metagRoot

F496352

General Info

Members	Datasets	Scaffolds	Average Seq Length
2073	915	4146	153

Family's Representative Sequence

Representative Sequence	3300006881\|Ga0068865_100151932\|Ga0068865_1001519323
Length	178
Sequence	MHRSLETAQFGAACAAIPFHGFPHMKTFSAKPAEVTKKWVLIDAKGLVVGRLATLVAMRLRGKHLPTYTPHVDCGDHVVIINAAHVVLTGRKREQKVYYKHTGFIGGIKERTAKSILEGRFPERVVEKAVERMVPRGPLGRVQMGNLRVYPGAEHPHEAQQPEKVDIASMNRKNMRAA

Samples

	Sample ID	Description	Type	Environment
1	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
2	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
3	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
6	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
7	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
8	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
9	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
10	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
11	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
12	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
13	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
14	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
15	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
16	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
17	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
18	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
19	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
22	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
23	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
24	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
25	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
26	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
27	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
28	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
29	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
30	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
31	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
32	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
33	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
34	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
35	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
36	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
37	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
38	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
39	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
40	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
41	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
42	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
43	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
47	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
48	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
49	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
50	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
51	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
52	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
53	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
54	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
55	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
56	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
57	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
58	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
59	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
60	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
61	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
62	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
63	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
64	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
65	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
66	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
67	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
68	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
69	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
70	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
71	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
72	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
73	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
74	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
75	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
76	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
77	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
78	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
79	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
80	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
81	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
82	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
83	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
84	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
85	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
86	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
87	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
88	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
89	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
90	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
91	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
94	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
95	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
96	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
97	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
98	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
99	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
100	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
101	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
102	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
103	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
104	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
105	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
107	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
108	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
109	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
110	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
111	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
112	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
113	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
115	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
116	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
117	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
118	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
119	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
120	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
121	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
122	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
123	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
125	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
126	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
127	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
128	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
129	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
130	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
131	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
132	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
133	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
134	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
135	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
136	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
137	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
138	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
139	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
140	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
141	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
142	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
143	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
144	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
145	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
146	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
147	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
148	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
149	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
150	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
151	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
152	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
153	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
154	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
155	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
156	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
157	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
158	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
159	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
160	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
161	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
162	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
163	3300022730	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2	Metagenome	Rhizosphere
164	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
165	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
166	3300023309	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1	Metatranscriptome	Rhizosphere
167	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
171	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
174	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
245	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
246	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
247	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
248	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
249	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
251	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
253	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
254	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
255	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300029285	Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1	Metatranscriptome	Rhizosphere
259	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
260	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
261	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
262	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
263	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
264	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
265	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
266	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
267	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
268	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
269	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
270	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
271	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
272	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
273	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
274	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
275	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
276	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
277	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
278	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
279	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
280	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
281	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
282	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
283	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
284	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
285	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
286	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
287	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
288	3300033544	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5	Metagenome	Unclassified
289	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
290	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
291	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
292	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
293	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
294	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
295	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
296	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
297	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
298	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
299	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
300	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
301	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
302	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
303	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
304	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
305	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
306	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
307	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
308	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
309	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
310	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
311	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
312	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
313	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
314	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
315	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
316	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
317	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
318	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
319	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
320	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
321	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
322	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
323	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
324	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
325	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
326	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
327	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
328	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
329	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
330	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
331	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
332	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
333	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
334	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
335	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
336	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
337	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
338	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
339	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
340	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
341	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
342	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
343	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
344	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
345	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
346	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
347	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
348	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
349	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
350	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
351	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
352	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
353	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
354	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
355	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
356	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
357	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
358	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
359	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
360	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
361	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
362	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
363	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
364	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
365	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
366	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
367	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
368	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
369	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
370	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
371	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
372	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
373	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
374	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
375	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
376	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
377	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
378	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
379	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
380	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
381	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
382	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
383	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
384	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
385	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
386	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
387	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
388	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
389	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
390	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
391	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
392	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
393	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
394	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
395	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
396	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
397	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
398	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
399	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
400	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
401	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
402	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
403	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
404	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
405	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
406	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
407	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
408	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
409	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
410	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
411	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
412	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
413	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
414	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
415	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
416	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
417	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
418	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
419	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
420	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
421	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
422	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
423	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
424	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
425	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
426	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
427	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
428	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
429	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
430	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
431	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
432	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
433	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
434	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
435	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
436	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
437	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
438	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
439	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
440	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
441	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
442	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
443	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
444	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
445	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
446	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
447	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
448	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
449	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
450	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
451	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
452	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
453	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
454	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
455	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
456	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
457	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
458	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
459	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
460	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
461	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
462	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
463	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
464	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
465	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
466	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
467	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
468	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
469	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
470	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
471	3300049128	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
472	3300049129	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
473	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
474	3300049160	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
475	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
476	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
477	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
478	3300049532	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
479	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
480	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
481	3300049537	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
482	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
483	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
484	3300049544	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
485	3300049548	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
486	3300049552	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
487	3300049556	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
488	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
489	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
490	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
491	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
492	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
493	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
494	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
495	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
496	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
497	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
498	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
499	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
500	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
501	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
502	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
503	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
504	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
505	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
506	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
507	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
508	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
509	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
510	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
513	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
514	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
515	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
516	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
517	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
518	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
519	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
520	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
521	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
522	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
523	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
524	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
525	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
526	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
527	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
528	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
529	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
530	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
531	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
532	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
533	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
534	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
535	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
536	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
537	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
538	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
539	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
540	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
541	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
542	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
543	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
544	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
545	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
546	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
547	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
548	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
549	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
550	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
551	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
552	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
553	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
554	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
555	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
556	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
557	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
558	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
559	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
560	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
561	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
562	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
563	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
564	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
565	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
566	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
567	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
568	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
569	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
570	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
571	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
572	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
573	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
574	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
575	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
576	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
577	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
578	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
579	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
580	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
581	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
582	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
583	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
584	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
585	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
586	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
587	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
588	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
589	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
590	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
591	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
592	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
593	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
594	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
595	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
596	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
597	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
598	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
599	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
600	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
601	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
602	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
603	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
604	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
605	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
606	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
607	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
608	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
609	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
610	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
611	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
612	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
613	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
614	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
615	2516143018	Ensifer sp. BR816	Isolate	Nodule
616	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
617	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
618	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
619	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
620	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
621	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
622	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
623	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
624	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
625	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
626	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
627	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
628	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
629	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
630	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
631	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
632	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
633	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
634	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
635	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
636	2643221557	Ensifer sp. Root558	Isolate	Unclassified
637	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
638	2643221610	Ensifer sp. Root74	Isolate	Unclassified
639	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
640	2643221668	Ensifer sp. Root423	Isolate	Unclassified
641	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
642	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
643	2643221723	Ensifer sp. Root278	Isolate	Unclassified
644	2643221726	Ensifer sp. Root954	Isolate	Unclassified
645	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
646	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
647	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
648	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
649	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
650	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
651	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
652	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
653	2791355199
654	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
655	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
656	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
657	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
658	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
659	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
660	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
661	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
662	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
663	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
664	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
665	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
666	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
667	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
668	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
669	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
670	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
671	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
672	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
673	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
674	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
675	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
676	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
677	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
678	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
679	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
680	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
681	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
682	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
683	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
684	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
685	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
686	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
687	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
688	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
689	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
690	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
691	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
692	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
693	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
694	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
695	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
696	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
697	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
698	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
699	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
700	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
701	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
702	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
703	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
704	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
705	2891088606	Methylosinus sp. 3S-1	Isolate	Rhizosphere
706	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
707	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
708	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
709	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
710	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
711	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
712	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
713	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
714	2906610324
715	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
716	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
717	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
718	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
719	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
720	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
721	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
722	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
723	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
724	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
725	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
726	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
727	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
728	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
729	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
730	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
731	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
732	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
733	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
734	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
735	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
736	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
737	2917554339	Chthonobacter rhizosphaerae yh7-1	Isolate	Rhizosphere
738	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
739	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
740	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
741	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
742	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
743	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
744	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
745	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
746	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
747	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
748	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
749	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
750	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
751	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
752	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
753	2922425934
754	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
755	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
756	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
757	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
758	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
759	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
760	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
761	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
762	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
763	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
764	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
765	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
766	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
767	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
768	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
769	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
770	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
771	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
772	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
773	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
774	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
775	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
776	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
777	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
778	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
779	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
780	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
781	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
782	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
783	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
784	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
785	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
786	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
787	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
788	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
789	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
790	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
791	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
792	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
793	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
794	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
795	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
796	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
797	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
798	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
799	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
800	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
801	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
802	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
803	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
804	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
805	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
806	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
807	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
808	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
809	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
810	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
811	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
812	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
813	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
814	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
815	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
816	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
817	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
818	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
819	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
820	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
821	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
822	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
823	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
824	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
825	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
826	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
827	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
828	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
829	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
830	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
831	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
832	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
833	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
834	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
835	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
836	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
837	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
838	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
839	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
840	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
841	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
842	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
843	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
844	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
845	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
846	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
847	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
848	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
849	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
850	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
851	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
852	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
853	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
854	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
855	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
856	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
857	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
858	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
859	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
860	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
861	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
862	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
863	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
864	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
865	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
866	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
867	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
868	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
869	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
870	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
871	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
872	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
873	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
874	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
875	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
876	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
877	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
878	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
879	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
880	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
881	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
882	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
883	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
884	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
885	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
886	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
887	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
888	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
889	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
890	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
891	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
892	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
893	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
894	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
895	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
896	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
897	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
898	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
899	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
900	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
901	3000865235	Altericroceibacterium indicum DSM 18604	Isolate	Rhizosphere
902	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
903	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
904	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
905	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
906	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
907	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
908	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
909	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
910	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
911	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
912	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
913	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
914	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
915	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	82.95
Metatranscriptomes	1.59
Isolates	15.46

