metagRoot

F496366

General Info

Members	Datasets	Scaffolds	Average Seq Length
2082	821	4165	107

Family's Representative Sequence

Representative Sequence	3300050507\|nmdc:mga05p37_103851_c1\|nmdc:mga05p37_103851_c1_903_1289
Length	128
Sequence	LTDSYLHGYTSINSQRVIDLKMPNAHDVLFRTLADPTRRAIFERLCREGEQTVGALTARAGVSQPAVSKHLGVLKQAGLVRDRHEGRQTHYSAQLGALAPLIDWTSQMAGFWQNRFDKLKDLLKRMDQ

Samples

	Sample ID	Description	Type	Environment
1	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
8	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
9	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
10	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
11	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
12	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
13	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
14	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
15	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
16	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
17	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
18	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
19	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
20	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
21	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
22	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
23	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
24	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
25	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
26	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
27	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
28	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
29	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
34	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
35	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
36	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
37	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
38	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
39	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
40	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
41	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
42	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
43	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
44	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
45	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
46	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
47	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
48	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
49	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
50	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
51	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
52	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
53	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
54	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
55	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
56	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
57	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
58	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
59	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
60	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
61	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
62	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
63	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
64	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
65	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
66	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
67	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
68	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
69	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
70	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
71	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
72	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
73	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
74	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
75	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
76	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
77	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
78	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
79	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
80	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
81	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
82	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
83	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
84	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
85	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
86	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
87	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
88	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
89	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
90	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
91	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
92	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
93	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
94	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
95	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
96	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
97	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
98	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
99	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
100	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
101	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
102	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
103	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
104	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
105	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
106	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
107	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
108	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
109	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
110	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
111	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
112	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
113	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
114	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
115	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
116	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
117	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
118	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
119	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
120	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
121	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
122	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
123	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
124	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
125	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
126	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
127	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
128	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
129	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
130	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
132	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
133	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
134	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
135	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
136	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
137	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
138	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
