4013775
366 Ga0209563_100766 3300025230 Bacteria 9765
367 Ga0209646_1000088 3300025246 Bacteria 192345
368 Ga0209677_100001 3300025253 Bacteria 4013787
369 Ga0209677_100448 3300025253 Bacteria 23936
370 Ga0209148_1000004 3300025254 Bacteria 1844481
371 Ga0209148_1004065 3300025254 Bacteria 3716
372 Ga0209148_1004139 3300025254 Bacteria 3659
373 Ga0209129_1000047 3300025258 Bacteria 270566
374 Ga0209455_1000117 3300025272 Bacteria 176940
375 Ga0209455_1003789 3300025272 Bacteria 5200
376 Ga0209025_1000920 3300025294 Bacteria 45267
377 Ga0209758_1002219 3300025297 Bacteria 20208
378 Ga0207426_1005431 3300025302 Bacteria 5816
379 Ga0209051_1003197 3300025303 Bacteria 10933
380 Ga0209051_1013778 3300025303 Bacteria 3820
381 Ga0207697_10001921 3300025315 Bacteria 11055
382 Ga0207656_10000005 3300025321 Bacteria 490514
383 Ga0207655_1006296 3300025728 Bacteria 7893
384 Ga0207655_1015554 3300025728 Bacteria 4220
385 Ga0207713_1051913 3300025735 Bacteria 1627
386 Ga0207653_10006417 3300025885 Bacteria 3667
387 Ga0207682_10001886 3300025893 Bacteria 9541
388 Ga0207692_10000225 3300025898 Bacteria 19145
389 Ga0207692_10009769 3300025898 Bacteria 4019
390 Ga0207692_10049387 3300025898 Bacteria 2123
391 Ga0207692_10051604 3300025898 Bacteria 2086
392 Ga0207692_10134957 3300025898 Bacteria 1398
393 Ga0207642_10011637 3300025899 Bacteria 3147
394 Ga0207710_10033869 3300025900 Bacteria 2242
395 Ga0207710_10052795 3300025900 Bacteria 1828
396 Ga0207647_10009551 3300025904 Bacteria 6885
397 Ga0207647_10091475 3300025904 Bacteria 1814
398 Ga0207647_10135588 3300025904 Bacteria 1445
399 Ga0207685_10000224 3300025905 Bacteria 8791
400 Ga0207685_10030315 3300025905 Bacteria 1924
401 Ga0207699_10000106 3300025906 Bacteria 58842
402 Ga0207699_10004744 3300025906 Bacteria 6495
403 Ga0207699_10005198 3300025906 Bacteria 6223
404 Ga0207699_10007365 3300025906 Bacteria 5381
405 Ga0207699_10008667 3300025906 Bacteria 5030
406 Ga0207645_10016279 3300025907 Bacteria 4924
407 Ga0207643_10015262 3300025908 Bacteria 4179
408 Ga0207643_10132631 3300025908 Bacteria 1483
409 Ga0207643_10135365 3300025908 Bacteria 1468
410 Ga0207705_10000001 3300025909 Bacteria 2061880
411 Ga0207705_10009574 3300025909 Bacteria 7048
412 Ga0207705_10014811 3300025909 Bacteria 5606
413 Ga0207705_10099321 3300025909 Bacteria 2140
414 Ga0207705_10139709 3300025909 Bacteria 1808
415 Ga0207705_10145603 3300025909 Bacteria 1772
416 Ga0207684_10002459 3300025910 Bacteria 18674
417 Ga0207684_10006157 3300025910 Bacteria 10973
418 Ga0207684_10013779 3300025910 Bacteria 6984
419 Ga0207684_10026141 3300025910 Bacteria 4975
420 Ga0207684_10031843 3300025910 Bacteria 4486
421 Ga0207684_10032282 3300025910 Bacteria 4454
422 Ga0207684_10032768 3300025910 Bacteria 4418
423 Ga0207654_10000001 3300025911 Bacteria 1816198
424 Ga0207707_10003758 3300025912 Bacteria 13458
425 Ga0207707_10303097 3300025912 Bacteria 1381
426 Ga0207695_10005496 3300025913 Bacteria 16776
427 Ga0207671_10000016 3300025914 Bacteria 435413
428 Ga0207671_10177663 3300025914 Bacteria 1655
429 Ga0207693_10002782 3300025915 Bacteria 15143
430 Ga0207693_10003038 3300025915 Bacteria 14506
431 Ga0207693_10007334 3300025915 Bacteria 9068
432 Ga0207693_10008350 3300025915 Bacteria 8474
433 Ga0207693_10045686 3300025915 Bacteria 3441
434 Ga0207693_10072583 3300025915 Bacteria 2694
435 Ga0207693_10087986 3300025915 Bacteria 2434
436 Ga0207663_10005403 3300025916 Bacteria 6432
437 Ga0207663_10021516 3300025916 Bacteria 3673
438 Ga0207663_10034482 3300025916 Bacteria 3027
439 Ga0207663_10091360 3300025916 Bacteria 2021
440 Ga0207663_10188167 3300025916 Bacteria 1480
441 Ga0207660_10000245 3300025917 Bacteria 35340
442 Ga0207660_10104135 3300025917 Bacteria 2124
443 Ga0207662_10002253 3300025918 Bacteria 9642
444 Ga0207657_10018246 3300025919 Bacteria 6709
445 Ga0207657_10045521 3300025919 Bacteria 3850
446 Ga0207657_10080562 3300025919 Bacteria 2736
447 Ga0207657_10086227 3300025919 Bacteria 2629
448 Ga0207649_10053258 3300025920 Bacteria 2514
449 Ga0207652_10000294 3300025921 Bacteria 51581
450 Ga0207652_10068778 3300025921 Bacteria 3073
451 Ga0207652_10118221 3300025921 Bacteria 2356
452 Ga0207652_10149647 3300025921 Bacteria 2090
453 Ga0207646_10001959 3300025922 Bacteria 24684
454 Ga0207646_10004445 3300025922 Bacteria 15203
455 Ga0207646_10020856 3300025922 Bacteria 6064
456 Ga0207646_10053018 3300025922 Bacteria 3629
457 Ga0207646_10111544 3300025922 Bacteria 2454
458 Ga0207646_10117071 3300025922 Bacteria 2393
459 Ga0207646_10312279 3300025922 Bacteria 1420
460 Ga0207646_10345862 3300025922 Bacteria 1344
461 Ga0207681_10042632 3300025923 Bacteria 3032
462 Ga0207694_10000057 3300025924 Bacteria 146441
463 Ga0207694_10100546 3300025924 Bacteria 2291
464 Ga0207687_10013434 3300025927 Bacteria 5345
465 Ga0207687_10043864 3300025927 Bacteria 3083
466 Ga0207687_10045183 3300025927 Bacteria 3043
467 Ga0207687_10144667 3300025927 Bacteria 1807
468 Ga0207687_10240039 3300025927 Bacteria 1436
469 Ga0207700_10000053 3300025928 Bacteria 75986
470 Ga0207700_10002291 3300025928 Bacteria 10983
471 Ga0207700_10008955 3300025928 Bacteria 6230
472 Ga0207700_10011392 3300025928 Bacteria 5666
473 Ga0207700_10014429 3300025928 Bacteria 5177
474 Ga0207700_10016711 3300025928 Bacteria 4883
475 Ga0207700_10018986 3300025928 Bacteria 4634
476 Ga0207700_10034772 3300025928 Bacteria 3621
477 Ga0207700_10062900 3300025928 Bacteria 2820
478 Ga0207700_10065079 3300025928 Bacteria 2780
479 Ga0207700_10114707 3300025928 Bacteria 2174
480 Ga0207700_10162334 3300025928 Bacteria 1857
481 Ga0207664_10000701 3300025929 Bacteria 22942
482 Ga0207664_10000834 3300025929 Bacteria 20936
483 Ga0207664_10002440 3300025929 Bacteria 12303
484 Ga0207664_10002847 3300025929 Bacteria 11488
485 Ga0207664_10002931 3300025929 Bacteria 11336
486 Ga0207664_10005087 3300025929 Bacteria 8961
487 Ga0207664_10005293 3300025929 Bacteria 8811
488 Ga0207664_10014166 3300025929 Bacteria 5751
489 Ga0207664_10035531 3300025929 Bacteria 3846
490 Ga0207664_10067649 3300025929 Bacteria 2867
491 Ga0207664_10076669 3300025929 Bacteria 2707
492 Ga0207664_10096423 3300025929 Bacteria 2434
493 Ga0207664_10111991 3300025929 Bacteria 2271
494 Ga0207664_10178465 3300025929 Bacteria 1822
495 Ga0207644_10011157 3300025931 Bacteria 5937
496 Ga0207644_10283993 3300025931 Bacteria 1329
497 Ga0207690_10040760 3300025932 Bacteria 3038
498 Ga0207706_10010621 3300025933 Bacteria 8411
499 Ga0207706_10022853 3300025933 Bacteria 5612
500 Ga0207706_10024565 3300025933 Bacteria 5402
501 Ga0207686_10157297 3300025934 Bacteria 1589
502 Ga0207709_10031526 3300025935 Bacteria 3097
503 Ga0207669_10131751 3300025937 Bacteria 1719
504 Ga0207665_10000166 3300025939 Bacteria 44650
505 Ga0207665_10002299 3300025939 Bacteria 12906
506 Ga0207665_10011425 3300025939 Bacteria 5833
507 Ga0207665_10012620 3300025939 Bacteria 5554
508 Ga0207665_10026642 3300025939 Bacteria 3817
509 Ga0207665_10041375 3300025939 Bacteria 3077
510 Ga0207691_10001200 3300025940 Bacteria 25797
511 Ga0207691_10067617 3300025940 Bacteria 3230
512 Ga0207691_10165816 3300025940 Bacteria 1936
513 Ga0207711_10005166 3300025941 Bacteria 11061
514 Ga0207711_10098454 3300025941 Bacteria 2584
515 Ga0207689_10007084 3300025942 Bacteria 9858
516 Ga0207661_10054298 3300025944 Bacteria 3209
517 Ga0207661_10252596 3300025944 Bacteria 1568
518 Ga0207661_10308762 3300025944 Bacteria 1419
519 Ga0207679_10100044 3300025945 Bacteria 2265
520 Ga0207679_10210222 3300025945 Bacteria 1631
521 Ga0207667_10002042 3300025949 Bacteria 25307
522 Ga0207667_10011034 3300025949 Bacteria 10527
523 Ga0207667_10027457 3300025949 Bacteria 6195
524 Ga0207667_10138396 3300025949 Bacteria 2507
525 Ga0207712_10233207 3300025961 Bacteria 1479
526 Ga0207668_10094646 3300025972 Bacteria 2203
527 Ga0207668_10111826 3300025972 Bacteria 2051
528 Ga0207658_10203354 3300025986 Bacteria 1655
529 Ga0207677_10193109 3300026023 Bacteria 1612
530 Ga0207703_10000345 3300026035 Bacteria 49953
531 Ga0207639_10079767 3300026041 Bacteria 2588
532 Ga0207639_10088644 3300026041 Bacteria 2470
533 Ga0207678_10003794 3300026067 Bacteria 13585
534 Ga0207678_10007006 3300026067 Bacteria 10007
535 Ga0207678_10250368 3300026067 Bacteria 1517
536 Ga0207708_10103770 3300026075 Bacteria 2202
537 Ga0207702_10077147 3300026078 Bacteria 2881
538 Ga0207702_10173137 3300026078 Bacteria 1981
539 Ga0207702_10173323 3300026078 Bacteria 1980
540 Ga0207641_10002332 3300026088 Bacteria 17607
541 Ga0207648_10047554 3300026089 Bacteria 3760
542 Ga0207648_10062162 3300026089 Bacteria 3256
543 Ga0207676_10043731 3300026095 Bacteria 3450
544 Ga0207676_10061345 3300026095 Bacteria 2977
545 Ga0207674_10012372 3300026116 Bacteria 9539
546 Ga0207674_10013065 3300026116 Bacteria 9245
547 Ga0207674_10019331 3300026116 Bacteria 7379
548 Ga0207674_10045712 3300026116 Bacteria 4501
549 Ga0207675_100005332 3300026118 Bacteria 12354
550 Ga0207675_100047486 3300026118 Bacteria 4008
551 Ga0207675_100110508 3300026118 Bacteria 2593
552 Ga0207683_10001303 3300026121 Bacteria 22540
553 Ga0207683_10050682 3300026121 Bacteria 3637
554 Ga0207683_10059997 3300026121 Bacteria 3342
555 Ga0207683_10078958 3300026121 Bacteria 2917
556 Ga0207683_10109649 3300026121 Bacteria 2471
557 Ga0207683_10143628 3300026121 Bacteria 2151
558 Ga0207698_10004794 3300026142 Bacteria 8280
559 Ga0207698_10120534 3300026142 Bacteria 2219
560 Ga0207698_10192526 3300026142 Bacteria 1818
561 Ga0207428_10000102 3300027907 Bacteria 118940
562 Ga0207428_10002614 3300027907 Bacteria 17980
563 Ga0207428_10085407 3300027907 Bacteria 2457
564 Ga0268265_10117329 3300028380 Bacteria 2186
565 Ga0268264_10007965 3300028381 Bacteria 8817
566 Ga0265337_1000031 3300028556 Bacteria 64194
567 Ga0265319_1002342 3300028563 Bacteria 10430
568 Ga0265334_10000091 3300028573 Bacteria 64750
569 Ga0265334_10003140 3300028573 Bacteria 7541
570 Ga0265323_10049795 3300028653 Bacteria 1490
571 Ga0265322_10003185 3300028654 Bacteria 4986
572 Ga0265336_10007606 3300028666 Bacteria 3848
573 Ga0307517_10002777 3300028786 Bacteria 27845
574 Ga0307517_10015795 3300028786 Bacteria 9994
575 Ga0307515_10010875 3300028794 Bacteria 17364
576 Ga0307515_10180353 3300028794 Bacteria 2064
577 Ga0265338_10000233 3300028800 Bacteria 103593
578 Ga0265338_10002443 3300028800 Bacteria 27876
579 Ga0265338_10025625 3300028800 Bacteria 5977
580 Ga0265338_10233416 3300028800 Bacteria 1367
581 Ga0265324_10004717 3300029957 Bacteria 6041
582 Ga0307511_10018996 3300030521 Bacteria 6550
583 Ga0307511_10048418 3300030521 Bacteria 3458
584 Ga0307511_10052434 3300030521 Bacteria 3250
585 Ga0307512_10013114 3300030522 Bacteria 7789
586 Ga0307512_10087803 3300030522 Bacteria 2187
587 Ga0307512_10121776 3300030522 Bacteria 1672
588 Ga0314311_1016886 3300030733 Bacteria 2903
589 Ga0265332_10006014 3300031238 Bacteria 5548
590 Ga0265320_10008863 3300031240 Bacteria 6116
591 Ga0265327_10000019 3300031251 Bacteria 427653
592 Ga0265316_10065002 3300031344 Bacteria 2825
593 Ga0307513_10000936 3300031456 Bacteria 42211
594 Ga0307513_10001197 3300031456 Bacteria 37689
595 Ga0307513_10034204 3300031456 Bacteria 5705
596 Ga0307513_10223828 3300031456 Bacteria 1700
597 Ga0307509_10010025 3300031507 Bacteria 11694
598 Ga0307509_10061631 3300031507 Bacteria 3958
599 Ga0307509_10126821 3300031507 Bacteria 2516
600 Ga0307408_100003074 3300031548 Bacteria 11504
601 Ga0307408_100060781 3300031548 Bacteria 2755
602 Ga0307408_100099817 3300031548 Bacteria 2209
603 Ga0307408_100156051 3300031548 Bacteria 1807
604 Ga0307408_100216733 3300031548 Bacteria 1559
605 Ga0265313_10002825 3300031595 Bacteria 14617
606 Ga0307508_10001583 3300031616 Bacteria 25403
607 Ga0307508_10029203 3300031616 Bacteria 4986
608 Ga0307508_10033651 3300031616 Bacteria 4625
609 Ga0307514_10008438 3300031649 Bacteria 8780
610 Ga0307514_10090774 3300031649 Bacteria 2227
611 Ga0307514_10096465 3300031649 Bacteria 2136
612 Ga0316575_10000668 3300031665 Bacteria 10159
613 Ga0316575_10003717 3300031665 Bacteria 5296
614 Ga0316575_10091932 3300031665 Bacteria 1229
615 Ga0316579_10002190 3300031691 Bacteria 7356
616 Ga0316579_10118321 3300031691 Bacteria 1272
617 Ga0265314_10006509 3300031711 Bacteria 10322
618 Ga0265342_10004101 3300031712 Bacteria 11614
619 Ga0316576_10001465 3300031727 Bacteria 12677
620 Ga0316576_10002319 3300031727 Bacteria 10792
621 Ga0316576_10021064 3300031727 Bacteria 4502
622 Ga0316576_10023914 3300031727 Bacteria 4262
623 Ga0316578_10002782 3300031728 Bacteria 7792
624 Ga0316578_10038070 3300031728 Bacteria 2772
625 Ga0307516_10019845 3300031730 Bacteria 6950
626 Ga0307516_10036778 3300031730 Bacteria 4898
627 Ga0307405_10014792 3300031731 Bacteria 4207
628 Ga0307405_10023043 3300031731 Bacteria 3532
629 Ga0307405_10071150 3300031731 Bacteria 2237
630 Ga0307405_10086782 3300031731 Bacteria 2060
631 Ga0307405_10088812 3300031731 Bacteria 2040
632 Ga0307413_10007992 3300031824 Bacteria 4959
633 Ga0307413_10009243 3300031824 Bacteria 4709
634 Ga0307413_10046827 3300031824 Bacteria 2575
635 Ga0307413_10108539 3300031824 Bacteria 1852
636 Ga0307518_10057070 3300031838 Bacteria 2836
637 Ga0307410_10012152 3300031852 Bacteria 4962
638 Ga0307410_10017054 3300031852 Bacteria 4349
639 Ga0307410_10025171 3300031852 Bacteria 3729
640 Ga0307410_10038935 3300031852 Bacteria 3118
641 Ga0307410_10148707 3300031852 Bacteria 1741
642 Ga0307410_10149908 3300031852 Bacteria 1735
643 Ga0307410_10165544 3300031852 Bacteria 1661
644 Ga0307410_10250384 3300031852 Bacteria 1377
645 Ga0307406_10000104 3300031901 Bacteria 49152
646 Ga0307406_10000932 3300031901 Bacteria 16339
647 Ga0307406_10001566 3300031901 Bacteria 12607
648 Ga0307406_10076440 3300031901 Bacteria 2212
649 Ga0307407_10007739 3300031903 Bacteria 4884
650 Ga0307407_10010003 3300031903 Bacteria 4450
651 Ga0307407_10048355 3300031903 Bacteria 2420
652 Ga0307407_10075390 3300031903 Bacteria 2022
653 Ga0307407_10081179 3300031903 Bacteria 1962
654 Ga0307407_10164226 3300031903 Bacteria 1456
655 Ga0307412_10017272 3300031911 Bacteria 4316
656 Ga0307412_10029651 3300031911 Bacteria 3436
657 Ga0307412_10098355 3300031911 Bacteria 2063
658 Ga0307412_10212449 3300031911 Bacteria 1477
659 Ga0307409_100009644 3300031995 Bacteria 5946
660 Ga0307409_100034809 3300031995 Bacteria 3684
661 Ga0307409_100063923 3300031995 Bacteria 2888
662 Ga0307409_100106542 3300031995 Bacteria 2340
663 Ga0307409_100109373 3300031995 Bacteria 2314
664 Ga0307409_100109684 3300031995 Bacteria 2311
665 Ga0307409_100140908 3300031995 Bacteria 2077
666 Ga0307409_100147804 3300031995 Bacteria 2035
667 Ga0307409_100228942 3300031995 Bacteria 1683
668 Ga0307409_100279486 3300031995 Bacteria 1542
669 Ga0307409_100390846 3300031995 Bacteria 1325
670 Ga0307416_100004847 3300032002 Bacteria 8187
671 Ga0307416_100008600 3300032002 Bacteria 6602
672 Ga0307416_100024975 3300032002 Bacteria 4372
673 Ga0307416_100055367 3300032002 Bacteria 3194
674 Ga0307416_100057924 3300032002 Bacteria 3138
675 Ga0307416_100172596 3300032002 Bacteria 2015
676 Ga0307416_100254176 3300032002 Bacteria 1713
677 Ga0307416_100455599 3300032002 Bacteria 1333
678 Ga0307414_10016958 3300032004 Bacteria 4445
679 Ga0307414_10020103 3300032004 Bacteria 4154
680 Ga0307414_10024236 3300032004 Bacteria 3866
681 Ga0307414_10065704 3300032004 Bacteria 2589
682 Ga0307414_10141928 3300032004 Bacteria 1882
683 Ga0307411_10028720 3300032005 Bacteria 3387
684 Ga0307411_10062908 3300032005 Bacteria 2478
685 Ga0307411_10121414 3300032005 Bacteria 1891
686 Ga0307411_10156076 3300032005 Bacteria 1703
687 Ga0307411_10167669 3300032005 Bacteria 1652
688 Ga0307415_100021173 3300032126 Bacteria 3990
689 Ga0307415_100213319 3300032126 Bacteria 1542
690 Ga0307415_100215722 3300032126 Bacteria 1534
691 Ga0307415_100220758 3300032126 Bacteria 1519
692 Ga0316583_10031886 3300032133 Bacteria 1875
693 Ga0316585_10008431 3300032137 Bacteria 2991
694 Ga0307507_10000024 3300033179 Bacteria 212340
695 Ga0307507_10039031 3300033179 Bacteria 4799
696 Ga0307510_10071034 3300033180 Bacteria 3471
697 Ga0307510_10093196 3300033180 Bacteria 2845
698 Ga0316212_1008686 3300033547 Bacteria 1459
699 Ga0373938_0002225 3300034957 Bacteria 3115
700 Ga0373926_0018060 3300035083 Bacteria 2424
701 Ga0373926_0054436 3300035083 Bacteria 1449
702 Ga0373934_0000060 3300035086 Bacteria 37064
703 Ga0373934_0005753 3300035086 Bacteria 4593
704 Ga0373934_0007765 3300035086 Bacteria 3985
705 Ga0373934_0021948 3300035086 Bacteria 2460
706 Ga0373940_0013993 3300035088 Bacteria 1951
707 Ga0373944_0001496 3300035089 Bacteria 5909
708 Ga0373944_0006615 3300035089 Bacteria 3078
709 Ga0373923_0001412 3300035111 Bacteria 6861
710 Ga0373923_0006524 3300035111 Bacteria 4041
711 Ga0373923_0022397 3300035111 Bacteria 2477
712 Ga0373923_0030949 3300035111 Bacteria 2154
713 Ga0373932_0015193 3300035112 Bacteria 1948
714 Ga0373936_0000847 3300035113 Bacteria 10892
715 Ga0373936_0007777 3300035113 Bacteria 4026
716 Ga0373936_0015652 3300035113 Bacteria 2907
717 Ga0373936_0057553 3300035113 Bacteria 1581
718 Ga0373945_0000182 3300035116 Bacteria 16849
719 Ga0373953_0000277 3300035117 Bacteria 14136
720 Ga0373953_0002414 3300035117 Bacteria 5643
721 Ga0373953_0003904 3300035117 Bacteria 4697
722 Ga0373953_0012377 3300035117 Bacteria 3020
723 Ga0373954_0002950 3300035118 Bacteria 7178
724 Ga0373954_0023130 3300035118 Bacteria 2823
725 Ga0373954_0024959 3300035118 Bacteria 2728
726 Ga0373954_0025004 3300035118 Bacteria 2726
727 Ga0373954_0026765 3300035118 Bacteria 2645
728 Ga0373956_0000422 3300035119 Bacteria 17238
729 Ga0373956_0005349 3300035119 Bacteria 5137
730 Ga0373956_0005512 3300035119 Bacteria 5066
731 Ga0373956_0014937 3300035119 Bacteria 3247
732 Ga0373956_0029433 3300035119 Bacteria 2395
733 Ga0373956_0054191 3300035119 Bacteria 1806
734 Ga0373957_0000077 3300035120 Bacteria 23677
735 Ga0373957_0002673 3300035120 Bacteria 5117
736 Ga0373957_0012834 3300035120 Bacteria 2828
737 Ga0373957_0022802 3300035120 Bacteria 2233
738 Ga0373957_0024157 3300035120 Bacteria 2180
739 Ga0373957_0062286 3300035120 Bacteria 1447
740 Ga0373946_0000651 3300035171 Bacteria 11638
741 Ga0373946_0007865 3300035171 Bacteria 3914
742 Ga0373946_0059149 3300035171 Bacteria 1626
743 Ga0373955_0000013 3300035172 Bacteria 73449