Biome Distribution

Category	Percentage (%)
Aerial Root	0.05
Bulb	0
Endosphere	9.6
Nodule	13.27
Rhizoplane	5.79
Rhizosphere	63.63
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0068865_100151932	3300006881	Bacteria	1757
2	RicEn_C8330	2010549000	Bacteria	1066
3	JGI24739J22299_10018417	3300001989	Bacteria	2510
4	JGI24737J22298_10006184	3300001990	Bacteria	4099
5	JGI24750J21931_1029166	3300002070	Bacteria	803
6	JGI24738J21930_10078412	3300002075	Bacteria	690
7	JGI25158J39367_1001323	3300002739	Bacteria	4394
8	JGI25159J45721_1000002	3300002987	Bacteria	289163
9	JGI25151J46595_10034901	3300003187	Bacteria	1917
10	JGI25406J46586_10005624	3300003203	Bacteria	5800
11	JGI25406J46586_10034041	3300003203	Bacteria	1874
12	JGI25165J46597_1047793	3300003214	Bacteria	549
13	JGI25160J50197_1000008	3300003354	Bacteria	289163
14	JGI25161J50226_1001402	3300003374	Bacteria	7322
15	Ga0007416J51690_1062205	3300003577	Bacteria	697
16	JGI25404J52841_10013477	3300003659	Bacteria	1773
17	Ga0055526_1000738	3300003771	Bacteria	24652
18	Ga0055526_1040251	3300003771	Bacteria	1180
19	Ga0055524_1001933	3300003775	Bacteria	11162
20	Ga0055524_1026936	3300003775	Bacteria	1760
21	Ga0055536_1003120	3300003781	Bacteria	9002
22	Ga0055530_10037481	3300003791	Bacteria	1212
23	Ga0055531_10032635	3300003794	Bacteria	1696
24	JGI25405J52794_10038913	3300003911	Bacteria	1002
25	Ga0055543_1000027	3300004625	Bacteria	136033
26	Ga0058859_10046184	3300004798	Bacteria	956
27	Ga0065165_1000015	3300005262	Bacteria	289201
28	Ga0065165_1103502	3300005262	Bacteria	709
29	Ga0065707_10170968	3300005295	Bacteria	1485
30	Ga0070658_10042306	3300005327	Bacteria	3679
31	Ga0070658_10472112	3300005327	Bacteria	1082
32	Ga0070658_10684824	3300005327	Bacteria	890
33	Ga0070676_10047287	3300005328	Bacteria	2512
34	Ga0070676_10094344	3300005328	Bacteria	1838
35	Ga0070676_10713016	3300005328	Bacteria	733
36	Ga0070683_100015738	3300005329	Bacteria	6649
37	Ga0070683_100029863	3300005329	Bacteria	4942
38	Ga0070683_100180712	3300005329	Bacteria	2002
39	Ga0070683_100291940	3300005329	Bacteria	1551
40	Ga0070683_100553689	3300005329	Bacteria	1100
41	Ga0070683_100920946	3300005329	Bacteria	839
42	Ga0070690_100428607	3300005330	Bacteria	976
43	Ga0070670_100577301	3300005331	Bacteria	1005
44	Ga0070670_101001699	3300005331	Bacteria	760
45	Ga0068869_100167920	3300005334	Bacteria	1712
46	Ga0068869_100604038	3300005334	Bacteria	927
47	Ga0070680_100018923	3300005336	Bacteria	5449
48	Ga0070680_100056843	3300005336	Bacteria	3198
49	Ga0070680_100135881	3300005336	Bacteria	2060
50	Ga0070680_100183906	3300005336	Bacteria	1760
51	Ga0070682_100008455	3300005337	Bacteria	5809
52	Ga0070682_100101285	3300005337	Bacteria	1902
53	Ga0070682_100944839	3300005337	Bacteria	712
54	Ga0068868_100383731	3300005338	Bacteria	1209
55	Ga0070660_100224174	3300005339	Bacteria	1528
56	Ga0070660_100340520	3300005339	Bacteria	1234
57	Ga0070660_100515691	3300005339	Bacteria	995
58	Ga0070660_100679771	3300005339	Bacteria	863
59	Ga0070660_101029572	3300005339	Bacteria	696
60	Ga0070689_100345709	3300005340	Bacteria	1246
61	Ga0070689_100885692	3300005340	Bacteria	789
62	Ga0070661_100006251	3300005344	Bacteria	8217
63	Ga0070661_100377475	3300005344	Bacteria	1117
64	Ga0070661_100397894	3300005344	Bacteria	1089
65	Ga0070661_100575093	3300005344	Bacteria	909
66	Ga0070668_100196196	3300005347	Bacteria	1655
67	Ga0070668_100254498	3300005347	Bacteria	1459
68	Ga0070668_100545563	3300005347	Bacteria	1008
69	Ga0070669_100641245	3300005353	Bacteria	893
70	Ga0070671_100157738	3300005355	Bacteria	1917
71	Ga0070671_100246864	3300005355	Bacteria	1516
72	Ga0070671_100685037	3300005355	Bacteria	889
73	Ga0070674_100092796	3300005356	Bacteria	2183
74	Ga0070673_100039344	3300005364	Bacteria	3617
75	Ga0070688_100110176	3300005365	Bacteria	1830
76	Ga0070688_100344427	3300005365	Bacteria	1089
77	Ga0070688_100995748	3300005365	Bacteria	665
78	Ga0070659_100027861	3300005366	Bacteria	4357
79	Ga0070659_100263056	3300005366	Bacteria	1431
80	Ga0070659_100844939	3300005366	Bacteria	798
81	Ga0070659_100912640	3300005366	Bacteria	768
82	Ga0070667_100403808	3300005367	Bacteria	1244
83	Ga0070667_100937478	3300005367	Bacteria	806
84	Ga0070667_101389359	3300005367	Bacteria	658
85	Ga0070703_10021042	3300005406	Bacteria	1904
86	Ga0070709_10002462	3300005434	Bacteria	10023
87	Ga0070709_10008513	3300005434	Bacteria	5636
88	Ga0070709_10183493	3300005434	Bacteria	1471
89	Ga0070709_10184872	3300005434	Bacteria	1466
90	Ga0070709_10480660	3300005434	Bacteria	940
91	Ga0070709_11096552	3300005434	Bacteria	636
92	Ga0070714_100040293	3300005435	Bacteria	3937
93	Ga0070714_100067912	3300005435	Bacteria	3076
94	Ga0070714_100107165	3300005435	Bacteria	2469
95	Ga0070714_100125033	3300005435	Bacteria	2292
96	Ga0070714_100240472	3300005435	Bacteria	1671
97	Ga0070714_100309048	3300005435	Bacteria	1476
98	Ga0070714_100327178	3300005435	Bacteria	1434
99	Ga0070714_100516403	3300005435	Bacteria	1141
100	Ga0070714_100645261	3300005435	Bacteria	1019
101	Ga0070714_100984120	3300005435	Bacteria	820
102	Ga0070713_100054482	3300005436	Bacteria	3318
103	Ga0070713_100134948	3300005436	Bacteria	2180
104	Ga0070713_100150938	3300005436	Bacteria	2067
105	Ga0070713_100159611	3300005436	Bacteria	2012
106	Ga0070713_100170252	3300005436	Bacteria	1951
107	Ga0070713_100310261	3300005436	Bacteria	1455
108	Ga0070713_100872619	3300005436	Bacteria	865
109	Ga0070713_102057563	3300005436	Bacteria	554
110	Ga0070710_10078629	3300005437	Bacteria	1920
111	Ga0070711_100010373	3300005439	Bacteria	5763
112	Ga0070711_100082334	3300005439	Bacteria	2297
113	Ga0070711_100092402	3300005439	Bacteria	2183
114	Ga0070711_100936117	3300005439	Bacteria	741
115	Ga0070705_100017248	3300005440	Bacteria	3766
116	Ga0070705_100944829	3300005440	Bacteria	696
117	Ga0070705_101027123	3300005440	Bacteria	670
118	Ga0070700_100047597	3300005441	Bacteria	2654
119	Ga0070700_100194323	3300005441	Bacteria	1421
120	Ga0070700_100207666	3300005441	Bacteria	1380
121	Ga0070700_100320279	3300005441	Bacteria	1139
122	Ga0070700_100925416	3300005441	Bacteria	711
123	Ga0070708_100120161	3300005445	Bacteria	2423
124	Ga0070663_100002668	3300005455	Bacteria	10108
125	Ga0070663_100033059	3300005455	Bacteria	3570
126	Ga0070663_100075556	3300005455	Bacteria	2463
127	Ga0070663_100187089	3300005455	Bacteria	1610
128	Ga0070663_100485468	3300005455	Bacteria	1023
129	Ga0070663_100682620	3300005455	Bacteria	871
130	Ga0070678_100120299	3300005456	Bacteria	2070
131	Ga0070678_100186502	3300005456	Bacteria	1702
132	Ga0070678_100484879	3300005456	Bacteria	1088
133	Ga0070678_101129453	3300005456	Bacteria	724
134	Ga0070662_100256251	3300005457	Bacteria	1408
135	Ga0070662_100327104	3300005457	Bacteria	1251
136	Ga0070662_100650976	3300005457	Bacteria	889
137	Ga0070662_100691154	3300005457	Bacteria	862
138	Ga0070681_10099207	3300005458	Bacteria	2859
139	Ga0070681_10351891	3300005458	Bacteria	1383
140	Ga0070681_10435919	3300005458	Bacteria	1222
141	Ga0070681_10590750	3300005458	Bacteria	1025
142	Ga0068867_100256310	3300005459	Bacteria	1424
143	Ga0068867_100264266	3300005459	Bacteria	1404
144	Ga0068867_100448570	3300005459	Bacteria	1098
145	Ga0070706_100317200	3300005467	Bacteria	1454
146	Ga0070707_100052880	3300005468	Bacteria	3894
147	Ga0070707_100228805	3300005468	Bacteria	1810
148	Ga0070707_101289819	3300005468	Bacteria	697
149	Ga0070699_100364883	3300005518	Bacteria	1302
150	Ga0070679_100013649	3300005530	Bacteria	7782
151	Ga0070679_100015214	3300005530	Bacteria	7390
152	Ga0070679_100097241	3300005530	Bacteria	2932
153	Ga0070679_100513109	3300005530	Bacteria	1143
154	Ga0070679_101015650	3300005530	Bacteria	773
155	Ga0070679_101256167	3300005530	Bacteria	686
156	Ga0070679_101737089	3300005530	Bacteria	572
157	Ga0070684_101331831	3300005535	Bacteria	676
158	Ga0070697_100470528	3300005536	Bacteria	1096
159	Ga0070697_100560212	3300005536	Bacteria	1002
160	Ga0068853_100004481	3300005539	Bacteria	10832
161	Ga0068853_100015855	3300005539	Bacteria	6189
162	Ga0068853_100052971	3300005539	Bacteria	3495
163	Ga0068853_100110318	3300005539	Bacteria	2443
164	Ga0068853_100127077	3300005539	Bacteria	2278
165	Ga0068853_100226854	3300005539	Bacteria	1708
166	Ga0070686_100791852	3300005544	Bacteria	763
167	Ga0070695_100046457	3300005545	Bacteria	2770
168	Ga0070696_100044865	3300005546	Bacteria	3062
169	Ga0070696_100304377	3300005546	Bacteria	1222
170	Ga0070693_100024540	3300005547	Bacteria	3234
171	Ga0070693_100328862	3300005547	Bacteria	1039
172	Ga0070693_100417981	3300005547	Bacteria	934
173	Ga0070693_100620606	3300005547	Bacteria	783
174	Ga0070665_100202041	3300005548	Bacteria	1988
175	Ga0070665_100266722	3300005548	Bacteria	1713
176	Ga0070665_100317782	3300005548	Bacteria	1561
177	Ga0070665_100465487	3300005548	Bacteria	1274
178	Ga0070665_100728740	3300005548	Bacteria	1004
179	Ga0070665_100840034	3300005548	Bacteria	931
180	Ga0070665_101529853	3300005548	Bacteria	675
181	Ga0070704_100348830	3300005549	Bacteria	1249
182	Ga0070704_100457054	3300005549	Bacteria	1101
183	Ga0070704_100649093	3300005549	Bacteria	931
184	Ga0068855_100053970	3300005563	Bacteria	4727
185	Ga0068855_100182115	3300005563	Bacteria	2375
186	Ga0068855_100192336	3300005563	Bacteria	2301
187	Ga0068855_100410078	3300005563	Bacteria	1483
188	Ga0068855_100467885	3300005563	Bacteria	1374
189	Ga0068855_100576464	3300005563	Bacteria	1216
190	Ga0070664_100074373	3300005564	Bacteria	2916
191	Ga0070664_100116463	3300005564	Bacteria	2337
192	Ga0070664_100231739	3300005564	Bacteria	1655
193	Ga0070664_100367144	3300005564	Bacteria	1311
194	Ga0070664_100927873	3300005564	Bacteria	817
195	Ga0068857_100017569	3300005577	Bacteria	6271
196	Ga0068857_100121424	3300005577	Bacteria	2352
197	Ga0068857_100317305	3300005577	Bacteria	1439
198	Ga0068857_100879236	3300005577	Bacteria	858
199	Ga0068854_100038649	3300005578	Bacteria	3357
200	Ga0068854_100448913	3300005578	Bacteria	1076
201	Ga0068854_100570165	3300005578	Bacteria	963
202	Ga0068854_100946911	3300005578	Bacteria	759
203	Ga0068856_100006094	3300005614	Bacteria	11843
204	Ga0068856_100065862	3300005614	Bacteria	3580
205	Ga0068856_100110816	3300005614	Bacteria	2742
206	Ga0068856_100156583	3300005614	Bacteria	2288
207	Ga0068856_100340456	3300005614	Bacteria	1518
208	Ga0068856_100491810	3300005614	Bacteria	1248
209	Ga0068856_100581455	3300005614	Bacteria	1141
210	Ga0068856_100724808	3300005614	Bacteria	1015
211	Ga0068856_101029015	3300005614	Bacteria	842
212	Ga0068856_101457740	3300005614	Bacteria	699
213	Ga0070702_100162870	3300005615	Bacteria	1443
214	Ga0070702_100345157	3300005615	Bacteria	1046
215	Ga0070702_100348940	3300005615	Bacteria	1041
216	Ga0068852_100146565	3300005616	Bacteria	2190
217	Ga0068852_100284438	3300005616	Bacteria	1595
218	Ga0068852_100690072	3300005616	Bacteria	1030
219	Ga0068859_100376432	3300005617	Bacteria	1515
220	Ga0068864_100053281	3300005618	Bacteria	3489
221	Ga0068864_101118178	3300005618	Bacteria	784
222	Ga0068861_100105909	3300005719	Bacteria	2246
223	Ga0068861_100147764	3300005719	Bacteria	1925
224	Ga0068861_100199789	3300005719	Bacteria	1677
225	Ga0068861_100205950	3300005719	Bacteria	1654
226	Ga0068861_101310056	3300005719	Bacteria	704
227	Ga0068851_10010739	3300005834	Bacteria	4279
228	Ga0068851_10013775	3300005834	Bacteria	3829
229	Ga0068851_10344548	3300005834	Bacteria	866
230	Ga0068870_11095314	3300005840	Bacteria	572
231	Ga0068863_100697453	3300005841	Bacteria	1009
232	Ga0068863_101108205	3300005841	Bacteria	796
233	Ga0068858_100094213	3300005842	Bacteria	2789
234	Ga0068858_100286803	3300005842	Bacteria	1568
235	Ga0068858_100414076	3300005842	Bacteria	1296
236	Ga0068858_100496569	3300005842	Bacteria	1179
237	Ga0068858_100680454	3300005842	Bacteria	1000
238	Ga0068860_100212431	3300005843	Bacteria	1877
239	Ga0068860_100219985	3300005843	Bacteria	1844
240	Ga0068860_100714014	3300005843	Bacteria	1013
241	Ga0068862_100312937	3300005844	Bacteria	1447
242	Ga0068862_100404856	3300005844	Bacteria	1277
243	Ga0081455_10006971	3300005937	Bacteria	12007
244	Ga0081455_10099315	3300005937	Bacteria	2341
245	Ga0081455_10103796	3300005937	Bacteria	2276
246	Ga0081455_10177877	3300005937	Bacteria	1614
247	Ga0081538_10006363	3300005981	Bacteria	10416
248	Ga0081538_10029956	3300005981	Bacteria	3705
249	Ga0081538_10096366	3300005981	Bacteria	1507
250	Ga0081540_1004115	3300005983	Bacteria	11230
251	Ga0081540_1009520	3300005983	Bacteria	6689
252	Ga0081540_1012618	3300005983	Bacteria	5545
253	Ga0081540_1044223	3300005983	Bacteria	2275
254	Ga0081540_1045436	3300005983	Bacteria	2230
255	Ga0081539_10000269	3300005985	Bacteria	119082
256	Ga0081539_10062546	3300005985	Bacteria	2034
257	Ga0070717_10012560	3300006028	Bacteria	6461
258	Ga0070717_10188204	3300006028	Bacteria	1802
259	Ga0070717_10270330	3300006028	Bacteria	1506
260	Ga0070717_10443987	3300006028	Bacteria	1169
261	Ga0070717_10577867	3300006028	Bacteria	1019
262	Ga0070717_10685922	3300006028	Bacteria	930
263	Ga0070717_11259602	3300006028	Bacteria	673
264	Ga0075365_10001148	3300006038	Bacteria	11592
265	Ga0075365_10021956	3300006038	Bacteria	3991
266	Ga0075365_10037942	3300006038	Bacteria	3129
267	Ga0075365_10169721	3300006038	Bacteria	1522
268	Ga0075365_10289964	3300006038	Bacteria	1151
269	Ga0075365_10312920	3300006038	Bacteria	1105
270	Ga0075365_10393637	3300006038	Bacteria	977
271	Ga0075365_10453573	3300006038	Bacteria	905
272	Ga0075365_10526887	3300006038	Bacteria	835
273	Ga0075368_10011878	3300006042	Bacteria	3177
274	Ga0075368_10019458	3300006042	Bacteria	2563
275	Ga0075368_10030901	3300006042	Bacteria	2076
276	Ga0075368_10116709	3300006042	Bacteria	1103
277	Ga0075363_100012935	3300006048	Bacteria	4030
278	Ga0075363_100070792	3300006048	Bacteria	1894
279	Ga0075363_100154702	3300006048	Bacteria	1296
280	Ga0075363_100191860	3300006048	Bacteria	1165
281	Ga0075363_100604166	3300006048	Bacteria	657
282	Ga0075364_10002911	3300006051	Bacteria	9655
283	Ga0075364_10060438	3300006051	Bacteria	2485
284	Ga0075364_10098573	3300006051	Bacteria	1944
285	Ga0075364_10109707	3300006051	Bacteria	1840
286	Ga0075364_10482445	3300006051	Bacteria	847
287	Ga0075364_10953889	3300006051	Bacteria	583
288	Ga0070715_10001086	3300006163	Bacteria	7704
289	Ga0070715_10129998	3300006163	Bacteria	1211
290	Ga0070715_10152446	3300006163	Bacteria	1134
291	Ga0070715_10574979	3300006163	Bacteria	657
292	Ga0070716_100043081	3300006173	Bacteria	2522
293	Ga0070716_100079982	3300006173	Bacteria	1948
294	Ga0070716_100201071	3300006173	Bacteria	1324
295	Ga0070716_100239911	3300006173	Bacteria	1229
296	Ga0070712_100020148	3300006175	Bacteria	4361
297	Ga0070712_100029091	3300006175	Bacteria	3702
298	Ga0070712_100040277	3300006175	Bacteria	3202
299	Ga0070712_100051258	3300006175	Bacteria	2874
300	Ga0070712_100065885	3300006175	Bacteria	2572
301	Ga0070712_100106069	3300006175	Bacteria	2088
302	Ga0070712_100227178	3300006175	Bacteria	1480
303	Ga0070712_101129473	3300006175	Bacteria	680
304	Ga0075362_10039615	3300006177	Bacteria	2072
305	Ga0075362_10246093	3300006177	Bacteria	879
306	Ga0075367_10017705	3300006178	Bacteria	3916
307	Ga0075367_10020853	3300006178	Bacteria	3655
308	Ga0075367_10054685	3300006178	Bacteria	2367
309	Ga0075367_10071918	3300006178	Bacteria	2081
310	Ga0075367_10136228	3300006178	Bacteria	1519
311	Ga0075367_10354826	3300006178	Bacteria	926
312	Ga0075367_10422703	3300006178	Bacteria	844
313	Ga0075367_10497395	3300006178	Bacteria	773
314	Ga0075367_10625147	3300006178	Bacteria	685
315	Ga0075369_10150029	3300006186	Bacteria	1065
316	Ga0075369_10276272	3300006186	Bacteria	782
317	Ga0075366_10056170	3300006195	Bacteria	2338
318	Ga0075366_10347946	3300006195	Bacteria	909
319	Ga0075366_10766804	3300006195	Bacteria	600
320	Ga0097621_100048649	3300006237	Bacteria	3441
321	Ga0097621_100138895	3300006237	Bacteria	2075
322	Ga0075370_10045609	3300006353	Bacteria	2479
323	Ga0075370_10067306	3300006353	Bacteria	2044
324	Ga0068871_100098510	3300006358	Bacteria	2446
325	Ga0068871_100104538	3300006358	Bacteria	2375
326	Ga0068871_100221941	3300006358	Bacteria	1638
327	Ga0068871_100287230	3300006358	Bacteria	1440
328	Ga0068871_100455643	3300006358	Bacteria	1147
329	Ga0068871_100705398	3300006358	Bacteria	925
330	Ga0075428_100111035	3300006844	Bacteria	2987
331	Ga0075430_100290390	3300006846	Bacteria	1353
332	Ga0075433_10345305	3300006852	Bacteria	1315
333	Ga0075434_100008873	3300006871	Bacteria	9361
334	Ga0075434_100492674	3300006871	Bacteria	1246
335	Ga0075434_100516617	3300006871	Bacteria	1215
336	Ga0075434_100760914	3300006871	Bacteria	985
337	Ga0075434_100767893	3300006871	Bacteria	980
338	Ga0075429_100164183	3300006880	Bacteria	1945
339	Ga0068865_100172053	3300006881	Bacteria	1661
340	Ga0068865_100250603	3300006881	Bacteria	1397
341	Ga0097620_100376432	3300006931	Bacteria	1515
342	Ga0099825_1017862	3300006941	Bacteria	5680
343	Ga0099825_1037273	3300006941	Bacteria	1619
344	Ga0099824_1004496	3300006942	Bacteria	20072
345	Ga0079104_1001982	3300006946	Bacteria	12009
346	Ga0079104_1013021	3300006946	Bacteria	2584
347	Ga0075435_100187882	3300007076	Bacteria	1748
348	Ga0075435_100441616	3300007076	Bacteria	1122
349	Ga0075435_100623339	3300007076	Bacteria	936
350	Ga0099794_10099610	3300007265	Bacteria	1450
351	Ga0099794_10100121	3300007265	Bacteria	1446
352	Ga0099795_10025562	3300007788	Bacteria	1982
353	Ga0099795_10159088	3300007788	Bacteria	931
354	Ga0099795_10349830	3300007788	Bacteria	661
355	Ga0105240_10037022	3300009093	Bacteria	6272
356	Ga0105240_10052173	3300009093	Bacteria	5142
357	Ga0105240_10542023	3300009093	Bacteria	1288
358	Ga0105240_10690301	3300009093	Bacteria	1115
359	Ga0105240_10744908	3300009093	Bacteria	1066
360	Ga0105240_10795883	3300009093	Bacteria	1024
361	Ga0105240_10961784	3300009093	Bacteria	915
362	Ga0105245_10007199	3300009098	Bacteria	9750
363	Ga0105245_10018719	3300009098	Bacteria	6058
364	Ga0105245_10625170	3300009098	Bacteria	1105
365	Ga0105247_10071185	3300009101	Bacteria	2174
366	Ga0105247_10225225	3300009101	Bacteria	1271
367	Ga0114129_10210254	3300009147	Bacteria	2630
368	Ga0114129_11191228	3300009147	Bacteria	949
369	Ga0105243_10023714	3300009148	Bacteria	4676
370	Ga0105243_10084140	3300009148	Bacteria	2605
371	Ga0105243_10154569	3300009148	Bacteria	1971
372	Ga0105243_11149734	3300009148	Bacteria	787
373	Ga0105241_10006398	3300009174	Bacteria	8680
374	Ga0105241_10007066	3300009174	Bacteria	8267
375	Ga0105241_10022614	3300009174	Bacteria	4657
376	Ga0105241_10026213	3300009174	Bacteria	4335
377	Ga0105241_10196962	3300009174	Bacteria	1680
378	Ga0105241_10791239	3300009174	Bacteria	873
379	Ga0105241_10870750	3300009174	Bacteria	834
380	Ga0105241_11073507	3300009174	Bacteria	757
381	Ga0105241_11185435	3300009174	Bacteria	723
382	Ga0105242_10362596	3300009176	Bacteria	1342
383	Ga0105242_10434987	3300009176	Bacteria	1233
384	Ga0105242_10836309	3300009176	Bacteria	915
385	Ga0105242_10845111	3300009176	Bacteria	910
386	Ga0105248_10188977	3300009177	Bacteria	2321
387	Ga0105248_10605353	3300009177	Bacteria	1236
388	Ga0105237_10013015	3300009545	Bacteria	8736
389	Ga0105237_10013957	3300009545	Bacteria	8407
390	Ga0105237_10021626	3300009545	Bacteria	6612
391	Ga0105237_10084684	3300009545	Bacteria	3160
392	Ga0105237_10222293	3300009545	Bacteria	1888
393	Ga0105237_10387545	3300009545	Bacteria	1402
394	Ga0105237_10532361	3300009545	Bacteria	1182
395	Ga0105238_10003269	3300009551	Bacteria	16169
396	Ga0105238_10008289	3300009551	Bacteria	10393
397	Ga0105238_10012843	3300009551	Bacteria	8450
398	Ga0105238_10106916	3300009551	Bacteria	2779
399	Ga0105238_10447990	3300009551	Bacteria	1288
400	Ga0105249_10005485	3300009553	Bacteria	10958
401	Ga0105249_10250408	3300009553	Bacteria	1756
402	Ga0105249_10253912	3300009553	Bacteria	1744
403	Ga0105249_12319179	3300009553	Bacteria	609
404	Ga0099796_10017133	3300010159	Bacteria	2152
405	Ga0099796_10084515	3300010159	Bacteria	1169
406	Ga0105239_10024638	3300010375	Bacteria	6628
407	Ga0105239_10253991	3300010375	Bacteria	1975
408	Ga0105239_10421683	3300010375	Bacteria	1512
409	Ga0105239_10532503	3300010375	Bacteria	1337
410	Ga0105239_11306517	3300010375	Bacteria	837
411	Ga0105246_10034876	3300011119	Bacteria	3357
412	Ga0105246_10177407	3300011119	Bacteria	1637
413	Ga0105246_10213206	3300011119	Bacteria	1509
414	Ga0105246_11806720	3300011119	Bacteria	584
415	Ga0157373_10302250	3300013100	Bacteria	1136
416	Ga0157373_10339718	3300013100	Bacteria	1070
417	Ga0157371_10002810	3300013102	Bacteria	16312
418	Ga0157370_10157794	3300013104	Bacteria	2111
419	Ga0157370_10205708	3300013104	Bacteria	1825
420	Ga0157370_10823742	3300013104	Bacteria	844
421	Ga0157369_10008435	3300013105	Bacteria	11819
422	Ga0157369_10012732	3300013105	Bacteria	9537
423	Ga0157369_10013675	3300013105	Bacteria	9176
424	Ga0157369_10027369	3300013105	Bacteria	6320
425	Ga0157369_10521711	3300013105	Bacteria	1229
426	Ga0157369_10562759	3300013105	Bacteria	1178
427	Ga0157369_10640320	3300013105	Bacteria	1097
428	Ga0157369_10658223	3300013105	Bacteria	1080
429	Ga0157369_11133780	3300013105	Bacteria	799
430	Ga0157374_10078358	3300013296	Bacteria	3129
431	Ga0157374_11294295	3300013296	Bacteria	751
432	Ga0157378_10015347	3300013297	Bacteria	6709
433	Ga0157378_10095012	3300013297	Bacteria	2715
434	Ga0157378_10833971	3300013297	Bacteria	949
435	Ga0163162_10071640	3300013306	Bacteria	3519
436	Ga0163162_10291419	3300013306	Bacteria	1764
437	Ga0163162_10402884	3300013306	Bacteria	1501
438	Ga0157372_10029313	3300013307	Bacteria	6008
439	Ga0157372_10189922	3300013307	Bacteria	2379
440	Ga0157372_10230616	3300013307	Bacteria	2146
441	Ga0157372_10400637	3300013307	Bacteria	1599
442	Ga0157372_10870711	3300013307	Bacteria	1045
443	Ga0157375_10022349	3300013308	Bacteria	5821
444	Ga0157375_10108521	3300013308	Bacteria	2870
445	Ga0157375_10121039	3300013308	Bacteria	2727
446	Ga0157375_10276356	3300013308	Bacteria	1842
447	Ga0157375_10457104	3300013308	Bacteria	1442
448	Ga0163163_10006520	3300014325	Bacteria	10217
449	Ga0163163_10339099	3300014325	Bacteria	1558
450	Ga0163163_10931521	3300014325	Bacteria	932
451	Ga0163163_11077902	3300014325	Bacteria	866
452	Ga0163163_11093098	3300014325	Bacteria	860
453	Ga0157380_10188014	3300014326	Bacteria	1821
454	Ga0157380_10418173	3300014326	Bacteria	1278
455	Ga0157380_10576683	3300014326	Bacteria	1108
456	Ga0182008_10248454	3300014497	Bacteria	917
457	Ga0182008_10770576	3300014497	Bacteria	556
458	Ga0157379_10006803	3300014968	Bacteria	9883
459	Ga0157379_10069660	3300014968	Bacteria	3146
460	Ga0157379_10105753	3300014968	Bacteria	2526
461	Ga0157379_10680363	3300014968	Bacteria	965
462	Ga0157379_11176270	3300014968	Bacteria	737
463	Ga0157376_10054267	3300014969	Bacteria	3340
464	Ga0157376_10054586	3300014969	Bacteria	3331
465	Ga0157376_10354315	3300014969	Bacteria	1405
466	Ga0182006_1064411	3300015261	Bacteria	1375
467	Ga0182007_10055894	3300015262	Bacteria	1297
468	Ga0182007_10257488	3300015262	Bacteria	628
469	Ga0163161_10046486	3300017792	Bacteria	3132
470	Ga0163161_10332821	3300017792	Bacteria	1203
471	Ga0163161_10623584	3300017792	Bacteria	891
472	Ga0197907_10172879	3300020069	Bacteria	1111
473	Ga0206352_10199053	3300020078	Bacteria	584
474	Ga0214544_1000009	3300021320	Bacteria	285865
475	Ga0214542_1000002	3300021321	Bacteria	720798
476	Ga0214545_1000002	3300021324	Bacteria	727485
477	Ga0214543_1000013	3300021327	Bacteria	329117
478	Ga0213873_10009424	3300021358	Bacteria	2028
479	Ga0213873_10045356	3300021358	Bacteria	1146
480	Ga0213873_10097241	3300021358	Bacteria	843
481	Ga0213872_10243199	3300021361	Bacteria	760
482	Ga0213876_10013034	3300021384	Bacteria	4418
483	Ga0213876_10013713	3300021384	Bacteria	4294
484	Ga0213876_10039731	3300021384	Bacteria	2486
485	Ga0213875_10000165	3300021388	Bacteria	68805
486	Ga0213871_10004808	3300021441	Bacteria	2735
487	Ga0224712_10182813	3300022467	Bacteria	945
488	Ga0224570_105612	3300022730	Bacteria	765
489	Ga0228711_1000591	3300022739	Bacteria	46284
490	Ga0228710_1000186	3300022740	Bacteria	61784
491	Ga0256744_122998	3300023309	Bacteria	741
492	Ga0209436_101681	3300025208	Bacteria	7333
493	Ga0209233_1001302	3300025261	Bacteria	9962
494	Ga0209130_1000007	3300025284	Bacteria	591584
495	Ga0209130_1030772	3300025284	Bacteria	1106
496	Ga0207673_1009161	3300025290	Bacteria	1261
497	Ga0209676_1006685	3300025292	Bacteria	5617
498	Ga0209025_1000943	3300025294	Bacteria	44218