139	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
140	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
141	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
142	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
143	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
144	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
145	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
146	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
147	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
148	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
149	3300009988	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG	Metagenome	Rhizosphere
150	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
151	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
152	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
153	3300012475	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610	Metagenome	Rhizosphere
154	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
155	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
156	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
157	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
158	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
159	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
160	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
161	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
162	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
163	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
164	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
165	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
166	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
167	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
168	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
169	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
170	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
171	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
172	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
173	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
174	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
175	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
176	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
177	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
178	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
179	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
180	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
181	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
182	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
183	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
184	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
188	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
189	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
190	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
192	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
193	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
194	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
197	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
199	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
270	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
271	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
272	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
274	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
278	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
279	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
280	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
281	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
282	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
283	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
284	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
285	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
286	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
287	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
288	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
289	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
290	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
291	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
292	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
293	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
294	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
295	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
296	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
297	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
298	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
299	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
300	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
301	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
302	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
303	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
304	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
305	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
306	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
307	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
308	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
309	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
310	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
311	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
312	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
313	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
314	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
315	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
316	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
317	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
318	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
319	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
320	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
321	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
322	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
323	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
324	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
325	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
326	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
327	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
328	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
329	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
330	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
331	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
332	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
333	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
334	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
335	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
336	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
337	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
338	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
339	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
340	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
341	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
342	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
343	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
344	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
345	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
346	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
347	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
348	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
349	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
350	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