744 Ga0373955_0027994 3300035172 Bacteria 2918
745 Ga0373955_0094242 3300035172 Bacteria 1710
746 Ga0373961_0013919 3300035241 Bacteria 2035
747 Ga0316574_0015485 3300035398 Bacteria 4425
748 Ga0316574_0076927 3300035398 Bacteria 2114
749 Ga0373924_0000936 3300035410 Bacteria 9209
750 Ga0373924_0009894 3300035410 Bacteria 3507
751 Ga0373935_0007297 3300035692 Bacteria 6609
752 Ga0373935_0037830 3300035692 Bacteria 3020
753 Ga0373935_0131404 3300035692 Bacteria 1682
754 Ga0373927_0012605 3300035695 Bacteria 5624
755 Ga0373927_0015053 3300035695 Bacteria 5113
756 Ga0373927_0144016 3300035695 Bacteria 1559
757 Ga0373933_0000139 3300035724 Bacteria 46756
758 Ga0373933_0001396 3300035724 Bacteria 14183
759 Ga0373933_0013994 3300035724 Bacteria 4451
760 Ga0373933_0044507 3300035724 Bacteria 2629
761 Ga0373947_0007347 3300035725 Bacteria 6378
762 Ga0373947_0123178 3300035725 Bacteria 1649
763 Ga0373947_0131535 3300035725 Bacteria 1598
764 Ga0373937_0000112 3300036401 Bacteria 77473
765 Ga0373937_0008701 3300036401 Bacteria 8819
766 Ga0373937_0010609 3300036401 Bacteria 8049
767 Ga0373937_0037477 3300036401 Bacteria 4418
768 Ga0373937_0193865 3300036401 Bacteria 1909
769 Ga0373937_0208875 3300036401 Bacteria 1836
770 Ga0372808_001746 3300036459 Bacteria 2349
771 Ga0316582_0004467 3300036647 Bacteria 7080
772 Ga0316582_0039405 3300036647 Bacteria 2942
773 Ga0316584_0003649 3300036712 Bacteria 10076
774 Ga0316584_0005041 3300036712 Bacteria 8802
775 Ga0316584_0012623 3300036712 Bacteria 5960
776 Ga0316584_0016410 3300036712 Bacteria 5309
777 Ga0316584_0030549 3300036712 Bacteria 3978
778 Ga0373925_0000008 3300037068 Bacteria 249158
779 Ga0373925_0002037 3300037068 Bacteria 16694
780 Ga0373925_0003433 3300037068 Bacteria 12260
781 Ga0373925_0007151 3300037068 Bacteria 8159
782 Ga0373925_0147876 3300037068 Bacteria 1842
783 Ga0395899_0005583 3300037312 Bacteria 9756
784 Ga0395899_0017225 3300037312 Bacteria 5505
785 Ga0395899_0032197 3300037312 Bacteria 3939
786 Ga0395899_0038763 3300037312 Bacteria 3567
787 Ga0395899_0040320 3300037312 Bacteria 3493
788 Ga0395899_0076971 3300037312 Bacteria 2434
789 Ga0395899_0110727 3300037312 Bacteria 1975
790 Ga0395899_0184253 3300037312 Bacteria 1464
791 Ga0395900_0011102 3300037418 Bacteria 9206
792 Ga0395900_0093930 3300037418 Bacteria 3081
793 Ga0395900_0102603 3300037418 Bacteria 2938
794 Ga0395900_0209796 3300037418 Bacteria 1967
795 Ga0395900_0407188 3300037418 Bacteria 1323
796 Ga0395898_0000381 3300037466 Bacteria 97274
797 Ga0395898_0001626 3300037466 Bacteria 30485
798 Ga0395898_0006252 3300037466 Bacteria 12744
799 Ga0395898_0016357 3300037466 Bacteria 7592
800 Ga0395898_0020646 3300037466 Bacteria 6689
801 Ga0395898_0027833 3300037466 Bacteria 5668
802 Ga0395898_0031520 3300037466 Bacteria 5296
803 Ga0395898_0057057 3300037466 Bacteria 3805
804 Ga0395898_0070700 3300037466 Bacteria 3373
805 Ga0395898_0089016 3300037466 Bacteria 2971
806 Ga0395898_0346841 3300037466 Bacteria 1416
807 Ga0395898_0367269 3300037466 Bacteria 1372
808 Ga0436364_0160104 3300037853 Bacteria 3213
809 Ga0436364_0287407 3300037853 Bacteria 132611
810 Ga0436364_0464514 3300037853 Bacteria 2581
811 Ga0436364_0964211 3300037853 Bacteria 1702
812 Ga0436364_1096374 3300037853 Bacteria 1783
813 Ga0436364_1261806 3300037853 Bacteria 5053
814 Ga0436364_1274663 3300037853 Bacteria 8091
815 Ga0436364_1379988 3300037853 Bacteria 24630
816 Ga0436364_1399659 3300037853 Bacteria 2774
817 Ga0395901_0036787 3300038443 Bacteria 5061
818 Ga0395901_0071477 3300038443 Bacteria 3616
819 Ga0395901_0079374 3300038443 Bacteria 3427
820 Ga0395901_0111329 3300038443 Bacteria 2875
821 Ga0395901_0131820 3300038443 Bacteria 2626
822 Ga0395901_0135263 3300038443 Bacteria 2591
823 Ga0395901_0145256 3300038443 Bacteria 2493
824 Ga0395901_0240809 3300038443 Bacteria 1887
825 Ga0395901_0272956 3300038443 Bacteria 1758
826 Ga0395901_0486909 3300038443 Bacteria 1257
827 Ga0400485_14348 3300038735 Bacteria 15612
828 Ga0400488_19742 3300038741 Bacteria 1306
829 Ga0400486_32183 3300038742 Bacteria 37185
830 Ga0436365_1516734 3300039437 Bacteria 2369
831 Ga0436360_1265940 3300039438 Bacteria 1838
832 Ga0439436_0001906 3300041404 Bacteria 6173
833 Ga0439436_0004852 3300041404 Bacteria 4127
834 Ga0439436_0012938 3300041404 Bacteria 2528
835 Ga0439436_0020025 3300041404 Bacteria 1993
836 Ga0439436_0037014 3300041404 Bacteria 1406
837 Ga0439438_052622 3300041405 Bacteria 1032
838 Ga0439439_0001108 3300041406 Bacteria 5147
839 Ga0439439_0002397 3300041406 Bacteria 3975
840 Ga0439447_016639 3300041407 Bacteria 2015
841 Ga0439466_0004226 3300041411 Bacteria 5546
842 Ga0439466_0004258 3300041411 Bacteria 5522
843 Ga0451791_0795391 3300041451 Bacteria 1382
844 Ga0451791_1067624 3300041451 Bacteria 5132
845 Ga0451793_0283208 3300041452 Bacteria 5544
846 Ga0451797_0921282 3300041453 Bacteria 2572
847 Ga0451802_0199680 3300041460 Bacteria 2116
848 Ga0451807_0181894 3300041486 Bacteria 2199
849 Ga0451833_1396629 3300041491 Bacteria 1597
850 Ga0451837_1299351 3300041494 Bacteria 1455
851 Ga0451839_1074799 3300041496 Bacteria 3420
852 Ga0451853_0509641 3300041512 Bacteria 3460
853 Ga0451853_2323682 3300041512 Bacteria 3405
854 Ga0439433_0000156 3300041999 Bacteria 10531
855 Ga0439433_0000220 3300041999 Bacteria 9358
856 Ga0439442_000012 3300042002 Bacteria 49187
857 Ga0439442_000083 3300042002 Bacteria 22714
858 Ga0439442_000162 3300042002 Bacteria 16792
859 Ga0439442_004696 3300042002 Bacteria 2716
860 Ga0439442_009119 3300042002 Bacteria 2005
861 Ga0439449_0000984 3300042007 Bacteria 11198
862 Ga0439449_0029595 3300042007 Bacteria 2041
863 Ga0439452_007207 3300042010 Bacteria 3421
864 Ga0439457_000027 3300042014 Bacteria 29657
865 Ga0439457_003698 3300042014 Bacteria 4122
866 Ga0439457_004957 3300042014 Bacteria 3405
867 Ga0439462_0041974 3300042015 Bacteria 1222
868 Ga0439462_0057144 3300042015 Bacteria 1053
869 Ga0450894_000043 3300042131 Bacteria 18761
870 Ga0450907_000265 3300042146 Bacteria 17745
871 Ga0450907_005873 3300042146 Bacteria 2060
872 Ga0439458_0001450 3300042157 Bacteria 5973
873 Ga0450909_000182 3300042185 Bacteria 7060
874 Ga0439434_0000031 3300042435 Bacteria 33054
875 Ga0439434_0003626 3300042435 Bacteria 4515
876 Ga0439434_0013610 3300042435 Bacteria 2416
877 Ga0450918_000950 3300042531 Bacteria 6051
878 Ga0450918_003686 3300042531 Bacteria 2836
879 Ga0466969_0019697 3300044656 Bacteria 3503
880 Ga0466969_0030935 3300044656 Bacteria 2725
881 Ga0466969_0037022 3300044656 Bacteria 2462
882 Ga0466972_0004584 3300044658 Bacteria 6926
883 Ga0466972_0035044 3300044658 Bacteria 2457
884 Ga0466972_0047412 3300044658 Bacteria 2078
885 Ga0466972_0059802 3300044658 Bacteria 1828
886 Ga0466965_0000038 3300044683 Bacteria 47424
887 Ga0466965_0013448 3300044683 Bacteria 3861
888 Ga0466965_0034551 3300044683 Bacteria 2473
889 Ga0466965_0046392 3300044683 Bacteria 2151
890 Ga0466966_0032573 3300044684 Bacteria 3377
891 Ga0466966_0058359 3300044684 Bacteria 2439
892 Ga0466966_0189110 3300044684 Bacteria 1248
893 Ga0466961_0000630 3300044693 Bacteria 22090
894 Ga0466961_0004359 3300044693 Bacteria 8866
895 Ga0466961_0004420 3300044693 Bacteria 8800
896 Ga0466961_0031022 3300044693 Bacteria 3435
897 Ga0466961_0048035 3300044693 Bacteria 2728
898 Ga0466961_0072229 3300044693 Bacteria 2189
899 Ga0466963_0000611 3300044694 Bacteria 17115
900 Ga0466963_0002295 3300044694 Bacteria 10636
901 Ga0466963_0074190 3300044694 Bacteria 2294
902 Ga0466963_0191155 3300044694 Bacteria 1430
903 Ga0466963_0255975 3300044694 Bacteria 1229
904 Ga0466971_0000512 3300044719 Bacteria 15294
905 Ga0466971_0001195 3300044719 Bacteria 10780
906 Ga0466971_0001379 3300044719 Bacteria 10183
907 Ga0466971_0084173 3300044719 Bacteria 1452
908 Ga0466968_0010980 3300044735 Bacteria 3521
909 Ga0466970_0000322 3300044765 Bacteria 23272
910 Ga0466970_0002564 3300044765 Bacteria 8766
911 Ga0466970_0004093 3300044765 Bacteria 7170
912 Ga0466970_0013270 3300044765 Bacteria 4223
913 Ga0466970_0020549 3300044765 Bacteria 3432
914 Ga0466970_0027254 3300044765 Bacteria 2997
915 Ga0466970_0044803 3300044765 Bacteria 2355
916 Ga0466970_0057628 3300044765 Bacteria 2077
917 Ga0466957_0000143 3300044842 Bacteria 30758
918 Ga0466957_0108661 3300044842 Bacteria 1757
919 Ga0466960_0009565 3300044901 Bacteria 4000
920 Ga0466960_0012316 3300044901 Bacteria 3605
921 Ga0466960_0029449 3300044901 Bacteria 2520
922 Ga0466960_0029531 3300044901 Bacteria 2516
923 Ga0466960_0118455 3300044901 Bacteria 1384
924 Ga0466959_0005248 3300045049 Bacteria 8845
925 Ga0466959_0051206 3300045049 Bacteria 3030
926 Ga0466959_0059799 3300045049 Bacteria 2773
927 Ga0466959_0196100 3300045049 Bacteria 1407
928 Ga0466958_0003353 3300045836 Bacteria 8302
929 Ga0466958_0017403 3300045836 Bacteria 4154
930 Ga0466958_0047464 3300045836 Bacteria 2593
931 Ga0466958_0071467 3300045836 Bacteria 2125
932 Ga0466958_0111387 3300045836 Bacteria 1709
933 Ga0466958_0172368 3300045836 Bacteria 1370
934 Ga0466967_0009414 3300045976 Bacteria 7245
935 Ga0466967_0027218 3300045976 Bacteria 4753
936 Ga0466967_0053667 3300045976 Bacteria 3544
937 Ga0466967_0080891 3300045976 Bacteria 2933
938 Ga0466967_0546302 3300045976 Bacteria 1140
939 Ga0495627_001457 3300046453 Bacteria 13875
940 Ga0495627_033005 3300046453 Bacteria 1625
941 Ga0495592_0000094 3300046454 Bacteria 78801
942 Ga0495592_0000481 3300046454 Bacteria 29134
943 Ga0495592_0008825 3300046454 Bacteria 7571
944 Ga0495592_0032917 3300046454 Bacteria 3910
945 Ga0495592_0086011 3300046454 Bacteria 2265
946 Ga0495592_0103099 3300046454 Bacteria 2030
947 Ga0495592_0110410 3300046454 Bacteria 1946
948 Ga0495592_0121173 3300046454 Bacteria 1840
949 Ga0495603_0001779 3300046455 Bacteria 12705
950 Ga0495603_0006149 3300046455 Bacteria 7176
951 Ga0495603_0012191 3300046455 Bacteria 5205
952 Ga0495603_0167868 3300046455 Bacteria 1271
953 Ga0495590_0000094 3300046457 Bacteria 54669
954 Ga0495590_0010180 3300046457 Bacteria 3543
955 Ga0495629_0002238 3300046459 Bacteria 14917
956 Ga0495629_0004014 3300046459 Bacteria 11058
957 Ga0495629_0005922 3300046459 Bacteria 9112
958 Ga0495629_0017611 3300046459 Bacteria 5121
959 Ga0495629_0079132 3300046459 Bacteria 2295
960 Ga0495638_0024022 3300046460 Bacteria 3979
961 Ga0495638_0183544 3300046460 Bacteria 1192
962 Ga0495641_0007164 3300046461 Bacteria 7040
963 Ga0495641_0014070 3300046461 Bacteria 4349
964 Ga0495641_0016263 3300046461 Bacteria 3926
965 Ga0495641_0040202 3300046461 Bacteria 2176
966 Ga0495651_0000041 3300046462 Bacteria 94160
967 Ga0495651_0002291 3300046462 Bacteria 14763
968 Ga0495651_0009757 3300046462 Bacteria 7383
969 Ga0495651_0013168 3300046462 Bacteria 6392
970 Ga0495651_0042337 3300046462 Bacteria 3536
971 Ga0495651_0042569 3300046462 Bacteria 3525
972 Ga0495651_0068071 3300046462 Bacteria 2714
973 Ga0495651_0073357 3300046462 Bacteria 2598
974 Ga0495651_0077794 3300046462 Bacteria 2510
975 Ga0495651_0081622 3300046462 Bacteria 2440
976 Ga0495651_0084716 3300046462 Bacteria 2388
977 Ga0495653_0002267 3300046463 Bacteria 15220
978 Ga0495653_0006276 3300046463 Bacteria 9755
979 Ga0495653_0007658 3300046463 Bacteria 8837
980 Ga0495653_0026502 3300046463 Bacteria 4646
981 Ga0495653_0039274 3300046463 Bacteria 3708
982 Ga0495653_0045800 3300046463 Bacteria 3389
983 Ga0495653_0137825 3300046463 Bacteria 1719
984 Ga0495650_0016212 3300046471 Bacteria 3783
985 Ga0495650_0060587 3300046471 Bacteria 1519
986 Ga0495580_0016321 3300046472 Bacteria 5577
987 Ga0495580_0023584 3300046472 Bacteria 4515
988 Ga0495580_0044397 3300046472 Bacteria 3161
989 Ga0495580_0078078 3300046472 Bacteria 2309
990 Ga0495582_0001614 3300046473 Bacteria 12697
991 Ga0495582_0015676 3300046473 Bacteria 4159
992 Ga0495582_0070053 3300046473 Bacteria 1939
993 Ga0495582_0120796 3300046473 Bacteria 1476
994 Ga0495605_0021869 3300046474 Bacteria 3382
995 Ga0495639_0001608 3300046475 Bacteria 10058
996 Ga0495639_0006034 3300046475 Bacteria 5205
997 Ga0495662_0000490 3300046476 Bacteria 18037
998 Ga0495662_0001269 3300046476 Bacteria 12479
999 Ga0495662_0006654 3300046476 Bacteria 5764
1000 Ga0495662_0015157 3300046476 Bacteria 3745
1001 Ga0495662_0017624 3300046476 Bacteria 3457
1002 Ga0495662_0022376 3300046476 Bacteria 3052
1003 Ga0495662_0098602 3300046476 Bacteria 1429
1004 Ga0495664_0000351 3300046477 Bacteria 22346
1005 Ga0495664_0002132 3300046477 Bacteria 10569
1006 Ga0495664_0012658 3300046477 Bacteria 4778
1007 Ga0495664_0013992 3300046477 Bacteria 4545
1008 Ga0495664_0014416 3300046477 Bacteria 4481
1009 Ga0495664_0023780 3300046477 Bacteria 3557
1010 Ga0495664_0045484 3300046477 Bacteria 2603
1011 Ga0495664_0095689 3300046477 Bacteria 1787
1012 Ga0495664_0121248 3300046477 Bacteria 1581
1013 Ga0495584_0011675 3300046491 Bacteria 4496
1014 Ga0495585_0002304 3300046492 Bacteria 13754
1015 Ga0495594_0008762 3300046499 Bacteria 5215
1016 Ga0495594_0025952 3300046499 Bacteria 3151
1017 Ga0495594_0044164 3300046499 Bacteria 2444
1018 Ga0495594_0117357 3300046499 Bacteria 1503
1019 Ga0495596_0024389 3300046500 Bacteria 2448
1020 Ga0495607_0129690 3300046501 Bacteria 1313
1021 Ga0495608_0000081 3300046511 Bacteria 69898
1022 Ga0495608_0005238 3300046511 Bacteria 9265
1023 Ga0495608_0005899 3300046511 Bacteria 8712
1024 Ga0495608_0009160 3300046511 Bacteria 6919
1025 Ga0495608_0012635 3300046511 Bacteria 5859
1026 Ga0495608_0015039 3300046511 Bacteria 5368
1027 Ga0495608_0022768 3300046511 Bacteria 4298
1028 Ga0495608_0038030 3300046511 Bacteria 3234
1029 Ga0495616_0008848 3300046513 Bacteria 5924
1030 Ga0495618_0007735 3300046514 Bacteria 6501
1031 Ga0495618_0016327 3300046514 Bacteria 4540
1032 Ga0495618_0087836 3300046514 Bacteria 1988
1033 Ga0495618_0108606 3300046514 Bacteria 1776
1034 Ga0495618_0126501 3300046514 Bacteria 1636
1035 Ga0495620_0020344 3300046515 Bacteria 3242
1036 Ga0495628_0000164 3300046516 Bacteria 57810
1037 Ga0495628_0017977 3300046516 Bacteria 5865
1038 Ga0495628_0027448 3300046516 Bacteria 4632
1039 Ga0495628_0038786 3300046516 Bacteria 3811
1040 Ga0495628_0067706 3300046516 Bacteria 2787
1041 Ga0495628_0069623 3300046516 Bacteria 2744
1042 Ga0495628_0112235 3300046516 Bacteria 2095
1043 Ga0495628_0112763 3300046516 Bacteria 2090
1044 Ga0495628_0134712 3300046516 Bacteria 1888
1045 Ga0495628_0138633 3300046516 Bacteria 1857
1046 Ga0495630_0026724 3300046517 Bacteria 4275
1047 Ga0495630_0049619 3300046517 Bacteria 3141
1048 Ga0495630_0118189 3300046517 Bacteria 2010
1049 Ga0495630_0172843 3300046517 Bacteria 1646
1050 Ga0495631_0004932 3300046518 Bacteria 7033
1051 Ga0495631_0025816 3300046518 Bacteria 2702
1052 Ga0495632_0085526 3300046519 Bacteria 1500
1053 Ga0495637_0051577 3300046520 Bacteria 1721
1054 Ga0495643_0001347 3300046522 Bacteria 23107
1055 Ga0495643_0056504 3300046522 Bacteria 2095
1056 Ga0495663_0025093 3300046525 Bacteria 1737
1057 Ga0495652_0000289 3300046529 Bacteria 59692
1058 Ga0495652_0020655 3300046529 Bacteria 5854
1059 Ga0495652_0026494 3300046529 Bacteria 5122
1060 Ga0495652_0069294 3300046529 Bacteria 2953
1061 Ga0495652_0080266 3300046529 Bacteria 2695
1062 Ga0495652_0102644 3300046529 Bacteria 2316
1063 Ga0495652_0122654 3300046529 Bacteria 2069
1064 Ga0495652_0162901 3300046529 Bacteria 1729
1065 Ga0495654_0023227 3300046530 Bacteria 3213
1066 Ga0495665_0001175 3300046531 Bacteria 13940
1067 Ga0495665_0002775 3300046531 Bacteria 9454
1068 Ga0495665_0003528 3300046531 Bacteria 8493
1069 Ga0495665_0026611 3300046531 Bacteria 3106
1070 Ga0495665_0101074 3300046531 Bacteria 1513
1071 Ga0495640_0013085 3300046533 Bacteria 6318
1072 Ga0495640_0022205 3300046533 Bacteria 4643
1073 Ga0495640_0026527 3300046533 Bacteria 4185
1074 Ga0495640_0040085 3300046533 Bacteria 3281
1075 Ga0495640_0045928 3300046533 Bacteria 3029
1076 Ga0495640_0050900 3300046533 Bacteria 2850
1077 Ga0495640_0125465 3300046533 Bacteria 1665
1078 Ga0495586_0005989 3300046535 Bacteria 6503
1079 Ga0495586_0017800 3300046535 Bacteria 3781
1080 Ga0495586_0035870 3300046535 Bacteria 2663
1081 Ga0495586_0040418 3300046535 Bacteria 2509
1082 Ga0495586_0070150 3300046535 Bacteria 1913
1083 Ga0495586_0081510 3300046535 Bacteria 1778
1084 Ga0495586_0114722 3300046535 Bacteria 1501
1085 Ga0495587_0000038 3300046536 Bacteria 116118
1086 Ga0495587_0002540 3300046536 Bacteria 12202
1087 Ga0495587_0003607 3300046536 Bacteria 10300
1088 Ga0495587_0004772 3300046536 Bacteria 8900
1089 Ga0495587_0006829 3300046536 Bacteria 7428
1090 Ga0495587_0011078 3300046536 Bacteria 5719
1091 Ga0495587_0042335 3300046536 Bacteria 2716
1092 Ga0495587_0259725 3300046536 Bacteria 976
1093 Ga0495609_0027336 3300046538 Bacteria 2608
1094 Ga0495609_0043122 3300046538 Bacteria 2025
1095 Ga0495597_0011805 3300046542 Bacteria 4229
1096 Ga0495645_0002826 3300046543 Bacteria 11777
1097 Ga0495645_0004680 3300046543 Bacteria 9340
1098 Ga0495645_0017922 3300046543 Bacteria 5081
1099 Ga0495645_0031690 3300046543 Bacteria 3852
1100 Ga0495645_0032889 3300046543 Bacteria 3783
1101 Ga0495645_0056280 3300046543 Bacteria 2855
1102 Ga0495645_0078459 3300046543 Bacteria 2373
1103 Ga0495645_0107550 3300046543 Bacteria 1977
1104 Ga0495645_0124372 3300046543 Bacteria 1813
1105 Ga0495645_0150757 3300046543 Bacteria 1615
1106 Ga0495645_0180555 3300046543 Bacteria 1446
1107 Ga0495622_0006569 3300046557 Bacteria 5392
1108 Ga0495667_0000070 3300046559 Bacteria 78776
1109 Ga0495667_0003737 3300046559 Bacteria 10240
1110 Ga0495667_0038072 3300046559 Bacteria 3203
1111 Ga0495667_0052664 3300046559 Bacteria 2680
1112 Ga0495667_0067051 3300046559 Bacteria 2345
1113 Ga0495667_0087278 3300046559 Bacteria 2023
1114 Ga0495667_0119304 3300046559 Bacteria 1703
1115 Ga0495667_0173174 3300046559 Bacteria 1386
1116 Ga0495634_0002454 3300046642 Bacteria 15402
1117 Ga0495634_0028577 3300046642 Bacteria 3869
1118 Ga0495634_0041285 3300046642 Bacteria 3134
1119 Ga0495634_0098856 3300046642 Bacteria 1887
1120 Ga0495611_0026253 3300046648 Bacteria 2540
1121 Ga0495625_0010712 3300046660 Bacteria 7549
1122 Ga0495635_0002501 3300046663 Bacteria 12559
1123 Ga0495635_0007697 3300046663 Bacteria 7515
1124 Ga0495635_0016282 3300046663 Bacteria 5191
1125 Ga0495635_0032208 3300046663 Bacteria 3637
1126 Ga0495635_0032458 3300046663 Bacteria 3622
1127 Ga0495635_0045447 3300046663 Bacteria 3030