499	Ga0209564_1000330	3300025295	Bacteria	92033
500	Ga0209564_1000726	3300025295	Bacteria	47041
501	Ga0209564_1030321	3300025295	Bacteria	1677
502	Ga0209758_1000100	3300025297	Bacteria	227948
503	Ga0209758_1000160	3300025297	Bacteria	154304
504	Ga0209758_1003932	3300025297	Bacteria	12945
505	Ga0209758_1072772	3300025297	Bacteria	1074
506	Ga0209050_1010941	3300025298	Bacteria	4385
507	Ga0209256_1018415	3300025299	Bacteria	2270
508	Ga0207426_1000064	3300025302	Bacteria	358276
509	Ga0209257_1005520	3300025304	Bacteria	8819
510	Ga0209257_1005571	3300025304	Bacteria	8758
511	Ga0207697_10279362	3300025315	Bacteria	740
512	Ga0207656_10001550	3300025321	Bacteria	7624
513	Ga0207656_10110968	3300025321	Bacteria	1267
514	Ga0207656_10137017	3300025321	Bacteria	1151
515	Ga0207656_10244713	3300025321	Bacteria	877
516	Ga0207696_1107795	3300025711	Bacteria	756
517	Ga0207653_10183399	3300025885	Bacteria	784
518	Ga0207682_10134960	3300025893	Bacteria	1104
519	Ga0207692_10002064	3300025898	Bacteria	7672
520	Ga0207692_10007251	3300025898	Bacteria	4533
521	Ga0207692_10131690	3300025898	Bacteria	1413
522	Ga0207642_10588633	3300025899	Bacteria	691
523	Ga0207710_10435017	3300025900	Bacteria	676
524	Ga0207688_10121411	3300025901	Bacteria	1525
525	Ga0207680_10591836	3300025903	Bacteria	793
526	Ga0207647_10001638	3300025904	Bacteria	17221
527	Ga0207647_10322252	3300025904	Bacteria	877
528	Ga0207647_10410034	3300025904	Bacteria	763
529	Ga0207685_10271544	3300025905	Bacteria	828
530	Ga0207699_10001291	3300025906	Bacteria	11902
531	Ga0207699_10030880	3300025906	Bacteria	3003
532	Ga0207699_10103636	3300025906	Bacteria	1810
533	Ga0207699_10719574	3300025906	Bacteria	731
534	Ga0207699_10799157	3300025906	Bacteria	693
535	Ga0207645_10030138	3300025907	Bacteria	3496
536	Ga0207645_10223170	3300025907	Bacteria	1242
537	Ga0207643_10038841	3300025908	Bacteria	2675
538	Ga0207705_10063652	3300025909	Bacteria	2665
539	Ga0207705_10118695	3300025909	Bacteria	1961
540	Ga0207705_10178414	3300025909	Bacteria	1602
541	Ga0207684_10087512	3300025910	Bacteria	2654
542	Ga0207654_10003299	3300025911	Bacteria	8158
543	Ga0207654_10008241	3300025911	Bacteria	5260
544	Ga0207654_10229509	3300025911	Bacteria	1235
545	Ga0207654_10323501	3300025911	Bacteria	1055
546	Ga0207654_10667581	3300025911	Bacteria	745
547	Ga0207654_11108205	3300025911	Bacteria	577
548	Ga0207707_10000494	3300025912	Bacteria	40531
549	Ga0207707_10000896	3300025912	Bacteria	29115
550	Ga0207707_10026257	3300025912	Bacteria	5091
551	Ga0207707_10805016	3300025912	Bacteria	783
552	Ga0207695_10001915	3300025913	Bacteria	32381
553	Ga0207695_10068825	3300025913	Bacteria	3626
554	Ga0207695_10076100	3300025913	Bacteria	3413
555	Ga0207695_10130622	3300025913	Bacteria	2470
556	Ga0207695_10320682	3300025913	Bacteria	1439
557	Ga0207695_10813533	3300025913	Bacteria	814
558	Ga0207695_10845903	3300025913	Bacteria	795
559	Ga0207671_10037241	3300025914	Bacteria	3608
560	Ga0207671_10042433	3300025914	Bacteria	3367
561	Ga0207671_10064798	3300025914	Bacteria	2717
562	Ga0207671_10509037	3300025914	Bacteria	960
563	Ga0207671_10749266	3300025914	Bacteria	776
564	Ga0207693_10012373	3300025915	Bacteria	6893
565	Ga0207693_10013898	3300025915	Bacteria	6483
566	Ga0207693_10020042	3300025915	Bacteria	5319
567	Ga0207693_10133565	3300025915	Bacteria	1951
568	Ga0207693_10137806	3300025915	Bacteria	1919
569	Ga0207693_10175239	3300025915	Bacteria	1688
570	Ga0207693_10478803	3300025915	Bacteria	972
571	Ga0207693_10580013	3300025915	Bacteria	874
572	Ga0207693_10591129	3300025915	Bacteria	864
573	Ga0207663_10007002	3300025916	Bacteria	5817
574	Ga0207663_10901524	3300025916	Bacteria	707
575	Ga0207660_10001052	3300025917	Bacteria	18273
576	Ga0207660_10017659	3300025917	Bacteria	4744
577	Ga0207660_10105913	3300025917	Bacteria	2108
578	Ga0207660_11029126	3300025917	Bacteria	671
579	Ga0207662_10039439	3300025918	Bacteria	2771
580	Ga0207657_10003957	3300025919	Bacteria	15726
581	Ga0207657_10454065	3300025919	Bacteria	1005
582	Ga0207657_10962782	3300025919	Bacteria	656
583	Ga0207652_10001721	3300025921	Bacteria	19093
584	Ga0207652_10002542	3300025921	Bacteria	15319
585	Ga0207652_10029879	3300025921	Bacteria	4561
586	Ga0207652_10054909	3300025921	Bacteria	3425
587	Ga0207652_10055375	3300025921	Bacteria	3411
588	Ga0207652_10897719	3300025921	Bacteria	783
589	Ga0207652_11106608	3300025921	Bacteria	693
590	Ga0207646_10053258	3300025922	Bacteria	3620
591	Ga0207646_10656744	3300025922	Bacteria	939
592	Ga0207681_10855157	3300025923	Bacteria	761
593	Ga0207694_10000560	3300025924	Bacteria	33675
594	Ga0207694_10021453	3300025924	Bacteria	4895
595	Ga0207694_10113842	3300025924	Bacteria	2154
596	Ga0207694_10652473	3300025924	Bacteria	887
597	Ga0207694_10815736	3300025924	Bacteria	788
598	Ga0207650_10011843	3300025925	Bacteria	6008
599	Ga0207650_10516885	3300025925	Bacteria	999
600	Ga0207650_11152948	3300025925	Bacteria	660
601	Ga0207687_10036772	3300025927	Bacteria	3336
602	Ga0207687_10063194	3300025927	Bacteria	2620
603	Ga0207687_10236972	3300025927	Bacteria	1444
604	Ga0207700_10000752	3300025928	Bacteria	18675
605	Ga0207700_10178935	3300025928	Bacteria	1774
606	Ga0207700_10231571	3300025928	Bacteria	1571
607	Ga0207700_10545943	3300025928	Bacteria	1028
608	Ga0207700_10565497	3300025928	Bacteria	1010
609	Ga0207700_10924032	3300025928	Bacteria	781
610	Ga0207700_10973937	3300025928	Bacteria	759
611	Ga0207700_11338823	3300025928	Bacteria	638
612	Ga0207664_10019866	3300025929	Bacteria	4972
613	Ga0207664_10028873	3300025929	Bacteria	4220
614	Ga0207664_10045802	3300025929	Bacteria	3431
615	Ga0207664_10049105	3300025929	Bacteria	3320
616	Ga0207664_10107890	3300025929	Bacteria	2311
617	Ga0207664_10127083	3300025929	Bacteria	2142
618	Ga0207664_10138268	3300025929	Bacteria	2057
619	Ga0207664_10316398	3300025929	Bacteria	1376
620	Ga0207664_10521755	3300025929	Bacteria	1065
621	Ga0207644_10076900	3300025931	Bacteria	2457
622	Ga0207690_10031062	3300025932	Bacteria	3414
623	Ga0207690_10335233	3300025932	Bacteria	1192
624	Ga0207690_10755500	3300025932	Bacteria	802
625	Ga0207706_10335182	3300025933	Bacteria	1316
626	Ga0207706_10344451	3300025933	Bacteria	1296
627	Ga0207706_10429869	3300025933	Bacteria	1144
628	Ga0207686_10145696	3300025934	Bacteria	1642
629	Ga0207709_10065482	3300025935	Bacteria	2286
630	Ga0207709_10154825	3300025935	Bacteria	1592
631	Ga0207669_10178280	3300025937	Bacteria	1520
632	Ga0207669_11310944	3300025937	Bacteria	615
633	Ga0207704_10154114	3300025938	Bacteria	1626
634	Ga0207665_10004741	3300025939	Bacteria	9038
635	Ga0207665_10051117	3300025939	Bacteria	2781
636	Ga0207665_10093913	3300025939	Bacteria	2083
637	Ga0207665_10139671	3300025939	Bacteria	1726
638	Ga0207665_10463519	3300025939	Bacteria	974
639	Ga0207665_11204652	3300025939	Bacteria	604
640	Ga0207691_10218045	3300025940	Bacteria	1655
641	Ga0207711_10154164	3300025941	Bacteria	2075
642	Ga0207689_11412658	3300025942	Bacteria	583
643	Ga0207661_10015207	3300025944	Bacteria	5658
644	Ga0207661_10043563	3300025944	Bacteria	3542
645	Ga0207661_10049175	3300025944	Bacteria	3355
646	Ga0207661_10583109	3300025944	Bacteria	1026
647	Ga0207679_10054680	3300025945	Bacteria	2940
648	Ga0207679_10249266	3300025945	Bacteria	1509
649	Ga0207679_10937797	3300025945	Bacteria	792
650	Ga0207679_11166438	3300025945	Bacteria	707
651	Ga0207667_10003512	3300025949	Bacteria	19383
652	Ga0207667_10031904	3300025949	Bacteria	5681
653	Ga0207667_10036764	3300025949	Bacteria	5243
654	Ga0207667_10217254	3300025949	Bacteria	1959
655	Ga0207667_10589605	3300025949	Bacteria	1122
656	Ga0207667_11295260	3300025949	Bacteria	705
657	Ga0207651_10120092	3300025960	Bacteria	1992
658	Ga0207651_11328753	3300025960	Bacteria	646
659	Ga0207668_10146431	3300025972	Bacteria	1823
660	Ga0207668_10212401	3300025972	Bacteria	1548
661	Ga0207640_10087632	3300025981	Bacteria	2146
662	Ga0207640_10166009	3300025981	Bacteria	1639
663	Ga0207640_10494629	3300025981	Bacteria	1017
664	Ga0207658_10465681	3300025986	Bacteria	1121
665	Ga0207658_10569488	3300025986	Bacteria	1015
666	Ga0207677_10018049	3300026023	Bacteria	4226
667	Ga0207703_10013791	3300026035	Bacteria	6300
668	Ga0207703_10562784	3300026035	Bacteria	1076
669	Ga0207703_10597987	3300026035	Bacteria	1043
670	Ga0207703_10825490	3300026035	Bacteria	886
671	Ga0207703_11878431	3300026035	Bacteria	575
672	Ga0207639_10021943	3300026041	Bacteria	4593
673	Ga0207639_10037656	3300026041	Bacteria	3593
674	Ga0207639_10041836	3300026041	Bacteria	3431
675	Ga0207639_10061426	3300026041	Bacteria	2902
676	Ga0207639_10280060	3300026041	Bacteria	1466
677	Ga0207639_11388373	3300026041	Bacteria	659
678	Ga0207678_10000332	3300026067	Bacteria	42422
679	Ga0207678_10004611	3300026067	Bacteria	12382
680	Ga0207678_10026691	3300026067	Bacteria	5039
681	Ga0207678_10052466	3300026067	Bacteria	3518
682	Ga0207678_11254623	3300026067	Bacteria	656
683	Ga0207708_10062304	3300026075	Bacteria	2849
684	Ga0207708_10140455	3300026075	Bacteria	1894
685	Ga0207702_10002920	3300026078	Bacteria	15999
686	Ga0207702_10004908	3300026078	Bacteria	11764
687	Ga0207702_10056968	3300026078	Bacteria	3320
688	Ga0207702_10122371	3300026078	Bacteria	2330
689	Ga0207702_10189778	3300026078	Bacteria	1898
690	Ga0207702_10582510	3300026078	Bacteria	1097
691	Ga0207702_11709235	3300026078	Bacteria	622
692	Ga0207641_10598618	3300026088	Bacteria	1079
693	Ga0207641_10946764	3300026088	Bacteria	856
694	Ga0207648_10247140	3300026089	Bacteria	1590
695	Ga0207648_10277553	3300026089	Bacteria	1498
696	Ga0207648_11200542	3300026089	Bacteria	712
697	Ga0207648_11435375	3300026089	Bacteria	649
698	Ga0207676_10286747	3300026095	Bacteria	1497
699	Ga0207676_10542209	3300026095	Bacteria	1110
700	Ga0207674_10016819	3300026116	Bacteria	7994
701	Ga0207674_10077541	3300026116	Bacteria	3329
702	Ga0207674_10090398	3300026116	Bacteria	3053
703	Ga0207674_10278261	3300026116	Bacteria	1621
704	Ga0207675_100089149	3300026118	Bacteria	2898
705	Ga0207675_100091921	3300026118	Bacteria	2853
706	Ga0207675_100418966	3300026118	Bacteria	1322
707	Ga0207683_10173172	3300026121	Bacteria	1955
708	Ga0207683_10801251	3300026121	Bacteria	874
709	Ga0207698_10033235	3300026142	Bacteria	3746
710	Ga0207698_10046487	3300026142	Bacteria	3278
711	Ga0207698_10232374	3300026142	Bacteria	1675
712	Ga0207698_11231393	3300026142	Bacteria	763
713	Ga0209281_1000236	3300027111	Bacteria	113362
714	Ga0209281_1000478	3300027111	Bacteria	55814
715	Ga0209389_1000084	3300027296	Bacteria	85267
716	Ga0209389_1000113	3300027296	Bacteria	72242
717	Ga0209589_1000023	3300027357	Bacteria	177856
718	Ga0209589_1000041	3300027357	Bacteria	125191
719	Ga0209489_100032	3300027361	Bacteria	177856
720	Ga0209489_100070	3300027361	Bacteria	138580
721	Ga0209489_107143	3300027361	Bacteria	17020
722	Ga0209700_100021	3300027363	Bacteria	230859
723	Ga0209700_100040	3300027363	Bacteria	177856
724	Ga0209179_1005261	3300027512	Bacteria	2013
725	Ga0209179_1057262	3300027512	Bacteria	843
726	Ga0209282_1000022	3300027666	Bacteria	173388
727	Ga0209588_1030958	3300027671	Bacteria	1711
728	Ga0209813_10006030	3300027866	Bacteria	2973
729	Ga0207428_10096125	3300027907	Bacteria	2294
730	Ga0207428_10352965	3300027907	Bacteria	1082
731	Ga0265357_1017704	3300028023	Bacteria	765
732	Ga0268266_10147096	3300028379	Bacteria	2120
733	Ga0268266_10158083	3300028379	Bacteria	2049
734	Ga0268266_10433144	3300028379	Bacteria	1248
735	Ga0268266_10625428	3300028379	Bacteria	1035
736	Ga0268266_11660383	3300028379	Bacteria	614
737	Ga0268265_10044540	3300028380	Bacteria	3304
738	Ga0268265_10311755	3300028380	Bacteria	1421
739	Ga0268265_10416782	3300028380	Bacteria	1246
740	Ga0268264_10288693	3300028381	Bacteria	1540
741	Ga0268264_10662288	3300028381	Bacteria	1034
742	Ga0268264_10694049	3300028381	Bacteria	1010
743	Ga0310981_1082270	3300029285	Bacteria	1050
744	Ga0265763_1001053	3300030763	Bacteria	1878
745	Ga0265773_1010373	3300031018	Bacteria	785
746	Ga0265760_10017474	3300031090	Bacteria	2060
747	Ga0265760_10195789	3300031090	Bacteria	681
748	Ga0265330_10032128	3300031235	Bacteria	2352
749	Ga0265330_10093264	3300031235	Bacteria	1291
750	Ga0265330_10327692	3300031235	Bacteria	646
751	Ga0265332_10054731	3300031238	Bacteria	1711
752	Ga0265332_10115174	3300031238	Bacteria	1131
753	Ga0265328_10000041	3300031239	Bacteria	89398
754	Ga0265328_10002936	3300031239	Bacteria	7610
755	Ga0265328_10046171	3300031239	Bacteria	1601
756	Ga0265340_10011816	3300031247	Bacteria	4627
757	Ga0265339_10038426	3300031249	Bacteria	2671
758	Ga0265339_10289676	3300031249	Bacteria	783
759	Ga0265331_10001829	3300031250	Bacteria	15071
760	Ga0265331_10057047	3300031250	Bacteria	1853
761	Ga0265327_10009162	3300031251	Bacteria	7193
762	Ga0307513_10587757	3300031456	Bacteria	823
763	Ga0307509_10858861	3300031507	Bacteria	572
764	Ga0307408_100136911	3300031548	Bacteria	1917
765	Ga0307408_100654546	3300031548	Bacteria	940
766	Ga0265313_10085459	3300031595	Bacteria	1426
767	Ga0265313_10090710	3300031595	Bacteria	1373
768	Ga0265313_10195696	3300031595	Bacteria	843
769	Ga0307508_10000038	3300031616	Bacteria	150186
770	Ga0307508_10551019	3300031616	Bacteria	751
771	Ga0265314_10010719	3300031711	Bacteria	7626
772	Ga0265314_10044240	3300031711	Bacteria	3157
773	Ga0265342_10005896	3300031712	Bacteria	9239
774	Ga0265342_10364501	3300031712	Bacteria	751
775	Ga0316576_10302130	3300031727	Bacteria	1196
776	Ga0307516_10607276	3300031730	Bacteria	748
777	Ga0307405_10447528	3300031731	Bacteria	1023
778	Ga0307412_10396612	3300031911	Bacteria	1122
779	Ga0307412_10969328	3300031911	Bacteria	749
780	Ga0307412_11130845	3300031911	Bacteria	698
781	Ga0315914_1000027	3300031967	Bacteria	106536
782	Ga0307416_100598347	3300032002	Bacteria	1182
783	Ga0307416_101010048	3300032002	Bacteria	935
784	Ga0307414_11330153	3300032004	Bacteria	667
785	Ga0307415_100871272	3300032126	Bacteria	828
786	Ga0307510_10099112	3300033180	Bacteria	2714
787	Ga0307510_10159079	3300033180	Bacteria	1860
788	Ga0315913_1000201	3300033430	Bacteria	43897
789	Ga0315911_1000001	3300033442	Bacteria	1088602
790	Ga0315915_1000001	3300033464	Bacteria	481518
791	Ga0316215_1008065	3300033544	Bacteria	1033
792	Ga0373930_0002958	3300034816	Bacteria	2672
793	Ga0373950_0016942	3300034818	Bacteria	1251
794	Ga0373926_0001023	3300035083	Bacteria	8192
795	Ga0373926_0024429	3300035083	Bacteria	2105
796	Ga0373926_0389574	3300035083	Bacteria	549
797	Ga0373928_0061237	3300035084	Bacteria	911
798	Ga0373928_0087846	3300035084	Bacteria	794
799	Ga0373929_0052685	3300035085	Bacteria	934
800	Ga0373929_0069246	3300035085	Bacteria	841
801	Ga0373934_0001298	3300035086	Bacteria	9102
802	Ga0373934_0025848	3300035086	Bacteria	2276
803	Ga0373934_0091704	3300035086	Bacteria	1225
804	Ga0373934_0111025	3300035086	Bacteria	1112
805	Ga0373944_0086254	3300035089	Bacteria	1044
806	Ga0373951_0028803	3300035091	Bacteria	1303
807	Ga0373952_0139787	3300035092	Bacteria	672
808	Ga0373923_0002016	3300035111	Bacteria	6109
809	Ga0373923_0002477	3300035111	Bacteria	5698
810	Ga0373923_0016894	3300035111	Bacteria	2781
811	Ga0373932_0034818	3300035112	Bacteria	1421
812	Ga0373936_0013716	3300035113	Bacteria	3092
813	Ga0373936_0018993	3300035113	Bacteria	2661
814	Ga0373936_0063273	3300035113	Bacteria	1514
815	Ga0373936_0087428	3300035113	Bacteria	1303
816	Ga0373939_0202858	3300035114	Bacteria	751
817	Ga0373941_0181458	3300035115	Bacteria	790
818	Ga0373945_0002268	3300035116	Bacteria	6018
819	Ga0373945_0008214	3300035116	Bacteria	3395
820	Ga0373945_0032300	3300035116	Bacteria	1854
821	Ga0373953_0006494	3300035117	Bacteria	3856
822	Ga0373953_0060374	3300035117	Bacteria	1549
823	Ga0373953_0061685	3300035117	Bacteria	1534
824	Ga0373954_0000741	3300035118	Bacteria	12587
825	Ga0373954_0337378	3300035118	Bacteria	744
826	Ga0373954_0361930	3300035118	Bacteria	716
827	Ga0373956_0000394	3300035119	Bacteria	17812
828	Ga0373956_0048981	3300035119	Bacteria	1894
829	Ga0373957_0000375	3300035120	Bacteria	11330
830	Ga0373957_0020784	3300035120	Bacteria	2324
831	Ga0373957_0268733	3300035120	Bacteria	720
832	Ga0373957_0397782	3300035120	Bacteria	592
833	Ga0373943_0002550	3300035170	Bacteria	8283
834	Ga0373943_0006273	3300035170	Bacteria	5341
835	Ga0373943_0159045	3300035170	Bacteria	1229
836	Ga0373943_0161182	3300035170	Bacteria	1221
837	Ga0373946_0001853	3300035171	Bacteria	7377
838	Ga0373946_0006127	3300035171	Bacteria	4357
839	Ga0373946_0353084	3300035171	Bacteria	735
840	Ga0373955_0000102	3300035172	Bacteria	34230
841	Ga0373955_0001328	3300035172	Bacteria	10490
842	Ga0373955_0241657	3300035172	Bacteria	1081
843	Ga0373955_0269748	3300035172	Bacteria	1023
844	Ga0373942_0149352	3300035207	Bacteria	750
845	Ga0316574_0020904	3300035398	Bacteria	3879
846	Ga0373924_0001614	3300035410	Bacteria	7396
847	Ga0373924_0007924	3300035410	Bacteria	3844
848	Ga0373924_0008169	3300035410	Bacteria	3794
849	Ga0373924_0048800	3300035410	Bacteria	1750
850	Ga0373924_0421046	3300035410	Bacteria	598
851	Ga0373935_0000917	3300035692	Bacteria	15926
852	Ga0373935_0003157	3300035692	Bacteria	9503
853	Ga0373935_0072985	3300035692	Bacteria	2217
854	Ga0373935_0118475	3300035692	Bacteria	1766
855	Ga0373935_0676707	3300035692	Bacteria	758
856	Ga0373927_0000225	3300035695	Bacteria	44840
857	Ga0373927_0021427	3300035695	Bacteria	4237
858	Ga0373927_0021716	3300035695	Bacteria	4206
859	Ga0373927_0046668	3300035695	Bacteria	2802
860	Ga0373927_0096347	3300035695	Bacteria	1923
861	Ga0373927_0127525	3300035695	Bacteria	1661
862	Ga0373927_0183094	3300035695	Bacteria	1374
863	Ga0373927_0359531	3300035695	Bacteria	960
864	Ga0373933_0001320	3300035724	Bacteria	14586
865	Ga0373933_0001518	3300035724	Bacteria	13555
866	Ga0373933_0002871	3300035724	Bacteria	9627
867	Ga0373933_0816033	3300035724	Bacteria	614
868	Ga0373947_0001251	3300035725	Bacteria	15645
869	Ga0373947_0011223	3300035725	Bacteria	5141
870	Ga0373947_0096593	3300035725	Bacteria	1850
871	Ga0373947_0242886	3300035725	Bacteria	1189
872	Ga0373947_0511089	3300035725	Bacteria	817
873	Ga0373937_0000958	3300036401	Bacteria	24483
874	Ga0373937_0008054	3300036401	Bacteria	9140
875	Ga0373937_0169637	3300036401	Bacteria	2047
876	Ga0373937_0213781	3300036401	Bacteria	1814
877	Ga0373937_0280044	3300036401	Bacteria	1575
878	Ga0373937_0984127	3300036401	Bacteria	792
879	Ga0373937_1293485	3300036401	Bacteria	677
880	Ga0373937_1678155	3300036401	Bacteria	582
881	Ga0265778_042939	3300036457	Bacteria	605
882	Ga0372808_000125	3300036459	Bacteria	4138
883	Ga0373925_0000012	3300037068	Bacteria	202139
884	Ga0373925_0000711	3300037068	Bacteria	31078
885	Ga0373925_0057892	3300037068	Bacteria	2905
886	Ga0373925_1013065	3300037068	Bacteria	684
887	Ga0373925_1269620	3300037068	Bacteria	604
888	Ga0395899_0108833	3300037312	Bacteria	1994
889	Ga0395899_0251538	3300037312	Bacteria	1212
890	Ga0395899_0825633	3300037312	Bacteria	571
891	Ga0395900_0000860	3300037418	Bacteria	40028
892	Ga0395900_0024972	3300037418	Bacteria	6116
893	Ga0395900_0087238	3300037418	Bacteria	3207
894	Ga0395900_0133686	3300037418	Bacteria	2541
895	Ga0395900_0295570	3300037418	Bacteria	1607
896	Ga0395900_0732365	3300037418	Bacteria	920
897	Ga0395900_0781656	3300037418	Bacteria	883
898	Ga0395898_0038657	3300037466	Bacteria	4728
899	Ga0395898_0046012	3300037466	Bacteria	4287
900	Ga0395898_0303846	3300037466	Bacteria	1522
901	Ga0395898_0337813	3300037466	Bacteria	1436
902	Ga0395898_1034052	3300037466	Bacteria	756
903	Ga0395905_0004133	3300037471	Bacteria	15196
904	Ga0395905_0056855	3300037471	Bacteria	3659
905	Ga0436364_0233650	3300037853	Bacteria	2283
906	Ga0436364_0441476	3300037853	Bacteria	1190
907	Ga0436364_0564476	3300037853	Bacteria	8477
908	Ga0436364_0867579	3300037853	Bacteria	589
909	Ga0436364_1156189	3300037853	Bacteria	652
910	Ga0436364_1273645	3300037853	Bacteria	20524
911	Ga0395901_0066269	3300038443	Bacteria	3761
912	Ga0395901_0158116	3300038443	Bacteria	2380
913	Ga0395901_0197550	3300038443	Bacteria	2109
914	Ga0395901_0266094	3300038443	Bacteria	1784
915	Ga0395901_0284030	3300038443	Bacteria	1719
916	Ga0395901_0406816	3300038443	Bacteria	1397
917	Ga0395901_0418543	3300038443	Bacteria	1374
918	Ga0395901_1034364	3300038443	Bacteria	795
919	Ga0395901_1835364	3300038443	Bacteria	555
920	Ga0237816_09722	3300039145	Bacteria	568
921	Ga0436365_0268210	3300039437	Bacteria	9455
922	Ga0436365_0362387	3300039437	Bacteria	6477
923	Ga0436365_0447357	3300039437	Bacteria	669
924	Ga0436365_0931695	3300039437	Bacteria	34638
925	Ga0436365_1019893	3300039437	Bacteria	754
926	Ga0436365_1080138	3300039437	Bacteria	1757
927	Ga0436365_1521898	3300039437	Bacteria	2210
928	Ga0436365_1815384	3300039437	Bacteria	5615
929	Ga0436365_1825840	3300039437	Bacteria	1255
930	Ga0436360_0083365	3300039438	Bacteria	950
931	Ga0436360_0578776	3300039438	Bacteria	782
932	Ga0436360_0620219	3300039438	Bacteria	2245
933	Ga0436360_0801048	3300039438	Bacteria	1543
934	Ga0436360_1104895	3300039438	Bacteria	1402
935	Ga0436360_1193365	3300039438	Bacteria	1441
936	Ga0436361_0241681	3300039447	Bacteria	795
937	Ga0436361_0652402	3300039447	Bacteria	2800
938	Ga0436363_0281671	3300039450	Bacteria	1122
939	Ga0436363_0379621	3300039450	Bacteria	1487
940	Ga0436363_0759887	3300039450	Bacteria	646
941	Ga0436363_1194591	3300039450	Bacteria	1953
942	Ga0436363_1351337	3300039450	Bacteria	1071
943	Ga0436363_1540305	3300039450	Bacteria	710
944	Ga0436362_0285155	3300039453	Bacteria	745
945	Ga0436362_0353879	3300039453	Bacteria	1774
946	Ga0436362_0731481	3300039453	Bacteria	630
947	Ga0436362_0764214	3300039453	Bacteria	3727
948	Ga0436362_1022607	3300039453	Bacteria	955
949	Ga0439466_0029339	3300041411	Bacteria	1893
950	Ga0439465_0102959	3300041413	Bacteria	987
951	Ga0451793_0372829	3300041452	Bacteria	601
952	Ga0451833_0752167	3300041491	Bacteria	644
953	Ga0451837_0172803	3300041494	Bacteria	682
954	Ga0451853_3548117	3300041512	Bacteria	1004
955	Ga0439463_136689	3300042016	Bacteria	635
956	Ga0439444_0034154	3300042437	Bacteria	970
957	Ga0466972_0004579	3300044658	Bacteria	6928
958	Ga0466972_0148474	3300044658	Bacteria	1102
959	Ga0466965_0030295	3300044683	Bacteria	2636
960	Ga0466966_0097283	3300044684	Bacteria	1823
961	Ga0466966_0160058	3300044684	Bacteria	1371
962	Ga0466963_0138046	3300044694	Bacteria	1688
963	Ga0466964_0030834	3300044706	Bacteria	2124
964	Ga0466971_0264900	3300044719	Bacteria	821
965	Ga0466968_0002010	3300044735	Bacteria	7392
966	Ga0466968_0020839	3300044735	Bacteria	2650
967	Ga0466968_0426389	3300044735	Bacteria	653
968	Ga0466959_0033049	3300045049	Bacteria	3828
969	Ga0466959_0182071	3300045049	Bacteria	1469
970	Ga0451576_1020663	3300045051	Bacteria	867
971	Ga0466958_0816768	3300045836	Bacteria	608
972	Ga0466967_0120250	3300045976	Bacteria	2425
973	Ga0466967_0201139	3300045976	Bacteria	1887
974	Ga0466967_0401622	3300045976	Bacteria	1333
975	Ga0466967_1726416	3300045976	Bacteria	623
976	Ga0495617_119654	3300046452	Bacteria	849
977	Ga0495592_0000033	3300046454	Bacteria	127028
978	Ga0495592_0000529	3300046454	Bacteria	27475
979	Ga0495592_0031189	3300046454	Bacteria	4029
980	Ga0495592_0040942	3300046454	Bacteria	3475
981	Ga0495592_0214262	3300046454	Bacteria	1292
982	Ga0495603_0001221	3300046455	Bacteria	14993
983	Ga0495603_0002595	3300046455	Bacteria	10668
984	Ga0495603_0073366	3300046455	Bacteria	2011
985	Ga0495590_0048858	3300046457	Bacteria	1476
986	Ga0495590_0151433	3300046457	Bacteria	841
987	Ga0495591_059863	3300046458	Bacteria	1015
988	Ga0495629_0000179	3300046459	Bacteria	56885
989	Ga0495629_0001007	3300046459	Bacteria	22607
990	Ga0495629_0013188	3300046459	Bacteria	5967
991	Ga0495629_0128885	3300046459	Bacteria	1762
992	Ga0495629_0295637	3300046459	Bacteria	1109
993	Ga0495638_0012856	3300046460	Bacteria	5719
994	Ga0495641_0005871	3300046461	Bacteria	8117
995	Ga0495651_0002153	3300046462	Bacteria	15247
996	Ga0495651_0009522	3300046462	Bacteria	7461
997	Ga0495651_0048743	3300046462	Bacteria	3270
998	Ga0495651_0061396	3300046462	Bacteria	2877
999	Ga0495651_0169950	3300046462	Bacteria	1553
1000	Ga0495651_0284262	3300046462	Bacteria	1116
1001	Ga0495651_0355353	3300046462	Bacteria	967
1002	Ga0495651_0441868	3300046462	Bacteria	842
1003	Ga0495653_0000019	3300046463	Bacteria	178799
1004	Ga0495653_0033261	3300046463	Bacteria	4086
1005	Ga0495653_0228893	3300046463	Bacteria	1245
1006	Ga0495653_0311959	3300046463	Bacteria	1022
1007	Ga0495650_0061393	3300046471	Bacteria	1506