351	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
352	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
353	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
354	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
355	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
356	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
357	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
358	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
359	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
360	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
361	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
362	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
363	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
364	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
365	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
366	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
367	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
368	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
369	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
370	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
371	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
372	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
373	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
374	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
375	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
376	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
377	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
378	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
379	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
380	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
381	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
382	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
383	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
384	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
385	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
386	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
387	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
388	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
389	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
390	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
391	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
392	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
393	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
394	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
395	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
396	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
397	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
398	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
399	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
400	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
401	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
402	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
403	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
404	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
405	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
406	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
407	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
408	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
409	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
410	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
411	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
412	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
413	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
414	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
415	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
416	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
417	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
418	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
419	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
420	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
421	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
422	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
423	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
424	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
425	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
426	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
427	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
428	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
429	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
430	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
431	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
432	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
433	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
434	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
435	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
436	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
437	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
438	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
439	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
440	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
441	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
442	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
443	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
444	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
445	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
446	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
447	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
448	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
449	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
450	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
451	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
452	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
453	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
454	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
455	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
456	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
457	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
458	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
459	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
460	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
461	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
462	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
463	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
464	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
465	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
466	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
467	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
468	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
469	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
470	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
471	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
472	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
473	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
474	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
475	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
476	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
477	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
478	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
479	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
480	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
481	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
482	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
483	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