1128 Ga0495635_0078795 3300046663 Bacteria 2255
1129 Ga0495659_0006157 3300046664 Bacteria 3792
1130 Ga0495588_0054453 3300046674 Bacteria 2064
1131 Ga0495588_0074525 3300046674 Bacteria 1767
1132 Ga0495657_0000192 3300046675 Bacteria 55017
1133 Ga0495657_0001801 3300046675 Bacteria 18344
1134 Ga0495657_0007863 3300046675 Bacteria 8184
1135 Ga0495657_0017701 3300046675 Bacteria 5169
1136 Ga0495657_0019259 3300046675 Bacteria 4926
1137 Ga0495657_0034064 3300046675 Bacteria 3540
1138 Ga0495657_0034170 3300046675 Bacteria 3533
1139 Ga0495657_0062590 3300046675 Bacteria 2457
1140 Ga0495657_0114737 3300046675 Bacteria 1702
1141 Ga0495657_0116754 3300046675 Bacteria 1684
1142 Ga0495599_0000100 3300046678 Bacteria 60814
1143 Ga0495599_0007362 3300046678 Bacteria 6671
1144 Ga0495599_0018592 3300046678 Bacteria 4329
1145 Ga0495599_0028460 3300046678 Bacteria 3503
1146 Ga0495599_0050021 3300046678 Bacteria 2619
1147 Ga0495623_0000409 3300046679 Bacteria 28354
1148 Ga0495623_0002698 3300046679 Bacteria 11725
1149 Ga0495623_0016055 3300046679 Bacteria 4839
1150 Ga0495623_0040737 3300046679 Bacteria 2965
1151 Ga0495623_0047715 3300046679 Bacteria 2718
1152 Ga0495623_0060152 3300046679 Bacteria 2384
1153 Ga0495623_0094606 3300046679 Bacteria 1827
1154 Ga0495646_0005300 3300046680 Bacteria 8141
1155 Ga0495646_0046110 3300046680 Bacteria 2659
1156 Ga0495646_0051293 3300046680 Bacteria 2497
1157 Ga0495647_0003185 3300046681 Bacteria 5254
1158 Ga0495647_0011635 3300046681 Bacteria 3017
1159 Ga0495658_0002514 3300046683 Bacteria 9224
1160 Ga0495658_0038925 3300046683 Bacteria 2635
1161 Ga0495658_0087508 3300046683 Bacteria 1840
1162 Ga0495613_0004118 3300046689 Bacteria 10875
1163 Ga0495613_0005121 3300046689 Bacteria 9835
1164 Ga0495613_0007805 3300046689 Bacteria 7963
1165 Ga0495613_0017497 3300046689 Bacteria 5336
1166 Ga0495613_0043432 3300046689 Bacteria 3325
1167 Ga0495613_0222982 3300046689 Bacteria 1323
1168 Ga0495624_0006182 3300046690 Bacteria 8513
1169 Ga0495624_0022253 3300046690 Bacteria 4194
1170 Ga0495624_0046417 3300046690 Bacteria 2761
1171 Ga0495624_0049837 3300046690 Bacteria 2654
1172 Ga0495624_0092011 3300046690 Bacteria 1870
1173 Ga0495670_0023417 3300046691 Bacteria 3048
1174 Ga0495670_0071207 3300046691 Bacteria 1760
1175 Ga0495671_0005333 3300046692 Bacteria 7543
1176 Ga0495589_0022703 3300046794 Bacteria 3200
1177 Ga0495600_0001188 3300046809 Bacteria 14237
1178 Ga0495600_0004237 3300046809 Bacteria 8567
1179 Ga0495600_0005804 3300046809 Bacteria 7460
1180 Ga0495600_0009346 3300046809 Bacteria 6054
1181 Ga0495600_0013174 3300046809 Bacteria 5188
1182 Ga0495600_0035019 3300046809 Bacteria 3260
1183 Ga0495600_0041537 3300046809 Bacteria 2997
1184 Ga0495600_0051307 3300046809 Bacteria 2693
1185 Ga0495600_0140257 3300046809 Bacteria 1568
1186 Ga0495600_0172600 3300046809 Bacteria 1395
1187 Ga0495660_0006238 3300046810 Bacteria 7074
1188 Ga0495581_0003354 3300047315 Bacteria 9191
1189 Ga0495581_0044659 3300047315 Bacteria 2562
1190 Ga0495581_0059541 3300047315 Bacteria 2207
1191 Ga0495581_0076501 3300047315 Bacteria 1936
1192 Ga0495581_0110107 3300047315 Bacteria 1601
1193 Ga0495581_0112287 3300047315 Bacteria 1585
1194 Ga0495604_0000061 3300047317 Bacteria 94158
1195 Ga0495604_0002802 3300047317 Bacteria 13991
1196 Ga0495604_0026075 3300047317 Bacteria 4654
1197 Ga0495604_0033094 3300047317 Bacteria 4093
1198 Ga0495604_0033445 3300047317 Bacteria 4070
1199 Ga0495604_0050839 3300047317 Bacteria 3216
1200 Ga0495604_0141761 3300047317 Bacteria 1716
1201 Ga0495604_0223403 3300047317 Bacteria 1295
1202 Ga0495636_0002194 3300047318 Bacteria 7493
1203 Ga0495636_0032486 3300047318 Bacteria 2141
1204 Ga0495674_0019179 3300047319 Bacteria 6353
1205 Ga0495674_0027638 3300047319 Bacteria 5182
1206 Ga0495674_0037963 3300047319 Bacteria 4327
1207 Ga0495674_0048001 3300047319 Bacteria 3781
1208 Ga0495674_0070377 3300047319 Bacteria 3023
1209 Ga0495674_0083559 3300047319 Bacteria 2736
1210 Ga0495674_0148901 3300047319 Bacteria 1963
1211 Ga0495674_0278225 3300047319 Bacteria 1372
1212 Ga0495672_0015842 3300047320 Bacteria 5103
1213 Ga0495676_0024813 3300047321 Bacteria 5181
1214 Ga0495676_0028997 3300047321 Bacteria 4718
1215 Ga0495676_0035758 3300047321 Bacteria 4152
1216 Ga0495676_0071092 3300047321 Bacteria 2676
1217 Ga0495676_0116781 3300047321 Bacteria 1947
1218 Ga0495680_0000099 3300047322 Bacteria 78801
1219 Ga0495680_0005688 3300047322 Bacteria 11668
1220 Ga0495680_0005926 3300047322 Bacteria 11419
1221 Ga0495680_0011978 3300047322 Bacteria 7654
1222 Ga0495680_0011998 3300047322 Bacteria 7646
1223 Ga0495680_0017923 3300047322 Bacteria 6025
1224 Ga0495680_0023854 3300047322 Bacteria 5083
1225 Ga0495680_0029389 3300047322 Bacteria 4500
1226 Ga0495680_0030570 3300047322 Bacteria 4396
1227 Ga0495680_0069758 3300047322 Bacteria 2680
1228 Ga0495680_0170421 3300047322 Bacteria 1576
1229 Ga0495680_0173768 3300047322 Bacteria 1559
1230 Ga0495687_002575 3300047443 Bacteria 14296
1231 Ga0495687_026770 3300047443 Bacteria 2709
1232 Ga0495675_0005606 3300047444 Bacteria 7664
1233 Ga0495675_0014263 3300047444 Bacteria 5023
1234 Ga0495675_0017765 3300047444 Bacteria 4510
1235 Ga0495675_0018969 3300047444 Bacteria 4368
1236 Ga0495675_0019565 3300047444 Bacteria 4301
1237 Ga0495675_0020983 3300047444 Bacteria 4159
1238 Ga0495675_0052338 3300047444 Bacteria 2592
1239 Ga0495675_0101922 3300047444 Bacteria 1796
1240 Ga0495685_000277 3300047447 Bacteria 17201
1241 Ga0495673_0084402 3300047469 Bacteria 1309
1242 Ga0495681_0000289 3300047470 Bacteria 40161
1243 Ga0495681_0077508 3300047470 Bacteria 1491
1244 Ga0495684_0002552 3300047471 Bacteria 14487
1245 Ga0495684_0002952 3300047471 Bacteria 13389
1246 Ga0495684_0013883 3300047471 Bacteria 6195
1247 Ga0495684_0016318 3300047471 Bacteria 5718
1248 Ga0495684_0027440 3300047471 Bacteria 4371
1249 Ga0495684_0039709 3300047471 Bacteria 3608
1250 Ga0495684_0089962 3300047471 Bacteria 2325
1251 Ga0495684_0128301 3300047471 Bacteria 1906
1252 Ga0495684_0154148 3300047471 Bacteria 1716
1253 Ga0495684_0193289 3300047471 Bacteria 1503
1254 Ga0495684_0221305 3300047471 Bacteria 1388
1255 Ga0495593_0001682 3300047673 Bacteria 13119
1256 Ga0495593_0007995 3300047673 Bacteria 6157
1257 Ga0495593_0016042 3300047673 Bacteria 4228
1258 Ga0495593_0031017 3300047673 Bacteria 2922
1259 Ga0495602_0000649 3300048088 Bacteria 32571
1260 Ga0495602_0021967 3300048088 Bacteria 6258
1261 Ga0495602_0022801 3300048088 Bacteria 6120
1262 Ga0495602_0046525 3300048088 Bacteria 3918
1263 Ga0495602_0077403 3300048088 Bacteria 2814
1264 Ga0495602_0108079 3300048088 Bacteria 2265
1265 Ga0495602_0177044 3300048088 Bacteria 1649
1266 Ga0495602_0207241 3300048088 Bacteria 1491
1267 Ga0495614_0000245 3300048089 Bacteria 21228
1268 Ga0495626_0004415 3300048091 Bacteria 8647
1269 Ga0496100_0007737 3300048903 Bacteria 5951
1270 Ga0496100_0016444 3300048903 Bacteria 4345
1271 Ga0496100_0029003 3300048903 Bacteria 3418
1272 Ga0496100_0037110 3300048903 Bacteria 3078
1273 Ga0496100_0097033 3300048903 Bacteria 2023
1274 Ga0496101_0007337 3300048904 Bacteria 7137
1275 Ga0496101_0028405 3300048904 Bacteria 3904
1276 Ga0496101_0050988 3300048904 Bacteria 2980
1277 Ga0496101_0103857 3300048904 Bacteria 2130
1278 Ga0496101_0158675 3300048904 Bacteria 1734
1279 Ga0496101_0174961 3300048904 Bacteria 1650
1280 Ga0496101_0278620 3300048904 Bacteria 1307
1281 Ga0496101_0286128 3300048904 Bacteria 1289
1282 Ga0496102_0000236 3300048905 Bacteria 72601
1283 Ga0496102_0006337 3300048905 Bacteria 10088
1284 Ga0496102_0012264 3300048905 Bacteria 7412
1285 Ga0496102_0013702 3300048905 Bacteria 7029
1286 Ga0496102_0046015 3300048905 Bacteria 3962
1287 Ga0496102_0058240 3300048905 Bacteria 3530
1288 Ga0496102_0128630 3300048905 Bacteria 2369
1289 Ga0496102_0357919 3300048905 Bacteria 1374
1290 Ga0496102_0375764 3300048905 Bacteria 1337
1291 Ga0496103_0000185 3300048906 Bacteria 62838
1292 Ga0496103_0008811 3300048906 Bacteria 5984
1293 Ga0496103_0018888 3300048906 Bacteria 4139
1294 Ga0496103_0033020 3300048906 Bacteria 3161
1295 Ga0496103_0042282 3300048906 Bacteria 2803
1296 Ga0496103_0070949 3300048906 Bacteria 2179
1297 Ga0496103_0118362 3300048906 Bacteria 1686
1298 Ga0496104_0000836 3300048907 Bacteria 26568
1299 Ga0496104_0004654 3300048907 Bacteria 11937
1300 Ga0496104_0006197 3300048907 Bacteria 10503
1301 Ga0496104_0006329 3300048907 Bacteria 10415
1302 Ga0496104_0021598 3300048907 Bacteria 5911
1303 Ga0496104_0095950 3300048907 Bacteria 2837
1304 Ga0496104_0315250 3300048907 Bacteria 1477
1305 Ga0496104_0349905 3300048907 Bacteria 1390
1306 Ga0496105_0001152 3300048908 Bacteria 18424
1307 Ga0496105_0006003 3300048908 Bacteria 9277
1308 Ga0496105_0009146 3300048908 Bacteria 7731
1309 Ga0496105_0025178 3300048908 Bacteria 4840
1310 Ga0496105_0039651 3300048908 Bacteria 3883
1311 Ga0496105_0041449 3300048908 Bacteria 3795
1312 Ga0496105_0061154 3300048908 Bacteria 3107
1313 Ga0496105_0094807 3300048908 Bacteria 2465
1314 Ga0496105_0142604 3300048908 Bacteria 1971
1315 Ga0496105_0147804 3300048908 Bacteria 1932
1316 Ga0496105_0163629 3300048908 Bacteria 1826
1317 Ga0496105_0203627 3300048908 Bacteria 1615
1318 Ga0496105_0262892 3300048908 Bacteria 1395
1319 Ga0496106_0004056 3300048909 Bacteria 10928
1320 Ga0496106_0050284 3300048909 Bacteria 3141
1321 Ga0496106_0213560 3300048909 Bacteria 1537
1322 Ga0496107_0010945 3300048910 Bacteria 6311
1323 Ga0496107_0039784 3300048910 Bacteria 3373
1324 Ga0496107_0076637 3300048910 Bacteria 2435
1325 Ga0496107_0142423 3300048910 Bacteria 1772
1326 Ga0496108_0002269 3300048911 Bacteria 15405
1327 Ga0496108_0006606 3300048911 Bacteria 9405
1328 Ga0496108_0020362 3300048911 Bacteria 5452
1329 Ga0496108_0071227 3300048911 Bacteria 2933
1330 Ga0496108_0086847 3300048911 Bacteria 2656
1331 Ga0496108_0099231 3300048911 Bacteria 2482
1332 Ga0496108_0141913 3300048911 Bacteria 2070
1333 Ga0496108_0311417 3300048911 Bacteria 1372
1334 Ga0496108_0332564 3300048911 Bacteria 1325
1335 Ga0496109_0001771 3300048912 Bacteria 17933
1336 Ga0496109_0043541 3300048912 Bacteria 4069
1337 Ga0496109_0093261 3300048912 Bacteria 2786
1338 Ga0496109_0109774 3300048912 Bacteria 2564
1339 Ga0496109_0189008 3300048912 Bacteria 1935
1340 Ga0496109_0278913 3300048912 Bacteria 1575
1341 Ga0496110_0000402 3300048913 Bacteria 29301
1342 Ga0496110_0040056 3300048913 Bacteria 4082
1343 Ga0496110_0064159 3300048913 Bacteria 3245
1344 Ga0496110_0067588 3300048913 Bacteria 3162
1345 Ga0496110_0110730 3300048913 Bacteria 2467
1346 Ga0496110_0139127 3300048913 Bacteria 2195
1347 Ga0496110_0171369 3300048913 Bacteria 1969
1348 Ga0496110_0180304 3300048913 Bacteria 1918
1349 Ga0496110_0237305 3300048913 Bacteria 1659
1350 Ga0496110_0263563 3300048913 Bacteria 1568
1351 Ga0496111_0008549 3300048914 Bacteria 6782
1352 Ga0496111_0192563 3300048914 Bacteria 1516
1353 Ga0496111_0209079 3300048914 Bacteria 1449
1354 Ga0496112_0003674 3300048915 Bacteria 12790
1355 Ga0496112_0004882 3300048915 Bacteria 11467
1356 Ga0496112_0057931 3300048915 Bacteria 3814
1357 Ga0496112_0100835 3300048915 Bacteria 2857
1358 Ga0496112_0166035 3300048915 Bacteria 2173
1359 Ga0496112_0256377 3300048915 Bacteria 1699
1360 Ga0496112_0412491 3300048915 Bacteria 1290
1361 Ga0496113_0015524 3300048916 Bacteria 5238
1362 Ga0496113_0017024 3300048916 Bacteria 5036
1363 Ga0496113_0029029 3300048916 Bacteria 3988
1364 Ga0496113_0048554 3300048916 Bacteria 3158
1365 Ga0496113_0071819 3300048916 Bacteria 2633
1366 Ga0496113_0074984 3300048916 Bacteria 2580
1367 Ga0496113_0469384 3300048916 Bacteria 1011
1368 Ga0496114_0003907 3300048917 Bacteria 11495
1369 Ga0496114_0010520 3300048917 Bacteria 7362
1370 Ga0496114_0021323 3300048917 Bacteria 5270
1371 Ga0496114_0028070 3300048917 Bacteria 4615
1372 Ga0496114_0028689 3300048917 Bacteria 4568
1373 Ga0496114_0081784 3300048917 Bacteria 2729
1374 Ga0496114_0106929 3300048917 Bacteria 2394
1375 Ga0496114_0129495 3300048917 Bacteria 2178
1376 Ga0496114_0130696 3300048917 Bacteria 2168
1377 Ga0496114_0167237 3300048917 Bacteria 1915
1378 Ga0496114_0176625 3300048917 Bacteria 1863
1379 Ga0496114_0242881 3300048917 Bacteria 1584
1380 Ga0496115_0004890 3300048918 Bacteria 9727
1381 Ga0496115_0006411 3300048918 Bacteria 8621
1382 Ga0496115_0006671 3300048918 Bacteria 8470
1383 Ga0496115_0012610 3300048918 Bacteria 6366
1384 Ga0496115_0030355 3300048918 Bacteria 4251
1385 Ga0496115_0049791 3300048918 Bacteria 3354
1386 Ga0496115_0081938 3300048918 Bacteria 2628
1387 Ga0496115_0133557 3300048918 Bacteria 2046
1388 Ga0496116_0000340 3300048919 Bacteria 74829
1389 Ga0496117_0000387 3300048920 Bacteria 75589
1390 Ga0496117_0000738 3300048920 Bacteria 51389
1391 Ga0496117_0000791 3300048920 Bacteria 49611
1392 Ga0496117_0000986 3300048920 Bacteria 43574
1393 Ga0496117_0001718 3300048920 Bacteria 30310
1394 Ga0496117_0012087 3300048920 Bacteria 7661
1395 Ga0496117_0012943 3300048920 Bacteria 7310
1396 Ga0496117_0023293 3300048920 Bacteria 4941
1397 Ga0496117_0041758 3300048920 Bacteria 3355
1398 Ga0496118_0000096 3300048921 Bacteria 163988
1399 Ga0496118_0000610 3300048921 Bacteria 58893
1400 Ga0496118_0002673 3300048921 Bacteria 23562
1401 Ga0496118_0006467 3300048921 Bacteria 12869
1402 Ga0496118_0009795 3300048921 Bacteria 9604
1403 Ga0496118_0016454 3300048921 Bacteria 6784
1404 Ga0496118_0033164 3300048921 Bacteria 4242
1405 Ga0496118_0042203 3300048921 Bacteria 3601
1406 Ga0496118_0091107 3300048921 Bacteria 2098
1407 Ga0496118_0115595 3300048921 Bacteria 1765
1408 Ga0496119_0000340 3300048922 Bacteria 65290
1409 Ga0496119_0000437 3300048922 Bacteria 57106
1410 Ga0496119_0001355 3300048922 Bacteria 29948
1411 Ga0496119_0002632 3300048922 Bacteria 19477
1412 Ga0496119_0004459 3300048922 Bacteria 13932
1413 Ga0496119_0005146 3300048922 Bacteria 12660
1414 Ga0496119_0009558 3300048922 Bacteria 8295
1415 Ga0496119_0018646 3300048922 Bacteria 5152
1416 Ga0496119_0041849 3300048922 Bacteria 2912
1417 Ga0496119_0061246 3300048922 Bacteria 2249
1418 Ga0496119_0063300 3300048922 Bacteria 2201
1419 Ga0496119_0065003 3300048922 Bacteria 2163
1420 Ga0496119_0123262 3300048922 Bacteria 1421
1421 Ga0496120_0001932 3300048923 Bacteria 22779
1422 Ga0496120_0005677 3300048923 Bacteria 9856
1423 Ga0496120_0006725 3300048923 Bacteria 8743
1424 Ga0496120_0006917 3300048923 Bacteria 8556
1425 Ga0496120_0022515 3300048923 Bacteria 3962
1426 Ga0496120_0023496 3300048923 Bacteria 3859
1427 Ga0496120_0031483 3300048923 Bacteria 3211
1428 Ga0496120_0039950 3300048923 Bacteria 2762
1429 Ga0496121_0000015 3300048924 Bacteria 571958
1430 Ga0496121_0080853 3300048924 Bacteria 2574
1431 Ga0496121_0169373 3300048924 Bacteria 1588
1432 Ga0496121_0219052 3300048924 Bacteria 1342
1433 Ga0496122_0000020 3300048925 Bacteria 401675
1434 Ga0496122_0001218 3300048925 Bacteria 43657
1435 Ga0496122_0005902 3300048925 Bacteria 14341
1436 Ga0496122_0005965 3300048925 Bacteria 14259
1437 Ga0496122_0009445 3300048925 Bacteria 10275
1438 Ga0496122_0011256 3300048925 Bacteria 9090
1439 Ga0496122_0062094 3300048925 Bacteria 2737
1440 Ga0496122_0070148 3300048925 Bacteria 2506
1441 Ga0496122_0086360 3300048925 Bacteria 2160
1442 Ga0496123_0000003 3300048926 Bacteria 866556
1443 Ga0496123_0000009 3300048926 Bacteria 509486
1444 Ga0496123_0000922 3300048926 Bacteria 46092
1445 Ga0496123_0003978 3300048926 Bacteria 16006
1446 Ga0496123_0028382 3300048926 Bacteria 4144
1447 Ga0496123_0039255 3300048926 Bacteria 3314
1448 Ga0496123_0078797 3300048926 Bacteria 2016
1449 Ga0496124_0000135 3300048927 Bacteria 152458
1450 Ga0496124_0002352 3300048927 Bacteria 24959
1451 Ga0496124_0002908 3300048927 Bacteria 21592
1452 Ga0496124_0005711 3300048927 Bacteria 13865
1453 Ga0496124_0039133 3300048927 Bacteria 4113
1454 Ga0496124_0078730 3300048927 Bacteria 2716
1455 Ga0496124_0105592 3300048927 Bacteria 2275
1456 Ga0496125_0000086 3300048928 Bacteria 216489
1457 Ga0496125_0000209 3300048928 Bacteria 122267
1458 Ga0496125_0001608 3300048928 Bacteria 31895
1459 Ga0496125_0005451 3300048928 Bacteria 14135
1460 Ga0496125_0006238 3300048928 Bacteria 12963
1461 Ga0496125_0012012 3300048928 Bacteria 8623
1462 Ga0496125_0036438 3300048928 Bacteria 4295
1463 Ga0496125_0040583 3300048928 Bacteria 3990
1464 Ga0496125_0080753 3300048928 Bacteria 2487
1465 Ga0496126_0000547 3300048929 Bacteria 72557
1466 Ga0496126_0002060 3300048929 Bacteria 28225
1467 Ga0496126_0007345 3300048929 Bacteria 12101
1468 Ga0496126_0030861 3300048929 Bacteria 5073
1469 Ga0496126_0038893 3300048929 Bacteria 4421
1470 Ga0496126_0053780 3300048929 Bacteria 3651
1471 Ga0496126_0069828 3300048929 Bacteria 3132
1472 Ga0496126_0083544 3300048929 Bacteria 2818
1473 Ga0496126_0118501 3300048929 Bacteria 2298
1474 Ga0496126_0281447 3300048929 Bacteria 1378
1475 Ga0501318_003946 3300049534 Bacteria 1395
1476 Ga0501321_002166 3300049537 Bacteria 1668
1477 Ga0501031_0002231 3300049568 Bacteria 12253
1478 Ga0501031_0005538 3300049568 Bacteria 8221
1479 Ga0501031_0006771 3300049568 Bacteria 7477
1480 Ga0501031_0008520 3300049568 Bacteria 6673
1481 Ga0501031_0028733 3300049568 Bacteria 3625
1482 Ga0501032_0001733 3300049569 Bacteria 17251
1483 Ga0501032_0006740 3300049569 Bacteria 8430
1484 Ga0501032_0007901 3300049569 Bacteria 7744
1485 Ga0501032_0010914 3300049569 Bacteria 6530
1486 Ga0501032_0012689 3300049569 Bacteria 6007
1487 Ga0501032_0015179 3300049569 Bacteria 5439
1488 Ga0501032_0017903 3300049569 Bacteria 4971
1489 Ga0501032_0020302 3300049569 Bacteria 4629
1490 Ga0501032_0038963 3300049569 Bacteria 3234
1491 Ga0501032_0043425 3300049569 Bacteria 3045
1492 Ga0501032_0057119 3300049569 Bacteria 2622
1493 Ga0501032_0123968 3300049569 Bacteria 1707
1494 Ga0501032_0143916 3300049569 Bacteria 1569
1495 Ga0501033_0001533 3300049570 Bacteria 20408
1496 Ga0501033_0006784 3300049570 Bacteria 8937
1497 Ga0501033_0016453 3300049570 Bacteria 5602
1498 Ga0501033_0037448 3300049570 Bacteria 3630
1499 Ga0501033_0047280 3300049570 Bacteria 3199
1500 Ga0501033_0075075 3300049570 Bacteria 2481
1501 Ga0501033_0099379 3300049570 Bacteria 2125
1502 Ga0501033_0163489 3300049570 Bacteria 1601
1503 Ga0501034_0000079 3300049571 Bacteria 171105
1504 Ga0501034_0000910 3300049571 Bacteria 43164