1008	Ga0495580_0000280	3300046472	Bacteria	41385
1009	Ga0495580_0064759	3300046472	Bacteria	2561
1010	Ga0495580_0270626	3300046472	Bacteria	1160
1011	Ga0495580_0374213	3300046472	Bacteria	963
1012	Ga0495582_0000061	3300046473	Bacteria	55522
1013	Ga0495582_0137091	3300046473	Bacteria	1385
1014	Ga0495582_0383538	3300046473	Bacteria	810
1015	Ga0495605_0214308	3300046474	Bacteria	834
1016	Ga0495639_0000102	3300046475	Bacteria	42249
1017	Ga0495639_0146719	3300046475	Bacteria	1136
1018	Ga0495639_0229139	3300046475	Bacteria	915
1019	Ga0495662_0000074	3300046476	Bacteria	35316
1020	Ga0495662_0005823	3300046476	Bacteria	6166
1021	Ga0495662_0331231	3300046476	Bacteria	749
1022	Ga0495664_0000005	3300046477	Bacteria	439635
1023	Ga0495664_0079176	3300046477	Bacteria	1969
1024	Ga0495664_0181366	3300046477	Bacteria	1276
1025	Ga0495664_0289569	3300046477	Bacteria	989
1026	Ga0495664_0443193	3300046477	Bacteria	778
1027	Ga0495584_0152383	3300046491	Bacteria	1174
1028	Ga0495584_0499056	3300046491	Bacteria	620
1029	Ga0495585_0419242	3300046492	Bacteria	643
1030	Ga0495585_0466476	3300046492	Bacteria	603
1031	Ga0495594_0000378	3300046499	Bacteria	22340
1032	Ga0495594_0120795	3300046499	Bacteria	1481
1033	Ga0495594_0212457	3300046499	Bacteria	1103
1034	Ga0495596_0166059	3300046500	Bacteria	858
1035	Ga0495596_0287247	3300046500	Bacteria	639
1036	Ga0495607_0018579	3300046501	Bacteria	4430
1037	Ga0495583_0045507	3300046506	Bacteria	2029
1038	Ga0495606_0003007	3300046507	Bacteria	18477
1039	Ga0495606_0075026	3300046507	Bacteria	2117
1040	Ga0495608_0000003	3300046511	Bacteria	369831
1041	Ga0495608_0017019	3300046511	Bacteria	5029
1042	Ga0495608_0027598	3300046511	Bacteria	3862
1043	Ga0495608_0063006	3300046511	Bacteria	2435
1044	Ga0495608_0328468	3300046511	Bacteria	944
1045	Ga0495608_0636508	3300046511	Bacteria	638
1046	Ga0495610_0022608	3300046512	Bacteria	3435
1047	Ga0495618_0000009	3300046514	Bacteria	200423
1048	Ga0495618_0030284	3300046514	Bacteria	3380
1049	Ga0495618_0425127	3300046514	Bacteria	809
1050	Ga0495620_0086962	3300046515	Bacteria	1258
1051	Ga0495620_0161418	3300046515	Bacteria	871
1052	Ga0495628_0000010	3300046516	Bacteria	234932
1053	Ga0495628_0004580	3300046516	Bacteria	12233
1054	Ga0495628_0429576	3300046516	Bacteria	962
1055	Ga0495628_0507717	3300046516	Bacteria	870
1056	Ga0495628_0818176	3300046516	Bacteria	651
1057	Ga0495630_0001032	3300046517	Bacteria	19216
1058	Ga0495630_0019921	3300046517	Bacteria	4938
1059	Ga0495630_0035668	3300046517	Bacteria	3716
1060	Ga0495630_0194931	3300046517	Bacteria	1546
1061	Ga0495631_0025780	3300046518	Bacteria	2704
1062	Ga0495632_0179476	3300046519	Bacteria	970
1063	Ga0495632_0207347	3300046519	Bacteria	890
1064	Ga0495637_0270586	3300046520	Bacteria	608
1065	Ga0495637_0275429	3300046520	Bacteria	601
1066	Ga0495643_0070380	3300046522	Bacteria	1837
1067	Ga0495643_0161102	3300046522	Bacteria	1104
1068	Ga0495643_0238029	3300046522	Bacteria	855
1069	Ga0495644_0047717	3300046523	Bacteria	1608
1070	Ga0495648_0002612	3300046524	Bacteria	16461
1071	Ga0495648_0002918	3300046524	Bacteria	15363
1072	Ga0495648_0047710	3300046524	Bacteria	2644
1073	Ga0495648_0400210	3300046524	Bacteria	614
1074	Ga0495663_0119448	3300046525	Bacteria	881
1075	Ga0495666_0030666	3300046526	Bacteria	2637
1076	Ga0495666_0074281	3300046526	Bacteria	1613
1077	Ga0495666_0336930	3300046526	Bacteria	680
1078	Ga0495642_0091087	3300046528	Bacteria	1291
1079	Ga0495652_0000016	3300046529	Bacteria	212723
1080	Ga0495652_0003857	3300046529	Bacteria	14624
1081	Ga0495652_0302150	3300046529	Bacteria	1163
1082	Ga0495652_0324151	3300046529	Bacteria	1112
1083	Ga0495652_0375860	3300046529	Bacteria	1012
1084	Ga0495652_1010329	3300046529	Bacteria	544
1085	Ga0495654_0000570	3300046530	Bacteria	29574
1086	Ga0495654_0020515	3300046530	Bacteria	3442
1087	Ga0495654_0221932	3300046530	Bacteria	799
1088	Ga0495665_0000261	3300046531	Bacteria	26625
1089	Ga0495665_0018842	3300046531	Bacteria	3709
1090	Ga0495665_0217422	3300046531	Bacteria	988
1091	Ga0495665_0425137	3300046531	Bacteria	673
1092	Ga0495640_0000015	3300046533	Bacteria	160055
1093	Ga0495640_0005071	3300046533	Bacteria	10455
1094	Ga0495640_0098913	3300046533	Bacteria	1917
1095	Ga0495640_0127618	3300046533	Bacteria	1648
1096	Ga0495640_0128170	3300046533	Bacteria	1644
1097	Ga0495640_0278168	3300046533	Bacteria	1043
1098	Ga0495586_0031353	3300046535	Bacteria	2847
1099	Ga0495586_0123977	3300046535	Bacteria	1444
1100	Ga0495586_0154055	3300046535	Bacteria	1294
1101	Ga0495586_0451814	3300046535	Bacteria	741
1102	Ga0495586_0475831	3300046535	Bacteria	720
1103	Ga0495587_0000009	3300046536	Bacteria	241480
1104	Ga0495587_0012126	3300046536	Bacteria	5441
1105	Ga0495587_0045732	3300046536	Bacteria	2600
1106	Ga0495587_0068894	3300046536	Bacteria	2061
1107	Ga0495587_0321844	3300046536	Bacteria	864
1108	Ga0495598_0164081	3300046537	Bacteria	783
1109	Ga0495609_0061898	3300046538	Bacteria	1653
1110	Ga0495621_0034630	3300046539	Bacteria	1745
1111	Ga0495645_0000005	3300046543	Bacteria	443917
1112	Ga0495645_0044800	3300046543	Bacteria	3226
1113	Ga0495645_0237606	3300046543	Bacteria	1217
1114	Ga0495645_0239088	3300046543	Bacteria	1213
1115	Ga0495645_0302873	3300046543	Bacteria	1043
1116	Ga0495645_0641093	3300046543	Bacteria	650
1117	Ga0495622_0002581	3300046557	Bacteria	8747
1118	Ga0495622_0007364	3300046557	Bacteria	5107
1119	Ga0495622_0018810	3300046557	Bacteria	3217
1120	Ga0495622_0121370	3300046557	Bacteria	1193
1121	Ga0495633_0354706	3300046558	Bacteria	664
1122	Ga0495667_0000003	3300046559	Bacteria	295404
1123	Ga0495667_0001533	3300046559	Bacteria	15276
1124	Ga0495667_0051591	3300046559	Bacteria	2713
1125	Ga0495667_0115177	3300046559	Bacteria	1737
1126	Ga0495656_0036106	3300046615	Bacteria	2034
1127	Ga0495668_0037410	3300046616	Bacteria	2715
1128	Ga0495634_0000161	3300046642	Bacteria	60925
1129	Ga0495634_0002829	3300046642	Bacteria	14247
1130	Ga0495634_0013704	3300046642	Bacteria	5854
1131	Ga0495634_0121773	3300046642	Bacteria	1670
1132	Ga0495634_0230461	3300046642	Bacteria	1140
1133	Ga0495634_0434794	3300046642	Bacteria	776
1134	Ga0495611_0317099	3300046648	Bacteria	717
1135	Ga0495625_0142198	3300046660	Bacteria	1618
1136	Ga0495625_0234733	3300046660	Bacteria	1196
1137	Ga0495625_0571528	3300046660	Bacteria	682
1138	Ga0495625_0694559	3300046660	Bacteria	601
1139	Ga0495635_0000013	3300046663	Bacteria	221753
1140	Ga0495635_0000094	3300046663	Bacteria	52578
1141	Ga0495635_0008716	3300046663	Bacteria	7083
1142	Ga0495635_0075468	3300046663	Bacteria	2309
1143	Ga0495635_0257932	3300046663	Bacteria	1174
1144	Ga0495635_0335582	3300046663	Bacteria	1010
1145	Ga0495635_0803350	3300046663	Bacteria	606
1146	Ga0495659_0375640	3300046664	Bacteria	610
1147	Ga0495661_0101572	3300046665	Bacteria	1617
1148	Ga0495661_0471618	3300046665	Bacteria	602
1149	Ga0495588_0007188	3300046674	Bacteria	5053
1150	Ga0495588_0050484	3300046674	Bacteria	2140
1151	Ga0495657_0000145	3300046675	Bacteria	63741
1152	Ga0495657_0019424	3300046675	Bacteria	4901
1153	Ga0495657_0165481	3300046675	Bacteria	1365
1154	Ga0495657_0208655	3300046675	Bacteria	1188
1155	Ga0495657_0263163	3300046675	Bacteria	1036
1156	Ga0495657_0319828	3300046675	Bacteria	922
1157	Ga0495599_0000011	3300046678	Bacteria	207639
1158	Ga0495599_0033332	3300046678	Bacteria	3236
1159	Ga0495599_0054338	3300046678	Bacteria	2509
1160	Ga0495599_0441812	3300046678	Bacteria	771
1161	Ga0495623_0000005	3300046679	Bacteria	140586
1162	Ga0495623_0001295	3300046679	Bacteria	16985
1163	Ga0495623_0113333	3300046679	Bacteria	1640
1164	Ga0495623_0129581	3300046679	Bacteria	1512
1165	Ga0495623_0154624	3300046679	Bacteria	1353
1166	Ga0495623_0383633	3300046679	Bacteria	759
1167	Ga0495646_0000011	3300046680	Bacteria	195220
1168	Ga0495646_0010260	3300046680	Bacteria	5957
1169	Ga0495646_0094282	3300046680	Bacteria	1724
1170	Ga0495646_0131928	3300046680	Bacteria	1406
1171	Ga0495647_0096996	3300046681	Bacteria	1216
1172	Ga0495658_0000315	3300046683	Bacteria	27478
1173	Ga0495658_0014138	3300046683	Bacteria	4072
1174	Ga0495658_0103704	3300046683	Bacteria	1701
1175	Ga0495658_0279000	3300046683	Bacteria	1054
1176	Ga0495658_0586610	3300046683	Bacteria	714
1177	Ga0495669_0039285	3300046684	Bacteria	2096
1178	Ga0495613_0002949	3300046689	Bacteria	12727
1179	Ga0495613_0047115	3300046689	Bacteria	3185
1180	Ga0495613_0075577	3300046689	Bacteria	2452
1181	Ga0495613_0094048	3300046689	Bacteria	2169
1182	Ga0495613_0146120	3300046689	Bacteria	1687
1183	Ga0495624_0001589	3300046690	Bacteria	17457
1184	Ga0495624_0007235	3300046690	Bacteria	7805
1185	Ga0495624_0016842	3300046690	Bacteria	4918
1186	Ga0495624_0074851	3300046690	Bacteria	2103
1187	Ga0495624_0183121	3300046690	Bacteria	1276
1188	Ga0495670_0206355	3300046691	Bacteria	1041
1189	Ga0495671_0038418	3300046692	Bacteria	2419
1190	Ga0495671_0209853	3300046692	Bacteria	944
1191	Ga0495649_0235277	3300046694	Bacteria	944
1192	Ga0495600_0000004	3300046809	Bacteria	180417
1193	Ga0495600_0000235	3300046809	Bacteria	30548
1194	Ga0495600_0017291	3300046809	Bacteria	4585
1195	Ga0495600_0222558	3300046809	Bacteria	1207
1196	Ga0495600_0390562	3300046809	Bacteria	867
1197	Ga0495600_0439097	3300046809	Bacteria	808
1198	Ga0495600_0566030	3300046809	Bacteria	693
1199	Ga0495600_0664140	3300046809	Bacteria	629
1200	Ga0495581_0000255	3300047315	Bacteria	25578
1201	Ga0495581_0028788	3300047315	Bacteria	3221
1202	Ga0495581_0062499	3300047315	Bacteria	2152
1203	Ga0495581_0071264	3300047315	Bacteria	2011
1204	Ga0495604_0000006	3300047317	Bacteria	420480
1205	Ga0495604_0010945	3300047317	Bacteria	7201
1206	Ga0495604_0095875	3300047317	Bacteria	2190
1207	Ga0495604_0402877	3300047317	Bacteria	901
1208	Ga0495604_0536694	3300047317	Bacteria	755
1209	Ga0495674_0000005	3300047319	Bacteria	375129
1210	Ga0495674_0000117	3300047319	Bacteria	60130
1211	Ga0495674_0067676	3300047319	Bacteria	3093
1212	Ga0495674_0109542	3300047319	Bacteria	2342
1213	Ga0495674_0191989	3300047319	Bacteria	1697
1214	Ga0495674_0383120	3300047319	Bacteria	1137
1215	Ga0495672_0008790	3300047320	Bacteria	7398
1216	Ga0495672_0011329	3300047320	Bacteria	6299
1217	Ga0495672_0066476	3300047320	Bacteria	2057
1218	Ga0495672_0228733	3300047320	Bacteria	914
1219	Ga0495672_0303009	3300047320	Bacteria	756
1220	Ga0495676_0039899	3300047321	Bacteria	3882
1221	Ga0495676_0092460	3300047321	Bacteria	2258
1222	Ga0495676_0119040	3300047321	Bacteria	1925
1223	Ga0495676_0425482	3300047321	Bacteria	878
1224	Ga0495676_0427106	3300047321	Bacteria	876
1225	Ga0495676_0833743	3300047321	Bacteria	593
1226	Ga0495680_0000606	3300047322	Bacteria	40481
1227	Ga0495680_0000688	3300047322	Bacteria	37864
1228	Ga0495680_0037680	3300047322	Bacteria	3872
1229	Ga0495680_0153054	3300047322	Bacteria	1680
1230	Ga0495680_0221582	3300047322	Bacteria	1350
1231	Ga0495680_0324420	3300047322	Bacteria	1077
1232	Ga0495683_0174537	3300047323	Bacteria	986
1233	Ga0495675_0000914	3300047444	Bacteria	17959
1234	Ga0495675_0003742	3300047444	Bacteria	9201
1235	Ga0495675_0082096	3300047444	Bacteria	2029
1236	Ga0495675_0468949	3300047444	Bacteria	726
1237	Ga0495677_0294668	3300047445	Bacteria	637
1238	Ga0495673_0176681	3300047469	Bacteria	811
1239	Ga0495681_0133431	3300047470	Bacteria	1055
1240	Ga0495684_0000001	3300047471	Bacteria	369809
1241	Ga0495684_0000633	3300047471	Bacteria	28283
1242	Ga0495684_0027320	3300047471	Bacteria	4382
1243	Ga0495684_0190754	3300047471	Bacteria	1515
1244	Ga0495684_0760215	3300047471	Bacteria	637
1245	Ga0495686_0362216	3300047472	Bacteria	786
1246	Ga0495686_0528351	3300047472	Bacteria	618
1247	Ga0495686_0556446	3300047472	Bacteria	598
1248	Ga0495593_0000086	3300047673	Bacteria	40986
1249	Ga0495593_0001573	3300047673	Bacteria	13474
1250	Ga0495593_0003839	3300047673	Bacteria	8972
1251	Ga0495593_0022070	3300047673	Bacteria	3552
1252	Ga0495593_0065297	3300047673	Bacteria	1898
1253	Ga0495602_0000003	3300048088	Bacteria	357240
1254	Ga0495602_0029828	3300048088	Bacteria	5185
1255	Ga0495602_0103140	3300048088	Bacteria	2336
1256	Ga0495602_0243861	3300048088	Bacteria	1343
1257	Ga0495602_0253623	3300048088	Bacteria	1309
1258	Ga0495602_0556749	3300048088	Bacteria	794
1259	Ga0495602_0828186	3300048088	Bacteria	620
1260	Ga0495614_0036301	3300048089	Bacteria	2116
1261	Ga0495614_0037942	3300048089	Bacteria	2068
1262	Ga0495614_0185434	3300048089	Bacteria	937
1263	Ga0495626_0216680	3300048091	Bacteria	779
1264	Ga0496100_0018586	3300048903	Bacteria	4126
1265	Ga0496100_0044877	3300048903	Bacteria	2834
1266	Ga0496100_0048511	3300048903	Bacteria	2741
1267	Ga0496100_0093156	3300048903	Bacteria	2061
1268	Ga0496100_0600708	3300048903	Bacteria	854
1269	Ga0496100_0690049	3300048903	Bacteria	796
1270	Ga0496100_0745872	3300048903	Bacteria	765
1271	Ga0496100_1017637	3300048903	Bacteria	652
1272	Ga0496100_1170150	3300048903	Bacteria	606
1273	Ga0496101_0021101	3300048904	Bacteria	4471
1274	Ga0496101_0023934	3300048904	Bacteria	4222
1275	Ga0496101_0024397	3300048904	Bacteria	4185
1276	Ga0496101_0069257	3300048904	Bacteria	2581
1277	Ga0496101_0180625	3300048904	Bacteria	1625
1278	Ga0496101_0566110	3300048904	Bacteria	898
1279	Ga0496101_0778147	3300048904	Bacteria	755
1280	Ga0496101_0820265	3300048904	Bacteria	733
1281	Ga0496102_0013632	3300048905	Bacteria	7045
1282	Ga0496102_0104016	3300048905	Bacteria	2641
1283	Ga0496102_0129216	3300048905	Bacteria	2363
1284	Ga0496102_0297844	3300048905	Bacteria	1520
1285	Ga0496102_0383058	3300048905	Bacteria	1323
1286	Ga0496102_1307304	3300048905	Bacteria	644
1287	Ga0496103_0051163	3300048906	Bacteria	2557
1288	Ga0496103_0575131	3300048906	Bacteria	718
1289	Ga0496104_0011141	3300048907	Bacteria	8046
1290	Ga0496104_0028162	3300048907	Bacteria	5206
1291	Ga0496104_0053677	3300048907	Bacteria	3809
1292	Ga0496104_0063744	3300048907	Bacteria	3496
1293	Ga0496104_0358997	3300048907	Bacteria	1369
1294	Ga0496104_0858266	3300048907	Bacteria	813
1295	Ga0496104_1141996	3300048907	Bacteria	682
1296	Ga0496104_1730364	3300048907	Bacteria	527
1297	Ga0496105_0008366	3300048908	Bacteria	8038
1298	Ga0496105_0039098	3300048908	Bacteria	3909
1299	Ga0496105_0063589	3300048908	Bacteria	3044
1300	Ga0496105_0089136	3300048908	Bacteria	2548
1301	Ga0496105_0272676	3300048908	Bacteria	1366
1302	Ga0496105_0383914	3300048908	Bacteria	1117
1303	Ga0496106_0000546	3300048909	Bacteria	26747
1304	Ga0496106_0010390	3300048909	Bacteria	6878
1305	Ga0496106_0016644	3300048909	Bacteria	5439
1306	Ga0496106_0148031	3300048909	Bacteria	1851
1307	Ga0496106_0164765	3300048909	Bacteria	1754
1308	Ga0496106_0227066	3300048909	Bacteria	1490
1309	Ga0496106_0260219	3300048909	Bacteria	1388
1310	Ga0496106_0278725	3300048909	Bacteria	1339
1311	Ga0496106_0409339	3300048909	Bacteria	1090
1312	Ga0496107_0002937	3300048910	Bacteria	11278
1313	Ga0496107_0017612	3300048910	Bacteria	5026
1314	Ga0496107_0023174	3300048910	Bacteria	4389
1315	Ga0496107_0026442	3300048910	Bacteria	4114
1316	Ga0496107_0041913	3300048910	Bacteria	3288
1317	Ga0496107_0058811	3300048910	Bacteria	2780
1318	Ga0496107_0064242	3300048910	Bacteria	2661
1319	Ga0496107_0275457	3300048910	Bacteria	1252
1320	Ga0496108_0001440	3300048911	Bacteria	18797
1321	Ga0496108_0021625	3300048911	Bacteria	5286
1322	Ga0496108_0038953	3300048911	Bacteria	3961
1323	Ga0496108_0161347	3300048911	Bacteria	1938
1324	Ga0496108_0486619	3300048911	Bacteria	1078
1325	Ga0496108_0531079	3300048911	Bacteria	1027
1326	Ga0496108_1124925	3300048911	Bacteria	666
1327	Ga0496109_0001610	3300048912	Bacteria	18841
1328	Ga0496109_0015876	3300048912	Bacteria	6575
1329	Ga0496109_0037030	3300048912	Bacteria	4407
1330	Ga0496109_0112910	3300048912	Bacteria	2527
1331	Ga0496109_0343522	3300048912	Bacteria	1410
1332	Ga0496109_0444626	3300048912	Bacteria	1224
1333	Ga0496109_0496941	3300048912	Bacteria	1151
1334	Ga0496110_0012816	3300048913	Bacteria	6906
1335	Ga0496110_0020630	3300048913	Bacteria	5567
1336	Ga0496110_0129448	3300048913	Bacteria	2278
1337	Ga0496110_0172952	3300048913	Bacteria	1960
1338	Ga0496110_0213272	3300048913	Bacteria	1755
1339	Ga0496110_0247476	3300048913	Bacteria	1622
1340	Ga0496110_0352434	3300048913	Bacteria	1341
1341	Ga0496110_0513245	3300048913	Bacteria	1091
1342	Ga0496110_0707552	3300048913	Bacteria	909
1343	Ga0496111_0000623	3300048914	Bacteria	18754
1344	Ga0496111_0021964	3300048914	Bacteria	4462
1345	Ga0496111_0130756	3300048914	Bacteria	1857
1346	Ga0496111_0135267	3300048914	Bacteria	1825
1347	Ga0496111_0148863	3300048914	Bacteria	1736
1348	Ga0496111_0168185	3300048914	Bacteria	1628
1349	Ga0496111_0488049	3300048914	Bacteria	907
1350	Ga0496112_0005886	3300048915	Bacteria	10683
1351	Ga0496112_0007905	3300048915	Bacteria	9474
1352	Ga0496112_0009200	3300048915	Bacteria	8878
1353	Ga0496112_0028997	3300048915	Bacteria	5348
1354	Ga0496112_0032003	3300048915	Bacteria	5106
1355	Ga0496112_0033853	3300048915	Bacteria	4970
1356	Ga0496112_0058867	3300048915	Bacteria	3784
1357	Ga0496112_1153893	3300048915	Bacteria	692
1358	Ga0496113_0018743	3300048916	Bacteria	4826
1359	Ga0496113_0069266	3300048916	Bacteria	2679
1360	Ga0496113_0090054	3300048916	Bacteria	2362
1361	Ga0496113_0090640	3300048916	Bacteria	2355
1362	Ga0496113_0092149	3300048916	Bacteria	2337
1363	Ga0496113_0134212	3300048916	Bacteria	1944
1364	Ga0496113_0815656	3300048916	Bacteria	741
1365	Ga0496114_0042084	3300048917	Bacteria	3785
1366	Ga0496114_0196990	3300048917	Bacteria	1763
1367	Ga0496114_0260361	3300048917	Bacteria	1527
1368	Ga0496114_0260807	3300048917	Bacteria	1526
1369	Ga0496114_0412939	3300048917	Bacteria	1195
1370	Ga0496114_1000127	3300048917	Bacteria	719
1371	Ga0496115_0016295	3300048918	Bacteria	5656
1372	Ga0496115_0049833	3300048918	Bacteria	3353
1373	Ga0496115_0091197	3300048918	Bacteria	2490
1374	Ga0496115_0280656	3300048918	Bacteria	1367
1375	Ga0496115_0328748	3300048918	Bacteria	1249
1376	Ga0496115_0356355	3300048918	Bacteria	1193
1377	Ga0496115_0431908	3300048918	Bacteria	1066
1378	Ga0496115_0802037	3300048918	Bacteria	733
1379	Ga0496116_0000036	3300048919	Bacteria	388508
1380	Ga0496116_0002789	3300048919	Bacteria	17955
1381	Ga0496116_0106088	3300048919	Bacteria	1665
1382	Ga0496117_0105448	3300048920	Bacteria	1771
1383	Ga0496117_0392628	3300048920	Bacteria	703
1384	Ga0496118_0019395	3300048921	Bacteria	6079
1385	Ga0496118_0145743	3300048921	Bacteria	1491
1386	Ga0496118_0378702	3300048921	Bacteria	743
1387	Ga0496119_0076330	3300048922	Bacteria	1944
1388	Ga0496119_0082799	3300048922	Bacteria	1845
1389	Ga0496119_0121673	3300048922	Bacteria	1434
1390	Ga0496119_0282281	3300048922	Bacteria	825
1391	Ga0496120_0017144	3300048923	Bacteria	4705
1392	Ga0496120_0218521	3300048923	Bacteria	912
1393	Ga0496121_0000495	3300048924	Bacteria	75339
1394	Ga0496121_0001789	3300048924	Bacteria	34756
1395	Ga0496121_0005072	3300048924	Bacteria	17180
1396	Ga0496121_0034850	3300048924	Bacteria	4521
1397	Ga0496121_0034862	3300048924	Bacteria	4520
1398	Ga0496121_0050270	3300048924	Bacteria	3524
1399	Ga0496121_0062362	3300048924	Bacteria	3054
1400	Ga0496121_0063016	3300048924	Bacteria	3033
1401	Ga0496121_0069767	3300048924	Bacteria	2834
1402	Ga0496121_0266591	3300048924	Bacteria	1179
1403	Ga0496121_0330914	3300048924	Bacteria	1022
1404	Ga0496122_0022175	3300048925	Bacteria	5655
1405	Ga0496122_0034583	3300048925	Bacteria	4132
1406	Ga0496122_0149319	3300048925	Bacteria	1445
1407	Ga0496122_0188894	3300048925	Bacteria	1218
1408	Ga0496123_0018478	3300048926	Bacteria	5544
1409	Ga0496123_0064518	3300048926	Bacteria	2333
1410	Ga0496123_0082048	3300048926	Bacteria	1956
1411	Ga0496124_0039401	3300048927	Bacteria	4096
1412	Ga0496124_0257641	3300048927	Bacteria	1286
1413	Ga0496124_0386706	3300048927	Bacteria	976
1414	Ga0496124_0454375	3300048927	Bacteria	872
1415	Ga0496124_0623260	3300048927	Bacteria	697
1416	Ga0496125_0000090	3300048928	Bacteria	214433
1417	Ga0496125_0007247	3300048928	Bacteria	11815
1418	Ga0496125_0035078	3300048928	Bacteria	4408
1419	Ga0496125_0047125	3300048928	Bacteria	3608
1420	Ga0496125_0450822	3300048928	Bacteria	737
1421	Ga0496126_0000156	3300048929	Bacteria	158537
1422	Ga0496126_0002315	3300048929	Bacteria	26122
1423	Ga0496126_0025419	3300048929	Bacteria	5697
1424	Ga0496126_0030050	3300048929	Bacteria	5155
1425	Ga0496126_0036160	3300048929	Bacteria	4620
1426	Ga0496126_0037055	3300048929	Bacteria	4554
1427	Ga0496126_0088621	3300048929	Bacteria	2725
1428	Ga0496126_0167913	3300048929	Bacteria	1871
1429	Ga0496126_0215286	3300048929	Bacteria	1616
1430	Ga0496126_0301598	3300048929	Bacteria	1321
1431	Ga0496126_0350809	3300048929	Bacteria	1207
1432	Ga0496126_0830769	3300048929	Bacteria	706
1433	Ga0496126_1135834	3300048929	Bacteria	578
1434	Ga0501308_007320	3300049128	Bacteria	1152
1435	Ga0501308_018794	3300049128	Bacteria	848
1436	Ga0501309_013743	3300049129	Bacteria	1080
1437	Ga0501310_013005	3300049130	Bacteria	961
1438	Ga0501304_006532	3300049160	Bacteria	943
1439	Ga0501305_019197	3300049161	Bacteria	996
1440	Ga0495678_064420	3300049459	Bacteria	1365
1441	Ga0501312_071986	3300049528	Bacteria	614
1442	Ga0501316_008140	3300049532	Bacteria	1152
1443	Ga0501317_010871	3300049533	Bacteria	1096
1444	Ga0501318_011077	3300049534	Bacteria	1013
1445	Ga0501318_044864	3300049534	Bacteria	642
1446	Ga0501321_009776	3300049537	Bacteria	1041
1447	Ga0501321_016660	3300049537	Bacteria	876
1448	Ga0501323_045435	3300049539	Bacteria	654
1449	Ga0501325_007084	3300049541	Bacteria	940
1450	Ga0501328_07990	3300049544	Bacteria	570
1451	Ga0501332_03259	3300049548	Bacteria	936
1452	Ga0501336_006130	3300049552	Bacteria	885
1453	Ga0501340_003708	3300049556	Bacteria	937
1454	Ga0501031_0004261	3300049568	Bacteria	9240
1455	Ga0501031_0198219	3300049568	Bacteria	1310
1456	Ga0501031_0655507	3300049568	Bacteria	675
1457	Ga0501032_0002348	3300049569	Bacteria	14835
1458	Ga0501032_0005554	3300049569	Bacteria	9354
1459	Ga0501032_0133411	3300049569	Bacteria	1637
1460	Ga0501032_0200242	3300049569	Bacteria	1303
1461	Ga0501033_0000256	3300049570	Bacteria	50977
1462	Ga0501033_0028851	3300049570	Bacteria	4169
1463	Ga0501033_0063293	3300049570	Bacteria	2723
1464	Ga0501033_0286749	3300049570	Bacteria	1161
1465	Ga0501033_0574320	3300049570	Bacteria	775
1466	Ga0501033_0629347	3300049570	Bacteria	734
1467	Ga0501034_0000013	3300049571	Bacteria	297898
1468	Ga0501034_0000175	3300049571	Bacteria	119465
1469	Ga0501034_0057071	3300049571	Bacteria	3926
1470	Ga0501034_0086890	3300049571	Bacteria	3127
1471	Ga0501034_0093502	3300049571	Bacteria	3003
1472	Ga0501034_0098202	3300049571	Bacteria	2924
1473	Ga0501034_0252110	3300049571	Bacteria	1709
1474	Ga0501034_0256371	3300049571	Bacteria	1693
1475	Ga0501034_0317404	3300049571	Bacteria	1491
1476	Ga0501034_1028788	3300049571	Bacteria	707
1477	Ga0501034_1345550	3300049571	Bacteria	590
1478	Ga0501036_0000032	3300049572	Bacteria	91370
1479	Ga0501036_0045218	3300049572	Bacteria	3731
1480	Ga0501036_0096271	3300049572	Bacteria	2502
1481	Ga0501036_0116216	3300049572	Bacteria	2260
1482	Ga0501036_0437097	3300049572	Bacteria	1090
1483	Ga0501036_1519031	3300049572	Bacteria	542
1484	Ga0501037_0000306	3300049573	Bacteria	41605
1485	Ga0501037_0001755	3300049573	Bacteria	15758
1486	Ga0501037_0079800	3300049573	Bacteria	2375
1487	Ga0501037_0239578	3300049573	Bacteria	1272
1488	Ga0501037_0340753	3300049573	Bacteria	1035
1489	Ga0501037_1150716	3300049573	Bacteria	501
1490	Ga0501038_0000114	3300049574	Bacteria	68140
1491	Ga0501038_0020928	3300049574	Bacteria	5878
1492	Ga0501038_0188065	3300049574	Bacteria	1663
1493	Ga0501038_0231514	3300049574	Bacteria	1470
1494	Ga0501039_0000066	3300049575	Bacteria	80201
1495	Ga0501039_0001954	3300049575	Bacteria	15288
1496	Ga0501039_0107823	3300049575	Bacteria	2177
1497	Ga0501039_0231692	3300049575	Bacteria	1452
1498	Ga0501039_0574632	3300049575	Bacteria	884
1499	Ga0501039_0850060	3300049575	Bacteria	711
1500	Ga0501039_0997708	3300049575	Bacteria	651
1501	Ga0501041_0129148	3300049577	Bacteria	1574
1502	Ga0501042_0027890	3300049578	Bacteria	3973
1503	Ga0501042_0889645	3300049578	Bacteria	648
1504	Ga0501043_0002389	3300049579	Bacteria	15913
1505	Ga0501043_0017681	3300049579	Bacteria	5591
1506	Ga0501043_0067300	3300049579	Bacteria	2813
1507	Ga0501043_0121851	3300049579	Bacteria	2045
1508	Ga0501043_0272000	3300049579	Bacteria	1300
1509	Ga0501046_0004110	3300049580	Bacteria	13261
1510	Ga0501046_0006119	3300049580	Bacteria	10697
1511	Ga0501046_0016268	3300049580	Bacteria	6235