484	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
485	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
486	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
487	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
488	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
489	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
490	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
491	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
492	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
493	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
494	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
495	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
496	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
497	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
498	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
499	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
500	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
501	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
503	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
504	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
505	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
510	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
511	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
512	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
513	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
514	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
515	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
516	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
517	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
519	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
522	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
523	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
524	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
525	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
526	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
527	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
528	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
529	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
530	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
531	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
532	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
533	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
534	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
535	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
536	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
537	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
538	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
539	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
540	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
541	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
542	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
543	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
544	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
545	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
546	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
547	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
548	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
549	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
550	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
551	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
552	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
553	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
554	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
555	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
556	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
557	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
558	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
559	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
560	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
561	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
562	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
563	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
564	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
565	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
566	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
567	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
568	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
569	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
570	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
571	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
572	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
573	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
574	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
575	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
576	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
577	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
578	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
579	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
580	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
581	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
582	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
583	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
584	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
585	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
586	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
587	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
588	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
589	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
590	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
591	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
592	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
593	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
594	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
595	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
596	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
597	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
598	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
599	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
600	2512875024
601	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
602	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
603	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
604	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
605	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
606	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
607	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
608	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
609	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
610	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
611	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
612	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
613	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
614	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
615	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
616	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
617	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
618	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
619	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
620	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
621	2643221556	Massilia sp. Root1485	Isolate	Unclassified
622	2643221557	Ensifer sp. Root558	Isolate	Unclassified
623	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
624	2643221610	Ensifer sp. Root74	Isolate	Unclassified
625	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