1505 Ga0501034_0004451 3300049571 Bacteria 15576
1506 Ga0501034_0004610 3300049571 Bacteria 15275
1507 Ga0501034_0005584 3300049571 Bacteria 13698
1508 Ga0501034_0007328 3300049571 Bacteria 11752
1509 Ga0501034_0016939 3300049571 Bacteria 7472
1510 Ga0501034_0022103 3300049571 Bacteria 6479
1511 Ga0501034_0024475 3300049571 Bacteria 6142
1512 Ga0501034_0032998 3300049571 Bacteria 5257
1513 Ga0501034_0060038 3300049571 Bacteria 3820
1514 Ga0501034_0062895 3300049571 Bacteria 3726
1515 Ga0501034_0069979 3300049571 Bacteria 3520
1516 Ga0501034_0095490 3300049571 Bacteria 2969
1517 Ga0501034_0130331 3300049571 Bacteria 2498
1518 Ga0501034_0172223 3300049571 Bacteria 2131
1519 Ga0501034_0174071 3300049571 Bacteria 2119
1520 Ga0501034_0278830 3300049571 Bacteria 1611
1521 Ga0501036_0002124 3300049572 Bacteria 15470
1522 Ga0501036_0003126 3300049572 Bacteria 13212
1523 Ga0501036_0010468 3300049572 Bacteria 7662
1524 Ga0501036_0026255 3300049572 Bacteria 4914
1525 Ga0501036_0061367 3300049572 Bacteria 3184
1526 Ga0501036_0065461 3300049572 Bacteria 3076
1527 Ga0501036_0070904 3300049572 Bacteria 2947
1528 Ga0501036_0082954 3300049572 Bacteria 2709
1529 Ga0501036_0084430 3300049572 Bacteria 2684
1530 Ga0501036_0304735 3300049572 Bacteria 1332
1531 Ga0501037_0003940 3300049573 Bacteria 10766
1532 Ga0501037_0005417 3300049573 Bacteria 9292
1533 Ga0501037_0005558 3300049573 Bacteria 9194
1534 Ga0501037_0012804 3300049573 Bacteria 6181
1535 Ga0501037_0013780 3300049573 Bacteria 5958
1536 Ga0501037_0018305 3300049573 Bacteria 5161
1537 Ga0501037_0019639 3300049573 Bacteria 4985
1538 Ga0501037_0056598 3300049573 Bacteria 2863
1539 Ga0501037_0073269 3300049573 Bacteria 2490
1540 Ga0501037_0088732 3300049573 Bacteria 2238
1541 Ga0501037_0119303 3300049573 Bacteria 1897
1542 Ga0501037_0170277 3300049573 Bacteria 1548
1543 Ga0501038_0002793 3300049574 Bacteria 16244
1544 Ga0501038_0009522 3300049574 Bacteria 8913
1545 Ga0501038_0014812 3300049574 Bacteria 7101
1546 Ga0501038_0019259 3300049574 Bacteria 6156
1547 Ga0501038_0019392 3300049574 Bacteria 6132
1548 Ga0501038_0035681 3300049574 Bacteria 4365
1549 Ga0501038_0036093 3300049574 Bacteria 4338
1550 Ga0501038_0038913 3300049574 Bacteria 4162
1551 Ga0501038_0061045 3300049574 Bacteria 3224
1552 Ga0501038_0073378 3300049574 Bacteria 2898
1553 Ga0501038_0075649 3300049574 Bacteria 2846
1554 Ga0501038_0079053 3300049574 Bacteria 2774
1555 Ga0501038_0125533 3300049574 Bacteria 2112
1556 Ga0501039_0001345 3300049575 Bacteria 17992
1557 Ga0501039_0012049 3300049575 Bacteria 6590
1558 Ga0501039_0014554 3300049575 Bacteria 6024
1559 Ga0501039_0134070 3300049575 Bacteria 1944
1560 Ga0501040_0006755 3300049576 Bacteria 7445
1561 Ga0501040_0019206 3300049576 Bacteria 4545
1562 Ga0501041_0000510 3300049577 Bacteria 19990
1563 Ga0501042_0002946 3300049578 Bacteria 10571
1564 Ga0501042_0005797 3300049578 Bacteria 7975
1565 Ga0501042_0006620 3300049578 Bacteria 7540
1566 Ga0501042_0044551 3300049578 Bacteria 3161
1567 Ga0501042_0144041 3300049578 Bacteria 1718
1568 Ga0501043_0002325 3300049579 Bacteria 16099
1569 Ga0501043_0003130 3300049579 Bacteria 13723
1570 Ga0501043_0008228 3300049579 Bacteria 8219
1571 Ga0501043_0008953 3300049579 Bacteria 7878
1572 Ga0501043_0010184 3300049579 Bacteria 7370
1573 Ga0501043_0010272 3300049579 Bacteria 7336
1574 Ga0501043_0015132 3300049579 Bacteria 6036
1575 Ga0501043_0043814 3300049579 Bacteria 3517
1576 Ga0501043_0091786 3300049579 Bacteria 2388
1577 Ga0501043_0119796 3300049579 Bacteria 2064
1578 Ga0501043_0157809 3300049579 Bacteria 1774
1579 Ga0501043_0160239 3300049579 Bacteria 1758
1580 Ga0501046_0004180 3300049580 Bacteria 13143
1581 Ga0501046_0007136 3300049580 Bacteria 9828
1582 Ga0501046_0009635 3300049580 Bacteria 8328
1583 Ga0501046_0016221 3300049580 Bacteria 6244
1584 Ga0501046_0121181 3300049580 Bacteria 1990
1585 Ga0501047_0000005 3300049581 Bacteria 456524
1586 Ga0501047_0003756 3300049581 Bacteria 14301
1587 Ga0501047_0010901 3300049581 Bacteria 8596
1588 Ga0501047_0018642 3300049581 Bacteria 6655
1589 Ga0501047_0021174 3300049581 Bacteria 6244
1590 Ga0501047_0023128 3300049581 Bacteria 5966
1591 Ga0501047_0032440 3300049581 Bacteria 5041
1592 Ga0501047_0050684 3300049581 Bacteria 4009
1593 Ga0501047_0051285 3300049581 Bacteria 3986
1594 Ga0501047_0082245 3300049581 Bacteria 3095
1595 Ga0501047_0239018 3300049581 Bacteria 1667
1596 Ga0501047_0371310 3300049581 Bacteria 1265
1597 Ga0501048_0001322 3300049582 Bacteria 18775
1598 Ga0501048_0004371 3300049582 Bacteria 10759
1599 Ga0501048_0008906 3300049582 Bacteria 7555
1600 Ga0501048_0010033 3300049582 Bacteria 7086
1601 Ga0501048_0101153 3300049582 Bacteria 2033
1602 Ga0501048_0188471 3300049582 Bacteria 1462
1603 Ga0501048_0236991 3300049582 Bacteria 1295
1604 Ga0501067_0001107 3300049583 Bacteria 14551
1605 Ga0501067_0020188 3300049583 Bacteria 3686
1606 Ga0501067_0083786 3300049583 Bacteria 1769
1607 Ga0501068_0004355 3300049584 Bacteria 7696
1608 Ga0501068_0030431 3300049584 Bacteria 3202
1609 Ga0501068_0165979 3300049584 Bacteria 1393
1610 Ga0501069_0042811 3300049585 Bacteria 2506
1611 Ga0501070_0002352 3300049586 Bacteria 16602
1612 Ga0501070_0003420 3300049586 Bacteria 13767
1613 Ga0501070_0009355 3300049586 Bacteria 8287
1614 Ga0501070_0010098 3300049586 Bacteria 7990
1615 Ga0501070_0015896 3300049586 Bacteria 6326
1616 Ga0501070_0018990 3300049586 Bacteria 5765
1617 Ga0501070_0033611 3300049586 Bacteria 4292
1618 Ga0501070_0038905 3300049586 Bacteria 3969
1619 Ga0501070_0039125 3300049586 Bacteria 3956
1620 Ga0501070_0095003 3300049586 Bacteria 2467
1621 Ga0501070_0204631 3300049586 Bacteria 1621
1622 Ga0501070_0236002 3300049586 Bacteria 1498
1623 Ga0501071_0001275 3300049587 Bacteria 14303
1624 Ga0501071_0002509 3300049587 Bacteria 11169
1625 Ga0501071_0061566 3300049587 Bacteria 2718
1626 Ga0501072_0033937 3300049588 Bacteria 3998
1627 Ga0501072_0104825 3300049588 Bacteria 2248
1628 Ga0501073_0000030 3300049589 Bacteria 115949
1629 Ga0501073_0113310 3300049589 Bacteria 1881
1630 Ga0501074_0004495 3300049590 Bacteria 9984
1631 Ga0501074_0008723 3300049590 Bacteria 7349
1632 Ga0501074_0089288 3300049590 Bacteria 2207
1633 Ga0501075_0008628 3300049591 Bacteria 7105
1634 Ga0501076_0049185 3300049592 Bacteria 3333
1635 Ga0501076_0175451 3300049592 Bacteria 1747
1636 Ga0501077_0021191 3300049593 Bacteria 4113
1637 Ga0501077_0036848 3300049593 Bacteria 3116
1638 Ga0501079_0001632 3300049741 Bacteria 15976
1639 Ga0501079_0025872 3300049741 Bacteria 4501
1640 Ga0501080_0000023 3300049742 Bacteria 90345
1641 Ga0501080_0042141 3300049742 Bacteria 4252
1642 Ga0501080_0056997 3300049742 Bacteria 3638
1643 Ga0501080_0064971 3300049742 Bacteria 3394
1644 Ga0501080_0071502 3300049742 Bacteria 3227
1645 Ga0501080_0093219 3300049742 Bacteria 2797
1646 Ga0501080_0273742 3300049742 Bacteria 1536
1647 Ga0501081_0012816 3300049743 Bacteria 5513
1648 Ga0501083_0000059 3300049744 Bacteria 78374
1649 Ga0501083_0004256 3300049744 Bacteria 10074
1650 Ga0501083_0004565 3300049744 Bacteria 9779
1651 Ga0501083_0031451 3300049744 Bacteria 3643
1652 Ga0501083_0315342 3300049744 Bacteria 1017
1653 Ga0501279_006874 3300049775 Bacteria 1506
1654 Ga0501035_0002846 3300049822 Bacteria 16722
1655 Ga0501035_0006735 3300049822 Bacteria 10739
1656 Ga0501035_0007884 3300049822 Bacteria 9947
1657 Ga0501035_0008420 3300049822 Bacteria 9603
1658 Ga0501035_0013293 3300049822 Bacteria 7595
1659 Ga0501035_0015593 3300049822 Bacteria 7011
1660 Ga0501035_0017656 3300049822 Bacteria 6581
1661 Ga0501035_0017981 3300049822 Bacteria 6519
1662 Ga0501035_0024286 3300049822 Bacteria 5559
1663 Ga0501035_0029166 3300049822 Bacteria 5032
1664 Ga0501035_0031513 3300049822 Bacteria 4827
1665 Ga0501035_0050317 3300049822 Bacteria 3734
1666 Ga0501044_0003414 3300049823 Bacteria 17900
1667 Ga0501044_0010052 3300049823 Bacteria 10282
1668 Ga0501044_0012278 3300049823 Bacteria 9273
1669 Ga0501044_0013325 3300049823 Bacteria 8898
1670 Ga0501044_0015296 3300049823 Bacteria 8263
1671 Ga0501044_0015324 3300049823 Bacteria 8256
1672 Ga0501044_0033710 3300049823 Bacteria 5377
1673 Ga0501044_0088361 3300049823 Bacteria 3128
1674 Ga0501044_0104368 3300049823 Bacteria 2848
1675 Ga0501044_0167162 3300049823 Bacteria 2173
1676 Ga0501044_0175285 3300049823 Bacteria 2113
1677 Ga0501044_0230097 3300049823 Bacteria 1801
1678 Ga0501045_0047819 3300049824 Bacteria 3116
1679 Ga0501045_0100124 3300049824 Bacteria 2145
1680 nmdc:mga00v17_10676_c1 3300050491 Bacteria 5025
1681 nmdc:mga0yw44_109474_c1 3300050492 Bacteria 1769
1682 nmdc:mga0yw44_16446_c1 3300050492 Bacteria 3996
1683 nmdc:mga0yw44_7068_c1 3300050492 Bacteria 5494
1684 nmdc:mga06z11_29345_c1 3300050494 Bacteria 2649
1685 nmdc:mga05p37_408632_c1 3300050507 Bacteria 1583
1686 nmdc:mga05p37_9690_c1 3300050507 Bacteria 11418
1687 nmdc:mga05p37_9984_c1 3300050507 Bacteria 11274
1688 nmdc:mga09592_110175_c1 3300050508 Bacteria 2362
1689 nmdc:mga09592_97806_c1 3300050508 Bacteria 2512
1690 nmdc:mga0qj67_176290_c1 3300050509 Bacteria 1736
1691 nmdc:mga06r32_202_c5 3300050510 Bacteria 10484
1692 nmdc:mga08y16_116201_c1 3300050511 Bacteria 2785
1693 nmdc:mga08y16_14541_c1 3300050511 Bacteria 8278
1694 nmdc:mga08y16_24871_c1 3300050511 Bacteria 6317
1695 nmdc:mga08y16_47659_c1 3300050511 Bacteria 4485
1696 nmdc:mga0n895_12260_c1 3300050512 Bacteria 7684
1697 nmdc:mga0n895_27126_c1 3300050512 Bacteria 5438
1698 nmdc:mga0n895_313887_c1 3300050512 Bacteria 1589
1699 nmdc:mga0n895_64173_c1 3300050512 Bacteria 3633
1700 nmdc:mga0rr50_128236_c1 3300050513 Bacteria 2028
1701 nmdc:mga0rr50_3162_c1 3300050513 Bacteria 9412
1702 nmdc:mga0rr50_4142_c2 3300050513 Bacteria 4312
1703 nmdc:mga0rr50_95002_c1 3300050513 Bacteria 2329
1704 nmdc:mga08x19_33654_c1 3300050514 Bacteria 3235
1705 nmdc:mga08x19_34607_c1 3300050514 Bacteria 3194
1706 nmdc:mga0a205_3224_c1 3300050515 Bacteria 14510
1707 nmdc:mga0sz30_11075_c1 3300050516 Bacteria 3470
1708 Ga0495601_0013029 3300053077 Bacteria 4996
1709 Ga0495601_0015770 3300053077 Bacteria 4572
1710 Ga0495601_0030603 3300053077 Bacteria 3342
1711 Ga0495601_0032437 3300053077 Bacteria 3252
1712 Ga0495612_0001130 3300053078 Bacteria 10953
1713 Ga0495612_0010468 3300053078 Bacteria 3750
1714 Ga0495612_0010525 3300053078 Bacteria 3739
1715 Ga0495612_0024452 3300053078 Bacteria 2425
1716 Ga0495612_0045980 3300053078 Bacteria 1787
1717 Ga0495612_0060823 3300053078 Bacteria 1564
1718 Ga0500635_0000664 3300053080 Bacteria 8729
1719 Ga0495595_0001495 3300053084 Bacteria 9132
1720 Ga0495595_0020681 3300053084 Bacteria 2866
1721 Ga0495595_0036502 3300053084 Bacteria 2230
1722 Ga0495619_0010408 3300053085 Bacteria 5853
1723 Ga0495619_0021908 3300053085 Bacteria 4084
1724 Ga0495619_0083432 3300053085 Bacteria 2155
1725 Ga0495619_0132743 3300053085 Bacteria 1712
1726 Ga0500578_0014632 3300053086 Bacteria 5044
1727 Ga0500643_000191 3300053087 Bacteria 58540
1728 Ga0500583_0103117 3300053092 Bacteria 1399
1729 Ga0500651_0003063 3300053093 Bacteria 9045
1730 Ga0500640_001744 3300053095 Bacteria 6801
1731 Ga0500641_0056548 3300053096 Bacteria 1626
1732 Ga0500556_0000115 3300053104 Bacteria 69837
1733 Ga0500556_0000426 3300053104 Bacteria 30343
1734 Ga0500560_009842 3300053107 Bacteria 2367
1735 Ga0500560_012532 3300053107 Bacteria 2201
1736 Ga0500562_000183 3300053108 Bacteria 16987
1737 Ga0500593_001772 3300053117 Bacteria 7763
1738 Ga0500658_0004371 3300053134 Bacteria 5294
1739 Ga0500559_0000050 3300053136 Bacteria 93262
1740 Ga0500559_0000800 3300053136 Bacteria 20562
1741 Ga0500559_0042277 3300053136 Bacteria 1988
1742 Ga0500568_0000038 3300053139 Bacteria 134267
1743 Ga0500568_0000117 3300053139 Bacteria 71510
1744 Ga0500568_0001933 3300053139 Bacteria 12699
1745 Ga0500568_0007501 3300053139 Bacteria 5345
1746 Ga0500568_0013939 3300053139 Bacteria 3648
1747 Ga0500573_0000014 3300053140 Bacteria 193353
1748 Ga0500573_0006418 3300053140 Bacteria 6366
1749 Ga0500573_0013932 3300053140 Bacteria 4542
1750 Ga0500573_0014968 3300053140 Bacteria 4392
1751 Ga0500577_0004479 3300053142 Bacteria 3697
1752 Ga0500577_0016903 3300053142 Bacteria 2311
1753 Ga0500577_0020950 3300053142 Bacteria 2148
1754 Ga0500590_013523 3300053148 Bacteria 4191
1755 Ga0500616_0000027 3300053153 Bacteria 441053
1756 Ga0500616_0000117 3300053153 Bacteria 145655
1757 Ga0500616_0000620 3300053153 Bacteria 43119
1758 Ga0500616_0011539 3300053153 Bacteria 5210
1759 Ga0500616_0061798 3300053153 Bacteria 1937
1760 Ga0500620_000082 3300053155 Bacteria 18227
1761 Ga0500624_002275 3300053157 Bacteria 2632
1762 Ga0500634_0003371 3300053161 Bacteria 7073
1763 Ga0501084_0011942 3300054114 Bacteria 7191
1764 Ga0501084_0042709 3300054114 Bacteria 3792
1765 Ga0590075_003544 3300059424 Bacteria 3706
1766 Ga0587072_000110 3300059643 Bacteria 6592
1767 Ga0501082_0011737 3300060353 Bacteria 7531
1768 Ga0501082_0021746 3300060353 Bacteria 5530
1769 Ga0501082_0024215 3300060353 Bacteria 5235
1770 Ga0501082_0053825 3300060353 Bacteria 3469
1771 Ga0466962_0001145 3300061719 Bacteria 12247
1772 Ga0466962_0001217 3300061719 Bacteria 11836
1773 Ga0466962_0005385 3300061719 Bacteria 6156
1774 Ga0466962_0012085 3300061719 Bacteria 4152
1775 Ga0466962_0057982 3300061719 Bacteria 1849
1776 Ga0530510_0002078 3300061734 Bacteria 13753
1777 Ga0530510_0113870 3300061734 Bacteria 1982
1778 Ga0530510_0142274 3300061734 Bacteria 1768
1779 2523384565 2523231044 Bacteria 6434991
1780 2537898248 2537561592 Bacteria 4348607
1781 2552105984 2551306166 Bacteria 9731570
1782 2554256717 2554235005 Bacteria 6457341
1783 2555228741 2554235227 Bacteria 3637389
1784 2585295996 2582581312 Bacteria 7308206
1785 2585306288 2582581313 Bacteria 10042643
1786 2585320272 2582581314 Bacteria 11452267
1787 2588106927 2585428157 Bacteria 3018951
1788 2616696701 2616644814 Bacteria 11555299
1789 2616903179 2616644941 Bacteria 8510691
1790 2643734866 2643221542 Bacteria 3563959
1791 2643753782 2643221546 Bacteria 2910897
1792 2643764695 2643221548 Bacteria 8053412
1793 2643768564 2643221549 Bacteria 4042819
1794 2643783527 2643221553 Bacteria 3544260
1795 2643847848 2643221566 Bacteria 3460379
1796 2643852653 2643221567 Bacteria 4163945
1797 2643888218 2643221575 Bacteria 4022601
1798 2643903027 2643221578 Bacteria 9213798
1799 2643941919 2643221587 Bacteria 7586415
1800 2643994890 2643221597 Bacteria 3347721
1801 2644082324 2643221613 Bacteria 4622396
1802 2644111941 2643221619 Bacteria 4158469
1803 2644135161 2643221624 Bacteria 4384879
1804 2644173026 2643221630 Bacteria 3601215
1805 2644175828 2643221631 Bacteria 8168043
1806 2644182446 2643221632 Bacteria 3406696
1807 2644197898 2643221635 Bacteria 2632343
1808 2644261510 2643221647 Bacteria 10741251
1809 2644277737 2643221649 Bacteria 3867359
1810 2644389541 2643221670 Bacteria 6497041
1811 2644404463 2643221673 Bacteria 9196637
1812 2644429002 2643221677 Bacteria 7584031
1813 2644439410 2643221678 Bacteria 9540101
1814 2644445480 2643221679 Bacteria 3839507
1815 2644462080 2643221682 Bacteria 6743283
1816 2644502903 2643221690 Bacteria 4654705
1817 2644515240 2643221692 Bacteria 7282860
1818 2644525268 2643221694 Bacteria 4392972
1819 2644610808 2643221711 Bacteria 4865335
1820 2644667053 2643221721 Bacteria 4486924
1821 2644669353 2643221722 Bacteria 4247614
1822 2644679225 2643221724 Bacteria 3593515
1823 2655033208 2654587600 Bacteria 3911798
1824 2676494524 2675903060 Bacteria 10051191
1825 2691514725 2690315906 Bacteria 4517044
1826 2723643100 2721755702 Bacteria 4373124
1827 2729906622 2728369276 Bacteria 5610032
1828 2730228728 2728369380 Bacteria 3620317
1829 2731908986 2731639228 Bacteria 4187555
1830 2738693731 2738541272 Bacteria 6848551
1831 2739328110 2738543027 Bacteria 6409078
1832 2739602919 2739367653 Bacteria 2780952
1833 2739607439 2739367654 Bacteria 6049412
1834 2747953169 2747842429 Bacteria 3914386
1835 2753037991 2751185725 Bacteria 5740550
1836 2753303633 2751185788 Bacteria 4541048
1837 2753325859 2751185792 Bacteria 5739090
1838 2758224676 2757320536 Bacteria 3629334
1839 2760304659 2758568522 Bacteria 5953541
1840 2760621530 2758568621 Bacteria 5967089
1841 2768643577 2767802112 Bacteria 6465194
1842 2774378827 2773857758 Bacteria 3592392
1843 2774383431 2773857759 Bacteria 2963774
1844 2774400613 2773857763 Bacteria 4180068
1845 2775654939 2775506735 Bacteria 4556596
1846 2784472905 2784132109 Bacteria 3141763
1847 2784589814 2784132148 Bacteria 8627943
1848 2785341790 2784746763 Bacteria 9783172
1849 2785370856 2784746768 Bacteria 10036182
1850 2786672035 2786546132 Bacteria 10419719
1851 2793981347 2791355406 Bacteria 11364898
1852 2804845461 2802429296 Bacteria 7227771
1853 2808628693 2808606306 Bacteria 3608896
1854 2808827838 2808606357 Bacteria 4466944
1855 2808843413 2808606359 Bacteria 9866990
1856 2808853190 2808606360 Bacteria 4404006
1857 2808875457 2808606365 Bacteria 4301966
1858 2808878308 2808606366 Bacteria 4415912
1859 2808884818 2808606368 Bacteria 3174172
1860 2808892081 2808606370 Bacteria 4942454
1861 2808897186 2808606371 Bacteria 4251511
1862 2808912998 2808606375 Bacteria 9466072
1863 2809026317 2808606394 Bacteria 6248540
1864 2809226524 2808606447 Bacteria 3572005
1865 2809233483 2808606448 Bacteria 8656184
1866 2810364339 2808606700 Bacteria 3482157
1867 2811845029 2808606982 Bacteria 7791042
1868 2812320401 2811994871 Bacteria 4497550
1869 2812322197 2811994872 Bacteria 4121241
1870 2812356628 2811994879 Bacteria 9313447
1871 2812364422 2811994880 Bacteria 4147780
1872 2812375766 2811994882 Bacteria 4688362
1873 2812479336 2811994917 Bacteria 7761064
1874 2816505500 2816332139 Bacteria 9138787
1875 2817508571 2816332305 Bacteria 2697803
1876 2819424663 2818991318 Bacteria 5266538
1877 2819667002 2818991458 Bacteria 4794049
1878 2819690356 2818991462 Bacteria 4320267
1879 2819695159 2818991463 Bacteria 7948711
1880 2819728382 2818991469 Bacteria 4644110
1881 2819742314 2818991472 Bacteria 10089953
1882 2821269128 2821268502 Bacteria 3750023
1883 2833710011 2833709550 Bacteria 4008291
1884 2835189079 2835188231 Bacteria 3476928
1885 2839989113 2839986021 Bacteria 3685650
1886 2844843321 2844841374 Bacteria 3917147
1887 2844849700 2844849076 Bacteria 4091819
1888 2844854372 2844852863 Bacteria 3849151