1512	Ga0501046_0136166	3300049580	Bacteria	1860
1513	Ga0501046_0850383	3300049580	Bacteria	638
1514	Ga0501047_0000085	3300049581	Bacteria	118617
1515	Ga0501047_0001692	3300049581	Bacteria	21460
1516	Ga0501047_0003015	3300049581	Bacteria	15979
1517	Ga0501047_0055143	3300049581	Bacteria	3844
1518	Ga0501047_0068872	3300049581	Bacteria	3408
1519	Ga0501047_0094351	3300049581	Bacteria	2871
1520	Ga0501047_1420230	3300049581	Bacteria	509
1521	Ga0501048_0000581	3300049582	Bacteria	25952
1522	Ga0501048_0001859	3300049582	Bacteria	16028
1523	Ga0501048_0058240	3300049582	Bacteria	2739
1524	Ga0501048_0674127	3300049582	Bacteria	742
1525	Ga0501067_0000096	3300049583	Bacteria	50761
1526	Ga0501067_0006235	3300049583	Bacteria	6613
1527	Ga0501067_0051676	3300049583	Bacteria	2277
1528	Ga0501068_0000220	3300049584	Bacteria	27785
1529	Ga0501068_0363186	3300049584	Bacteria	931
1530	Ga0501069_0023247	3300049585	Bacteria	3378
1531	Ga0501070_0024675	3300049586	Bacteria	5042
1532	Ga0501070_0049626	3300049586	Bacteria	3485
1533	Ga0501070_0152433	3300049586	Bacteria	1907
1534	Ga0501070_0185665	3300049586	Bacteria	1710
1535	Ga0501070_0287636	3300049586	Bacteria	1340
1536	Ga0501071_0239885	3300049587	Bacteria	1367
1537	Ga0501071_1153564	3300049587	Bacteria	599
1538	Ga0501072_0003496	3300049588	Bacteria	11831
1539	Ga0501072_0062351	3300049588	Bacteria	2941
1540	Ga0501073_0000026	3300049589	Bacteria	124358
1541	Ga0501073_0056913	3300049589	Bacteria	2734
1542	Ga0501073_0155419	3300049589	Bacteria	1585
1543	Ga0501073_0205070	3300049589	Bacteria	1363
1544	Ga0501074_0000878	3300049590	Bacteria	19194
1545	Ga0501074_0016996	3300049590	Bacteria	5277
1546	Ga0501074_0952527	3300049590	Bacteria	604
1547	Ga0501076_0098295	3300049592	Bacteria	2358
1548	Ga0501076_1463114	3300049592	Bacteria	561
1549	Ga0501077_0157199	3300049593	Bacteria	1443
1550	Ga0501079_0007708	3300049741	Bacteria	8148
1551	Ga0501080_0000048	3300049742	Bacteria	76890
1552	Ga0501080_0005240	3300049742	Bacteria	11553
1553	Ga0501080_0205144	3300049742	Bacteria	1808
1554	Ga0501080_0508553	3300049742	Bacteria	1076
1555	Ga0501080_0636532	3300049742	Bacteria	944
1556	Ga0501083_0012775	3300049744	Bacteria	5873
1557	Ga0501083_0112533	3300049744	Bacteria	1789
1558	Ga0501083_0290843	3300049744	Bacteria	1063
1559	Ga0501083_0468751	3300049744	Bacteria	820
1560	Ga0501035_0000058	3300049822	Bacteria	135089
1561	Ga0501035_0003195	3300049822	Bacteria	15713
1562	Ga0501035_0012181	3300049822	Bacteria	7954
1563	Ga0501035_0026608	3300049822	Bacteria	5291
1564	Ga0501035_0027489	3300049822	Bacteria	5199
1565	Ga0501035_0048616	3300049822	Bacteria	3804
1566	Ga0501035_0154490	3300049822	Bacteria	1989
1567	Ga0501035_0487278	3300049822	Bacteria	1016
1568	Ga0501035_1159003	3300049822	Bacteria	601
1569	Ga0501044_0000023	3300049823	Bacteria	196555
1570	Ga0501044_0000061	3300049823	Bacteria	133207
1571	Ga0501044_0027976	3300049823	Bacteria	5950
1572	Ga0501044_0055059	3300049823	Bacteria	4086
1573	Ga0501044_0143593	3300049823	Bacteria	2374
1574	Ga0501044_0492961	3300049823	Bacteria	1127
1575	Ga0501044_0506943	3300049823	Bacteria	1107
1576	Ga0501044_0522220	3300049823	Bacteria	1087
1577	Ga0501044_0557782	3300049823	Bacteria	1042
1578	Ga0501044_1096512	3300049823	Bacteria	665
1579	Ga0501044_1210823	3300049823	Bacteria	623
1580	Ga0501044_1338116	3300049823	Bacteria	582
1581	Ga0501045_0042795	3300049824	Bacteria	3297
1582	nmdc:mga03683_143859_c1	3300050489	Bacteria	1073
1583	nmdc:mga03683_41604_c1	3300050489	Bacteria	1888
1584	nmdc:mga03n38_14425_c1	3300050490	Bacteria	3028
1585	nmdc:mga03n38_230488_c1	3300050490	Bacteria	971
1586	nmdc:mga00v17_117600_c1	3300050491	Bacteria	1691
1587	nmdc:mga00v17_1983_c1	3300050491	Bacteria	10563
1588	nmdc:mga00v17_24303_c2	3300050491	Bacteria	2659
1589	nmdc:mga00v17_264845_c1	3300050491	Bacteria	1115
1590	nmdc:mga00v17_301989_c1	3300050491	Bacteria	1040
1591	nmdc:mga00v17_35100_c1	3300050491	Bacteria	2983
1592	nmdc:mga00v17_62255_c1	3300050491	Bacteria	2295
1593	nmdc:mga0yw44_1163035_c1	3300050492	Bacteria	521
1594	nmdc:mga0yw44_20306_c1	3300050492	Bacteria	3684
1595	nmdc:mga0yw44_30838_c1	3300050492	Bacteria	3112
1596	nmdc:mga0yw44_32702_c1	3300050492	Bacteria	3033
1597	nmdc:mga0yw44_39108_c1	3300050492	Bacteria	2811
1598	nmdc:mga0yw44_459_c1	3300050492	Bacteria	14439
1599	nmdc:mga0yw44_514020_c1	3300050492	Bacteria	813
1600	nmdc:mga0yw44_832515_c1	3300050492	Bacteria	626
1601	nmdc:mga06z11_168361_c1	3300050494	Bacteria	1257
1602	nmdc:mga06z11_21028_c1	3300050494	Bacteria	3026
1603	nmdc:mga06z11_282923_c1	3300050494	Bacteria	983
1604	nmdc:mga06z11_325884_c1	3300050494	Bacteria	917
1605	nmdc:mga06z11_49115_c1	3300050494	Bacteria	2151
1606	nmdc:mga06z11_55052_c1	3300050494	Bacteria	2053
1607	nmdc:mga04h51_1394_c1	3300050495	Bacteria	5580
1608	nmdc:mga04h51_35591_c1	3300050495	Bacteria	1597
1609	nmdc:mga07m45_306823_c1	3300050496	Bacteria	923
1610	nmdc:mga07m45_528296_c1	3300050496	Bacteria	683
1611	nmdc:mga07m45_697765_c1	3300050496	Bacteria	584
1612	nmdc:mga07m45_91404_c1	3300050496	Bacteria	1744
1613	nmdc:mga05p37_68622_c1	3300050507	Bacteria	4360
1614	nmdc:mga05p37_855744_c1	3300050507	Bacteria	987
1615	nmdc:mga09592_1195526_c1	3300050508	Bacteria	629
1616	nmdc:mga06r32_1382176_c1	3300050510	Bacteria	646
1617	nmdc:mga08y16_170983_c1	3300050511	Bacteria	2257
1618	nmdc:mga08y16_250897_c1	3300050511	Bacteria	1829
1619	nmdc:mga0n895_170239_c1	3300050512	Bacteria	2210
1620	nmdc:mga0n895_250652_c1	3300050512	Bacteria	1797
1621	nmdc:mga0n895_461193_c1	3300050512	Bacteria	1282
1622	nmdc:mga0rr50_432630_c1	3300050513	Bacteria	1114
1623	nmdc:mga0rr50_484306_c1	3300050513	Bacteria	1051
1624	nmdc:mga0rr50_485295_c1	3300050513	Bacteria	1050
1625	nmdc:mga0a205_440830_c1	3300050515	Bacteria	1163
1626	nmdc:mga0a205_92540_c1	3300050515	Bacteria	2921
1627	nmdc:mga0sz30_184273_c1	3300050516	Bacteria	927
1628	Ga0495601_0000005	3300053077	Bacteria	387079
1629	Ga0495601_0047764	3300053077	Bacteria	2695
1630	Ga0495601_0093641	3300053077	Bacteria	1935
1631	Ga0495601_0242183	3300053077	Bacteria	1177
1632	Ga0495601_0254185	3300053077	Bacteria	1147
1633	Ga0495601_0314174	3300053077	Bacteria	1020
1634	Ga0495601_0689966	3300053077	Bacteria	652
1635	Ga0495601_0874501	3300053077	Bacteria	568
1636	Ga0495612_0000001	3300053078	Bacteria	418244
1637	Ga0495612_0031291	3300053078	Bacteria	2145
1638	Ga0495612_0075747	3300053078	Bacteria	1409
1639	Ga0495612_0084319	3300053078	Bacteria	1338
1640	Ga0495612_0207005	3300053078	Bacteria	866
1641	Ga0495612_0269259	3300053078	Bacteria	760
1642	Ga0500635_0026822	3300053080	Bacteria	1826
1643	Ga0500635_0096805	3300053080	Bacteria	1081
1644	Ga0500635_0136602	3300053080	Bacteria	928
1645	Ga0495655_0037018	3300053083	Bacteria	1223
1646	Ga0495595_0000030	3300053084	Bacteria	89992
1647	Ga0495595_0001636	3300053084	Bacteria	8761
1648	Ga0495595_0016240	3300053084	Bacteria	3181
1649	Ga0495595_0100207	3300053084	Bacteria	1397
1650	Ga0495595_0556011	3300053084	Bacteria	586
1651	Ga0495619_0000007	3300053085	Bacteria	369936
1652	Ga0495619_0000182	3300053085	Bacteria	46524
1653	Ga0495619_0023152	3300053085	Bacteria	3980
1654	Ga0495619_0125210	3300053085	Bacteria	1763
1655	Ga0495619_0300175	3300053085	Bacteria	1112
1656	Ga0495619_0676223	3300053085	Bacteria	703
1657	Ga0495619_0942512	3300053085	Bacteria	579
1658	Ga0500578_0105572	3300053086	Bacteria	1779
1659	Ga0500643_037138	3300053087	Bacteria	1452
1660	Ga0500643_093566	3300053087	Bacteria	818
1661	Ga0500581_102258	3300053089	Bacteria	1407
1662	Ga0500646_0038243	3300053090	Bacteria	1343
1663	Ga0500646_0039192	3300053090	Bacteria	1328
1664	Ga0500646_0065724	3300053090	Bacteria	1077
1665	Ga0500647_0182706	3300053091	Bacteria	961
1666	Ga0500647_0255521	3300053091	Bacteria	768
1667	Ga0500651_0292593	3300053093	Bacteria	936
1668	Ga0500651_0401878	3300053093	Bacteria	769
1669	Ga0500566_0000184	3300053094	Bacteria	32281
1670	Ga0500566_0296002	3300053094	Bacteria	764
1671	Ga0500641_0170287	3300053096	Bacteria	937
1672	Ga0500554_002968	3300053102	Bacteria	3404
1673	Ga0500554_062233	3300053102	Bacteria	1200
1674	Ga0500554_079623	3300053102	Bacteria	1077
1675	Ga0500555_022366	3300053103	Bacteria	1817
1676	Ga0500556_0000002	3300053104	Bacteria	773626
1677	Ga0500557_062831	3300053105	Bacteria	1209
1678	Ga0500562_015550	3300053108	Bacteria	1952
1679	Ga0500562_020009	3300053108	Bacteria	1736
1680	Ga0500572_000010	3300053111	Bacteria	67071
1681	Ga0500591_123561	3300053115	Bacteria	1058
1682	Ga0500592_003032	3300053116	Bacteria	2685
1683	Ga0500594_0011442	3300053118	Bacteria	2071
1684	Ga0500595_000143	3300053119	Bacteria	46542
1685	Ga0500595_011977	3300053119	Bacteria	3369
1686	Ga0500595_012668	3300053119	Bacteria	3253
1687	Ga0500595_118184	3300053119	Bacteria	750
1688	Ga0500595_139396	3300053119	Bacteria	680
1689	Ga0500607_120424	3300053121	Bacteria	1270
1690	Ga0500608_000393	3300053122	Bacteria	16801
1691	Ga0500608_023169	3300053122	Bacteria	2887
1692	Ga0500614_020882	3300053123	Bacteria	1515
1693	Ga0500618_000219	3300053125	Bacteria	45126
1694	Ga0500621_068570	3300053126	Bacteria	1431
1695	Ga0500642_0000058	3300053130	Bacteria	66200
1696	Ga0500652_000711	3300053131	Bacteria	11297
1697	Ga0500655_058105	3300053133	Bacteria	776
1698	Ga0500658_0012749	3300053134	Bacteria	3103
1699	Ga0500658_0275415	3300053134	Bacteria	773
1700	Ga0500559_0000366	3300053136	Bacteria	33251
1701	Ga0500559_0004662	3300053136	Bacteria	6458
1702	Ga0500559_0096796	3300053136	Bacteria	1356
1703	Ga0500561_0180669	3300053137	Bacteria	664
1704	Ga0500568_0010866	3300053139	Bacteria	4245
1705	Ga0500568_0016627	3300053139	Bacteria	3265
1706	Ga0500568_0016779	3300053139	Bacteria	3245
1707	Ga0500568_0049861	3300053139	Bacteria	1651
1708	Ga0500577_0000616	3300053142	Bacteria	9140
1709	Ga0500579_243184	3300053143	Bacteria	594
1710	Ga0500586_030001	3300053145	Bacteria	1785
1711	Ga0500588_0019761	3300053146	Bacteria	1797
1712	Ga0500590_008580	3300053148	Bacteria	5106
1713	Ga0500590_079781	3300053148	Bacteria	1610
1714	Ga0500603_000664	3300053150	Bacteria	8371
1715	Ga0500603_000777	3300053150	Bacteria	7654
1716	Ga0500603_043016	3300053150	Bacteria	1212
1717	Ga0500616_0000069	3300053153	Bacteria	234334
1718	Ga0500616_0008352	3300053153	Bacteria	6443
1719	Ga0500616_0009267	3300053153	Bacteria	5999
1720	Ga0500616_0296072	3300053153	Bacteria	674
1721	Ga0500622_0006990	3300053156	Bacteria	6461
1722	Ga0500627_0122759	3300053158	Bacteria	1172
1723	Ga0500630_003535	3300053159	Bacteria	7555
1724	Ga0500634_0027957	3300053161	Bacteria	3071
1725	Ga0500638_006438	3300053162	Bacteria	4805
1726	Ga0500638_105237	3300053162	Bacteria	1310
1727	Ga0500638_219457	3300053162	Bacteria	790
1728	Ga0500638_320794	3300053162	Bacteria	588
1729	Ga0500639_000034	3300053163	Bacteria	66994
1730	Ga0500636_0006585	3300053177	Bacteria	6672
1731	Ga0500636_0012365	3300053177	Bacteria	5003
1732	Ga0500637_0000742	3300053178	Bacteria	13043
1733	Ga0500637_0012431	3300053178	Bacteria	4436
1734	Ga0500637_0035468	3300053178	Bacteria	2796
1735	Ga0500637_0206351	3300053178	Bacteria	1116
1736	Ga0500570_109881	3300053724	Bacteria	1123
1737	Ga0500570_116171	3300053724	Bacteria	1067
1738	Ga0500611_008139	3300053727	Bacteria	1609
1739	Ga0500645_032570	3300053730	Bacteria	1562
1740	Ga0500596_003092	3300053735	Bacteria	3199
1741	Ga0500587_027631	3300053739	Bacteria	766
1742	Ga0500661_002284	3300055283	Bacteria	3620
1743	Ga0500661_086154	3300055283	Bacteria	586
1744	Ga0587062_019951	3300059639	Bacteria	940
1745	Ga0501082_0006469	3300060353	Bacteria	10161
1746	Ga0501082_0080678	3300060353	Bacteria	2808
1747	Ga0501082_0260842	3300060353	Bacteria	1507
1748	Ga0501082_0926517	3300060353	Bacteria	762
1749	Ga0466962_0227605	3300061719	Bacteria	914
1750	Ga0530510_1402460	3300061734	Bacteria	536
1751	2509147235	2508501128	Bacteria	8613869
1752	2510305049	2510065057	Bacteria	6649661
1753	2511501134	2511231052	Bacteria	6974333
1754	2512532549	2512047086	Bacteria	6850303
1755	2512972115	2512875026	Bacteria	6861065
1756	2513582908	2513237086	Bacteria	7265287
1757	2513604785	2513237089	Bacteria	6553624
1758	2513616296	2513237091	Bacteria	6900273
1759	2513628254	2513237092	Bacteria	8341956
1760	2513646594	2513237095	Bacteria	8976980
1761	2513656642	2513237096	Bacteria	8722461
1762	2513702039	2513237102	Bacteria	7703324
1763	2513858568	2513237137	Bacteria	9558895
1764	2513880981	2513237140	Bacteria	7076289
1765	2513889229	2513237141	Bacteria	8496279
1766	2513902217	2513237143	Bacteria	6664116
1767	2513917827	2513237145	Bacteria	8979722
1768	2513987485	2513237156	Bacteria	6402557
1769	2514007438	2513237160	Bacteria	6650282
1770	2514010741	2513237161	Bacteria	8871253
1771	2515608311	2515154107	Bacteria	6795637
1772	2516209002	2516143018	Bacteria	6951533
1773	2516892415	2516653046	Bacteria	6989037
1774	2517102061	2517093001	Bacteria	9002274
1775	2517569223	2517487022	Bacteria	7227575
1776	2517893125	2517572143	Bacteria	9484767
1777	2524436499	2524023205	Bacteria	8918781
1778	2524451024	2524023207	Bacteria	6813453
1779	2524539349	2524023228	Bacteria	10118060
1780	2551682493	2551306084	Bacteria	8942552
1781	2551683788	2551306085	Bacteria	7347181
1782	2551694601	2551306086	Bacteria	6843938
1783	2551703836	2551306087	Bacteria	7351905
1784	2551712167	2551306089	Bacteria	7162724
1785	2551723230	2551306090	Bacteria	7953713
1786	2551727471	2551306091	Bacteria	7086830
1787	2551738431	2551306092	Bacteria	6992595
1788	2551746397	2551306093	Bacteria	7064773
1789	2600192088	2599185352	Bacteria	7228948
1790	2600375370	2600254933	Bacteria	4750527
1791	2603858839	2602042107	Bacteria	6226103
1792	2617376524	2617270741	Bacteria	8201522
1793	2643807078	2643221557	Bacteria	7184309
1794	2643855779	2643221568	Bacteria	5187270
1795	2644069655	2643221610	Bacteria	7480339
1796	2644288309	2643221651	Bacteria	4798932
1797	2644380460	2643221668	Bacteria	7306521
1798	2644420809	2643221675	Bacteria	7473456
1799	2644454334	2643221680	Bacteria	7473610
1800	2644675444	2643221723	Bacteria	7095460
1801	2644689671	2643221726	Bacteria	7455827
1802	2671117759	2667528175	Bacteria	7532676
1803	2723845794	2721755755	Bacteria	8322773
1804	2728754639	2728368998	Bacteria	8720350
1805	2738946434	2738541317	Bacteria	5340176
1806	2745077128	2744054633	Bacteria	8678936
1807	2776912942	2775507049	Bacteria	6284736
1808	2793064851	2791355196	Bacteria	7323613
1809	2793070005	2791355197	Bacteria	8420563
1810	2793077213
1811	2802719237	2802428858	Bacteria	6636079
1812	2802723204	2802428859	Bacteria	6667919
1813	2802732436	2802428860	Bacteria	6525526
1814	2802738566	2802428861	Bacteria	6534206
1815	2802745188	2802428862	Bacteria	6633353
1816	2802751625	2802428863	Bacteria	6410669
1817	2818240213	2816332527	Bacteria	8933356
1818	2824604226	2824600985	Bacteria	8488197
1819	2824617456	2824609381	Bacteria	8672835
1820	2824619776	2824617872	Bacteria	8814715
1821	2824629384	2824626560	Bacteria	8813858
1822	2824642137	2824635225	Bacteria	8785348
1823	2824651178	2824644064	Bacteria	8743947
1824	2824660048	2824653114	Bacteria	8493680
1825	2824677002	2824671348	Bacteria	8369588
1826	2824683709	2824679649	Bacteria	8248951
1827	2824694978	2824687955	Bacteria	8360029
1828	2824712619	2824704595	Bacteria	9667483
1829	2824721226	2824714736	Bacteria	8717648
1830	2824731271	2824723954	Bacteria	8758240
1831	2824739456	2824732956	Bacteria	7810675
1832	2824749635	2824746037	Bacteria	7911610
1833	2824760189	2824753945	Bacteria	9787441
1834	2824767178	2824763712	Bacteria	9792355
1835	2837679435	2837678835	Bacteria	5252418
1836	2837682913	2837678835	Bacteria	5252418
1837	2838126602	2838122688	Bacteria	8803140
1838	2841947256	2841941048	Bacteria	8688029
1839	2841950701	2841949485	Bacteria	8680857
1840	2841964389	2841957949	Bacteria	8652217
1841	2841967018	2841966195	Bacteria	8673214
1842	2841975763	2841974524	Bacteria	8931498
1843	2841990130	2841983080	Bacteria	8395090
1844	2842039811	2842038055	Bacteria	8002051
1845	2842047243	2842045827	Bacteria	8006841
1846	2847935206	2847930680	Bacteria	9342022
1847	2855831486	2855825444	Bacteria	6785811
1848	2855840610	2855839649	Bacteria	7135830
1849	2857528055	2857524615	Bacteria	6615449
1850	2858801137	2858800743	Bacteria	6603254
1851	2874612791	2874612657	Bacteria	8252029
1852	2874627838	2874620515	Bacteria	8290088
1853	2876810938	2876808645	Bacteria	8824342
1854	2879089110	2879083081	Bacteria	8587928
1855	2879115666	2879110137	Bacteria	8907982
1856	2881366652	2881364244	Bacteria	7710352
1857	2881669594	2881665667	Bacteria	8175609
1858	2885373284	2885366525	Bacteria	8326213
1859	2885378306	2885374607	Bacteria	8927485
1860	2888383266	2888378607	Bacteria	9652610
1861	2888423649	2888419890	Bacteria	7857137
1862	2889040635	2889033259	Bacteria	9099371
1863	2891089367	2891088606	Bacteria	4762464
1864	2891377148	2891373044	Bacteria	5202277
1865	2893068476	2893066018	Bacteria	6158120
1866	2894654716	2894652903	Bacteria	4587256
1867	2899803896	2899803654	Bacteria	5577784
1868	2903753059	2903748898	Bacteria	9972761
1869	2904672842	2904666416	Bacteria	8226587
1870	2904696541	2904690495	Bacteria	9412302
1871	2904717105	2904711408	Bacteria	9771557
1872	2906617664
1873	2906636789	2906635258	Bacteria	8601019
1874	2906645909	2906643746	Bacteria	8722424
1875	2906661363	2906660503	Bacteria	8595048
1876	2908743518	2908739725	Bacteria	8628932
1877	2908760394	2908756301	Bacteria	8864324
1878	2908779370	2908775508	Bacteria	8092255
1879	2913310849	2913308742	Bacteria	5350706
1880	2915985815	2915980308	Bacteria	6624279
1881	2915989178	2915986958	Bacteria	6739310
1882	2915995198	2915993759	Bacteria	7016183
1883	2916005608	2916000859	Bacteria	6865702
1884	2916013944	2916007675	Bacteria	6898660
1885	2916021176	2916014648	Bacteria	6946486
1886	2916023191	2916021584	Bacteria	6854472
1887	2916031456	2916028427	Bacteria	6748433
1888	2916038835	2916035215	Bacteria	6755766
1889	2916044537	2916041962	Bacteria	6820487
1890	2916049555	2916048683	Bacteria	6543552
1891	2916055196	2916055098	Bacteria	6758838
1892	2916065743	2916061851	Bacteria	6737736
1893	2916070421	2916068649	Bacteria	6943657
1894	2916077672	2916076590	Bacteria	6596108
1895	2917555330	2917554339	Bacteria	4987857
1896	2919075454	2919073203	Bacteria	6531949
1897	2919167455	2919166419	Bacteria	4952238
1898	2921204590	2921201388	Bacteria	6926299
1899	2921210470	2921208531	Bacteria	6745326
1900	2921238289	2921237296	Bacteria	6876710
1901	2921246258	2921244191	Bacteria	6568419
1902	2921251515	2921250672	Bacteria	6677771
1903	2921257948	2921257292	Bacteria	6808382
1904	2921264073	2921263974	Bacteria	6864552
1905	2921286826	2921282425	Bacteria	6826397
1906	2921294545	2921289301	Bacteria	7316391
1907	2921304050	2921296804	Bacteria	7176999
1908	2922367740	2922361189	Bacteria	7436256
1909	2922392356	2922386360	Bacteria	7017218
1910	2922395580	2922393267	Bacteria	8285685
1911	2922429361
1912	2924146523	2924144063	Bacteria	6883928
1913	2924151259	2924150972	Bacteria	7169444
1914	2924160737	2924158325	Bacteria	7188855
1915	2924171775	2924165586	Bacteria	7260590
1916	2924177462	2924172951	Bacteria	6749356
1917	2924185327	2924179722	Bacteria	6843264
1918	2924188782	2924186466	Bacteria	6876637
1919	2924196601	2924193448	Bacteria	6955718
1920	2924203084	2924200457	Bacteria	6757188
1921	2924212570	2924207177	Bacteria	6917007
1922	2924216098	2924214083	Bacteria	7080103
1923	2924224676	2924221636	Bacteria	7113495
1924	2924230353	2924228884	Bacteria	6633132
1925	2935634064	2935630451	Bacteria	8169952
1926	2937000941	2936996657	Bacteria	6298727
1927	2937004379	2937002841	Bacteria	6934057
1928	2937011132	2937009748	Bacteria	6746052
1929	2937019464	2937016420	Bacteria	6782579
1930	2937028564	2937023124	Bacteria	6815156
1931	2937030455	2937029754	Bacteria	6424026
1932	2937040646	2937036028	Bacteria	6846469
1933	2937045186	2937042894	Bacteria	6741576
1934	2937056056	2937049772	Bacteria	6757901
1935	2937059234	2937056579	Bacteria	7107896
1936	2937065463	2937063883	Bacteria	7199456
1937	2937077343	2937071275	Bacteria	6984483
1938	2937079498	2937078374	Bacteria	6610289
1939	2937091669	2937084907	Bacteria	6618516
1940	2937095752	2937091812	Bacteria	6979387
1941	2937104054	2937098957	Bacteria	7249374
1942	2937111809	2937106411	Bacteria	6947143
1943	2937114029	2937113482	Bacteria	6505872
1944	2937125527	2937119839	Bacteria	6597547
1945	2937126699	2937126314	Bacteria	6771275
1946	2941510955	2941507105	Bacteria	8166816
1947	2941518339	2941515067	Bacteria	8166720
1948	2941527398	2941523033	Bacteria	8169134
1949	2957379640	2957375807	Bacteria	6425588
1950	2957382810	2957382221	Bacteria	6737050
1951	2957388968	2957388812	Bacteria	6778072
1952	2957396598	2957395598	Bacteria	6822399
1953	2957407597	2957402308	Bacteria	6741770
1954	2957409648	2957408893	Bacteria	6558585
1955	2957418663	2957415311	Bacteria	6991633
1956	2957424688	2957422303	Bacteria	7172205
1957	2957432602	2957430029	Bacteria	7022557
1958	2957439295	2957437181	Bacteria	6568994
1959	2957450084	2957443900	Bacteria	6869977
1960	2957456524	2957450854	Bacteria	6765715
1961	2957463637	2957457609	Bacteria	6967680
1962	2957466568	2957464669	Bacteria	6568877
1963	2957477271	2957471148	Bacteria	6797643
1964	2957479856	2957478035	Bacteria	6756658
1965	2957486045	2957484790	Bacteria	6703082
1966	2957497320	2957491536	Bacteria	6695180
1967	2957498812	2957498199	Bacteria	7126688
1968	2957509191	2957505466	Bacteria	7253085
1969	2960589240	2960584000	Bacteria	6864594
1970	2960595116	2960591022	Bacteria	6622873
1971	2960598907	2960597568	Bacteria	6550735
1972	2960608499	2960603979	Bacteria	6898737
1973	2960611848	2960610863	Bacteria	6691244
1974	2960617865	2960617483	Bacteria	6727748
1975	2960626833	2960624210	Bacteria	6875384
1976	2960634782	2960631154	Bacteria	6732508
1977	2960643253	2960637947	Bacteria	7296468
1978	2960645729	2960645483	Bacteria	7211087
1979	2960655692	2960652885	Bacteria	7083688
1980	2960666776	2960660292	Bacteria	7041660
1981	2960668756	2960667422	Bacteria	6763020
1982	2960677535	2960674078	Bacteria	6609048
1983	2960684962	2960680706	Bacteria	6624464
1984	2960689130	2960687367	Bacteria	6535474
1985	2960695024	2960693952	Bacteria	6749742
1986	2964613778	2964607997	Bacteria	7101408
1987	2964617851	2964615318	Bacteria	6809089
1988	2964625016	2964621998	Bacteria	6834995
1989	2964635320	2964628898	Bacteria	7083044
1990	2964642476	2964636051	Bacteria	7091832
1991	2964646672	2964643177	Bacteria	6820887
1992	2964656399	2964649959	Bacteria	6675118
1993	2964659790	2964656573	Bacteria	7100150
1994	2964665639	2964663802	Bacteria	7019362
1995	2964672692	2964670856	Bacteria	6851364
1996	2964683717	2964678106	Bacteria	6792020
1997	2964686335	2964685014	Bacteria	6839111
1998	2964692202	2964691889	Bacteria	6802758
1999	2964702792	2964698721	Bacteria	6765331
2000	2964708653	2964705432	Bacteria	7114648
2001	2964718719	2964712639	Bacteria	6695970
2002	2964726486	2964719344	Bacteria	7286602
2003	2967666829	2967664464	Bacteria	6948836
2004	2967677651	2967671571	Bacteria	7021409
2005	2967681565	2967678726	Bacteria	7264382
2006	2967690421	2967686174	Bacteria	6678622
2007	2967693409	2967693043	Bacteria	6804451
2008	2967702133	2967699805	Bacteria	6854538
2009	2967711089	2967706974	Bacteria	7186053
2010	2967716365	2967714385	Bacteria	7000047
2011	2967723265	2967721400	Bacteria	7073753
2012	2967730969	2967728569	Bacteria	6641507
2013	2967735607	2967735183	Bacteria	6827012
2014	2967744168	2967742019	Bacteria	6794534
2015	2967754442	2967748971	Bacteria	6733771
2016	2967757058	2967755722	Bacteria	6814706
2017	2967763960	2967762386	Bacteria	6923502
2018	2967771616	2967769361	Bacteria	6587838
2019	2967776838	2967775926	Bacteria	6738189
2020	2970020616	2970019648	Bacteria	7072033
2021	2970032134	2970026789	Bacteria	6785236
2022	2970037866	2970033650	Bacteria	7118744
2023	2970041461	2970040964	Bacteria	6731123
2024	2970050418	2970047711	Bacteria	7088379
2025	2970057983	2970054988	Bacteria	6611507
2026	2970067383	2970061556	Bacteria	7099761
2027	2970072063	2970068827	Bacteria	7123112
2028	2970081601	2970076120	Bacteria	6697332
2029	2970085953	2970082768	Bacteria	6183754
2030	2970089666	2970088815	Bacteria	6933825
2031	2970097545	2970095765	Bacteria	6936963
2032	2970105012	2970102677	Bacteria	6812532
2033	2970113030	2970109326	Bacteria	6863976
2034	2970117883	2970116247	Bacteria	6501857
2035	2970123314	2970122695	Bacteria	6625855
2036	2970129681	2970129317	Bacteria	6806560