626	2643221668	Ensifer sp. Root423	Isolate	Unclassified
627	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
628	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
629	2643221684	Massilia sp. Root133	Isolate	Unclassified
630	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
631	2643221726	Ensifer sp. Root954	Isolate	Unclassified
632	2643221734	Bosea sp. Root670	Isolate	Unclassified
633	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
634	2718217927	Rhizobium sp. N324	Isolate	Nodule
635	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
636	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
637	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
638	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
639	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
640	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
641	2718218423	Rhizobium sp. N941	Isolate	Nodule
642	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
643	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
644	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
645	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
646	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
647	2721755809	Rhizobium sp. N541	Isolate	Nodule
648	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
649	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
650	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
651	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
652	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
653	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
654	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
655	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
656	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
657	2791355199
658	2791355256	Rhizobium sp. M10	Isolate	Nodule
659	2791355261	Rhizobium sp. J15	Isolate	Nodule
660	2791355262	Rhizobium sp. M1	Isolate	Nodule
661	2791355263	Rhizobium chutanense C5	Isolate	Nodule
662	2791355265	Rhizobium sp. H4	Isolate	Nodule
663	2791355266	Rhizobium sp. L43	Isolate	Nodule
664	2791355267	Rhizobium sp. L18	Isolate	Nodule
665	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
666	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
667	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
668	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
669	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
670	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
671	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
672	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
673	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
674	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
675	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
676	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
677	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
678	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
679	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
680	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
681	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
682	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
683	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
684	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
685	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
686	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
687	2841760612	Bosea sp. Tri-49	Isolate	Nodule
688	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
689	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
690	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
691	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
692	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
693	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
694	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
695	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
696	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
697	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
698	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
699	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
700	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
701	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
702	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
703	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
704	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
705	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
706	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
707	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
708	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
709	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
710	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
711	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
712	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
713	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
714	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
715	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
716	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
717	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
718	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
719	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
720	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
721	2844104063	Bosea sp. Tri-39	Isolate	Nodule
722	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
723	2851246043	Bosea sp. Tri-54	Isolate	Nodule
724	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
725	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
726	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
727	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
728	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
729	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
730	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
731	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
732	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
733	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
734	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
735	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
736	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
737	2882632389	Mesorhizobium waimense ICMP19557	Isolate	Unclassified
738	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
739	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
740	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
741	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
742	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
743	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
744	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
745	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
746	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
747	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
748	2904699407
749	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
750	2909042592	Labrys sp. LIt4	Isolate	Nodule
751	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
752	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
753	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
754	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
755	2928163908	Burkholderia sp. 567	Isolate	Unclassified
756	2928170801	Burkholderia sp. 572	Isolate	Unclassified
757	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
758	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
759	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
760	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
761	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