1889 2848551703 2848551377 Bacteria 3720646
1890 2852632770 2852632344 Bacteria 3463163
1891 2852642776 2852635781 Bacteria 8251373
1892 2852644397 2852643534 Bacteria 3013378
1893 2852646538 2852646457 Bacteria 3408613
1894 2852665830 2852663356 Bacteria 4090475
1895 2856746564 2856741275 Bacteria 8096094
1896 2857480484 2857479173 Bacteria 2469263
1897 2857633705 2857632687 Bacteria 2448521
1898 2857712593 2857710386 Bacteria 3186771
1899 2857722181 2857720070 Bacteria 3189373
1900 2857724667 2857723135 Bacteria 4217853
1901 2857729262 2857727296 Bacteria 2745552
1902 2857730614 2857729791 Bacteria 4040535
1903 2857734492 2857733635 Bacteria 3532004
1904 2857739751 2857737099 Bacteria 3104305
1905 2857741167 2857740372 Bacteria 4782044
1906 2862185244 2862178590 Bacteria 8583590
1907 2862287082 2862281513 Bacteria 9621493
1908 2862292054 2862290372 Bacteria 7471434
1909 2862385302 2862382967 Bacteria 10317375
1910 2862511968 2862507626 Bacteria 9425308
1911 2862578110 2862574272 Bacteria 10567477
1912 2862709676 2862705112 Bacteria 6563286
1913 2863411483 2863404153 Bacteria 9672205
1914 2867349841 2867346516 Bacteria 7608576
1915 2867373302 2867369537 Bacteria 6501581
1916 2867434122 2867428634 Bacteria 9590268
1917 2867478680 2867475112 Bacteria 6909112
1918 2870622239 2870622029 Bacteria 3643329
1919 2870629522 2870628048 Bacteria 3696012
1920 2870801986 2870801768 Bacteria 2710986
1921 2870806376 2870804320 Bacteria 2552467
1922 2873154636 2873151551 Bacteria 8625867
1923 2873322080 2873314349 Bacteria 8512634
1924 2875396116 2875391855 Bacteria 7600475
1925 2877679721 2877676314 Bacteria 9512378
1926 2884694879 2884693830 Bacteria 11273186
1927 2884996381 2884994152 Bacteria 4492978
1928 2887447131 2887443736 Bacteria 4426037
1929 2891331433 2891326441 Bacteria 6439512
1930 2891401853 2891395885 Bacteria 9251614
1931 2891560593 2891554331 Bacteria 8812224
1932 2891566160 2891562705 Bacteria 8039471
1933 2893685140 2893684298 Bacteria 2897960
1934 2895432642 2895427314 Bacteria 13147766
1935 2895446426 2895442618 Bacteria 11027144
1936 2904432440 2904430863 Bacteria 3486923
1937 2904500400 2904497146 Bacteria 4731781
1938 2904501765 2904501621 Bacteria 3401437
1939 2904510287 2904509784 Bacteria 3520416
1940 2904776799 2904776348 Bacteria 4658726
1941 2905927870 2905926851 Bacteria 4423176
1942 2906801637 2906799679 Bacteria 4031749
1943 2908676181 2908674828 Bacteria 3382763
1944 2908678498 2908678064 Bacteria 3482747
1945 2909077060 2909074476 Bacteria 3436050
1946 2910810674 2910809715 Bacteria 4982797
1947 2912718358 2912715099 Bacteria 9460473
1948 2912730710 2912723979 Bacteria 8557534
1949 2912762198 2912757875 Bacteria 7940295
1950 2915359603 2915358134 Bacteria 6050864
1951 2918505904 2918501144 Bacteria 8668083
1952 2919036344 2919034639 Bacteria 4763403
1953 2919041800 2919039151 Bacteria 3391018
1954 2919043240 2919042368 Bacteria 3905917
1955 2919054468 2919051321 Bacteria 4210889
1956 2919058802 2919055335 Bacteria 3875751
1957 2919059646 2919059106 Bacteria 4991624
1958 2919070819 2919069694 Bacteria 3622919
1959 2919391597 2919391150 Bacteria 4884741
1960 2919397768 2919395869 Bacteria 3704152
1961 2919445606 2919443155 Bacteria 4072969
1962 2919447880 2919446982 Bacteria 3994487
1963 2919470311 2919468124 Bacteria 9133025
1964 2919525379 2919523602 Bacteria 3788128
1965 2919540794 2919538618 Bacteria 4677069
1966 2920882720 2920879853 Bacteria 4216831
1967 2928090944 2928090899 Bacteria 3158267
1968 2928105537 2928104781 Bacteria 3877447
1969 2928121418 2928121344 Bacteria 3972376
1970 2928153459 2928153084 Bacteria 4020257
1971 2928500943 2928500415 Bacteria 3384541
1972 2932426928 2932426870 Bacteria 4547726
1973 2932432256 2932431166 Bacteria 4215299
1974 2933419565 2933418574 Bacteria 4476724
1975 2935395278 2935390628 Bacteria 7043367
1976 2935412172 2935409751 Bacteria 4179611
1977 2935893553 2935890801 Bacteria 4593001
1978 2939598807 2939598168 Bacteria 4687164
1979 2939650045 2939647034 Bacteria 4681660
1980 2939677490 2939674588 Bacteria 4844420
1981 2945918156 2945916053 Bacteria 4555517
1982 2945921554 2945920336 Bacteria 4501603
1983 2945942223 2945941187 Bacteria 4682474
1984 2945960001 2945956166 Bacteria 5110334
1985 2945970886 2945968032 Bacteria 4111363
1986 2946005488 2946003308 Bacteria 3857229
1987 2946026599 2946024296 Bacteria 3508095
1988 2946034682 2946033335 Bacteria 3835514
1989 2946038203 2946037020 Bacteria 4900426
1990 2946043203 2946041624 Bacteria 4191385
1991 2946048504 2946045630 Bacteria 8527308
1992 2946062002 2946059875 Bacteria 4386623
1993 2946069240 2946064051 Bacteria 8957905
1994 2946077189 2946072368 Bacteria 8999607
1995 2946081800 2946080515 Bacteria 4310960
1996 2947227685 2947224130 Bacteria 9938529
1997 2953999481 2953998280 Bacteria 4812144
1998 2954004828 2954002825 Bacteria 9173742
1999 2954384633 2954380949 Bacteria 10050426
2000 2954678307 2954673503 Bacteria 9685905
2001 2954685850 2954682443 Bacteria 9862841
2002 2954695489 2954691527 Bacteria 10720516
2003 2954710682 2954701450 Bacteria 10834262
2004 2954714920 2954711539 Bacteria 10867210
2005 2954724863 2954721474 Bacteria 10456478
2006 2954736955 2954731030 Bacteria 10243860
2007 2954743789 2954740390 Bacteria 10229294
2008 2954755805 2954749733 Bacteria 10366972
2009 2954762741 2954759201 Bacteria 9358192
2010 2956941033 2956939328 Bacteria 3474458
2011 2964328524 2964326757 Bacteria 3290868
2012 2966601376 2966598605 Bacteria 7676064
2013 2966926590 2966924647 Bacteria 3268643
2014 2974298324 2974294766 Bacteria 3767688
2015 2974306186 2974302888 Bacteria 4369871
2016 2974325447 2974324384 Bacteria 3750535
2017 2977230392 2977228692 Bacteria 3450105
2018 2977239195 2977236895 Bacteria 3569373
2019 2977252073 2977251589 Bacteria 2952848
2020 2977265623 2977264416 Bacteria 3750737
2021 2984543021 2984542743 Bacteria 3569378
2022 2984551932 2984551494 Bacteria 3877562
2023 2984582301 2984580707 Bacteria 3351387
2024 2990044890 2990044586 Bacteria 6603797
2025 2990060988 2990059506 Bacteria 9321252
2026 2990093261 2990088156 Bacteria 6657676
2027 2995728402 2995726249 Bacteria 3470435
2028 2997458291 2997451912 Bacteria 8492419
2029 2997601414 2997600082 Bacteria 9896405
2030 3001120725 3001119090 Bacteria 3449530
2031 3001892153 3001889506 Bacteria 2975194
2032 3006326633 3006321560 Bacteria 8247479
2033 3006397840 3006393351 Bacteria 6615579
2034 3006429828 3006425503 Bacteria 6491253
2035 3006493413 3006486233 Bacteria 8157040
2036 3006498897 3006493962 Bacteria 8825450
2037 8002811619 8002811521 Bacteria 2942897
2038 8004021608 8004021418 Bacteria 4313954
2039 8004027974 8004025490 Bacteria 4327753
2040 8004183588 8004182704 Bacteria 3391155
2041 8004213407 8004212874 Bacteria 2861420
2042 8008490555 8008485437 Bacteria 7198341
2043 8008566634 8008558824 Bacteria 10610750
2044 8008577735 8008574985 Bacteria 7815457
2045 8016254998 8016254467 Bacteria 3797036
2046 8023627007 8023623736 Bacteria 8593882
2047 8025417166 8025413630 Bacteria 7014048
2048 8025479533 8025478263 Bacteria 8209203
2049 8025529857 8025524527 Bacteria 7197316
2050 8025532243 8025530807 Bacteria 8495698
2051 8033687274 8033684223 Bacteria 6906479
2052 8045832305 8045830549 Bacteria 4444727
2053 8047896896 8047893842 Bacteria 11723082
2054 8048362054 8048356638 Bacteria 11044339
2055 8048373881 8048369669 Bacteria 11666822
2056 8048384347 8048379754 Bacteria 11877923
2057 8048413751 8048406513 Bacteria 8936924
2058 8054108427 8054107350 Bacteria 5022511
2059 8054164200 8054160619 Bacteria 7783213
2060 8054475838 8054472261 Bacteria 7464355
2061 8055035349 8055034563 Bacteria 3562128
2062 8055038962 8055037949 Bacteria 3337834
2063 8055073949 8055066027 Bacteria 9479577
2064 8055179018 8055172936 Bacteria 9305943
2065 8056039332 8056037122 Bacteria 3854319
2066 8056063837 8056060235 Bacteria 7259403
2067 8056448512 8056447290 Bacteria 7680491
2068 8056583246 8056579771 Bacteria 5840325
2069 8056672849 8056667051 Bacteria 6953971
2070 8056837541 8056829672 Bacteria 9045328
2071 8057347458 8057345674 Bacteria 4160394
2072 Ga0105244_10000735
2073 LJQas_1000257
2074 LJQas_1000741
2075 JGI25154J39366_1003355
2076 JGI25152J39213_1000399
2077 JGI25406J46586_10001751
2078 JGI25160J50197_1014988
2079 Ga0006562J51391_1013439
2080 Ga0006562J51391_1013440
2081 Ga0006562J51391_1025688
2082 Ga0006562J51391_1025689
2083 Ga0006562J51391_1098594
2084 Ga0006562J51391_1098595
2085 Ga0055539_1000005
2086 Ga0055533_1000001
2087 Ga0055527_1000017
2088 Ga0055542_1000044
2089 Ga0055529_1000279
2090 Ga0055541_1008325
2091 Ga0065714_10104412
2092 Ga0070658_10000266
2093 Ga0070658_10013342
2094 Ga0070658_10031946
2095 Ga0070658_10035794
2096 Ga0070658_10043257
2097 Ga0070658_10219665
2098 Ga0070676_10045831
2099 Ga0070683_100019688
2100 Ga0070683_100048077
2101 Ga0070683_100058043
2102 Ga0070683_100225127
2103 Ga0070683_100257981
2104 Ga0070683_100323958
2105 Ga0070690_100059023
2106 Ga0068869_100099715
2107 Ga0070680_100000604
2108 Ga0070680_100040663
2109 Ga0070682_100100331
2110 Ga0070682_100142635
2111 Ga0070682_100195328
2112 Ga0068868_100022267
2113 Ga0070660_100081123
2114 Ga0070689_100095806
2115 Ga0070691_10120944
2116 Ga0070687_100056394
2117 Ga0070692_10019702
2118 Ga0070692_10052038
2119 Ga0070692_10076527
2120 Ga0070668_100088728
2121 Ga0070668_100215082
2122 Ga0070669_100022755
2123 Ga0070675_100005971
2124 Ga0070675_100032384
2125 Ga0070674_100019987
2126 Ga0070674_100078162
2127 Ga0070673_100038887
2128 Ga0070673_100058206
2129 Ga0070673_100171762
2130 Ga0070659_100053135
2131 Ga0070667_100021591
2132 Ga0070709_10000118
2133 Ga0070709_10003048
2134 Ga0070709_10004402
2135 Ga0070709_10036494
2136 Ga0070714_100001466
2137 Ga0070714_100005802
2138 Ga0070714_100030612
2139 Ga0070714_100066156
2140 Ga0070714_100073929
2141 Ga0070714_100085074
2142 Ga0070713_100001299
2143 Ga0070713_100015416
2144 Ga0070713_100018101
2145 Ga0070713_100026407
2146 Ga0070710_10000216
2147 Ga0070710_10000381
2148 Ga0070710_10001064
2149 Ga0070710_10024900
2150 Ga0070710_10054249
2151 Ga0070710_10075637
2152 Ga0070710_10113558
2153 Ga0070711_100000774
2154 Ga0070711_100001507
2155 Ga0070711_100011359
2156 Ga0070711_100052982
2157 Ga0070705_100027550
2158 Ga0070705_100143311
2159 Ga0070700_100018526
2160 Ga0070708_100042482
2161 Ga0070708_100114211
2162 Ga0070708_100282487
2163 Ga0070663_100165035
2164 Ga0070678_100059360
2165 Ga0070678_100082055
2166 Ga0070678_100216134
2167 Ga0070681_10037371
2168 Ga0070681_10076072
2169 Ga0070681_10113295
2170 Ga0070681_10314051
2171 Ga0068867_100277951
2172 Ga0070685_10017980
2173 Ga0070706_100002453
2174 Ga0070706_100007246
2175 Ga0070706_100013652
2176 Ga0070706_100019132
2177 Ga0070706_100029833
2178 Ga0070706_100030981
2179 Ga0070706_100048810
2180 Ga0070706_100238770
2181 Ga0070707_100000878
2182 Ga0070707_100016295
2183 Ga0070707_100017111
2184 Ga0070707_100027135
2185 Ga0070707_100043198
2186 Ga0070707_100063769
2187 Ga0070707_100120942
2188 Ga0070698_100000621
2189 Ga0070698_100001092
2190 Ga0070698_100017339
2191 Ga0070698_100017533
2192 Ga0070698_100018948
2193 Ga0070698_100029366
2194 Ga0070698_100035507
2195 Ga0070698_100132843
2196 Ga0070699_100298178
2197 Ga0070679_100054351
2198 Ga0070679_100105416
2199 Ga0070679_100127582
2200 Ga0070679_100140904
2201 Ga0070679_100184734
2202 Ga0070684_100029632
2203 Ga0070684_100122242
2204 Ga0070684_100274891
2205 Ga0070697_100025290
2206 Ga0070697_100045569
2207 Ga0068853_100074526
2208 Ga0068853_100185674
2209 Ga0068853_100258327
2210 Ga0070672_100013432
2211 Ga0070672_100015790
2212 Ga0070672_100021208
2213 Ga0070686_100164925
2214 Ga0070695_100058153
2215 Ga0070696_100048404
2216 Ga0070693_100032957
2217 Ga0070665_100006265
2218 Ga0070665_100178198
2219 Ga0070665_100215114
2220 Ga0070704_100145513
2221 Ga0068855_100022690
2222 Ga0068855_100043681
2223 Ga0068855_100119766
2224 Ga0068855_100177890
2225 Ga0070664_100076214
2226 Ga0068857_100050157
2227 Ga0068857_100204484
2228 Ga0068854_100051107
2229 Ga0068856_100091894
2230 Ga0068856_100103109
2231 Ga0068856_100115037
2232 Ga0068856_100288139
2233 Ga0068856_100329509
2234 Ga0068856_100368358
2235 Ga0070702_100000716
2236 Ga0070702_100046300
2237 Ga0070702_100077702
2238 Ga0068852_100012452
2239 Ga0068852_100063039
2240 Ga0068852_100188837
2241 Ga0068852_100201339
2242 Ga0068859_100078111
2243 Ga0068859_100106112
2244 Ga0068864_100037398
2245 Ga0068866_10129595
2246 Ga0068861_100025788
2247 Ga0068861_100173790
2248 Ga0068851_10000022
2249 Ga0068870_10043557
2250 Ga0068870_10092007
2251 Ga0068863_100000912
2252 Ga0068863_100027376
2253 Ga0068863_100121426
2254 Ga0068863_100188176
2255 Ga0068863_100413521
2256 Ga0068858_100000016
2257 Ga0068858_100090777
2258 Ga0068858_100183277
2259 Ga0068860_100022448
2260 Ga0068860_100240062
2261 Ga0081540_1001352
2262 Ga0081540_1002515
2263 Ga0081540_1002903
2264 Ga0081539_10001393
2265 Ga0081539_10019489
2266 Ga0070717_10000504
2267 Ga0070717_10055270
2268 Ga0070717_10058992
2269 Ga0070717_10112192
2270 Ga0070717_10120794
2271 Ga0070717_10140625
2272 Ga0070717_10191812
2273 Ga0070717_10210671
2274 Ga0075365_10017542
2275 Ga0075365_10022365
2276 Ga0075365_10046434
2277 Ga0075432_10000249
2278 Ga0075432_10001177
2279 Ga0075432_10023188
2280 Ga0075432_10039010
2281 Ga0070715_10003999
2282 Ga0070715_10008469
2283 Ga0070715_10086227
2284 Ga0070716_100039444
2285 Ga0070716_100068368
2286 Ga0070712_100006228
2287 Ga0070712_100009230
2288 Ga0070712_100049554
2289 Ga0070712_100060346
2290 Ga0070712_100135383
2291 Ga0075367_10025051
2292 Ga0075428_100023989
2293 Ga0075428_100106170
2294 Ga0075430_100190988
2295 Ga0075431_100005919
2296 Ga0075433_10000652
2297 Ga0075433_10001827
2298 Ga0075433_10007398
2299 Ga0075433_10028029
2300 Ga0075434_100000181
2301 Ga0075434_100018396
2302 Ga0075434_100038538
2303 Ga0075434_100060076
2304 Ga0075429_100038385
2305 Ga0075429_100038598
2306 Ga0075436_100010867
2307 Ga0075436_100047311
2308 Ga0075436_100132048
2309 Ga0097620_100078109
2310 Ga0097620_100106127
2311 Ga0075435_100068135
2312 Ga0075435_100108572
2313 Ga0105251_10004563
2314 Ga0105251_10006598
2315 Ga0105251_10011880
2316 Ga0105240_10155493
2317 Ga0111539_10000095
2318 Ga0111539_10010369
2319 Ga0111539_10165704
2320 Ga0105245_10013491
2321 Ga0105245_10036186
2322 Ga0105245_10039281
2323 Ga0105245_10144385
2324 Ga0105245_10202729
2325 Ga0105245_10319187
2326 Ga0105247_10070656
2327 Ga0114129_10008769
2328 Ga0114129_10014475
2329 Ga0114129_10027431
2330 Ga0114129_10053520
2331 Ga0114129_10280963
2332 Ga0105243_10149832
2333 Ga0105243_10228885
2334 Ga0105243_10332041
2335 Ga0105243_10335691
2336 Ga0105241_10004447
2337 Ga0105242_10010462
2338 Ga0105242_10020736
2339 Ga0105242_10033389
2340 Ga0105242_10113127
2341 Ga0105242_10251589
2342 Ga0105242_10274188
2343 Ga0105248_10000880
2344 Ga0105248_10091708
2345 Ga0105248_10173957
2346 Ga0105248_10246363
2347 Ga0105237_10006728
2348 Ga0105237_10064474
2349 Ga0105237_10166341
2350 Ga0105238_10002053
2351 Ga0105249_10065057
2352 Ga0105249_10109470
2353 Ga0105249_10152986
2354 Ga0105249_10175164
2355 Ga0105032_100683
2356 Ga0105033_101458
2357 Ga0105239_10112904
2358 Ga0105246_10000474
2359 Ga0105246_10030002
2360 Ga0157344_1000433
2361 Ga0157373_10091086
2362 Ga0157371_10071463
2363 Ga0157370_10001462
2364 Ga0157370_10161321
2365 Ga0157370_10171889
2366 Ga0157369_10028346
2367 Ga0157369_10031501
2368 Ga0157369_10050500
2369 Ga0157369_10054453
2370 Ga0157369_10064247
2371 Ga0157369_10077143
2372 Ga0157369_10088646
2373 Ga0157369_10282236
2374 Ga0171462_1001
2375 Ga0157374_10024151
2376 Ga0157374_10042610
2377 Ga0157374_10191923
2378 Ga0163162_10017442
2379 Ga0163162_10098066
2380 Ga0157372_10115493
2381 Ga0157372_10117818
2382 Ga0157372_10389671
2383 Ga0157372_10435920
2384 Ga0157375_10104547
2385 Ga0157375_10222721
2386 Ga0157375_10483163
2387 Ga0157375_10538782
2388 Ga0157375_10583356
2389 Ga0163163_10008035
2390 Ga0163163_10177155
2391 Ga0163163_10245003
2392 Ga0163163_10393289
2393 Ga0157380_10018506
2394 Ga0157380_10177247
2395 Ga0182008_10000155
2396 Ga0157377_10011120
2397 Ga0157379_10006602
2398 Ga0157379_10007743
2399 Ga0157376_10102957
2400 Ga0157376_10177269
2401 Ga0157376_10311140
2402 Ga0182007_10006083
2403 Ga0183367_1002
2404 Ga0163161_10022188
2405 Ga0163161_10064109
2406 Ga0197907_10254036
2407 Ga0197907_10622146
2408 Ga0206356_10718652
2409 Ga0206352_10797669
2410 Ga0206350_10773787
2411 Ga0206350_11125152
2412 Ga0206354_10351484
2413 Ga0206354_10556289
2414 Ga0206354_10679121
2415 Ga0206354_10854419
2416 Ga0206354_11188581
2417 Ga0206354_11707980
2418 Ga0206353_10410223
2419 Ga0206353_10645933
2420 Ga0206353_10842314
2421 Ga0206353_10849751
2422 Ga0206353_11875109
2423 Ga0213875_10000250
2424 Ga0213875_10000514
2425 Ga0213875_10117901
2426 Ga0224712_10002198
2427 Ga0224712_10002255
2428 Ga0224712_10021596
2429 Ga0224712_10037054
2430 Ga0224572_1000179
2431 Ga0224572_1000254
2432 Ga0209566_100053
2433 Ga0209674_100001
2434 Ga0209672_100039
2435 Ga0209147_101049
2436 Ga0209563_100001
2437 Ga0209563_100766
2438 Ga0209646_1000088
2439 Ga0209677_100001
2440 Ga0209677_100448
2441 Ga0209148_1000004
2442 Ga0209148_1004065
2443 Ga0209148_1004139
2444 Ga0209129_1000047
2445 Ga0209455_1000117
2446 Ga0209455_1003789
2447 Ga0209025_1000920
2448 Ga0209758_1002219
2449 Ga0207426_1005431
2450 Ga0209051_1003197
2451 Ga0209051_1013778
2452 Ga0207697_10001921
2453 Ga0207656_10000005
2454 Ga0207655_1006296
2455 Ga0207655_1015554
2456 Ga0207713_1051913
2457 Ga0207653_10006417
2458 Ga0207682_10001886
2459 Ga0207692_10000225
2460 Ga0207692_10009769
2461 Ga0207692_10049387
2462 Ga0207692_10051604
2463 Ga0207692_10134957
2464 Ga0207642_10011637
2465 Ga0207710_10033869
2466 Ga0207710_10052795
2467 Ga0207647_10009551
2468 Ga0207647_10091475
2469 Ga0207647_10135588
2470 Ga0207685_10000224
2471 Ga0207685_10030315
2472 Ga0207699_10000106
2473 Ga0207699_10004744
2474 Ga0207699_10005198
2475 Ga0207699_10007365
2476 Ga0207699_10008667
2477 Ga0207645_10016279
2478 Ga0207643_10015262
2479 Ga0207643_10132631
2480 Ga0207643_10135365
2481 Ga0207705_10000001
2482 Ga0207705_10009574
2483 Ga0207705_10014811
2484 Ga0207705_10099321
2485 Ga0207705_10139709
2486 Ga0207705_10145603
2487 Ga0207684_10002459
2488 Ga0207684_10006157