2037	2970138824	2970136068	Bacteria	7207982
2038	2970145990	2970143518	Bacteria	6446480
2039	2970151154	2970149975	Bacteria	6779706
2040	2970163555	2970156795	Bacteria	7168044
2041	2970166912	2970164137	Bacteria	6861252
2042	2970172864	2970170962	Bacteria	6876229
2043	2970178419	2970177841	Bacteria	6768001
2044	2970187448	2970184632	Bacteria	7054431
2045	2970194217	2970191845	Bacteria	7032787
2046	2977517815	2977516862	Bacteria	6940108
2047	2977527151	2977523885	Bacteria	6960446
2048	2977534481	2977530762	Bacteria	6951399
2049	2977538151	2977537788	Bacteria	6929320
2050	2977551672	2977544691	Bacteria	6875412
2051	2977552151	2977551784	Bacteria	7125765
2052	2977560245	2977558990	Bacteria	6863948
2053	2977566376	2977565890	Bacteria	6901543
2054	2977576596	2977572785	Bacteria	6763888
2055	2977581256	2977579622	Bacteria	6772100
2056	2978973887	2978969890	Bacteria	5400756
2057	2984589233	2984587000	Bacteria	5263363
2058	2989354042	2989349275	Bacteria	6349068
2059	3000867384	3000865235	Bacteria	3106258
2060	3005479529	3005474847	Bacteria	9259049
2061	3005489413	3005483717	Bacteria	7877331
2062	3005588548	3005587118	Bacteria	7794411
2063	648736528	648276728	Bacteria	6968865
2064	8003993109	8003992118	Bacteria	7266902
2065	8004000353	8003999396	Bacteria	7063185
2066	8006941610	8006933436	Bacteria	10410654
2067	8006967444	8006964411	Bacteria	8966052
2068	8006981320	8006973647	Bacteria	10679141
2069	8006988076	8006984368	Bacteria	9651211
2070	8019557530	8019555841	Bacteria	9642137
2071	8019567767	8019565922	Bacteria	9639779
2072	8056674554	8056673599	Bacteria	7871253
2073	8056690209	8056689827	Bacteria	6712655
2074	Ga0068865_100151932
2075	RicEn_C8330
2076	JGI24739J22299_10018417
2077	JGI24737J22298_10006184
2078	JGI24750J21931_1029166
2079	JGI24738J21930_10078412
2080	JGI25158J39367_1001323
2081	JGI25159J45721_1000002
2082	JGI25151J46595_10034901
2083	JGI25406J46586_10005624
2084	JGI25406J46586_10034041
2085	JGI25165J46597_1047793
2086	JGI25160J50197_1000008
2087	JGI25161J50226_1001402
2088	Ga0007416J51690_1062205
2089	JGI25404J52841_10013477
2090	Ga0055526_1000738
2091	Ga0055526_1040251
2092	Ga0055524_1001933
2093	Ga0055524_1026936
2094	Ga0055536_1003120
2095	Ga0055530_10037481
2096	Ga0055531_10032635
2097	JGI25405J52794_10038913
2098	Ga0055543_1000027
2099	Ga0058859_10046184
2100	Ga0065165_1000015
2101	Ga0065165_1103502
2102	Ga0065707_10170968
2103	Ga0070658_10042306
2104	Ga0070658_10472112
2105	Ga0070658_10684824
2106	Ga0070676_10047287
2107	Ga0070676_10094344
2108	Ga0070676_10713016
2109	Ga0070683_100015738
2110	Ga0070683_100029863
2111	Ga0070683_100180712
2112	Ga0070683_100291940
2113	Ga0070683_100553689
2114	Ga0070683_100920946
2115	Ga0070690_100428607
2116	Ga0070670_100577301
2117	Ga0070670_101001699
2118	Ga0068869_100167920
2119	Ga0068869_100604038
2120	Ga0070680_100018923
2121	Ga0070680_100056843
2122	Ga0070680_100135881
2123	Ga0070680_100183906
2124	Ga0070682_100008455
2125	Ga0070682_100101285
2126	Ga0070682_100944839
2127	Ga0068868_100383731
2128	Ga0070660_100224174
2129	Ga0070660_100340520
2130	Ga0070660_100515691
2131	Ga0070660_100679771
2132	Ga0070660_101029572
2133	Ga0070689_100345709
2134	Ga0070689_100885692
2135	Ga0070661_100006251
2136	Ga0070661_100377475
2137	Ga0070661_100397894
2138	Ga0070661_100575093
2139	Ga0070668_100196196
2140	Ga0070668_100254498
2141	Ga0070668_100545563
2142	Ga0070669_100641245
2143	Ga0070671_100157738
2144	Ga0070671_100246864
2145	Ga0070671_100685037
2146	Ga0070674_100092796
2147	Ga0070673_100039344
2148	Ga0070688_100110176
2149	Ga0070688_100344427
2150	Ga0070688_100995748
2151	Ga0070659_100027861
2152	Ga0070659_100263056
2153	Ga0070659_100844939
2154	Ga0070659_100912640
2155	Ga0070667_100403808
2156	Ga0070667_100937478
2157	Ga0070667_101389359
2158	Ga0070703_10021042
2159	Ga0070709_10002462
2160	Ga0070709_10008513
2161	Ga0070709_10183493
2162	Ga0070709_10184872
2163	Ga0070709_10480660
2164	Ga0070709_11096552
2165	Ga0070714_100040293
2166	Ga0070714_100067912
2167	Ga0070714_100107165
2168	Ga0070714_100125033
2169	Ga0070714_100240472
2170	Ga0070714_100309048
2171	Ga0070714_100327178
2172	Ga0070714_100516403
2173	Ga0070714_100645261
2174	Ga0070714_100984120
2175	Ga0070713_100054482
2176	Ga0070713_100134948
2177	Ga0070713_100150938
2178	Ga0070713_100159611
2179	Ga0070713_100170252
2180	Ga0070713_100310261
2181	Ga0070713_100872619
2182	Ga0070713_102057563
2183	Ga0070710_10078629
2184	Ga0070711_100010373
2185	Ga0070711_100082334
2186	Ga0070711_100092402
2187	Ga0070711_100936117
2188	Ga0070705_100017248
2189	Ga0070705_100944829
2190	Ga0070705_101027123
2191	Ga0070700_100047597
2192	Ga0070700_100194323
2193	Ga0070700_100207666
2194	Ga0070700_100320279
2195	Ga0070700_100925416
2196	Ga0070708_100120161
2197	Ga0070663_100002668
2198	Ga0070663_100033059
2199	Ga0070663_100075556
2200	Ga0070663_100187089
2201	Ga0070663_100485468
2202	Ga0070663_100682620
2203	Ga0070678_100120299
2204	Ga0070678_100186502
2205	Ga0070678_100484879
2206	Ga0070678_101129453
2207	Ga0070662_100256251
2208	Ga0070662_100327104
2209	Ga0070662_100650976
2210	Ga0070662_100691154
2211	Ga0070681_10099207
2212	Ga0070681_10351891
2213	Ga0070681_10435919
2214	Ga0070681_10590750
2215	Ga0068867_100256310
2216	Ga0068867_100264266
2217	Ga0068867_100448570
2218	Ga0070706_100317200
2219	Ga0070707_100052880
2220	Ga0070707_100228805
2221	Ga0070707_101289819
2222	Ga0070699_100364883
2223	Ga0070679_100013649
2224	Ga0070679_100015214
2225	Ga0070679_100097241
2226	Ga0070679_100513109
2227	Ga0070679_101015650
2228	Ga0070679_101256167
2229	Ga0070679_101737089
2230	Ga0070684_101331831
2231	Ga0070697_100470528
2232	Ga0070697_100560212
2233	Ga0068853_100004481
2234	Ga0068853_100015855
2235	Ga0068853_100052971
2236	Ga0068853_100110318
2237	Ga0068853_100127077
2238	Ga0068853_100226854
2239	Ga0070686_100791852
2240	Ga0070695_100046457
2241	Ga0070696_100044865
2242	Ga0070696_100304377
2243	Ga0070693_100024540
2244	Ga0070693_100328862
2245	Ga0070693_100417981
2246	Ga0070693_100620606
2247	Ga0070665_100202041
2248	Ga0070665_100266722
2249	Ga0070665_100317782
2250	Ga0070665_100465487
2251	Ga0070665_100728740
2252	Ga0070665_100840034
2253	Ga0070665_101529853
2254	Ga0070704_100348830
2255	Ga0070704_100457054
2256	Ga0070704_100649093
2257	Ga0068855_100053970
2258	Ga0068855_100182115
2259	Ga0068855_100192336
2260	Ga0068855_100410078
2261	Ga0068855_100467885
2262	Ga0068855_100576464
2263	Ga0070664_100074373
2264	Ga0070664_100116463
2265	Ga0070664_100231739
2266	Ga0070664_100367144
2267	Ga0070664_100927873
2268	Ga0068857_100017569
2269	Ga0068857_100121424
2270	Ga0068857_100317305
2271	Ga0068857_100879236
2272	Ga0068854_100038649
2273	Ga0068854_100448913
2274	Ga0068854_100570165
2275	Ga0068854_100946911
2276	Ga0068856_100006094
2277	Ga0068856_100065862
2278	Ga0068856_100110816
2279	Ga0068856_100156583
2280	Ga0068856_100340456
2281	Ga0068856_100491810
2282	Ga0068856_100581455
2283	Ga0068856_100724808
2284	Ga0068856_101029015
2285	Ga0068856_101457740
2286	Ga0070702_100162870
2287	Ga0070702_100345157
2288	Ga0070702_100348940
2289	Ga0068852_100146565
2290	Ga0068852_100284438
2291	Ga0068852_100690072
2292	Ga0068859_100376432
2293	Ga0068864_100053281
2294	Ga0068864_101118178
2295	Ga0068861_100105909
2296	Ga0068861_100147764
2297	Ga0068861_100199789
2298	Ga0068861_100205950
2299	Ga0068861_101310056
2300	Ga0068851_10010739
2301	Ga0068851_10013775
2302	Ga0068851_10344548
2303	Ga0068870_11095314
2304	Ga0068863_100697453
2305	Ga0068863_101108205
2306	Ga0068858_100094213
2307	Ga0068858_100286803
2308	Ga0068858_100414076
2309	Ga0068858_100496569
2310	Ga0068858_100680454
2311	Ga0068860_100212431
2312	Ga0068860_100219985
2313	Ga0068860_100714014
2314	Ga0068862_100312937
2315	Ga0068862_100404856
2316	Ga0081455_10006971
2317	Ga0081455_10099315
2318	Ga0081455_10103796
2319	Ga0081455_10177877
2320	Ga0081538_10006363
2321	Ga0081538_10029956
2322	Ga0081538_10096366
2323	Ga0081540_1004115
2324	Ga0081540_1009520
2325	Ga0081540_1012618
2326	Ga0081540_1044223
2327	Ga0081540_1045436
2328	Ga0081539_10000269
2329	Ga0081539_10062546
2330	Ga0070717_10012560
2331	Ga0070717_10188204
2332	Ga0070717_10270330
2333	Ga0070717_10443987
2334	Ga0070717_10577867
2335	Ga0070717_10685922
2336	Ga0070717_11259602
2337	Ga0075365_10001148
2338	Ga0075365_10021956
2339	Ga0075365_10037942
2340	Ga0075365_10169721
2341	Ga0075365_10289964
2342	Ga0075365_10312920
2343	Ga0075365_10393637
2344	Ga0075365_10453573
2345	Ga0075365_10526887
2346	Ga0075368_10011878
2347	Ga0075368_10019458
2348	Ga0075368_10030901
2349	Ga0075368_10116709
2350	Ga0075363_100012935
2351	Ga0075363_100070792
2352	Ga0075363_100154702
2353	Ga0075363_100191860
2354	Ga0075363_100604166
2355	Ga0075364_10002911
2356	Ga0075364_10060438
2357	Ga0075364_10098573
2358	Ga0075364_10109707
2359	Ga0075364_10482445
2360	Ga0075364_10953889
2361	Ga0070715_10001086
2362	Ga0070715_10129998
2363	Ga0070715_10152446
2364	Ga0070715_10574979
2365	Ga0070716_100043081
2366	Ga0070716_100079982
2367	Ga0070716_100201071
2368	Ga0070716_100239911
2369	Ga0070712_100020148
2370	Ga0070712_100029091
2371	Ga0070712_100040277
2372	Ga0070712_100051258
2373	Ga0070712_100065885
2374	Ga0070712_100106069
2375	Ga0070712_100227178
2376	Ga0070712_101129473
2377	Ga0075362_10039615
2378	Ga0075362_10246093
2379	Ga0075367_10017705
2380	Ga0075367_10020853
2381	Ga0075367_10054685
2382	Ga0075367_10071918
2383	Ga0075367_10136228
2384	Ga0075367_10354826
2385	Ga0075367_10422703
2386	Ga0075367_10497395
2387	Ga0075367_10625147
2388	Ga0075369_10150029
2389	Ga0075369_10276272
2390	Ga0075366_10056170
2391	Ga0075366_10347946
2392	Ga0075366_10766804
2393	Ga0097621_100048649
2394	Ga0097621_100138895
2395	Ga0075370_10045609
2396	Ga0075370_10067306
2397	Ga0068871_100098510
2398	Ga0068871_100104538
2399	Ga0068871_100221941
2400	Ga0068871_100287230
2401	Ga0068871_100455643
2402	Ga0068871_100705398
2403	Ga0075428_100111035
2404	Ga0075430_100290390
2405	Ga0075433_10345305
2406	Ga0075434_100008873
2407	Ga0075434_100492674
2408	Ga0075434_100516617
2409	Ga0075434_100760914
2410	Ga0075434_100767893
2411	Ga0075429_100164183
2412	Ga0068865_100172053
2413	Ga0068865_100250603
2414	Ga0097620_100376432
2415	Ga0099825_1017862
2416	Ga0099825_1037273
2417	Ga0099824_1004496
2418	Ga0079104_1001982
2419	Ga0079104_1013021
2420	Ga0075435_100187882
2421	Ga0075435_100441616
2422	Ga0075435_100623339
2423	Ga0099794_10099610
2424	Ga0099794_10100121
2425	Ga0099795_10025562
2426	Ga0099795_10159088
2427	Ga0099795_10349830
2428	Ga0105240_10037022
2429	Ga0105240_10052173
2430	Ga0105240_10542023
2431	Ga0105240_10690301
2432	Ga0105240_10744908
2433	Ga0105240_10795883
2434	Ga0105240_10961784
2435	Ga0105245_10007199
2436	Ga0105245_10018719
2437	Ga0105245_10625170
2438	Ga0105247_10071185
2439	Ga0105247_10225225
2440	Ga0114129_10210254
2441	Ga0114129_11191228
2442	Ga0105243_10023714
2443	Ga0105243_10084140
2444	Ga0105243_10154569
2445	Ga0105243_11149734
2446	Ga0105241_10006398
2447	Ga0105241_10007066
2448	Ga0105241_10022614
2449	Ga0105241_10026213
2450	Ga0105241_10196962
2451	Ga0105241_10791239
2452	Ga0105241_10870750
2453	Ga0105241_11073507
2454	Ga0105241_11185435
2455	Ga0105242_10362596
2456	Ga0105242_10434987
2457	Ga0105242_10836309
2458	Ga0105242_10845111
2459	Ga0105248_10188977
2460	Ga0105248_10605353
2461	Ga0105237_10013015
2462	Ga0105237_10013957
2463	Ga0105237_10021626
2464	Ga0105237_10084684
2465	Ga0105237_10222293
2466	Ga0105237_10387545
2467	Ga0105237_10532361
2468	Ga0105238_10003269
2469	Ga0105238_10008289
2470	Ga0105238_10012843
2471	Ga0105238_10106916
2472	Ga0105238_10447990
2473	Ga0105249_10005485
2474	Ga0105249_10250408
2475	Ga0105249_10253912
2476	Ga0105249_12319179
2477	Ga0099796_10017133
2478	Ga0099796_10084515
2479	Ga0105239_10024638
2480	Ga0105239_10253991
2481	Ga0105239_10421683
2482	Ga0105239_10532503
2483	Ga0105239_11306517
2484	Ga0105246_10034876
2485	Ga0105246_10177407
2486	Ga0105246_10213206
2487	Ga0105246_11806720
2488	Ga0157373_10302250
2489	Ga0157373_10339718
2490	Ga0157371_10002810
2491	Ga0157370_10157794
2492	Ga0157370_10205708
2493	Ga0157370_10823742
2494	Ga0157369_10008435
2495	Ga0157369_10012732
2496	Ga0157369_10013675
2497	Ga0157369_10027369
2498	Ga0157369_10521711
2499	Ga0157369_10562759
2500	Ga0157369_10640320
2501	Ga0157369_10658223
2502	Ga0157369_11133780
2503	Ga0157374_10078358
2504	Ga0157374_11294295
2505	Ga0157378_10015347
2506	Ga0157378_10095012
2507	Ga0157378_10833971
2508	Ga0163162_10071640
2509	Ga0163162_10291419
2510	Ga0163162_10402884
2511	Ga0157372_10029313
2512	Ga0157372_10189922
2513	Ga0157372_10230616
2514	Ga0157372_10400637
2515	Ga0157372_10870711
2516	Ga0157375_10022349
2517	Ga0157375_10108521
2518	Ga0157375_10121039
2519	Ga0157375_10276356
2520	Ga0157375_10457104
2521	Ga0163163_10006520
2522	Ga0163163_10339099
2523	Ga0163163_10931521
2524	Ga0163163_11077902
2525	Ga0163163_11093098
2526	Ga0157380_10188014
2527	Ga0157380_10418173
2528	Ga0157380_10576683
2529	Ga0182008_10248454
2530	Ga0182008_10770576
2531	Ga0157379_10006803
2532	Ga0157379_10069660
2533	Ga0157379_10105753
2534	Ga0157379_10680363
2535	Ga0157379_11176270
2536	Ga0157376_10054267
2537	Ga0157376_10054586
2538	Ga0157376_10354315
2539	Ga0182006_1064411
2540	Ga0182007_10055894
2541	Ga0182007_10257488
2542	Ga0163161_10046486
2543	Ga0163161_10332821
2544	Ga0163161_10623584
2545	Ga0197907_10172879
2546	Ga0206352_10199053
2547	Ga0214544_1000009
2548	Ga0214542_1000002
2549	Ga0214545_1000002
2550	Ga0214543_1000013
2551	Ga0213873_10009424
2552	Ga0213873_10045356
2553	Ga0213873_10097241
2554	Ga0213872_10243199
2555	Ga0213876_10013034
2556	Ga0213876_10013713
2557	Ga0213876_10039731
2558	Ga0213875_10000165
2559	Ga0213871_10004808
2560	Ga0224712_10182813
2561	Ga0224570_105612
2562	Ga0228711_1000591
2563	Ga0228710_1000186
2564	Ga0256744_122998
2565	Ga0209436_101681
2566	Ga0209233_1001302
2567	Ga0209130_1000007
2568	Ga0209130_1030772
2569	Ga0207673_1009161
2570	Ga0209676_1006685
2571	Ga0209025_1000943
2572	Ga0209564_1000330
2573	Ga0209564_1000726
2574	Ga0209564_1030321
2575	Ga0209758_1000100
2576	Ga0209758_1000160
2577	Ga0209758_1003932
2578	Ga0209758_1072772
2579	Ga0209050_1010941
2580	Ga0209256_1018415
2581	Ga0207426_1000064
2582	Ga0209257_1005520
2583	Ga0209257_1005571
2584	Ga0207697_10279362
2585	Ga0207656_10001550
2586	Ga0207656_10110968
2587	Ga0207656_10137017
2588	Ga0207656_10244713
2589	Ga0207696_1107795
2590	Ga0207653_10183399
2591	Ga0207682_10134960
2592	Ga0207692_10002064
2593	Ga0207692_10007251
2594	Ga0207692_10131690
2595	Ga0207642_10588633
2596	Ga0207710_10435017
2597	Ga0207688_10121411
2598	Ga0207680_10591836
2599	Ga0207647_10001638
2600	Ga0207647_10322252
2601	Ga0207647_10410034
2602	Ga0207685_10271544
2603	Ga0207699_10001291
2604	Ga0207699_10030880
2605	Ga0207699_10103636
2606	Ga0207699_10719574
2607	Ga0207699_10799157
2608	Ga0207645_10030138
2609	Ga0207645_10223170
2610	Ga0207643_10038841
2611	Ga0207705_10063652
2612	Ga0207705_10118695
2613	Ga0207705_10178414
2614	Ga0207684_10087512
2615	Ga0207654_10003299
2616	Ga0207654_10008241
2617	Ga0207654_10229509
2618	Ga0207654_10323501
2619	Ga0207654_10667581
2620	Ga0207654_11108205
2621	Ga0207707_10000494
2622	Ga0207707_10000896
2623	Ga0207707_10026257
2624	Ga0207707_10805016
2625	Ga0207695_10001915
2626	Ga0207695_10068825
2627	Ga0207695_10076100
2628	Ga0207695_10130622
2629	Ga0207695_10320682
2630	Ga0207695_10813533
2631	Ga0207695_10845903
2632	Ga0207671_10037241
2633	Ga0207671_10042433
2634	Ga0207671_10064798
2635	Ga0207671_10509037
2636	Ga0207671_10749266
2637	Ga0207693_10012373
2638	Ga0207693_10013898
2639	Ga0207693_10020042
2640	Ga0207693_10133565
2641	Ga0207693_10137806
2642	Ga0207693_10175239
2643	Ga0207693_10478803
2644	Ga0207693_10580013
2645	Ga0207693_10591129
2646	Ga0207663_10007002
2647	Ga0207663_10901524
2648	Ga0207660_10001052
2649	Ga0207660_10017659
2650	Ga0207660_10105913
2651	Ga0207660_11029126
2652	Ga0207662_10039439
2653	Ga0207657_10003957
2654	Ga0207657_10454065
2655	Ga0207657_10962782
2656	Ga0207652_10001721
2657	Ga0207652_10002542
2658	Ga0207652_10029879
2659	Ga0207652_10054909
2660	Ga0207652_10055375
2661	Ga0207652_10897719
2662	Ga0207652_11106608
2663	Ga0207646_10053258
2664	Ga0207646_10656744
2665	Ga0207681_10855157
2666	Ga0207694_10000560
2667	Ga0207694_10021453
2668	Ga0207694_10113842
2669	Ga0207694_10652473
2670	Ga0207694_10815736
2671	Ga0207650_10011843
2672	Ga0207650_10516885
2673	Ga0207650_11152948
2674	Ga0207687_10036772
2675	Ga0207687_10063194
2676	Ga0207687_10236972
2677	Ga0207700_10000752
2678	Ga0207700_10178935
2679	Ga0207700_10231571
2680	Ga0207700_10545943
2681	Ga0207700_10565497
2682	Ga0207700_10924032
2683	Ga0207700_10973937
2684	Ga0207700_11338823
2685	Ga0207664_10019866
2686	Ga0207664_10028873
2687	Ga0207664_10045802
2688	Ga0207664_10049105
2689	Ga0207664_10107890
2690	Ga0207664_10127083
2691	Ga0207664_10138268
2692	Ga0207664_10316398
2693	Ga0207664_10521755
2694	Ga0207644_10076900
2695	Ga0207690_10031062
2696	Ga0207690_10335233
2697	Ga0207690_10755500
2698	Ga0207706_10335182
2699	Ga0207706_10344451
2700	Ga0207706_10429869
2701	Ga0207686_10145696
2702	Ga0207709_10065482
2703	Ga0207709_10154825
2704	Ga0207669_10178280
2705	Ga0207669_11310944
2706	Ga0207704_10154114
2707	Ga0207665_10004741
2708	Ga0207665_10051117
2709	Ga0207665_10093913
2710	Ga0207665_10139671
2711	Ga0207665_10463519
2712	Ga0207665_11204652
2713	Ga0207691_10218045
2714	Ga0207711_10154164
2715	Ga0207689_11412658
2716	Ga0207661_10015207
2717	Ga0207661_10043563
2718	Ga0207661_10049175
2719	Ga0207661_10583109
2720	Ga0207679_10054680
2721	Ga0207679_10249266
2722	Ga0207679_10937797
2723	Ga0207679_11166438
2724	Ga0207667_10003512
2725	Ga0207667_10031904
2726	Ga0207667_10036764
2727	Ga0207667_10217254
2728	Ga0207667_10589605
2729	Ga0207667_11295260
2730	Ga0207651_10120092
2731	Ga0207651_11328753
2732	Ga0207668_10146431
2733	Ga0207668_10212401
2734	Ga0207640_10087632
2735	Ga0207640_10166009
2736	Ga0207640_10494629
2737	Ga0207658_10465681
2738	Ga0207658_10569488
2739	Ga0207677_10018049
2740	Ga0207703_10013791
2741	Ga0207703_10562784
2742	Ga0207703_10597987
2743	Ga0207703_10825490
2744	Ga0207703_11878431
2745	Ga0207639_10021943
2746	Ga0207639_10037656
2747	Ga0207639_10041836
2748	Ga0207639_10061426
2749	Ga0207639_10280060
2750	Ga0207639_11388373
2751	Ga0207678_10000332
2752	Ga0207678_10004611
2753	Ga0207678_10026691
2754	Ga0207678_10052466
2755	Ga0207678_11254623
2756	Ga0207708_10062304
2757	Ga0207708_10140455
2758	Ga0207702_10002920
2759	Ga0207702_10004908
2760	Ga0207702_10056968
2761	Ga0207702_10122371
2762	Ga0207702_10189778
2763	Ga0207702_10582510
2764	Ga0207702_11709235
2765	Ga0207641_10598618
2766	Ga0207641_10946764
2767	Ga0207648_10247140
2768	Ga0207648_10277553
2769	Ga0207648_11200542
2770	Ga0207648_11435375
2771	Ga0207676_10286747
2772	Ga0207676_10542209
2773	Ga0207674_10016819
2774	Ga0207674_10077541
2775	Ga0207674_10090398
2776	Ga0207674_10278261
2777	Ga0207675_100089149
2778	Ga0207675_100091921
2779	Ga0207675_100418966
2780	Ga0207683_10173172
2781	Ga0207683_10801251
2782	Ga0207698_10033235
2783	Ga0207698_10046487
2784	Ga0207698_10232374
2785	Ga0207698_11231393
2786	Ga0209281_1000236
2787	Ga0209281_1000478
2788	Ga0209389_1000084
2789	Ga0209389_1000113
2790	Ga0209589_1000023
2791	Ga0209589_1000041
2792	Ga0209489_100032
2793	Ga0209489_100070
2794	Ga0209489_107143
2795	Ga0209700_100021
2796	Ga0209700_100040
2797	Ga0209179_1005261
2798	Ga0209179_1057262
2799	Ga0209282_1000022
2800	Ga0209588_1030958
2801	Ga0209813_10006030
2802	Ga0207428_10096125
2803	Ga0207428_10352965
2804	Ga0265357_1017704
2805	Ga0268266_10147096
2806	Ga0268266_10158083
2807	Ga0268266_10433144
2808	Ga0268266_10625428
2809	Ga0268266_11660383
2810	Ga0268265_10044540
2811	Ga0268265_10311755
2812	Ga0268265_10416782
2813	Ga0268264_10288693
2814	Ga0268264_10662288
2815	Ga0268264_10694049
2816	Ga0310981_1082270
2817	Ga0265763_1001053
2818	Ga0265773_1010373
2819	Ga0265760_10017474
2820	Ga0265760_10195789
2821	Ga0265330_10032128
2822	Ga0265330_10093264
2823	Ga0265330_10327692
2824	Ga0265332_10054731
2825	Ga0265332_10115174
2826	Ga0265328_10000041
2827	Ga0265328_10002936
2828	Ga0265328_10046171
2829	Ga0265340_10011816
2830	Ga0265339_10038426
2831	Ga0265339_10289676
2832	Ga0265331_10001829
2833	Ga0265331_10057047
2834	Ga0265327_10009162
2835	Ga0307513_10587757
2836	Ga0307509_10858861
2837	Ga0307408_100136911
2838	Ga0307408_100654546
2839	Ga0265313_10085459
2840	Ga0265313_10090710
2841	Ga0265313_10195696
2842	Ga0307508_10000038
2843	Ga0307508_10551019
2844	Ga0265314_10010719
2845	Ga0265314_10044240
2846	Ga0265342_10005896
2847	Ga0265342_10364501
2848	Ga0316576_10302130
2849	Ga0307516_10607276
2850	Ga0307405_10447528
2851	Ga0307412_10396612
2852	Ga0307412_10969328
2853	Ga0307412_11130845
2854	Ga0315914_1000027
2855	Ga0307416_100598347
2856	Ga0307416_101010048
2857	Ga0307414_11330153
2858	Ga0307415_100871272
2859	Ga0307510_10099112
2860	Ga0307510_10159079
2861	Ga0315913_1000201
2862	Ga0315911_1000001
2863	Ga0315915_1000001
2864	Ga0316215_1008065
2865	Ga0373930_0002958
2866	Ga0373950_0016942
2867	Ga0373926_0001023
2868	Ga0373926_0024429
2869	Ga0373926_0389574
2870	Ga0373928_0061237
2871	Ga0373928_0087846
2872	Ga0373929_0052685
2873	Ga0373929_0069246
2874	Ga0373934_0001298
2875	Ga0373934_0025848
2876	Ga0373934_0091704
2877	Ga0373934_0111025
2878	Ga0373944_0086254
2879	Ga0373951_0028803
2880	Ga0373952_0139787
2881	Ga0373923_0002016
2882	Ga0373923_0002477
2883	Ga0373923_0016894
2884	Ga0373932_0034818
2885	Ga0373936_0013716
2886	Ga0373936_0018993
2887	Ga0373936_0063273
2888	Ga0373936_0087428
2889	Ga0373939_0202858
2890	Ga0373941_0181458
2891	Ga0373945_0002268
2892	Ga0373945_0008214
2893	Ga0373945_0032300
2894	Ga0373953_0006494
2895	Ga0373953_0060374
2896	Ga0373953_0061685
2897	Ga0373954_0000741
2898	Ga0373954_0337378
2899	Ga0373954_0361930
2900	Ga0373956_0000394
2901	Ga0373956_0048981
2902	Ga0373957_0000375
2903	Ga0373957_0020784
2904	Ga0373957_0268733
2905	Ga0373957_0397782
2906	Ga0373943_0002550
2907	Ga0373943_0006273
2908	Ga0373943_0159045
2909	Ga0373943_0161182
2910	Ga0373946_0001853
2911	Ga0373946_0006127
2912	Ga0373946_0353084
2913	Ga0373955_0000102
2914	Ga0373955_0001328
2915	Ga0373955_0241657
2916	Ga0373955_0269748
2917	Ga0373942_0149352
2918	Ga0316574_0020904
2919	Ga0373924_0001614
2920	Ga0373924_0007924
2921	Ga0373924_0008169
2922	Ga0373924_0048800
2923	Ga0373924_0421046
2924	Ga0373935_0000917
2925	Ga0373935_0003157
2926	Ga0373935_0072985
2927	Ga0373935_0118475
2928	Ga0373935_0676707
2929	Ga0373927_0000225
2930	Ga0373927_0021427
2931	Ga0373927_0021716
2932	Ga0373927_0046668
2933	Ga0373927_0096347
2934	Ga0373927_0127525
2935	Ga0373927_0183094
2936	Ga0373927_0359531
2937	Ga0373933_0001320
2938	Ga0373933_0001518
2939	Ga0373933_0002871
2940	Ga0373933_0816033
2941	Ga0373947_0001251
2942	Ga0373947_0011223
2943	Ga0373947_0096593
2944	Ga0373947_0242886
2945	Ga0373947_0511089
2946	Ga0373937_0000958
2947	Ga0373937_0008054
2948	Ga0373937_0169637
2949	Ga0373937_0213781
2950	Ga0373937_0280044
2951	Ga0373937_0984127
2952	Ga0373937_1293485
2953	Ga0373937_1678155
2954	Ga0265778_042939
2955	Ga0372808_000125
2956	Ga0373925_0000012
2957	Ga0373925_0000711
2958	Ga0373925_0057892
2959	Ga0373925_1013065
2960	Ga0373925_1269620
2961	Ga0395899_0108833
2962	Ga0395899_0251538
2963	Ga0395899_0825633
2964	Ga0395900_0000860
2965	Ga0395900_0024972
2966	Ga0395900_0087238
2967	Ga0395900_0133686
2968	Ga0395900_0295570
2969	Ga0395900_0732365
2970	Ga0395900_0781656
2971	Ga0395898_0038657
2972	Ga0395898_0046012
2973	Ga0395898_0303846
2974	Ga0395898_0337813
2975	Ga0395898_1034052
2976	Ga0395905_0004133
2977	Ga0395905_0056855
2978	Ga0436364_0233650
2979	Ga0436364_0441476
2980	Ga0436364_0564476
2981	Ga0436364_0867579
2982	Ga0436364_1156189
2983	Ga0436364_1273645
2984	Ga0395901_0066269
2985	Ga0395901_0158116
2986	Ga0395901_0197550
2987	Ga0395901_0266094
2988	Ga0395901_0284030
2989	Ga0395901_0406816
2990	Ga0395901_0418543
2991	Ga0395901_1034364
2992	Ga0395901_1835364
2993	Ga0237816_09722
2994	Ga0436365_0268210
2995	Ga0436365_0362387
2996	Ga0436365_0447357
2997	Ga0436365_0931695
2998	Ga0436365_1019893
2999	Ga0436365_1080138
3000	Ga0436365_1521898
3001	Ga0436365_1815384
3002	Ga0436365_1825840
3003	Ga0436360_0083365
3004	Ga0436360_0578776
3005	Ga0436360_0620219
3006	Ga0436360_0801048
3007	Ga0436360_1104895
3008	Ga0436360_1193365