762	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
763	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
764	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
765	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
766	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
767	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
768	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
769	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
770	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
771	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
772	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
773	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
774	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
775	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
776	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
777	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
778	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
779	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
780	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
781	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
782	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
783	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
784	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
785	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
786	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
787	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
788	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
789	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
790	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
791	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
792	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
793	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
794	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
795	8005275841	Rhizobium sp. N4311	Isolate	Nodule
796	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
797	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
798	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
799	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
800	8005382845	Rhizobium sp. R634	Isolate	Nodule
801	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
802	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
803	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
804	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
805	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
806	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
807	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
808	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
809	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
810	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
811	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
812	8018176218	Rhizobium sp. N122	Isolate	Nodule
813	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
814	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
815	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
816	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere
817	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
818	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
819	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
820	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
821	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.85
Metatranscriptomes	0.19
Isolates	10.96

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.23
Nodule	8.79
Rhizoplane	4.8
Rhizosphere	63.5
Stem	0
Stem Tuber	0
Unclassified	0.05

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	nmdc:mga05p37_103851_c1	3300050507	Bacteria	3497
2	JGI24740J21852_10041907	3300001979	Bacteria	1376
3	JGI24740J21852_10054674	3300001979	Bacteria	1126
4	JGI24740J21852_10098950	3300001979	Bacteria	744
5	JGI24739J22299_10007431	3300001989	Bacteria	4112
6	JGI24739J22299_10128685	3300001989	Bacteria	754
7	JGI24737J22298_10065588	3300001990	Bacteria	1088
8	JGI24743J22301_10066113	3300001991	Bacteria	750
9	JGI24735J21928_10071275	3300002067	Bacteria	996
10	JGI24033J26618_1050241	3300002155	Bacteria	597
11	JGI24742J22300_10098037	3300002244	Bacteria	565
12	JGI25152J39213_1005749	3300002773	Bacteria	3535
13	JGI25150J39212_1020455	3300002774	Bacteria	1020
14	JGI25151J46595_10000019	3300003187	Bacteria	236340
15	JGI25151J46595_10000039	3300003187	Bacteria	180051
16	JGI25151J46595_10005366	3300003187	Bacteria	6627
17	JGI25406J46586_10000580	3300003203	Bacteria	17278
18	JGI25406J46586_10003693	3300003203	Bacteria	7175
19	JGI25406J46586_10255405	3300003203	Bacteria	515
20	JGI25153J46596_10020719	3300003215	Bacteria	2477
21	rootH2_10081585	3300003320	Bacteria	1553
22	rootL2_10012908	3300003322	Bacteria	6121
23	rootL2_10012936	3300003322	Bacteria	7006
24	rootL2_10026479	3300003322	Bacteria	5697
25	rootH1_10034705	3300003316	Bacteria	8660
26	rootH1_10034705	3300003323	Bacteria	1881
27	rootH1_10072664	3300003323	Bacteria	8917
28	JGI25160J50197_1022447	3300003354	Bacteria	1850
29	JGI25161J50226_1001412	3300003374	Bacteria	7273
30	JGI25404J52841_10006637	3300003659	Bacteria	2428
31	JGI25404J52841_10009203	3300003659	Bacteria	2110
32	JGI25404J52841_10024006	3300003659	Bacteria	1315
33	JGI25404J52841_10095234	3300003659	Bacteria	623
34	Ga0055532_1001352	3300003758	Bacteria	7002
35	Ga0055526_1000490	3300003771	Bacteria	31450
36	Ga0055526_1001293	3300003771	Bacteria	17953
37	Ga0055526_1008753	3300003771	Bacteria	4990
38	Ga0055524_1000104	3300003775	Bacteria	104549
39	Ga0055524_1000377	3300003775	Bacteria	38923
40	Ga0055524_1001266	3300003775	Bacteria	14812
41	Ga0055524_1008537	3300003775	Bacteria	4248
42	Ga0055524_1017124	3300003775	Bacteria	2568
43	Ga0055528_1001616	3300003790	Bacteria	13306
44	Ga0055528_1003033	3300003790	Bacteria	8653
45	Ga0055541_1018105	3300003841	Bacteria	878
46	Ga0058692_1005805	3300003856	Bacteria	3471
47	JGI25405J52794_10032168	3300003911	Bacteria	1092
48	Ga0055543_1000668	3300004625	Bacteria	18040
49	Ga0065165_1083718	3300005262	Bacteria	823
50	Ga0070658_10071259	3300005327	Bacteria	2846
51	Ga0070658_10217097	3300005327	Bacteria	1616
52	Ga0070658_10351064	3300005327	Bacteria	1262
53	Ga0070658_10444708	3300005327	Bacteria	1116
54	Ga0070658_10493897	3300005327	Bacteria	1057
55	Ga0070658_11123377	3300005327	Bacteria	683
56	Ga0070676_10412974	3300005328	Bacteria	942
57	Ga0070676_10520939	3300005328	Bacteria	847
58	Ga0070676_10838125	3300005328	Bacteria	681
59	Ga0070683_100957039	3300005329	Bacteria	822
60	Ga0070683_101577434	3300005329	Bacteria	631
61	Ga0070690_100065286	3300005330	Bacteria	2353
62	Ga0070690_100275338	3300005330	Bacteria	1199
63	Ga0070670_100092493	3300005331	Bacteria	2601
64	Ga0070670_100159970	3300005331	Bacteria	1951
65	Ga0070670_100633992	3300005331	Bacteria	958
66	Ga0068869_100009913	3300005334	Bacteria	6190
67	Ga0068869_100206253	3300005334	Bacteria	1552
68	Ga0068869_100234842	3300005334	Bacteria	1458
69	Ga0068869_102087818	3300005334	Bacteria	509
70	Ga0068869_102123220	3300005334	Bacteria	505
71	Ga0070666_10065588	3300005335	Bacteria	2464
72	Ga0070666_10313099	3300005335	Bacteria	1119
73	Ga0070666_10958734	3300005335	Bacteria	634
74	Ga0070680_100000131	3300005336	Bacteria	44894
75	Ga0070680_100003117	3300005336	Bacteria	12308
76	Ga0070680_100070560	3300005336	Bacteria	2869
77	Ga0070682_100068407	3300005337	Bacteria	2265
78	Ga0070682_100674523	3300005337	Bacteria	826
79	Ga0068868_100197515	3300005338	Bacteria	1675
80	Ga0068868_100530745	3300005338	Bacteria	1034
81	Ga0068868_101799724	3300005338	Bacteria	579
82	Ga0070660_100000164	3300005339	Bacteria	43441
83	Ga0070660_100090610	3300005339	Bacteria	2411
84	Ga0070660_100165571	3300005339	Bacteria	1784