2489 Ga0207684_10013779
2490 Ga0207684_10026141
2491 Ga0207684_10031843
2492 Ga0207684_10032282
2493 Ga0207684_10032768
2494 Ga0207654_10000001
2495 Ga0207707_10003758
2496 Ga0207707_10303097
2497 Ga0207695_10005496
2498 Ga0207671_10000016
2499 Ga0207671_10177663
2500 Ga0207693_10002782
2501 Ga0207693_10003038
2502 Ga0207693_10007334
2503 Ga0207693_10008350
2504 Ga0207693_10045686
2505 Ga0207693_10072583
2506 Ga0207693_10087986
2507 Ga0207663_10005403
2508 Ga0207663_10021516
2509 Ga0207663_10034482
2510 Ga0207663_10091360
2511 Ga0207663_10188167
2512 Ga0207660_10000245
2513 Ga0207660_10104135
2514 Ga0207662_10002253
2515 Ga0207657_10018246
2516 Ga0207657_10045521
2517 Ga0207657_10080562
2518 Ga0207657_10086227
2519 Ga0207649_10053258
2520 Ga0207652_10000294
2521 Ga0207652_10068778
2522 Ga0207652_10118221
2523 Ga0207652_10149647
2524 Ga0207646_10001959
2525 Ga0207646_10004445
2526 Ga0207646_10020856
2527 Ga0207646_10053018
2528 Ga0207646_10111544
2529 Ga0207646_10117071
2530 Ga0207646_10312279
2531 Ga0207646_10345862
2532 Ga0207681_10042632
2533 Ga0207694_10000057
2534 Ga0207694_10100546
2535 Ga0207687_10013434
2536 Ga0207687_10043864
2537 Ga0207687_10045183
2538 Ga0207687_10144667
2539 Ga0207687_10240039
2540 Ga0207700_10000053
2541 Ga0207700_10002291
2542 Ga0207700_10008955
2543 Ga0207700_10011392
2544 Ga0207700_10014429
2545 Ga0207700_10016711
2546 Ga0207700_10018986
2547 Ga0207700_10034772
2548 Ga0207700_10062900
2549 Ga0207700_10065079
2550 Ga0207700_10114707
2551 Ga0207700_10162334
2552 Ga0207664_10000701
2553 Ga0207664_10000834
2554 Ga0207664_10002440
2555 Ga0207664_10002847
2556 Ga0207664_10002931
2557 Ga0207664_10005087
2558 Ga0207664_10005293
2559 Ga0207664_10014166
2560 Ga0207664_10035531
2561 Ga0207664_10067649
2562 Ga0207664_10076669
2563 Ga0207664_10096423
2564 Ga0207664_10111991
2565 Ga0207664_10178465
2566 Ga0207644_10011157
2567 Ga0207644_10283993
2568 Ga0207690_10040760
2569 Ga0207706_10010621
2570 Ga0207706_10022853
2571 Ga0207706_10024565
2572 Ga0207686_10157297
2573 Ga0207709_10031526
2574 Ga0207669_10131751
2575 Ga0207665_10000166
2576 Ga0207665_10002299
2577 Ga0207665_10011425
2578 Ga0207665_10012620
2579 Ga0207665_10026642
2580 Ga0207665_10041375
2581 Ga0207691_10001200
2582 Ga0207691_10067617
2583 Ga0207691_10165816
2584 Ga0207711_10005166
2585 Ga0207711_10098454
2586 Ga0207689_10007084
2587 Ga0207661_10054298
2588 Ga0207661_10252596
2589 Ga0207661_10308762
2590 Ga0207679_10100044
2591 Ga0207679_10210222
2592 Ga0207667_10002042
2593 Ga0207667_10011034
2594 Ga0207667_10027457
2595 Ga0207667_10138396
2596 Ga0207712_10233207
2597 Ga0207668_10094646
2598 Ga0207668_10111826
2599 Ga0207658_10203354
2600 Ga0207677_10193109
2601 Ga0207703_10000345
2602 Ga0207639_10079767
2603 Ga0207639_10088644
2604 Ga0207678_10003794
2605 Ga0207678_10007006
2606 Ga0207678_10250368
2607 Ga0207708_10103770
2608 Ga0207702_10077147
2609 Ga0207702_10173137
2610 Ga0207702_10173323
2611 Ga0207641_10002332
2612 Ga0207648_10047554
2613 Ga0207648_10062162
2614 Ga0207676_10043731
2615 Ga0207676_10061345
2616 Ga0207674_10012372
2617 Ga0207674_10013065
2618 Ga0207674_10019331
2619 Ga0207674_10045712
2620 Ga0207675_100005332
2621 Ga0207675_100047486
2622 Ga0207675_100110508
2623 Ga0207683_10001303
2624 Ga0207683_10050682
2625 Ga0207683_10059997
2626 Ga0207683_10078958
2627 Ga0207683_10109649
2628 Ga0207683_10143628
2629 Ga0207698_10004794
2630 Ga0207698_10120534
2631 Ga0207698_10192526
2632 Ga0207428_10000102
2633 Ga0207428_10002614
2634 Ga0207428_10085407
2635 Ga0268265_10117329
2636 Ga0268264_10007965
2637 Ga0265337_1000031
2638 Ga0265319_1002342
2639 Ga0265334_10000091
2640 Ga0265334_10003140
2641 Ga0265323_10049795
2642 Ga0265322_10003185
2643 Ga0265336_10007606
2644 Ga0307517_10002777
2645 Ga0307517_10015795
2646 Ga0307515_10010875
2647 Ga0307515_10180353
2648 Ga0265338_10000233
2649 Ga0265338_10002443
2650 Ga0265338_10025625
2651 Ga0265338_10233416
2652 Ga0265324_10004717
2653 Ga0307511_10018996
2654 Ga0307511_10048418
2655 Ga0307511_10052434
2656 Ga0307512_10013114
2657 Ga0307512_10087803
2658 Ga0307512_10121776
2659 Ga0314311_1016886
2660 Ga0265332_10006014
2661 Ga0265320_10008863
2662 Ga0265327_10000019
2663 Ga0265316_10065002
2664 Ga0307513_10000936
2665 Ga0307513_10001197
2666 Ga0307513_10034204
2667 Ga0307513_10223828
2668 Ga0307509_10010025
2669 Ga0307509_10061631
2670 Ga0307509_10126821
2671 Ga0307408_100003074
2672 Ga0307408_100060781
2673 Ga0307408_100099817
2674 Ga0307408_100156051
2675 Ga0307408_100216733
2676 Ga0265313_10002825
2677 Ga0307508_10001583
2678 Ga0307508_10029203
2679 Ga0307508_10033651
2680 Ga0307514_10008438
2681 Ga0307514_10090774
2682 Ga0307514_10096465
2683 Ga0316575_10000668
2684 Ga0316575_10003717
2685 Ga0316575_10091932
2686 Ga0316579_10002190
2687 Ga0316579_10118321
2688 Ga0265314_10006509
2689 Ga0265342_10004101
2690 Ga0316576_10001465
2691 Ga0316576_10002319
2692 Ga0316576_10021064
2693 Ga0316576_10023914
2694 Ga0316578_10002782
2695 Ga0316578_10038070
2696 Ga0307516_10019845
2697 Ga0307516_10036778
2698 Ga0307405_10014792
2699 Ga0307405_10023043
2700 Ga0307405_10071150
2701 Ga0307405_10086782
2702 Ga0307405_10088812
2703 Ga0307413_10007992
2704 Ga0307413_10009243
2705 Ga0307413_10046827
2706 Ga0307413_10108539
2707 Ga0307518_10057070
2708 Ga0307410_10012152
2709 Ga0307410_10017054
2710 Ga0307410_10025171
2711 Ga0307410_10038935
2712 Ga0307410_10148707
2713 Ga0307410_10149908
2714 Ga0307410_10165544
2715 Ga0307410_10250384
2716 Ga0307406_10000104
2717 Ga0307406_10000932
2718 Ga0307406_10001566
2719 Ga0307406_10076440
2720 Ga0307407_10007739
2721 Ga0307407_10010003
2722 Ga0307407_10048355
2723 Ga0307407_10075390
2724 Ga0307407_10081179
2725 Ga0307407_10164226
2726 Ga0307412_10017272
2727 Ga0307412_10029651
2728 Ga0307412_10098355
2729 Ga0307412_10212449
2730 Ga0307409_100009644
2731 Ga0307409_100034809
2732 Ga0307409_100063923
2733 Ga0307409_100106542
2734 Ga0307409_100109373
2735 Ga0307409_100109684
2736 Ga0307409_100140908
2737 Ga0307409_100147804
2738 Ga0307409_100228942
2739 Ga0307409_100279486
2740 Ga0307409_100390846
2741 Ga0307416_100004847
2742 Ga0307416_100008600
2743 Ga0307416_100024975
2744 Ga0307416_100055367
2745 Ga0307416_100057924
2746 Ga0307416_100172596
2747 Ga0307416_100254176
2748 Ga0307416_100455599
2749 Ga0307414_10016958
2750 Ga0307414_10020103
2751 Ga0307414_10024236
2752 Ga0307414_10065704
2753 Ga0307414_10141928
2754 Ga0307411_10028720
2755 Ga0307411_10062908
2756 Ga0307411_10121414
2757 Ga0307411_10156076
2758 Ga0307411_10167669
2759 Ga0307415_100021173
2760 Ga0307415_100213319
2761 Ga0307415_100215722
2762 Ga0307415_100220758
2763 Ga0316583_10031886
2764 Ga0316585_10008431
2765 Ga0307507_10000024
2766 Ga0307507_10039031
2767 Ga0307510_10071034
2768 Ga0307510_10093196
2769 Ga0316212_1008686
2770 Ga0373938_0002225
2771 Ga0373926_0018060
2772 Ga0373926_0054436
2773 Ga0373934_0000060
2774 Ga0373934_0005753
2775 Ga0373934_0007765
2776 Ga0373934_0021948
2777 Ga0373940_0013993
2778 Ga0373944_0001496
2779 Ga0373944_0006615
2780 Ga0373923_0001412
2781 Ga0373923_0006524
2782 Ga0373923_0022397
2783 Ga0373923_0030949
2784 Ga0373932_0015193
2785 Ga0373936_0000847
2786 Ga0373936_0007777
2787 Ga0373936_0015652
2788 Ga0373936_0057553
2789 Ga0373945_0000182
2790 Ga0373953_0000277
2791 Ga0373953_0002414
2792 Ga0373953_0003904
2793 Ga0373953_0012377
2794 Ga0373954_0002950
2795 Ga0373954_0023130
2796 Ga0373954_0024959
2797 Ga0373954_0025004
2798 Ga0373954_0026765
2799 Ga0373956_0000422
2800 Ga0373956_0005349
2801 Ga0373956_0005512
2802 Ga0373956_0014937
2803 Ga0373956_0029433
2804 Ga0373956_0054191
2805 Ga0373957_0000077
2806 Ga0373957_0002673
2807 Ga0373957_0012834
2808 Ga0373957_0022802
2809 Ga0373957_0024157
2810 Ga0373957_0062286
2811 Ga0373946_0000651
2812 Ga0373946_0007865
2813 Ga0373946_0059149
2814 Ga0373955_0000013
2815 Ga0373955_0027994
2816 Ga0373955_0094242
2817 Ga0373961_0013919
2818 Ga0316574_0015485
2819 Ga0316574_0076927
2820 Ga0373924_0000936
2821 Ga0373924_0009894
2822 Ga0373935_0007297
2823 Ga0373935_0037830
2824 Ga0373935_0131404
2825 Ga0373927_0012605
2826 Ga0373927_0015053
2827 Ga0373927_0144016
2828 Ga0373933_0000139
2829 Ga0373933_0001396
2830 Ga0373933_0013994
2831 Ga0373933_0044507
2832 Ga0373947_0007347
2833 Ga0373947_0123178
2834 Ga0373947_0131535
2835 Ga0373937_0000112
2836 Ga0373937_0008701
2837 Ga0373937_0010609
2838 Ga0373937_0037477
2839 Ga0373937_0193865
2840 Ga0373937_0208875
2841 Ga0372808_001746
2842 Ga0316582_0004467
2843 Ga0316582_0039405
2844 Ga0316584_0003649
2845 Ga0316584_0005041
2846 Ga0316584_0012623
2847 Ga0316584_0016410
2848 Ga0316584_0030549
2849 Ga0373925_0000008
2850 Ga0373925_0002037
2851 Ga0373925_0003433
2852 Ga0373925_0007151
2853 Ga0373925_0147876
2854 Ga0395899_0005583
2855 Ga0395899_0017225
2856 Ga0395899_0032197
2857 Ga0395899_0038763
2858 Ga0395899_0040320
2859 Ga0395899_0076971
2860 Ga0395899_0110727
2861 Ga0395899_0184253
2862 Ga0395900_0011102
2863 Ga0395900_0093930
2864 Ga0395900_0102603
2865 Ga0395900_0209796
2866 Ga0395900_0407188
2867 Ga0395898_0000381
2868 Ga0395898_0001626
2869 Ga0395898_0006252
2870 Ga0395898_0016357
2871 Ga0395898_0020646
2872 Ga0395898_0027833
2873 Ga0395898_0031520
2874 Ga0395898_0057057
2875 Ga0395898_0070700
2876 Ga0395898_0089016
2877 Ga0395898_0346841
2878 Ga0395898_0367269
2879 Ga0436364_0160104
2880 Ga0436364_0287407
2881 Ga0436364_0464514
2882 Ga0436364_0964211
2883 Ga0436364_1096374
2884 Ga0436364_1261806
2885 Ga0436364_1274663
2886 Ga0436364_1379988
2887 Ga0436364_1399659
2888 Ga0395901_0036787
2889 Ga0395901_0071477
2890 Ga0395901_0079374
2891 Ga0395901_0111329
2892 Ga0395901_0131820
2893 Ga0395901_0135263
2894 Ga0395901_0145256
2895 Ga0395901_0240809
2896 Ga0395901_0272956
2897 Ga0395901_0486909
2898 Ga0400485_14348
2899 Ga0400488_19742
2900 Ga0400486_32183
2901 Ga0436365_1516734
2902 Ga0436360_1265940
2903 Ga0439436_0001906
2904 Ga0439436_0004852
2905 Ga0439436_0012938
2906 Ga0439436_0020025
2907 Ga0439436_0037014
2908 Ga0439438_052622
2909 Ga0439439_0001108
2910 Ga0439439_0002397
2911 Ga0439447_016639
2912 Ga0439466_0004226
2913 Ga0439466_0004258
2914 Ga0451791_0795391
2915 Ga0451791_1067624
2916 Ga0451793_0283208
2917 Ga0451797_0921282
2918 Ga0451802_0199680
2919 Ga0451807_0181894
2920 Ga0451833_1396629
2921 Ga0451837_1299351
2922 Ga0451839_1074799
2923 Ga0451853_0509641
2924 Ga0451853_2323682
2925 Ga0439433_0000156
2926 Ga0439433_0000220
2927 Ga0439442_000012
2928 Ga0439442_000083
2929 Ga0439442_000162
2930 Ga0439442_004696
2931 Ga0439442_009119
2932 Ga0439449_0000984
2933 Ga0439449_0029595
2934 Ga0439452_007207
2935 Ga0439457_000027
2936 Ga0439457_003698
2937 Ga0439457_004957
2938 Ga0439462_0041974
2939 Ga0439462_0057144
2940 Ga0450894_000043
2941 Ga0450907_000265
2942 Ga0450907_005873
2943 Ga0439458_0001450
2944 Ga0450909_000182
2945 Ga0439434_0000031
2946 Ga0439434_0003626
2947 Ga0439434_0013610
2948 Ga0450918_000950
2949 Ga0450918_003686
2950 Ga0466969_0019697
2951 Ga0466969_0030935
2952 Ga0466969_0037022
2953 Ga0466972_0004584
2954 Ga0466972_0035044
2955 Ga0466972_0047412
2956 Ga0466972_0059802
2957 Ga0466965_0000038
2958 Ga0466965_0013448
2959 Ga0466965_0034551
2960 Ga0466965_0046392
2961 Ga0466966_0032573
2962 Ga0466966_0058359
2963 Ga0466966_0189110
2964 Ga0466961_0000630
2965 Ga0466961_0004359
2966 Ga0466961_0004420
2967 Ga0466961_0031022
2968 Ga0466961_0048035
2969 Ga0466961_0072229
2970 Ga0466963_0000611
2971 Ga0466963_0002295
2972 Ga0466963_0074190
2973 Ga0466963_0191155
2974 Ga0466963_0255975
2975 Ga0466971_0000512
2976 Ga0466971_0001195
2977 Ga0466971_0001379
2978 Ga0466971_0084173
2979 Ga0466968_0010980
2980 Ga0466970_0000322
2981 Ga0466970_0002564
2982 Ga0466970_0004093
2983 Ga0466970_0013270
2984 Ga0466970_0020549
2985 Ga0466970_0027254
2986 Ga0466970_0044803
2987 Ga0466970_0057628
2988 Ga0466957_0000143
2989 Ga0466957_0108661
2990 Ga0466960_0009565
2991 Ga0466960_0012316
2992 Ga0466960_0029449
2993 Ga0466960_0029531
2994 Ga0466960_0118455
2995 Ga0466959_0005248
2996 Ga0466959_0051206
2997 Ga0466959_0059799
2998 Ga0466959_0196100
2999 Ga0466958_0003353
3000 Ga0466958_0017403
3001 Ga0466958_0047464
3002 Ga0466958_0071467
3003 Ga0466958_0111387
3004 Ga0466958_0172368
3005 Ga0466967_0009414
3006 Ga0466967_0027218
3007 Ga0466967_0053667
3008 Ga0466967_0080891
3009 Ga0466967_0546302
3010 Ga0495627_001457
3011 Ga0495627_033005
3012 Ga0495592_0000094
3013 Ga0495592_0000481
3014 Ga0495592_0008825
3015 Ga0495592_0032917
3016 Ga0495592_0086011
3017 Ga0495592_0103099
3018 Ga0495592_0110410
3019 Ga0495592_0121173
3020 Ga0495603_0001779
3021 Ga0495603_0006149
3022 Ga0495603_0012191
3023 Ga0495603_0167868
3024 Ga0495590_0000094
3025 Ga0495590_0010180
3026 Ga0495629_0002238
3027 Ga0495629_0004014
3028 Ga0495629_0005922
3029 Ga0495629_0017611
3030 Ga0495629_0079132
3031 Ga0495638_0024022
3032 Ga0495638_0183544
3033 Ga0495641_0007164
3034 Ga0495641_0014070
3035 Ga0495641_0016263
3036 Ga0495641_0040202
3037 Ga0495651_0000041
3038 Ga0495651_0002291
3039 Ga0495651_0009757
3040 Ga0495651_0013168
3041 Ga0495651_0042337
3042 Ga0495651_0042569
3043 Ga0495651_0068071
3044 Ga0495651_0073357
3045 Ga0495651_0077794
3046 Ga0495651_0081622
3047 Ga0495651_0084716
3048 Ga0495653_0002267
3049 Ga0495653_0006276
3050 Ga0495653_0007658
3051 Ga0495653_0026502
3052 Ga0495653_0039274
3053 Ga0495653_0045800
3054 Ga0495653_0137825
3055 Ga0495650_0016212
3056 Ga0495650_0060587
3057 Ga0495580_0016321
3058 Ga0495580_0023584
3059 Ga0495580_0044397
3060 Ga0495580_0078078
3061 Ga0495582_0001614
3062 Ga0495582_0015676
3063 Ga0495582_0070053
3064 Ga0495582_0120796
3065 Ga0495605_0021869
3066 Ga0495639_0001608
3067 Ga0495639_0006034
3068 Ga0495662_0000490
3069 Ga0495662_0001269
3070 Ga0495662_0006654
3071 Ga0495662_0015157
3072 Ga0495662_0017624
3073 Ga0495662_0022376
3074 Ga0495662_0098602
3075 Ga0495664_0000351
3076 Ga0495664_0002132
3077 Ga0495664_0012658
3078 Ga0495664_0013992
3079 Ga0495664_0014416
3080 Ga0495664_0023780
3081 Ga0495664_0045484
3082 Ga0495664_0095689
3083 Ga0495664_0121248
3084 Ga0495584_0011675
3085 Ga0495585_0002304
3086 Ga0495594_0008762
3087 Ga0495594_0025952
3088 Ga0495594_0044164
3089 Ga0495594_0117357
3090 Ga0495596_0024389
3091 Ga0495607_0129690
3092 Ga0495608_0000081
3093 Ga0495608_0005238
3094 Ga0495608_0005899
3095 Ga0495608_0009160
3096 Ga0495608_0012635
3097 Ga0495608_0015039
3098 Ga0495608_0022768
3099 Ga0495608_0038030
3100 Ga0495616_0008848
3101 Ga0495618_0007735
3102 Ga0495618_0016327
3103 Ga0495618_0087836
3104 Ga0495618_0108606
3105 Ga0495618_0126501
3106 Ga0495620_0020344
3107 Ga0495628_0000164
3108 Ga0495628_0017977
3109 Ga0495628_0027448
3110 Ga0495628_0038786
3111 Ga0495628_0067706
3112 Ga0495628_0069623
3113 Ga0495628_0112235
3114 Ga0495628_0112763
3115 Ga0495628_0134712
3116 Ga0495628_0138633
3117 Ga0495630_0026724
3118 Ga0495630_0049619
3119 Ga0495630_0118189
3120 Ga0495630_0172843
3121 Ga0495631_0004932
3122 Ga0495631_0025816
3123 Ga0495632_0085526
3124 Ga0495637_0051577
3125 Ga0495643_0001347
3126 Ga0495643_0056504
3127 Ga0495663_0025093
3128 Ga0495652_0000289
3129 Ga0495652_0020655
3130 Ga0495652_0026494
3131 Ga0495652_0069294
3132 Ga0495652_0080266
3133 Ga0495652_0102644
3134 Ga0495652_0122654
3135 Ga0495652_0162901
3136 Ga0495654_0023227
3137 Ga0495665_0001175
3138 Ga0495665_0002775
3139 Ga0495665_0003528
3140 Ga0495665_0026611
3141 Ga0495665_0101074
3142 Ga0495640_0013085
3143 Ga0495640_0022205
3144 Ga0495640_0026527
3145 Ga0495640_0040085
3146 Ga0495640_0045928
3147 Ga0495640_0050900
3148 Ga0495640_0125465
3149 Ga0495586_0005989
3150 Ga0495586_0017800
3151 Ga0495586_0035870
3152 Ga0495586_0040418
3153 Ga0495586_0070150
3154 Ga0495586_0081510
3155 Ga0495586_0114722
3156 Ga0495587_0000038
3157 Ga0495587_0002540
3158 Ga0495587_0003607
3159 Ga0495587_0004772
3160 Ga0495587_0006829
3161 Ga0495587_0011078
3162 Ga0495587_0042335
3163 Ga0495587_0259725
3164 Ga0495609_0027336
3165 Ga0495609_0043122
3166 Ga0495597_0011805
3167 Ga0495645_0002826
3168 Ga0495645_0004680
3169 Ga0495645_0017922
3170 Ga0495645_0031690
3171 Ga0495645_0032889
3172 Ga0495645_0056280
3173 Ga0495645_0078459
3174 Ga0495645_0107550
3175 Ga0495645_0124372
3176 Ga0495645_0150757
3177 Ga0495645_0180555
3178 Ga0495622_0006569
3179 Ga0495667_0000070
3180 Ga0495667_0003737
3181 Ga0495667_0038072
3182 Ga0495667_0052664
3183 Ga0495667_0067051
3184 Ga0495667_0087278
3185 Ga0495667_0119304
3186 Ga0495667_0173174
3187 Ga0495634_0002454
3188 Ga0495634_0028577
3189 Ga0495634_0041285
3190 Ga0495634_0098856
3191 Ga0495611_0026253
3192 Ga0495625_0010712
3193 Ga0495635_0002501
3194 Ga0495635_0007697
3195 Ga0495635_0016282
3196 Ga0495635_0032208
3197 Ga0495635_0032458
3198 Ga0495635_0045447
3199 Ga0495635_0078795
3200 Ga0495659_0006157
3201 Ga0495588_0054453
3202 Ga0495588_0074525
3203 Ga0495657_0000192
3204 Ga0495657_0001801
3205 Ga0495657_0007863
3206 Ga0495657_0017701
3207 Ga0495657_0019259
3208 Ga0495657_0034064
3209 Ga0495657_0034170
3210 Ga0495657_0062590
3211 Ga0495657_0114737
3212 Ga0495657_0116754
3213 Ga0495599_0000100
3214 Ga0495599_0007362
3215 Ga0495599_0018592
3216 Ga0495599_0028460
3217 Ga0495599_0050021
3218 Ga0495623_0000409
3219 Ga0495623_0002698
3220 Ga0495623_0016055
3221 Ga0495623_0040737
3222 Ga0495623_0047715
3223 Ga0495623_0060152
3224 Ga0495623_0094606
3225 Ga0495646_0005300
3226 Ga0495646_0046110
3227 Ga0495646_0051293
3228 Ga0495647_0003185
3229 Ga0495647_0011635
3230 Ga0495658_0002514
3231 Ga0495658_0038925
3232 Ga0495658_0087508
3233 Ga0495613_0004118
3234 Ga0495613_0005121
3235 Ga0495613_0007805
3236 Ga0495613_0017497
3237 Ga0495613_0043432
3238 Ga0495613_0222982
3239 Ga0495624_0006182
3240 Ga0495624_0022253
3241 Ga0495624_0046417
3242 Ga0495624_0049837
3243 Ga0495624_0092011
3244 Ga0495670_0023417
3245 Ga0495670_0071207
3246 Ga0495671_0005333
3247 Ga0495589_0022703
3248 Ga0495600_0001188
3249 Ga0495600_0004237
3250 Ga0495600_0005804
3251 Ga0495600_0009346
3252 Ga0495600_0013174
3253 Ga0495600_0035019
3254 Ga0495600_0041537
3255 Ga0495600_0051307
3256 Ga0495600_0140257
3257 Ga0495600_0172600
3258 Ga0495660_0006238
3259 Ga0495581_0003354
3260 Ga0495581_0044659
3261 Ga0495581_0059541
3262 Ga0495581_0076501
3263 Ga0495581_0110107
3264 Ga0495581_0112287
3265 Ga0495604_0000061
3266 Ga0495604_0002802
3267 Ga0495604_0026075