3009	Ga0436361_0241681
3010	Ga0436361_0652402
3011	Ga0436363_0281671
3012	Ga0436363_0379621
3013	Ga0436363_0759887
3014	Ga0436363_1194591
3015	Ga0436363_1351337
3016	Ga0436363_1540305
3017	Ga0436362_0285155
3018	Ga0436362_0353879
3019	Ga0436362_0731481
3020	Ga0436362_0764214
3021	Ga0436362_1022607
3022	Ga0439466_0029339
3023	Ga0439465_0102959
3024	Ga0451793_0372829
3025	Ga0451833_0752167
3026	Ga0451837_0172803
3027	Ga0451853_3548117
3028	Ga0439463_136689
3029	Ga0439444_0034154
3030	Ga0466972_0004579
3031	Ga0466972_0148474
3032	Ga0466965_0030295
3033	Ga0466966_0097283
3034	Ga0466966_0160058
3035	Ga0466963_0138046
3036	Ga0466964_0030834
3037	Ga0466971_0264900
3038	Ga0466968_0002010
3039	Ga0466968_0020839
3040	Ga0466968_0426389
3041	Ga0466959_0033049
3042	Ga0466959_0182071
3043	Ga0451576_1020663
3044	Ga0466958_0816768
3045	Ga0466967_0120250
3046	Ga0466967_0201139
3047	Ga0466967_0401622
3048	Ga0466967_1726416
3049	Ga0495617_119654
3050	Ga0495592_0000033
3051	Ga0495592_0000529
3052	Ga0495592_0031189
3053	Ga0495592_0040942
3054	Ga0495592_0214262
3055	Ga0495603_0001221
3056	Ga0495603_0002595
3057	Ga0495603_0073366
3058	Ga0495590_0048858
3059	Ga0495590_0151433
3060	Ga0495591_059863
3061	Ga0495629_0000179
3062	Ga0495629_0001007
3063	Ga0495629_0013188
3064	Ga0495629_0128885
3065	Ga0495629_0295637
3066	Ga0495638_0012856
3067	Ga0495641_0005871
3068	Ga0495651_0002153
3069	Ga0495651_0009522
3070	Ga0495651_0048743
3071	Ga0495651_0061396
3072	Ga0495651_0169950
3073	Ga0495651_0284262
3074	Ga0495651_0355353
3075	Ga0495651_0441868
3076	Ga0495653_0000019
3077	Ga0495653_0033261
3078	Ga0495653_0228893
3079	Ga0495653_0311959
3080	Ga0495650_0061393
3081	Ga0495580_0000280
3082	Ga0495580_0064759
3083	Ga0495580_0270626
3084	Ga0495580_0374213
3085	Ga0495582_0000061
3086	Ga0495582_0137091
3087	Ga0495582_0383538
3088	Ga0495605_0214308
3089	Ga0495639_0000102
3090	Ga0495639_0146719
3091	Ga0495639_0229139
3092	Ga0495662_0000074
3093	Ga0495662_0005823
3094	Ga0495662_0331231
3095	Ga0495664_0000005
3096	Ga0495664_0079176
3097	Ga0495664_0181366
3098	Ga0495664_0289569
3099	Ga0495664_0443193
3100	Ga0495584_0152383
3101	Ga0495584_0499056
3102	Ga0495585_0419242
3103	Ga0495585_0466476
3104	Ga0495594_0000378
3105	Ga0495594_0120795
3106	Ga0495594_0212457
3107	Ga0495596_0166059
3108	Ga0495596_0287247
3109	Ga0495607_0018579
3110	Ga0495583_0045507
3111	Ga0495606_0003007
3112	Ga0495606_0075026
3113	Ga0495608_0000003
3114	Ga0495608_0017019
3115	Ga0495608_0027598
3116	Ga0495608_0063006
3117	Ga0495608_0328468
3118	Ga0495608_0636508
3119	Ga0495610_0022608
3120	Ga0495618_0000009
3121	Ga0495618_0030284
3122	Ga0495618_0425127
3123	Ga0495620_0086962
3124	Ga0495620_0161418
3125	Ga0495628_0000010
3126	Ga0495628_0004580
3127	Ga0495628_0429576
3128	Ga0495628_0507717
3129	Ga0495628_0818176
3130	Ga0495630_0001032
3131	Ga0495630_0019921
3132	Ga0495630_0035668
3133	Ga0495630_0194931
3134	Ga0495631_0025780
3135	Ga0495632_0179476
3136	Ga0495632_0207347
3137	Ga0495637_0270586
3138	Ga0495637_0275429
3139	Ga0495643_0070380
3140	Ga0495643_0161102
3141	Ga0495643_0238029
3142	Ga0495644_0047717
3143	Ga0495648_0002612
3144	Ga0495648_0002918
3145	Ga0495648_0047710
3146	Ga0495648_0400210
3147	Ga0495663_0119448
3148	Ga0495666_0030666
3149	Ga0495666_0074281
3150	Ga0495666_0336930
3151	Ga0495642_0091087
3152	Ga0495652_0000016
3153	Ga0495652_0003857
3154	Ga0495652_0302150
3155	Ga0495652_0324151
3156	Ga0495652_0375860
3157	Ga0495652_1010329
3158	Ga0495654_0000570
3159	Ga0495654_0020515
3160	Ga0495654_0221932
3161	Ga0495665_0000261
3162	Ga0495665_0018842
3163	Ga0495665_0217422
3164	Ga0495665_0425137
3165	Ga0495640_0000015
3166	Ga0495640_0005071
3167	Ga0495640_0098913
3168	Ga0495640_0127618
3169	Ga0495640_0128170
3170	Ga0495640_0278168
3171	Ga0495586_0031353
3172	Ga0495586_0123977
3173	Ga0495586_0154055
3174	Ga0495586_0451814
3175	Ga0495586_0475831
3176	Ga0495587_0000009
3177	Ga0495587_0012126
3178	Ga0495587_0045732
3179	Ga0495587_0068894
3180	Ga0495587_0321844
3181	Ga0495598_0164081
3182	Ga0495609_0061898
3183	Ga0495621_0034630
3184	Ga0495645_0000005
3185	Ga0495645_0044800
3186	Ga0495645_0237606
3187	Ga0495645_0239088
3188	Ga0495645_0302873
3189	Ga0495645_0641093
3190	Ga0495622_0002581
3191	Ga0495622_0007364
3192	Ga0495622_0018810
3193	Ga0495622_0121370
3194	Ga0495633_0354706
3195	Ga0495667_0000003
3196	Ga0495667_0001533
3197	Ga0495667_0051591
3198	Ga0495667_0115177
3199	Ga0495656_0036106
3200	Ga0495668_0037410
3201	Ga0495634_0000161
3202	Ga0495634_0002829
3203	Ga0495634_0013704
3204	Ga0495634_0121773
3205	Ga0495634_0230461
3206	Ga0495634_0434794
3207	Ga0495611_0317099
3208	Ga0495625_0142198
3209	Ga0495625_0234733
3210	Ga0495625_0571528
3211	Ga0495625_0694559
3212	Ga0495635_0000013
3213	Ga0495635_0000094
3214	Ga0495635_0008716
3215	Ga0495635_0075468
3216	Ga0495635_0257932
3217	Ga0495635_0335582
3218	Ga0495635_0803350
3219	Ga0495659_0375640
3220	Ga0495661_0101572
3221	Ga0495661_0471618
3222	Ga0495588_0007188
3223	Ga0495588_0050484
3224	Ga0495657_0000145
3225	Ga0495657_0019424
3226	Ga0495657_0165481
3227	Ga0495657_0208655
3228	Ga0495657_0263163
3229	Ga0495657_0319828
3230	Ga0495599_0000011
3231	Ga0495599_0033332
3232	Ga0495599_0054338
3233	Ga0495599_0441812
3234	Ga0495623_0000005
3235	Ga0495623_0001295
3236	Ga0495623_0113333
3237	Ga0495623_0129581
3238	Ga0495623_0154624
3239	Ga0495623_0383633
3240	Ga0495646_0000011
3241	Ga0495646_0010260
3242	Ga0495646_0094282
3243	Ga0495646_0131928
3244	Ga0495647_0096996
3245	Ga0495658_0000315
3246	Ga0495658_0014138
3247	Ga0495658_0103704
3248	Ga0495658_0279000
3249	Ga0495658_0586610
3250	Ga0495669_0039285
3251	Ga0495613_0002949
3252	Ga0495613_0047115
3253	Ga0495613_0075577
3254	Ga0495613_0094048
3255	Ga0495613_0146120
3256	Ga0495624_0001589
3257	Ga0495624_0007235
3258	Ga0495624_0016842
3259	Ga0495624_0074851
3260	Ga0495624_0183121
3261	Ga0495670_0206355
3262	Ga0495671_0038418
3263	Ga0495671_0209853
3264	Ga0495649_0235277
3265	Ga0495600_0000004
3266	Ga0495600_0000235
3267	Ga0495600_0017291
3268	Ga0495600_0222558
3269	Ga0495600_0390562
3270	Ga0495600_0439097
3271	Ga0495600_0566030
3272	Ga0495600_0664140
3273	Ga0495581_0000255
3274	Ga0495581_0028788
3275	Ga0495581_0062499
3276	Ga0495581_0071264
3277	Ga0495604_0000006
3278	Ga0495604_0010945
3279	Ga0495604_0095875
3280	Ga0495604_0402877
3281	Ga0495604_0536694
3282	Ga0495674_0000005
3283	Ga0495674_0000117
3284	Ga0495674_0067676
3285	Ga0495674_0109542
3286	Ga0495674_0191989
3287	Ga0495674_0383120
3288	Ga0495672_0008790
3289	Ga0495672_0011329
3290	Ga0495672_0066476
3291	Ga0495672_0228733
3292	Ga0495672_0303009
3293	Ga0495676_0039899
3294	Ga0495676_0092460
3295	Ga0495676_0119040
3296	Ga0495676_0425482
3297	Ga0495676_0427106
3298	Ga0495676_0833743
3299	Ga0495680_0000606
3300	Ga0495680_0000688
3301	Ga0495680_0037680
3302	Ga0495680_0153054
3303	Ga0495680_0221582
3304	Ga0495680_0324420
3305	Ga0495683_0174537
3306	Ga0495675_0000914
3307	Ga0495675_0003742
3308	Ga0495675_0082096
3309	Ga0495675_0468949
3310	Ga0495677_0294668
3311	Ga0495673_0176681
3312	Ga0495681_0133431
3313	Ga0495684_0000001
3314	Ga0495684_0000633
3315	Ga0495684_0027320
3316	Ga0495684_0190754
3317	Ga0495684_0760215
3318	Ga0495686_0362216
3319	Ga0495686_0528351
3320	Ga0495686_0556446
3321	Ga0495593_0000086
3322	Ga0495593_0001573
3323	Ga0495593_0003839
3324	Ga0495593_0022070
3325	Ga0495593_0065297
3326	Ga0495602_0000003
3327	Ga0495602_0029828
3328	Ga0495602_0103140
3329	Ga0495602_0243861
3330	Ga0495602_0253623
3331	Ga0495602_0556749
3332	Ga0495602_0828186
3333	Ga0495614_0036301
3334	Ga0495614_0037942
3335	Ga0495614_0185434
3336	Ga0495626_0216680
3337	Ga0496100_0018586
3338	Ga0496100_0044877
3339	Ga0496100_0048511
3340	Ga0496100_0093156
3341	Ga0496100_0600708
3342	Ga0496100_0690049
3343	Ga0496100_0745872
3344	Ga0496100_1017637
3345	Ga0496100_1170150
3346	Ga0496101_0021101
3347	Ga0496101_0023934
3348	Ga0496101_0024397
3349	Ga0496101_0069257
3350	Ga0496101_0180625
3351	Ga0496101_0566110
3352	Ga0496101_0778147
3353	Ga0496101_0820265
3354	Ga0496102_0013632
3355	Ga0496102_0104016
3356	Ga0496102_0129216
3357	Ga0496102_0297844
3358	Ga0496102_0383058
3359	Ga0496102_1307304
3360	Ga0496103_0051163
3361	Ga0496103_0575131
3362	Ga0496104_0011141
3363	Ga0496104_0028162
3364	Ga0496104_0053677
3365	Ga0496104_0063744
3366	Ga0496104_0358997
3367	Ga0496104_0858266
3368	Ga0496104_1141996
3369	Ga0496104_1730364
3370	Ga0496105_0008366
3371	Ga0496105_0039098
3372	Ga0496105_0063589
3373	Ga0496105_0089136
3374	Ga0496105_0272676
3375	Ga0496105_0383914
3376	Ga0496106_0000546
3377	Ga0496106_0010390
3378	Ga0496106_0016644
3379	Ga0496106_0148031
3380	Ga0496106_0164765
3381	Ga0496106_0227066
3382	Ga0496106_0260219
3383	Ga0496106_0278725
3384	Ga0496106_0409339
3385	Ga0496107_0002937
3386	Ga0496107_0017612
3387	Ga0496107_0023174
3388	Ga0496107_0026442
3389	Ga0496107_0041913
3390	Ga0496107_0058811
3391	Ga0496107_0064242
3392	Ga0496107_0275457
3393	Ga0496108_0001440
3394	Ga0496108_0021625
3395	Ga0496108_0038953
3396	Ga0496108_0161347
3397	Ga0496108_0486619
3398	Ga0496108_0531079
3399	Ga0496108_1124925
3400	Ga0496109_0001610
3401	Ga0496109_0015876
3402	Ga0496109_0037030
3403	Ga0496109_0112910
3404	Ga0496109_0343522
3405	Ga0496109_0444626
3406	Ga0496109_0496941
3407	Ga0496110_0012816
3408	Ga0496110_0020630
3409	Ga0496110_0129448
3410	Ga0496110_0172952
3411	Ga0496110_0213272
3412	Ga0496110_0247476
3413	Ga0496110_0352434
3414	Ga0496110_0513245
3415	Ga0496110_0707552
3416	Ga0496111_0000623
3417	Ga0496111_0021964
3418	Ga0496111_0130756
3419	Ga0496111_0135267
3420	Ga0496111_0148863
3421	Ga0496111_0168185
3422	Ga0496111_0488049
3423	Ga0496112_0005886
3424	Ga0496112_0007905
3425	Ga0496112_0009200
3426	Ga0496112_0028997
3427	Ga0496112_0032003
3428	Ga0496112_0033853
3429	Ga0496112_0058867
3430	Ga0496112_1153893
3431	Ga0496113_0018743
3432	Ga0496113_0069266
3433	Ga0496113_0090054
3434	Ga0496113_0090640
3435	Ga0496113_0092149
3436	Ga0496113_0134212
3437	Ga0496113_0815656
3438	Ga0496114_0042084
3439	Ga0496114_0196990
3440	Ga0496114_0260361
3441	Ga0496114_0260807
3442	Ga0496114_0412939
3443	Ga0496114_1000127
3444	Ga0496115_0016295
3445	Ga0496115_0049833
3446	Ga0496115_0091197
3447	Ga0496115_0280656
3448	Ga0496115_0328748
3449	Ga0496115_0356355
3450	Ga0496115_0431908
3451	Ga0496115_0802037
3452	Ga0496116_0000036
3453	Ga0496116_0002789
3454	Ga0496116_0106088
3455	Ga0496117_0105448
3456	Ga0496117_0392628
3457	Ga0496118_0019395
3458	Ga0496118_0145743
3459	Ga0496118_0378702
3460	Ga0496119_0076330
3461	Ga0496119_0082799
3462	Ga0496119_0121673
3463	Ga0496119_0282281
3464	Ga0496120_0017144
3465	Ga0496120_0218521
3466	Ga0496121_0000495
3467	Ga0496121_0001789
3468	Ga0496121_0005072
3469	Ga0496121_0034850
3470	Ga0496121_0034862
3471	Ga0496121_0050270
3472	Ga0496121_0062362
3473	Ga0496121_0063016
3474	Ga0496121_0069767
3475	Ga0496121_0266591
3476	Ga0496121_0330914
3477	Ga0496122_0022175
3478	Ga0496122_0034583
3479	Ga0496122_0149319
3480	Ga0496122_0188894
3481	Ga0496123_0018478
3482	Ga0496123_0064518
3483	Ga0496123_0082048
3484	Ga0496124_0039401
3485	Ga0496124_0257641
3486	Ga0496124_0386706
3487	Ga0496124_0454375
3488	Ga0496124_0623260
3489	Ga0496125_0000090
3490	Ga0496125_0007247
3491	Ga0496125_0035078
3492	Ga0496125_0047125
3493	Ga0496125_0450822
3494	Ga0496126_0000156
3495	Ga0496126_0002315
3496	Ga0496126_0025419
3497	Ga0496126_0030050
3498	Ga0496126_0036160
3499	Ga0496126_0037055
3500	Ga0496126_0088621
3501	Ga0496126_0167913
3502	Ga0496126_0215286
3503	Ga0496126_0301598
3504	Ga0496126_0350809
3505	Ga0496126_0830769
3506	Ga0496126_1135834
3507	Ga0501308_007320
3508	Ga0501308_018794
3509	Ga0501309_013743
3510	Ga0501310_013005
3511	Ga0501304_006532
3512	Ga0501305_019197
3513	Ga0495678_064420
3514	Ga0501312_071986
3515	Ga0501316_008140
3516	Ga0501317_010871
3517	Ga0501318_011077
3518	Ga0501318_044864
3519	Ga0501321_009776
3520	Ga0501321_016660
3521	Ga0501323_045435
3522	Ga0501325_007084
3523	Ga0501328_07990
3524	Ga0501332_03259
3525	Ga0501336_006130
3526	Ga0501340_003708
3527	Ga0501031_0004261
3528	Ga0501031_0198219
3529	Ga0501031_0655507
3530	Ga0501032_0002348
3531	Ga0501032_0005554
3532	Ga0501032_0133411
3533	Ga0501032_0200242
3534	Ga0501033_0000256
3535	Ga0501033_0028851
3536	Ga0501033_0063293
3537	Ga0501033_0286749
3538	Ga0501033_0574320
3539	Ga0501033_0629347
3540	Ga0501034_0000013
3541	Ga0501034_0000175
3542	Ga0501034_0057071
3543	Ga0501034_0086890
3544	Ga0501034_0093502
3545	Ga0501034_0098202
3546	Ga0501034_0252110
3547	Ga0501034_0256371
3548	Ga0501034_0317404
3549	Ga0501034_1028788
3550	Ga0501034_1345550
3551	Ga0501036_0000032
3552	Ga0501036_0045218
3553	Ga0501036_0096271
3554	Ga0501036_0116216
3555	Ga0501036_0437097
3556	Ga0501036_1519031
3557	Ga0501037_0000306
3558	Ga0501037_0001755
3559	Ga0501037_0079800
3560	Ga0501037_0239578
3561	Ga0501037_0340753
3562	Ga0501037_1150716
3563	Ga0501038_0000114
3564	Ga0501038_0020928
3565	Ga0501038_0188065
3566	Ga0501038_0231514
3567	Ga0501039_0000066
3568	Ga0501039_0001954
3569	Ga0501039_0107823
3570	Ga0501039_0231692
3571	Ga0501039_0574632
3572	Ga0501039_0850060
3573	Ga0501039_0997708
3574	Ga0501041_0129148
3575	Ga0501042_0027890
3576	Ga0501042_0889645
3577	Ga0501043_0002389
3578	Ga0501043_0017681
3579	Ga0501043_0067300
3580	Ga0501043_0121851
3581	Ga0501043_0272000
3582	Ga0501046_0004110
3583	Ga0501046_0006119
3584	Ga0501046_0016268
3585	Ga0501046_0136166
3586	Ga0501046_0850383
3587	Ga0501047_0000085
3588	Ga0501047_0001692
3589	Ga0501047_0003015
3590	Ga0501047_0055143
3591	Ga0501047_0068872
3592	Ga0501047_0094351
3593	Ga0501047_1420230
3594	Ga0501048_0000581
3595	Ga0501048_0001859
3596	Ga0501048_0058240
3597	Ga0501048_0674127
3598	Ga0501067_0000096
3599	Ga0501067_0006235
3600	Ga0501067_0051676
3601	Ga0501068_0000220
3602	Ga0501068_0363186
3603	Ga0501069_0023247
3604	Ga0501070_0024675
3605	Ga0501070_0049626
3606	Ga0501070_0152433
3607	Ga0501070_0185665
3608	Ga0501070_0287636
3609	Ga0501071_0239885
3610	Ga0501071_1153564
3611	Ga0501072_0003496
3612	Ga0501072_0062351
3613	Ga0501073_0000026
3614	Ga0501073_0056913
3615	Ga0501073_0155419
3616	Ga0501073_0205070
3617	Ga0501074_0000878
3618	Ga0501074_0016996
3619	Ga0501074_0952527
3620	Ga0501076_0098295
3621	Ga0501076_1463114
3622	Ga0501077_0157199
3623	Ga0501079_0007708
3624	Ga0501080_0000048
3625	Ga0501080_0005240
3626	Ga0501080_0205144
3627	Ga0501080_0508553
3628	Ga0501080_0636532
3629	Ga0501083_0012775
3630	Ga0501083_0112533
3631	Ga0501083_0290843
3632	Ga0501083_0468751
3633	Ga0501035_0000058
3634	Ga0501035_0003195
3635	Ga0501035_0012181
3636	Ga0501035_0026608
3637	Ga0501035_0027489
3638	Ga0501035_0048616
3639	Ga0501035_0154490
3640	Ga0501035_0487278
3641	Ga0501035_1159003
3642	Ga0501044_0000023
3643	Ga0501044_0000061
3644	Ga0501044_0027976
3645	Ga0501044_0055059
3646	Ga0501044_0143593
3647	Ga0501044_0492961
3648	Ga0501044_0506943
3649	Ga0501044_0522220
3650	Ga0501044_0557782
3651	Ga0501044_1096512
3652	Ga0501044_1210823
3653	Ga0501044_1338116
3654	Ga0501045_0042795
3655	nmdc:mga03683_143859_c1
3656	nmdc:mga03683_41604_c1
3657	nmdc:mga03n38_14425_c1
3658	nmdc:mga03n38_230488_c1
3659	nmdc:mga00v17_117600_c1
3660	nmdc:mga00v17_1983_c1
3661	nmdc:mga00v17_24303_c2
3662	nmdc:mga00v17_264845_c1
3663	nmdc:mga00v17_301989_c1
3664	nmdc:mga00v17_35100_c1
3665	nmdc:mga00v17_62255_c1
3666	nmdc:mga0yw44_1163035_c1
3667	nmdc:mga0yw44_20306_c1
3668	nmdc:mga0yw44_30838_c1
3669	nmdc:mga0yw44_32702_c1
3670	nmdc:mga0yw44_39108_c1
3671	nmdc:mga0yw44_459_c1
3672	nmdc:mga0yw44_514020_c1
3673	nmdc:mga0yw44_832515_c1
3674	nmdc:mga06z11_168361_c1
3675	nmdc:mga06z11_21028_c1
3676	nmdc:mga06z11_282923_c1
3677	nmdc:mga06z11_325884_c1
3678	nmdc:mga06z11_49115_c1
3679	nmdc:mga06z11_55052_c1
3680	nmdc:mga04h51_1394_c1
3681	nmdc:mga04h51_35591_c1
3682	nmdc:mga07m45_306823_c1
3683	nmdc:mga07m45_528296_c1
3684	nmdc:mga07m45_697765_c1
3685	nmdc:mga07m45_91404_c1
3686	nmdc:mga05p37_68622_c1
3687	nmdc:mga05p37_855744_c1
3688	nmdc:mga09592_1195526_c1
3689	nmdc:mga06r32_1382176_c1
3690	nmdc:mga08y16_170983_c1
3691	nmdc:mga08y16_250897_c1
3692	nmdc:mga0n895_170239_c1
3693	nmdc:mga0n895_250652_c1
3694	nmdc:mga0n895_461193_c1
3695	nmdc:mga0rr50_432630_c1
3696	nmdc:mga0rr50_484306_c1
3697	nmdc:mga0rr50_485295_c1
3698	nmdc:mga0a205_440830_c1
3699	nmdc:mga0a205_92540_c1
3700	nmdc:mga0sz30_184273_c1
3701	Ga0495601_0000005
3702	Ga0495601_0047764
3703	Ga0495601_0093641
3704	Ga0495601_0242183
3705	Ga0495601_0254185
3706	Ga0495601_0314174
3707	Ga0495601_0689966
3708	Ga0495601_0874501
3709	Ga0495612_0000001
3710	Ga0495612_0031291
3711	Ga0495612_0075747
3712	Ga0495612_0084319
3713	Ga0495612_0207005
3714	Ga0495612_0269259
3715	Ga0500635_0026822
3716	Ga0500635_0096805
3717	Ga0500635_0136602
3718	Ga0495655_0037018
3719	Ga0495595_0000030
3720	Ga0495595_0001636
3721	Ga0495595_0016240
3722	Ga0495595_0100207
3723	Ga0495595_0556011
3724	Ga0495619_0000007
3725	Ga0495619_0000182
3726	Ga0495619_0023152
3727	Ga0495619_0125210
3728	Ga0495619_0300175
3729	Ga0495619_0676223
3730	Ga0495619_0942512
3731	Ga0500578_0105572
3732	Ga0500643_037138
3733	Ga0500643_093566
3734	Ga0500581_102258
3735	Ga0500646_0038243
3736	Ga0500646_0039192
3737	Ga0500646_0065724
3738	Ga0500647_0182706
3739	Ga0500647_0255521
3740	Ga0500651_0292593
3741	Ga0500651_0401878
3742	Ga0500566_0000184
3743	Ga0500566_0296002
3744	Ga0500641_0170287
3745	Ga0500554_002968
3746	Ga0500554_062233
3747	Ga0500554_079623
3748	Ga0500555_022366
3749	Ga0500556_0000002
3750	Ga0500557_062831
3751	Ga0500562_015550
3752	Ga0500562_020009
3753	Ga0500572_000010
3754	Ga0500591_123561
3755	Ga0500592_003032
3756	Ga0500594_0011442
3757	Ga0500595_000143
3758	Ga0500595_011977
3759	Ga0500595_012668
3760	Ga0500595_118184
3761	Ga0500595_139396
3762	Ga0500607_120424
3763	Ga0500608_000393
3764	Ga0500608_023169
3765	Ga0500614_020882
3766	Ga0500618_000219
3767	Ga0500621_068570
3768	Ga0500642_0000058
3769	Ga0500652_000711
3770	Ga0500655_058105
3771	Ga0500658_0012749
3772	Ga0500658_0275415
3773	Ga0500559_0000366
3774	Ga0500559_0004662
3775	Ga0500559_0096796
3776	Ga0500561_0180669
3777	Ga0500568_0010866
3778	Ga0500568_0016627
3779	Ga0500568_0016779
3780	Ga0500568_0049861
3781	Ga0500577_0000616
3782	Ga0500579_243184
3783	Ga0500586_030001
3784	Ga0500588_0019761
3785	Ga0500590_008580
3786	Ga0500590_079781
3787	Ga0500603_000664
3788	Ga0500603_000777
3789	Ga0500603_043016
3790	Ga0500616_0000069
3791	Ga0500616_0008352
3792	Ga0500616_0009267
3793	Ga0500616_0296072
3794	Ga0500622_0006990
3795	Ga0500627_0122759
3796	Ga0500630_003535
3797	Ga0500634_0027957
3798	Ga0500638_006438
3799	Ga0500638_105237
3800	Ga0500638_219457
3801	Ga0500638_320794
3802	Ga0500639_000034
3803	Ga0500636_0006585
3804	Ga0500636_0012365
3805	Ga0500637_0000742
3806	Ga0500637_0012431
3807	Ga0500637_0035468
3808	Ga0500637_0206351
3809	Ga0500570_109881
3810	Ga0500570_116171
3811	Ga0500611_008139
3812	Ga0500645_032570
3813	Ga0500596_003092
3814	Ga0500587_027631
3815	Ga0500661_002284
3816	Ga0500661_086154
3817	Ga0587062_019951
3818	Ga0501082_0006469
3819	Ga0501082_0080678
3820	Ga0501082_0260842
3821	Ga0501082_0926517
3822	Ga0466962_0227605
3823	Ga0530510_1402460
3824	2509147235
3825	2510305049
3826	2511501134
3827	2512532549
3828	2512972115
3829	2513582908
3830	2513604785
3831	2513616296
3832	2513628254
3833	2513646594
3834	2513656642
3835	2513702039
3836	2513858568
3837	2513880981
3838	2513889229
3839	2513902217
3840	2513917827
3841	2513987485
3842	2514007438
3843	2514010741
3844	2515608311
3845	2516209002
3846	2516892415
3847	2517102061
3848	2517569223
3849	2517893125
3850	2524436499
3851	2524451024
3852	2524539349
3853	2551682493
3854	2551683788
3855	2551694601
3856	2551703836
3857	2551712167
3858	2551723230
3859	2551727471
3860	2551738431
3861	2551746397
3862	2600192088
3863	2600375370
3864	2603858839
3865	2617376524
3866	2643807078
3867	2643855779
3868	2644069655
3869	2644288309
3870	2644380460
3871	2644420809
3872	2644454334
3873	2644675444
3874	2644689671
3875	2671117759
3876	2723845794
3877	2728754639
3878	2738946434
3879	2745077128
3880	2776912942
3881	2793064851
3882	2793070005
3883	2793077213
3884	2802719237
3885	2802723204
3886	2802732436
3887	2802738566
3888	2802745188
3889	2802751625
3890	2818240213
3891	2824604226
3892	2824617456
3893	2824619776
3894	2824629384
3895	2824642137
3896	2824651178
3897	2824660048
3898	2824677002
3899	2824683709
3900	2824694978
3901	2824712619
3902	2824721226
3903	2824731271
3904	2824739456
3905	2824749635
3906	2824760189
3907	2824767178
3908	2837679435
3909	2837682913
3910	2838126602
3911	2841947256
3912	2841950701
3913	2841964389
3914	2841967018
3915	2841975763
3916	2841990130
3917	2842039811
3918	2842047243
3919	2847935206
3920	2855831486
3921	2855840610
3922	2857528055
3923	2858801137
3924	2874612791
3925	2874627838
3926	2876810938
3927	2879089110
3928	2879115666
3929	2881366652
3930	2881669594
3931	2885373284
3932	2885378306
3933	2888383266
3934	2888423649
3935	2889040635
3936	2891089367
3937	2891377148
3938	2893068476
3939	2894654716
3940	2899803896
3941	2903753059
3942	2904672842
3943	2904696541
3944	2904717105
3945	2906617664
3946	2906636789
3947	2906645909
3948	2906661363
3949	2908743518
3950	2908760394
3951	2908779370
3952	2913310849
3953	2915985815
3954	2915989178
3955	2915995198
3956	2916005608
3957	2916013944
3958	2916021176
3959	2916023191
3960	2916031456
3961	2916038835
3962	2916044537
3963	2916049555
3964	2916055196
3965	2916065743
3966	2916070421
3967	2916077672
3968	2917555330
3969	2919075454
3970	2919167455
3971	2921204590
3972	2921210470
3973	2921238289
3974	2921246258
3975	2921251515
3976	2921257948
3977	2921264073
3978	2921286826
3979	2921294545
3980	2921304050
3981	2922367740
3982	2922392356
3983	2922395580
3984	2922429361
3985	2924146523
3986	2924151259
3987	2924160737
3988	2924171775
3989	2924177462
3990	2924185327
3991	2924188782
3992	2924196601
3993	2924203084
3994	2924212570
3995	2924216098
3996	2924224676
3997	2924230353
3998	2935634064
3999	2937000941
4000	2937004379
4001	2937011132
4002	2937019464
4003	2937028564
4004	2937030455
4005	2937040646
4006	2937045186
4007	2937056056
4008	2937059234
4009	2937065463
4010	2937077343
4011	2937079498
4012	2937091669
4013	2937095752
4014	2937104054
4015	2937111809
4016	2937114029
4017	2937125527
4018	2937126699
4019	2941510955
4020	2941518339
4021	2941527398
4022	2957379640
4023	2957382810
4024	2957388968
4025	2957396598
4026	2957407597
4027	2957409648
4028	2957418663
4029	2957424688
4030	2957432602
4031	2957439295
4032	2957450084
4033	2957456524
4034	2957463637
4035	2957466568
4036	2957477271
4037	2957479856
4038	2957486045
4039	2957497320
4040	2957498812
4041	2957509191
4042	2960589240
4043	2960595116
4044	2960598907
4045	2960608499
4046	2960611848
4047	2960617865
4048	2960626833
4049	2960634782
4050	2960643253
4051	2960645729
4052	2960655692
4053	2960666776
4054	2960668756
4055	2960677535
4056	2960684962
4057	2960689130
4058	2960695024
4059	2964613778
4060	2964617851
4061	2964625016
4062	2964635320
4063	2964642476
4064	2964646672
4065	2964656399
4066	2964659790
4067	2964665639
4068	2964672692
4069	2964683717
4070	2964686335
4071	2964692202
4072	2964702792
4073	2964708653
4074	2964718719
4075	2964726486
4076	2967666829
4077	2967677651
4078	2967681565
4079	2967690421
4080	2967693409
4081	2967702133
4082	2967711089
4083	2967716365
4084	2967723265
4085	2967730969
4086	2967735607
4087	2967744168
4088	2967754442
4089	2967757058
4090	2967763960
4091	2967771616
4092	2967776838
4093	2970020616
4094	2970032134
4095	2970037866
4096	2970041461
4097	2970050418
4098	2970057983
4099	2970067383
4100	2970072063
4101	2970081601
4102	2970085953
4103	2970089666
4104	2970097545
4105	2970105012
4106	2970113030
4107	2970117883
4108	2970123314
4109	2970129681
4110	2970138824
4111	2970145990
4112	2970151154
4113	2970163555
4114	2970166912
4115	2970172864
4116	2970178419
4117	2970187448
4118	2970194217
4119	2977517815
4120	2977527151
4121	2977534481
4122	2977538151
4123	2977551672
4124	2977552151
4125	2977560245
4126	2977566376
4127	2977576596
4128	2977581256
4129	2978973887
4130	2984589233
4131	2989354042
4132	3000867384
4133	3005479529
4134	3005489413
4135	3005588548
4136	648736528
4137	8003993109
4138	8004000353
4139	8006941610
4140	8006967444
4141	8006981320
4142	8006988076
4143	8019557530
4144	8019567767
4145	8056674554
4146	8056690209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