85	Ga0070660_100297898	3300005339	Bacteria	1322
86	Ga0070660_100408726	3300005339	Bacteria	1123
87	Ga0070660_100498956	3300005339	Bacteria	1012
88	Ga0070660_100525728	3300005339	Bacteria	986
89	Ga0070660_100818530	3300005339	Bacteria	784
90	Ga0070660_100928051	3300005339	Bacteria	734
91	Ga0070689_100143370	3300005340	Bacteria	1922
92	Ga0070689_101355895	3300005340	Bacteria	642
93	Ga0070691_10509583	3300005341	Bacteria	697
94	Ga0070691_10885391	3300005341	Bacteria	550
95	Ga0070687_100046647	3300005343	Bacteria	2219
96	Ga0070687_100149968	3300005343	Bacteria	1368
97	Ga0070661_100124797	3300005344	Bacteria	1930
98	Ga0070661_100288824	3300005344	Bacteria	1274
99	Ga0070661_100528707	3300005344	Bacteria	947
100	Ga0070661_100662386	3300005344	Bacteria	848
101	Ga0070661_101254517	3300005344	Bacteria	621
102	Ga0070692_10841781	3300005345	Bacteria	630
103	Ga0070668_100050008	3300005347	Bacteria	3217
104	Ga0070668_100232228	3300005347	Bacteria	1525
105	Ga0070668_100410551	3300005347	Bacteria	1158
106	Ga0070668_100704700	3300005347	Bacteria	891
107	Ga0070668_100726372	3300005347	Bacteria	878
108	Ga0070668_100826353	3300005347	Bacteria	824
109	Ga0070669_100271489	3300005353	Bacteria	1356
110	Ga0070669_100375452	3300005353	Bacteria	1159
111	Ga0070669_101973631	3300005353	Bacteria	510
112	Ga0070675_100192528	3300005354	Bacteria	1768
113	Ga0070675_100221143	3300005354	Bacteria	1649
114	Ga0070675_100896733	3300005354	Bacteria	813
115	Ga0070671_100007126	3300005355	Bacteria	8938
116	Ga0070671_100246197	3300005355	Bacteria	1518
117	Ga0070671_100283253	3300005355	Bacteria	1410
118	Ga0070671_100430471	3300005355	Bacteria	1131
119	Ga0070674_100014571	3300005356	Bacteria	4890
120	Ga0070674_100079943	3300005356	Bacteria	2333
121	Ga0070674_100115388	3300005356	Bacteria	1980
122	Ga0070674_100278062	3300005356	Bacteria	1326
123	Ga0070674_100491646	3300005356	Bacteria	1020
124	Ga0070674_101089866	3300005356	Bacteria	705
125	Ga0070674_101621353	3300005356	Bacteria	584
126	Ga0070673_100032500	3300005364	Bacteria	3930
127	Ga0070673_100467822	3300005364	Bacteria	1136
128	Ga0070673_101174097	3300005364	Bacteria	719
129	Ga0070688_100260774	3300005365	Bacteria	1238
130	Ga0070659_100000128	3300005366	Bacteria	57485
131	Ga0070659_100037717	3300005366	Bacteria	3768
132	Ga0070659_100040147	3300005366	Bacteria	3656
133	Ga0070659_100058500	3300005366	Bacteria	3042
134	Ga0070659_100340358	3300005366	Bacteria	1257
135	Ga0070659_101222068	3300005366	Bacteria	665
136	Ga0070667_100344369	3300005367	Bacteria	1348
137	Ga0070667_101890677	3300005367	Bacteria	562
138	Ga0070703_10001384	3300005406	Bacteria	7352
139	Ga0070709_10001085	3300005434	Bacteria	15066
140	Ga0070709_10673790	3300005434	Bacteria	803
141	Ga0070709_10900162	3300005434	Bacteria	700
142	Ga0070714_100033077	3300005435	Bacteria	4321
143	Ga0070714_100042322	3300005435	Bacteria	3848
144	Ga0070714_100209117	3300005435	Bacteria	1788
145	Ga0070714_102004465	3300005435	Bacteria	564
146	Ga0070713_100008466	3300005436	Bacteria	7295
147	Ga0070713_100032474	3300005436	Bacteria	4170
148	Ga0070713_100182121	3300005436	Bacteria	1888
149	Ga0070710_10001483	3300005437	Bacteria	11048
150	Ga0070710_10154041	3300005437	Bacteria	1420
151	Ga0070710_10511341	3300005437	Bacteria	824
152	Ga0070710_10678838	3300005437	Bacteria	725
153	Ga0070701_10137612	3300005438	Bacteria	1393
154	Ga0070711_100000833	3300005439	Bacteria	16166
155	Ga0070711_100063722	3300005439	Bacteria	2574
156	Ga0070711_101322626	3300005439	Bacteria	626
157	Ga0070705_100002172	3300005440	Bacteria	9965
158	Ga0070700_100002573	3300005441	Bacteria	9275
159	Ga0070700_100006013	3300005441	Bacteria	6456
160	Ga0070694_100920355	3300005444	Bacteria	723
161	Ga0070708_100040322	3300005445	Bacteria	4089
162	Ga0070708_100957685	3300005445	Bacteria	803
163	Ga0070708_101538185	3300005445	Bacteria	620
164	Ga0070708_101710009	3300005445	Bacteria	585
165	Ga0070663_100002316	3300005455	Bacteria	10688
166	Ga0070663_100007077	3300005455	Bacteria	6806
167	Ga0070663_100022076	3300005455	Bacteria	4248
168	Ga0070663_100099940	3300005455	Bacteria	2163
169	Ga0070663_100167588	3300005455	Bacteria	1695
170	Ga0070663_100414280	3300005455	Bacteria	1104
171	Ga0070663_101052165	3300005455	Bacteria	710
172	Ga0070663_101337014	3300005455	Bacteria	633
173	Ga0070678_100150815	3300005456	Bacteria	1872
174	Ga0070678_100859734	3300005456	Bacteria	827
175	Ga0070678_100967874	3300005456	Bacteria	781
176	Ga0070678_100984242	3300005456	Bacteria	774
177	Ga0070662_100048934	3300005457	Bacteria	3047
178	Ga0070662_100154769	3300005457	Bacteria	1788
179	Ga0070662_100684533	3300005457	Bacteria	867
180	Ga0070662_100722546	3300005457	Bacteria	843
181	Ga0070662_100746758	3300005457	Bacteria	830
182	Ga0070662_101622982	3300005457	Bacteria	558
183	Ga0070681_10000021	3300005458	Bacteria	116877
184	Ga0070681_10198217	3300005458	Bacteria	1926
185	Ga0070681_10408286	3300005458	Bacteria	1270
186	Ga0070681_10690369	3300005458	Bacteria	936
187	Ga0068867_100100996	3300005459	Bacteria	2203
188	Ga0068867_100219772	3300005459	Bacteria	1531
189	Ga0068867_101138940	3300005459	Bacteria	714
190	Ga0068867_101294565	3300005459	Bacteria	673
191	Ga0070685_10321077	3300005466	Bacteria	1049
192	Ga0070706_100465656	3300005467	Bacteria	1176
193	Ga0070706_100529174	3300005467	Bacteria	1096
194	Ga0070706_101214053	3300005467	Bacteria	693
195	Ga0070706_102020930	3300005467	Bacteria	522
196	Ga0070707_100325697	3300005468	Bacteria	1493
197	Ga0070707_100954358	3300005468	Bacteria	822
198	Ga0070707_102281822	3300005468	Bacteria	509
199	Ga0070698_100298207	3300005471	Bacteria	1543
200	Ga0070698_101139874	3300005471	Bacteria	729
201	Ga0070699_100000444	3300005518	Bacteria	39757
202	Ga0070699_102050258	3300005518	Bacteria	523
203	Ga0070679_100000848	3300005530	Bacteria	26636
204	Ga0070679_100156663	3300005530	Bacteria	2252
205	Ga0070679_100713184	3300005530	Bacteria	946
206	Ga0070684_100926684	3300005535	Bacteria	817
207	Ga0070684_102124160	3300005535	Bacteria	530
208	Ga0070697_100928432	3300005536	Bacteria	772
209	Ga0068853_100211606	3300005539	Bacteria	1767
210	Ga0068853_100220773	3300005539	Bacteria	1731
211	Ga0068853_100805484	3300005539	Bacteria	900
212	Ga0068853_101840253	3300005539	Bacteria	587
213	Ga0070672_100091058	3300005543	Bacteria	2460
214	Ga0070672_100286076	3300005543	Bacteria	1395
215	Ga0070686_100657338	3300005544	Bacteria	832
216	Ga0070695_100070926	3300005545	Bacteria	2280
217	Ga0070696_100000123	3300005546	Bacteria	40797
218	Ga0070696_100112212	3300005546	Bacteria	1964
219	Ga0070696_100222159	3300005546	Bacteria	1418
220	Ga0070693_100008394	3300005547	Bacteria	5090
221	Ga0070693_100165569	3300005547	Bacteria	1412
222	Ga0070665_100004851	3300005548	Bacteria	13976
223	Ga0070665_100014726	3300005548	Bacteria	7846
224	Ga0070665_100022028	3300005548	Bacteria	6410
225	Ga0070665_100023861	3300005548	Bacteria	6162
226	Ga0070665_100034562	3300005548	Bacteria	5083
227	Ga0070665_100043926	3300005548	Bacteria	4489
228	Ga0070665_100049039	3300005548	Bacteria	4238
229	Ga0070665_100110571	3300005548	Bacteria	2750
230	Ga0070665_100272212	3300005548	Bacteria	1695
231	Ga0070665_100323155	3300005548	Bacteria	1547
232	Ga0070665_100480746	3300005548	Bacteria	1253
233	Ga0070665_100788778	3300005548	Bacteria	963
234	Ga0070665_101708048	3300005548	Bacteria	637
235	Ga0070704_100000095	3300005549	Bacteria	30467
236	Ga0068855_100255514	3300005563	Bacteria	1954
237	Ga0068855_100528922	3300005563	Bacteria	1278
238	Ga0068855_100626380	3300005563	Bacteria	1158
239	Ga0068855_100643355	3300005563	Bacteria	1139
240	Ga0068855_100659921	3300005563	Bacteria	1122
241	Ga0068855_102027822	3300005563	Bacteria	581
242	Ga0070664_100050158	3300005564	Bacteria	3531