3268 Ga0495604_0033094
3269 Ga0495604_0033445
3270 Ga0495604_0050839
3271 Ga0495604_0141761
3272 Ga0495604_0223403
3273 Ga0495636_0002194
3274 Ga0495636_0032486
3275 Ga0495674_0019179
3276 Ga0495674_0027638
3277 Ga0495674_0037963
3278 Ga0495674_0048001
3279 Ga0495674_0070377
3280 Ga0495674_0083559
3281 Ga0495674_0148901
3282 Ga0495674_0278225
3283 Ga0495672_0015842
3284 Ga0495676_0024813
3285 Ga0495676_0028997
3286 Ga0495676_0035758
3287 Ga0495676_0071092
3288 Ga0495676_0116781
3289 Ga0495680_0000099
3290 Ga0495680_0005688
3291 Ga0495680_0005926
3292 Ga0495680_0011978
3293 Ga0495680_0011998
3294 Ga0495680_0017923
3295 Ga0495680_0023854
3296 Ga0495680_0029389
3297 Ga0495680_0030570
3298 Ga0495680_0069758
3299 Ga0495680_0170421
3300 Ga0495680_0173768
3301 Ga0495687_002575
3302 Ga0495687_026770
3303 Ga0495675_0005606
3304 Ga0495675_0014263
3305 Ga0495675_0017765
3306 Ga0495675_0018969
3307 Ga0495675_0019565
3308 Ga0495675_0020983
3309 Ga0495675_0052338
3310 Ga0495675_0101922
3311 Ga0495685_000277
3312 Ga0495673_0084402
3313 Ga0495681_0000289
3314 Ga0495681_0077508
3315 Ga0495684_0002552
3316 Ga0495684_0002952
3317 Ga0495684_0013883
3318 Ga0495684_0016318
3319 Ga0495684_0027440
3320 Ga0495684_0039709
3321 Ga0495684_0089962
3322 Ga0495684_0128301
3323 Ga0495684_0154148
3324 Ga0495684_0193289
3325 Ga0495684_0221305
3326 Ga0495593_0001682
3327 Ga0495593_0007995
3328 Ga0495593_0016042
3329 Ga0495593_0031017
3330 Ga0495602_0000649
3331 Ga0495602_0021967
3332 Ga0495602_0022801
3333 Ga0495602_0046525
3334 Ga0495602_0077403
3335 Ga0495602_0108079
3336 Ga0495602_0177044
3337 Ga0495602_0207241
3338 Ga0495614_0000245
3339 Ga0495626_0004415
3340 Ga0496100_0007737
3341 Ga0496100_0016444
3342 Ga0496100_0029003
3343 Ga0496100_0037110
3344 Ga0496100_0097033
3345 Ga0496101_0007337
3346 Ga0496101_0028405
3347 Ga0496101_0050988
3348 Ga0496101_0103857
3349 Ga0496101_0158675
3350 Ga0496101_0174961
3351 Ga0496101_0278620
3352 Ga0496101_0286128
3353 Ga0496102_0000236
3354 Ga0496102_0006337
3355 Ga0496102_0012264
3356 Ga0496102_0013702
3357 Ga0496102_0046015
3358 Ga0496102_0058240
3359 Ga0496102_0128630
3360 Ga0496102_0357919
3361 Ga0496102_0375764
3362 Ga0496103_0000185
3363 Ga0496103_0008811
3364 Ga0496103_0018888
3365 Ga0496103_0033020
3366 Ga0496103_0042282
3367 Ga0496103_0070949
3368 Ga0496103_0118362
3369 Ga0496104_0000836
3370 Ga0496104_0004654
3371 Ga0496104_0006197
3372 Ga0496104_0006329
3373 Ga0496104_0021598
3374 Ga0496104_0095950
3375 Ga0496104_0315250
3376 Ga0496104_0349905
3377 Ga0496105_0001152
3378 Ga0496105_0006003
3379 Ga0496105_0009146
3380 Ga0496105_0025178
3381 Ga0496105_0039651
3382 Ga0496105_0041449
3383 Ga0496105_0061154
3384 Ga0496105_0094807
3385 Ga0496105_0142604
3386 Ga0496105_0147804
3387 Ga0496105_0163629
3388 Ga0496105_0203627
3389 Ga0496105_0262892
3390 Ga0496106_0004056
3391 Ga0496106_0050284
3392 Ga0496106_0213560
3393 Ga0496107_0010945
3394 Ga0496107_0039784
3395 Ga0496107_0076637
3396 Ga0496107_0142423
3397 Ga0496108_0002269
3398 Ga0496108_0006606
3399 Ga0496108_0020362
3400 Ga0496108_0071227
3401 Ga0496108_0086847
3402 Ga0496108_0099231
3403 Ga0496108_0141913
3404 Ga0496108_0311417
3405 Ga0496108_0332564
3406 Ga0496109_0001771
3407 Ga0496109_0043541
3408 Ga0496109_0093261
3409 Ga0496109_0109774
3410 Ga0496109_0189008
3411 Ga0496109_0278913
3412 Ga0496110_0000402
3413 Ga0496110_0040056
3414 Ga0496110_0064159
3415 Ga0496110_0067588
3416 Ga0496110_0110730
3417 Ga0496110_0139127
3418 Ga0496110_0171369
3419 Ga0496110_0180304
3420 Ga0496110_0237305
3421 Ga0496110_0263563
3422 Ga0496111_0008549
3423 Ga0496111_0192563
3424 Ga0496111_0209079
3425 Ga0496112_0003674
3426 Ga0496112_0004882
3427 Ga0496112_0057931
3428 Ga0496112_0100835
3429 Ga0496112_0166035
3430 Ga0496112_0256377
3431 Ga0496112_0412491
3432 Ga0496113_0015524
3433 Ga0496113_0017024
3434 Ga0496113_0029029
3435 Ga0496113_0048554
3436 Ga0496113_0071819
3437 Ga0496113_0074984
3438 Ga0496113_0469384
3439 Ga0496114_0003907
3440 Ga0496114_0010520
3441 Ga0496114_0021323
3442 Ga0496114_0028070
3443 Ga0496114_0028689
3444 Ga0496114_0081784
3445 Ga0496114_0106929
3446 Ga0496114_0129495
3447 Ga0496114_0130696
3448 Ga0496114_0167237
3449 Ga0496114_0176625
3450 Ga0496114_0242881
3451 Ga0496115_0004890
3452 Ga0496115_0006411
3453 Ga0496115_0006671
3454 Ga0496115_0012610
3455 Ga0496115_0030355
3456 Ga0496115_0049791
3457 Ga0496115_0081938
3458 Ga0496115_0133557
3459 Ga0496116_0000340
3460 Ga0496117_0000387
3461 Ga0496117_0000738
3462 Ga0496117_0000791
3463 Ga0496117_0000986
3464 Ga0496117_0001718
3465 Ga0496117_0012087
3466 Ga0496117_0012943
3467 Ga0496117_0023293
3468 Ga0496117_0041758
3469 Ga0496118_0000096
3470 Ga0496118_0000610
3471 Ga0496118_0002673
3472 Ga0496118_0006467
3473 Ga0496118_0009795
3474 Ga0496118_0016454
3475 Ga0496118_0033164
3476 Ga0496118_0042203
3477 Ga0496118_0091107
3478 Ga0496118_0115595
3479 Ga0496119_0000340
3480 Ga0496119_0000437
3481 Ga0496119_0001355
3482 Ga0496119_0002632
3483 Ga0496119_0004459
3484 Ga0496119_0005146
3485 Ga0496119_0009558
3486 Ga0496119_0018646
3487 Ga0496119_0041849
3488 Ga0496119_0061246
3489 Ga0496119_0063300
3490 Ga0496119_0065003
3491 Ga0496119_0123262
3492 Ga0496120_0001932
3493 Ga0496120_0005677
3494 Ga0496120_0006725
3495 Ga0496120_0006917
3496 Ga0496120_0022515
3497 Ga0496120_0023496
3498 Ga0496120_0031483
3499 Ga0496120_0039950
3500 Ga0496121_0000015
3501 Ga0496121_0080853
3502 Ga0496121_0169373
3503 Ga0496121_0219052
3504 Ga0496122_0000020
3505 Ga0496122_0001218
3506 Ga0496122_0005902
3507 Ga0496122_0005965
3508 Ga0496122_0009445
3509 Ga0496122_0011256
3510 Ga0496122_0062094
3511 Ga0496122_0070148
3512 Ga0496122_0086360
3513 Ga0496123_0000003
3514 Ga0496123_0000009
3515 Ga0496123_0000922
3516 Ga0496123_0003978
3517 Ga0496123_0028382
3518 Ga0496123_0039255
3519 Ga0496123_0078797
3520 Ga0496124_0000135
3521 Ga0496124_0002352
3522 Ga0496124_0002908
3523 Ga0496124_0005711
3524 Ga0496124_0039133
3525 Ga0496124_0078730
3526 Ga0496124_0105592
3527 Ga0496125_0000086
3528 Ga0496125_0000209
3529 Ga0496125_0001608
3530 Ga0496125_0005451
3531 Ga0496125_0006238
3532 Ga0496125_0012012
3533 Ga0496125_0036438
3534 Ga0496125_0040583
3535 Ga0496125_0080753
3536 Ga0496126_0000547
3537 Ga0496126_0002060
3538 Ga0496126_0007345
3539 Ga0496126_0030861
3540 Ga0496126_0038893
3541 Ga0496126_0053780
3542 Ga0496126_0069828
3543 Ga0496126_0083544
3544 Ga0496126_0118501
3545 Ga0496126_0281447
3546 Ga0501318_003946
3547 Ga0501321_002166
3548 Ga0501031_0002231
3549 Ga0501031_0005538
3550 Ga0501031_0006771
3551 Ga0501031_0008520
3552 Ga0501031_0028733
3553 Ga0501032_0001733
3554 Ga0501032_0006740
3555 Ga0501032_0007901
3556 Ga0501032_0010914
3557 Ga0501032_0012689
3558 Ga0501032_0015179
3559 Ga0501032_0017903
3560 Ga0501032_0020302
3561 Ga0501032_0038963
3562 Ga0501032_0043425
3563 Ga0501032_0057119
3564 Ga0501032_0123968
3565 Ga0501032_0143916
3566 Ga0501033_0001533
3567 Ga0501033_0006784
3568 Ga0501033_0016453
3569 Ga0501033_0037448
3570 Ga0501033_0047280
3571 Ga0501033_0075075
3572 Ga0501033_0099379
3573 Ga0501033_0163489
3574 Ga0501034_0000079
3575 Ga0501034_0000910
3576 Ga0501034_0004451
3577 Ga0501034_0004610
3578 Ga0501034_0005584
3579 Ga0501034_0007328
3580 Ga0501034_0016939
3581 Ga0501034_0022103
3582 Ga0501034_0024475
3583 Ga0501034_0032998
3584 Ga0501034_0060038
3585 Ga0501034_0062895
3586 Ga0501034_0069979
3587 Ga0501034_0095490
3588 Ga0501034_0130331
3589 Ga0501034_0172223
3590 Ga0501034_0174071
3591 Ga0501034_0278830
3592 Ga0501036_0002124
3593 Ga0501036_0003126
3594 Ga0501036_0010468
3595 Ga0501036_0026255
3596 Ga0501036_0061367
3597 Ga0501036_0065461
3598 Ga0501036_0070904
3599 Ga0501036_0082954
3600 Ga0501036_0084430
3601 Ga0501036_0304735
3602 Ga0501037_0003940
3603 Ga0501037_0005417
3604 Ga0501037_0005558
3605 Ga0501037_0012804
3606 Ga0501037_0013780
3607 Ga0501037_0018305
3608 Ga0501037_0019639
3609 Ga0501037_0056598
3610 Ga0501037_0073269
3611 Ga0501037_0088732
3612 Ga0501037_0119303
3613 Ga0501037_0170277
3614 Ga0501038_0002793
3615 Ga0501038_0009522
3616 Ga0501038_0014812
3617 Ga0501038_0019259
3618 Ga0501038_0019392
3619 Ga0501038_0035681
3620 Ga0501038_0036093
3621 Ga0501038_0038913
3622 Ga0501038_0061045
3623 Ga0501038_0073378
3624 Ga0501038_0075649
3625 Ga0501038_0079053
3626 Ga0501038_0125533
3627 Ga0501039_0001345
3628 Ga0501039_0012049
3629 Ga0501039_0014554
3630 Ga0501039_0134070
3631 Ga0501040_0006755
3632 Ga0501040_0019206
3633 Ga0501041_0000510
3634 Ga0501042_0002946
3635 Ga0501042_0005797
3636 Ga0501042_0006620
3637 Ga0501042_0044551
3638 Ga0501042_0144041
3639 Ga0501043_0002325
3640 Ga0501043_0003130
3641 Ga0501043_0008228
3642 Ga0501043_0008953
3643 Ga0501043_0010184
3644 Ga0501043_0010272
3645 Ga0501043_0015132
3646 Ga0501043_0043814
3647 Ga0501043_0091786
3648 Ga0501043_0119796
3649 Ga0501043_0157809
3650 Ga0501043_0160239
3651 Ga0501046_0004180
3652 Ga0501046_0007136
3653 Ga0501046_0009635
3654 Ga0501046_0016221
3655 Ga0501046_0121181
3656 Ga0501047_0000005
3657 Ga0501047_0003756
3658 Ga0501047_0010901
3659 Ga0501047_0018642
3660 Ga0501047_0021174
3661 Ga0501047_0023128
3662 Ga0501047_0032440
3663 Ga0501047_0050684
3664 Ga0501047_0051285
3665 Ga0501047_0082245
3666 Ga0501047_0239018
3667 Ga0501047_0371310
3668 Ga0501048_0001322
3669 Ga0501048_0004371
3670 Ga0501048_0008906
3671 Ga0501048_0010033
3672 Ga0501048_0101153
3673 Ga0501048_0188471
3674 Ga0501048_0236991
3675 Ga0501067_0001107
3676 Ga0501067_0020188
3677 Ga0501067_0083786
3678 Ga0501068_0004355
3679 Ga0501068_0030431
3680 Ga0501068_0165979
3681 Ga0501069_0042811
3682 Ga0501070_0002352
3683 Ga0501070_0003420
3684 Ga0501070_0009355
3685 Ga0501070_0010098
3686 Ga0501070_0015896
3687 Ga0501070_0018990
3688 Ga0501070_0033611
3689 Ga0501070_0038905
3690 Ga0501070_0039125
3691 Ga0501070_0095003
3692 Ga0501070_0204631
3693 Ga0501070_0236002
3694 Ga0501071_0001275
3695 Ga0501071_0002509
3696 Ga0501071_0061566
3697 Ga0501072_0033937
3698 Ga0501072_0104825
3699 Ga0501073_0000030
3700 Ga0501073_0113310
3701 Ga0501074_0004495
3702 Ga0501074_0008723
3703 Ga0501074_0089288
3704 Ga0501075_0008628
3705 Ga0501076_0049185
3706 Ga0501076_0175451
3707 Ga0501077_0021191
3708 Ga0501077_0036848
3709 Ga0501079_0001632
3710 Ga0501079_0025872
3711 Ga0501080_0000023
3712 Ga0501080_0042141
3713 Ga0501080_0056997
3714 Ga0501080_0064971
3715 Ga0501080_0071502
3716 Ga0501080_0093219
3717 Ga0501080_0273742
3718 Ga0501081_0012816
3719 Ga0501083_0000059
3720 Ga0501083_0004256
3721 Ga0501083_0004565
3722 Ga0501083_0031451
3723 Ga0501083_0315342
3724 Ga0501279_006874
3725 Ga0501035_0002846
3726 Ga0501035_0006735
3727 Ga0501035_0007884
3728 Ga0501035_0008420
3729 Ga0501035_0013293
3730 Ga0501035_0015593
3731 Ga0501035_0017656
3732 Ga0501035_0017981
3733 Ga0501035_0024286
3734 Ga0501035_0029166
3735 Ga0501035_0031513
3736 Ga0501035_0050317
3737 Ga0501044_0003414
3738 Ga0501044_0010052
3739 Ga0501044_0012278
3740 Ga0501044_0013325
3741 Ga0501044_0015296
3742 Ga0501044_0015324
3743 Ga0501044_0033710
3744 Ga0501044_0088361
3745 Ga0501044_0104368
3746 Ga0501044_0167162
3747 Ga0501044_0175285
3748 Ga0501044_0230097
3749 Ga0501045_0047819
3750 Ga0501045_0100124
3751 nmdc:mga00v17_10676_c1
3752 nmdc:mga0yw44_109474_c1
3753 nmdc:mga0yw44_16446_c1
3754 nmdc:mga0yw44_7068_c1
3755 nmdc:mga06z11_29345_c1
3756 nmdc:mga05p37_408632_c1
3757 nmdc:mga05p37_9690_c1
3758 nmdc:mga05p37_9984_c1
3759 nmdc:mga09592_110175_c1
3760 nmdc:mga09592_97806_c1
3761 nmdc:mga0qj67_176290_c1
3762 nmdc:mga06r32_202_c5
3763 nmdc:mga08y16_116201_c1
3764 nmdc:mga08y16_14541_c1
3765 nmdc:mga08y16_24871_c1
3766 nmdc:mga08y16_47659_c1
3767 nmdc:mga0n895_12260_c1
3768 nmdc:mga0n895_27126_c1
3769 nmdc:mga0n895_313887_c1
3770 nmdc:mga0n895_64173_c1
3771 nmdc:mga0rr50_128236_c1
3772 nmdc:mga0rr50_3162_c1
3773 nmdc:mga0rr50_4142_c2
3774 nmdc:mga0rr50_95002_c1
3775 nmdc:mga08x19_33654_c1
3776 nmdc:mga08x19_34607_c1
3777 nmdc:mga0a205_3224_c1
3778 nmdc:mga0sz30_11075_c1
3779 Ga0495601_0013029
3780 Ga0495601_0015770
3781 Ga0495601_0030603
3782 Ga0495601_0032437
3783 Ga0495612_0001130
3784 Ga0495612_0010468
3785 Ga0495612_0010525
3786 Ga0495612_0024452
3787 Ga0495612_0045980
3788 Ga0495612_0060823
3789 Ga0500635_0000664
3790 Ga0495595_0001495
3791 Ga0495595_0020681
3792 Ga0495595_0036502
3793 Ga0495619_0010408
3794 Ga0495619_0021908
3795 Ga0495619_0083432
3796 Ga0495619_0132743
3797 Ga0500578_0014632
3798 Ga0500643_000191
3799 Ga0500583_0103117
3800 Ga0500651_0003063
3801 Ga0500640_001744
3802 Ga0500641_0056548
3803 Ga0500556_0000115
3804 Ga0500556_0000426
3805 Ga0500560_009842
3806 Ga0500560_012532
3807 Ga0500562_000183
3808 Ga0500593_001772
3809 Ga0500658_0004371
3810 Ga0500559_0000050
3811 Ga0500559_0000800
3812 Ga0500559_0042277
3813 Ga0500568_0000038
3814 Ga0500568_0000117
3815 Ga0500568_0001933
3816 Ga0500568_0007501
3817 Ga0500568_0013939
3818 Ga0500573_0000014
3819 Ga0500573_0006418
3820 Ga0500573_0013932
3821 Ga0500573_0014968
3822 Ga0500577_0004479
3823 Ga0500577_0016903
3824 Ga0500577_0020950
3825 Ga0500590_013523
3826 Ga0500616_0000027
3827 Ga0500616_0000117
3828 Ga0500616_0000620
3829 Ga0500616_0011539
3830 Ga0500616_0061798
3831 Ga0500620_000082
3832 Ga0500624_002275
3833 Ga0500634_0003371
3834 Ga0501084_0011942
3835 Ga0501084_0042709
3836 Ga0590075_003544
3837 Ga0587072_000110
3838 Ga0501082_0011737
3839 Ga0501082_0021746
3840 Ga0501082_0024215
3841 Ga0501082_0053825
3842 Ga0466962_0001145
3843 Ga0466962_0001217
3844 Ga0466962_0005385
3845 Ga0466962_0012085
3846 Ga0466962_0057982
3847 Ga0530510_0002078
3848 Ga0530510_0113870
3849 Ga0530510_0142274
3850 2523384565
3851 2537898248
3852 2552105984
3853 2554256717
3854 2555228741
3855 2585295996
3856 2585306288
3857 2585320272
3858 2588106927
3859 2616696701
3860 2616903179
3861 2643734866
3862 2643753782
3863 2643764695
3864 2643768564
3865 2643783527
3866 2643847848
3867 2643852653
3868 2643888218
3869 2643903027
3870 2643941919
3871 2643994890
3872 2644082324
3873 2644111941
3874 2644135161
3875 2644173026
3876 2644175828
3877 2644182446
3878 2644197898
3879 2644261510
3880 2644277737
3881 2644389541
3882 2644404463
3883 2644429002
3884 2644439410
3885 2644445480
3886 2644462080
3887 2644502903
3888 2644515240
3889 2644525268
3890 2644610808
3891 2644667053
3892 2644669353
3893 2644679225
3894 2655033208
3895 2676494524
3896 2691514725
3897 2723643100
3898 2729906622
3899 2730228728
3900 2731908986
3901 2738693731
3902 2739328110
3903 2739602919
3904 2739607439
3905 2747953169
3906 2753037991
3907 2753303633
3908 2753325859
3909 2758224676
3910 2760304659
3911 2760621530
3912 2768643577
3913 2774378827
3914 2774383431
3915 2774400613
3916 2775654939
3917 2784472905
3918 2784589814
3919 2785341790
3920 2785370856
3921 2786672035
3922 2793981347
3923 2804845461
3924 2808628693
3925 2808827838
3926 2808843413
3927 2808853190
3928 2808875457
3929 2808878308
3930 2808884818
3931 2808892081
3932 2808897186
3933 2808912998
3934 2809026317
3935 2809226524
3936 2809233483
3937 2810364339
3938 2811845029
3939 2812320401
3940 2812322197
3941 2812356628
3942 2812364422
3943 2812375766
3944 2812479336
3945 2816505500
3946 2817508571
3947 2819424663
3948 2819667002
3949 2819690356
3950 2819695159
3951 2819728382
3952 2819742314
3953 2821269128
3954 2833710011
3955 2835189079
3956 2839989113
3957 2844843321
3958 2844849700
3959 2844854372
3960 2848551703
3961 2852632770
3962 2852642776
3963 2852644397
3964 2852646538
3965 2852665830
3966 2856746564
3967 2857480484
3968 2857633705
3969 2857712593
3970 2857722181
3971 2857724667
3972 2857729262
3973 2857730614
3974 2857734492
3975 2857739751
3976 2857741167
3977 2862185244
3978 2862287082
3979 2862292054
3980 2862385302
3981 2862511968
3982 2862578110
3983 2862709676
3984 2863411483
3985 2867349841
3986 2867373302
3987 2867434122
3988 2867478680
3989 2870622239
3990 2870629522
3991 2870801986
3992 2870806376
3993 2873154636
3994 2873322080
3995 2875396116
3996 2877679721
3997 2884694879
3998 2884996381
3999 2887447131
4000 2891331433
4001 2891401853
4002 2891560593
4003 2891566160
4004 2893685140
4005 2895432642
4006 2895446426
4007 2904432440
4008 2904500400
4009 2904501765
4010 2904510287
4011 2904776799
4012 2905927870
4013 2906801637
4014 2908676181
4015 2908678498
4016 2909077060
4017 2910810674
4018 2912718358
4019 2912730710
4020 2912762198
4021 2915359603
4022 2918505904
4023 2919036344
4024 2919041800
4025 2919043240
4026 2919054468
4027 2919058802
4028 2919059646
4029 2919070819
4030 2919391597
4031 2919397768
4032 2919445606
4033 2919447880
4034 2919470311
4035 2919525379
4036 2919540794
4037 2920882720
4038 2928090944
4039 2928105537
4040 2928121418
4041 2928153459
4042 2928500943
4043 2932426928
4044 2932432256
4045 2933419565
4046 2935395278
4047 2935412172
4048 2935893553
4049 2939598807
4050 2939650045
4051 2939677490
4052 2945918156
4053 2945921554
4054 2945942223
4055 2945960001
4056 2945970886
4057 2946005488
4058 2946026599
4059 2946034682
4060 2946038203
4061 2946043203
4062 2946048504
4063 2946062002
4064 2946069240
4065 2946077189
4066 2946081800
4067 2947227685
4068 2953999481
4069 2954004828
4070 2954384633
4071 2954678307
4072 2954685850
4073 2954695489
4074 2954710682
4075 2954714920
4076 2954724863
4077 2954736955
4078 2954743789
4079 2954755805
4080 2954762741
4081 2956941033
4082 2964328524
4083 2966601376
4084 2966926590
4085 2974298324
4086 2974306186
4087 2974325447
4088 2977230392
4089 2977239195
4090 2977252073
4091 2977265623
4092 2984543021
4093 2984551932
4094 2984582301
4095 2990044890
4096 2990060988
4097 2990093261
4098 2995728402
4099 2997458291
4100 2997601414
4101 3001120725
4102 3001892153
4103 3006326633
4104 3006397840
4105 3006429828
4106 3006493413
4107 3006498897
4108 8002811619
4109 8004021608
4110 8004027974
4111 8004183588
4112 8004213407
4113 8008490555
4114 8008566634
4115 8008577735
4116 8016254998
4117 8023627007
4118 8025417166
4119 8025479533
4120 8025529857
4121 8025532243
4122 8033687274
4123 8045832305
4124 8047896896
4125 8048362054
4126 8048373881
4127 8048384347
4128 8048413751
4129 8054108427
4130 8054164200
4131 8054475838
4132 8055035349
4133 8055038962
4134 8055073949
4135 8055179018
4136 8056039332
4137 8056063837
4138 8056448512
4139 8056583246
4140 8056672849
4141 8056837541
4142 8057347458