37

156

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6ysi-assembly1.cif.gz_F	acinetobacter baumannii ribosome-tigecycline complex - 50s subunit	0.9557	1	143
5xym-assembly1.cif.gz_J	large subunit of mycobacterium smegmatis	0.9527	3	143
7asp-assembly1.cif.gz_H	staphylococcus aureus 70s after 50 minutes incubation at 37c	0.9517	2	141
7jql-assembly2.cif.gz_2N	crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution	0.9516	1	143
8fn2-assembly1.cif.gz_L	the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi	0.9509	2	141

ID	Description	Score	Start	End	Superfamily
4dhcN00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13	0.9502	1	143	3.90.1180.10
4dhcN00	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13	0.9437	1	143	3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13	0.9351	12	142	3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13	0.9343	12	142	3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10	Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13	0.9243	13	141	3.90.1180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1Q7BZ54-F1-model_v4	50S ribosomal protein L13	0.9841	15	154	GO:0003729 GO:0003735 GO:0006412 GO:0017148 GO:0022625
AF-A0A1E5QAR2-F1-model_v4	Large ribosomal subunit protein uL13	0.9808	1	154	GO:0003729 GO:0003735 GO:0006412 GO:0017148 GO:0022625
AF-A8I7Z7-F1-model_v4	Large ribosomal subunit protein uL13 (50S ribosomal protein L13)	0.9806	1	153	GO:0003729 GO:0003735 GO:0006412 GO:0017148 GO:0022625
AF-A0A2D6JYY4-F1-model_v4	Large ribosomal subunit protein uL13	0.9801	1	154	GO:0003729 GO:0003735 GO:0006412 GO:0017148 GO:0022625
AF-A7INH1-F1-model_v4	Large ribosomal subunit protein uL13 (50S ribosomal protein L13)	0.9795	1	153	GO:0003729 GO:0003735 GO:0006412 GO:0017148 GO:0022625

F496352

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00572

Ribosomal_L13

Ribosomal protein L13

37

156

0.99

Structural Annotation

Top 5 Hits

Map