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01645

Glu_synthase

Conserved region in glutamate synthase

265

340

0.83

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

69

356

0.82

PF01070

FMN_dh

FMN-dependent dehydrogenase

151

347

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.9483 4 364
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.9256 4 364
4qq3-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp 0.8494 6 363
4qq3-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp 0.8364 6 363
6mgu-assembly1.cif.gz_A crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with inhibitor oxanosine monophosphate 0.8355 14 363
ID Description Score Start End Superfamily
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.944 17 364 3.20.20.70
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9386 17 364 3.20.20.70
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.847 6 363 3.20.20.70
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.834 6 363 3.20.20.70
af_B4F8B4_8_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7927 47 290 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3P5WU28-F1-model_v4 Putative oxidoreductase/MSMEI_1564 (EC 1.-.-.-) 0.987 1 368 GO:0003938
GO:0006183
AF-H0QRD3-F1-model_v4 IMP dehydrogenase family protein 0.9869 1 369 GO:0003938
GO:0006183
AF-A0A1G5PLG8-F1-model_v4 IMP dehydrogenase 0.9869 1 369 GO:0003938
GO:0006183
AF-K2M477-F1-model_v4 deleted 0.9866 15 222
AF-A0A7G6WMW6-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9863 1 369 GO:0003938
GO:0006183

Map