243	Ga0070664_100294796	3300005564	Bacteria	1465
244	Ga0070664_100736825	3300005564	Bacteria	919
245	Ga0070664_100845793	3300005564	Bacteria	857
246	Ga0068857_100003759	3300005577	Bacteria	12760
247	Ga0068857_100093791	3300005577	Bacteria	2688
248	Ga0068857_100140907	3300005577	Bacteria	2179
249	Ga0068857_100424867	3300005577	Bacteria	1239
250	Ga0068854_100101000	3300005578	Bacteria	2163
251	Ga0068854_100242606	3300005578	Bacteria	1436
252	Ga0068856_100000013	3300005614	Bacteria	165611
253	Ga0068856_100197605	3300005614	Bacteria	2025
254	Ga0068856_100340158	3300005614	Bacteria	1519
255	Ga0068856_100765400	3300005614	Bacteria	985
256	Ga0070702_100051399	3300005615	Bacteria	2359
257	Ga0070702_100130670	3300005615	Bacteria	1586
258	Ga0070702_100239090	3300005615	Bacteria	1225
259	Ga0070702_100618555	3300005615	Bacteria	815
260	Ga0068852_100001360	3300005616	Bacteria	16411
261	Ga0068852_100005224	3300005616	Bacteria	9260
262	Ga0068852_100032253	3300005616	Bacteria	4335
263	Ga0068852_100146541	3300005616	Bacteria	2190
264	Ga0068852_100324416	3300005616	Bacteria	1496
265	Ga0068859_100001820	3300005617	Bacteria	21717
266	Ga0068859_100255350	3300005617	Bacteria	1843
267	Ga0068864_100031215	3300005618	Bacteria	4520
268	Ga0068864_100033280	3300005618	Bacteria	4382
269	Ga0068864_100049303	3300005618	Bacteria	3623
270	Ga0068864_100524834	3300005618	Bacteria	1142
271	Ga0068866_10053091	3300005718	Bacteria	2071
272	Ga0068866_10301356	3300005718	Bacteria	1001
273	Ga0068861_100004883	3300005719	Bacteria	9025
274	Ga0068861_100076485	3300005719	Bacteria	2608
275	Ga0068861_100400345	3300005719	Bacteria	1218
276	Ga0068861_100509272	3300005719	Bacteria	1089
277	Ga0068861_102231249	3300005719	Bacteria	549
278	Ga0068851_10156582	3300005834	Bacteria	1249
279	Ga0068851_10166511	3300005834	Bacteria	1214
280	Ga0068870_10068896	3300005840	Bacteria	1923
281	Ga0068870_10369650	3300005840	Bacteria	925
282	Ga0068863_100385737	3300005841	Bacteria	1368
283	Ga0068863_100794768	3300005841	Bacteria	943
284	Ga0068858_100003992	3300005842	Bacteria	14556
285	Ga0068858_100209639	3300005842	Bacteria	1844
286	Ga0068858_100350008	3300005842	Bacteria	1415
287	Ga0068858_100956261	3300005842	Bacteria	839
288	Ga0068860_100002696	3300005843	Bacteria	18484
289	Ga0068860_100086532	3300005843	Bacteria	2983
290	Ga0068860_100386960	3300005843	Bacteria	1381
291	Ga0068860_100565889	3300005843	Bacteria	1140
292	Ga0068860_100977962	3300005843	Bacteria	864
293	Ga0068862_100083453	3300005844	Bacteria	2774
294	Ga0068862_100132303	3300005844	Bacteria	2207
295	Ga0068862_100527555	3300005844	Bacteria	1124
296	Ga0068862_100671179	3300005844	Bacteria	1001
297	Ga0068862_100714777	3300005844	Bacteria	972
298	Ga0068862_100744304	3300005844	Bacteria	953
299	Ga0068862_100765090	3300005844	Bacteria	941
300	Ga0068862_100904907	3300005844	Bacteria	868
301	Ga0081455_10002516	3300005937	Bacteria	21762
302	Ga0081455_10005510	3300005937	Bacteria	13875
303	Ga0081455_10007059	3300005937	Bacteria	11921
304	Ga0081455_10011303	3300005937	Bacteria	8979
305	Ga0081455_10096781	3300005937	Bacteria	2379
306	Ga0081455_10353122	3300005937	Bacteria	1036
307	Ga0081455_10967520	3300005937	Bacteria	527
308	Ga0081538_10009365	3300005981	Bacteria	8184
309	Ga0081538_10023382	3300005981	Bacteria	4445
310	Ga0081538_10080152	3300005981	Bacteria	1743
311	Ga0081540_1004444	3300005983	Bacteria	10695
312	Ga0081540_1005727	3300005983	Bacteria	9215
313	Ga0081540_1008113	3300005983	Bacteria	7373
314	Ga0081540_1011527	3300005983	Bacteria	5905
315	Ga0081540_1012092	3300005983	Bacteria	5711
316	Ga0081540_1054003	3300005983	Bacteria	1966
317	Ga0081540_1250835	3300005983	Bacteria	618
318	Ga0081539_10000321	3300005985	Bacteria	106887
319	Ga0081539_10000747	3300005985	Bacteria	64612
320	Ga0081539_10036458	3300005985	Bacteria	2944
321	Ga0081539_10061707	3300005985	Bacteria	2052
322	Ga0081539_10247343	3300005985	Bacteria	794
323	Ga0070717_10158236	3300006028	Bacteria	1964
324	Ga0070717_10442351	3300006028	Bacteria	1171
325	Ga0070717_10477302	3300006028	Bacteria	1126
326	Ga0070717_10682416	3300006028	Bacteria	933
327	Ga0070717_10927950	3300006028	Bacteria	793
328	Ga0070717_11083283	3300006028	Bacteria	730
329	Ga0070717_11516741	3300006028	Bacteria	608
330	Ga0075365_10001032	3300006038	Bacteria	11976
331	Ga0075365_10003599	3300006038	Bacteria	8022
332	Ga0075365_10003713	3300006038	Bacteria	7936
333	Ga0075365_10027545	3300006038	Bacteria	3617
334	Ga0075365_10121151	3300006038	Bacteria	1805
335	Ga0075365_10173966	3300006038	Bacteria	1503
336	Ga0075365_10254937	3300006038	Bacteria	1233
337	Ga0075365_10285878	3300006038	Bacteria	1160
338	Ga0075365_10353774	3300006038	Bacteria	1035
339	Ga0075365_10389614	3300006038	Bacteria	983
340	Ga0075365_10430996	3300006038	Bacteria	931
341	Ga0075365_10668668	3300006038	Bacteria	734
342	Ga0075365_11013684	3300006038	Bacteria	585
343	Ga0075368_10086400	3300006042	Bacteria	1280
344	Ga0075368_10123903	3300006042	Bacteria	1072
345	Ga0075368_10129371	3300006042	Bacteria	1049
346	Ga0075368_10177505	3300006042	Bacteria	897
347	Ga0075368_10183979	3300006042	Bacteria	881
348	Ga0075368_10184082	3300006042	Bacteria	881
349	Ga0075368_10325817	3300006042	Bacteria	666
350	Ga0075368_10456266	3300006042	Bacteria	567
351	Ga0075363_100003578	3300006048	Bacteria	6646
352	Ga0075363_100009475	3300006048	Bacteria	4578
353	Ga0075363_100030992	3300006048	Bacteria	2771
354	Ga0075363_100077529	3300006048	Bacteria	1813
355	Ga0075363_100354336	3300006048	Bacteria	857
356	Ga0075363_100378440	3300006048	Bacteria	830
357	Ga0075363_100947053	3300006048	Bacteria	529
358	Ga0075364_10028877	3300006051	Bacteria	3553
359	Ga0075364_10081820	3300006051	Bacteria	2135
360	Ga0075364_10104366	3300006051	Bacteria	1888
361	Ga0075364_10145504	3300006051	Bacteria	1596
362	Ga0075364_10394820	3300006051	Bacteria	944
363	Ga0075364_10581388	3300006051	Bacteria	765
364	Ga0070715_10004391	3300006163	Bacteria	4622
365	Ga0070716_100002916	3300006173	Bacteria	7968
366	Ga0070712_100006043	3300006175	Bacteria	7496
367	Ga0070712_100088087	3300006175	Bacteria	2267
368	Ga0070712_100531868	3300006175	Bacteria	989
369	Ga0075362_10000141	3300006177	Bacteria	19610
370	Ga0075362_10023752	3300006177	Bacteria	2595
371	Ga0075362_10040280	3300006177	Bacteria	2057
372	Ga0075362_10060225	3300006177	Bacteria	1716
373	Ga0075362_10149629	3300006177	Bacteria	1120
374	Ga0075362_10190172	3300006177	Bacteria	997
375	Ga0075362_10243297	3300006177	Bacteria	884
376	Ga0075362_10261832	3300006177	Bacteria	852
377	Ga0075367_10002608	3300006178	Bacteria	8282
378	Ga0075367_10005099	3300006178	Bacteria	6483
379	Ga0075367_10007744	3300006178	Bacteria	5523
380	Ga0075367_10010345	3300006178	Bacteria	4899
381	Ga0075367_10058646	3300006178	Bacteria	2291
382	Ga0075367_10163966	3300006178	Bacteria	1382
383	Ga0075367_10279259	3300006178	Bacteria	1050
384	Ga0075367_10320019	3300006178	Bacteria	977
385	Ga0075367_10521145	3300006178	Bacteria	754
386	Ga0075367_10547267	3300006178	Bacteria	735
387	Ga0075367_10903326	3300006178	Bacteria	563
388	Ga0075367_11041271	3300006178	Bacteria	523
389	Ga0075369_10001683	3300006186	Bacteria	7632
390	Ga0075369_10099812	3300006186	Bacteria	1302
391	Ga0075369_10247360	3300006186	Bacteria	828
392	Ga0075369_10446726	3300006186	Bacteria	612
393	Ga0075366_10005088	3300006195	Bacteria	7112
394	Ga0075366_10046334	3300006195	Bacteria	2576
395	Ga0075366_10058002	3300006195	Bacteria	2300
396	Ga0075366_10086837	3300006195	Bacteria	1871
397	Ga0075366_10089071	3300006195	Bacteria	1848
398	Ga0075366_10213473	3300006195	Bacteria	1175
399	Ga0075366_10233198	3300006195	Bacteria	1122
400	Ga0075366_10319550	3300006195	Bacteria	951
401	Ga0075366_10351545	3300006195	Bacteria	904
402	Ga0075366_10427579	3300006195	Bacteria	816
403	Ga0075366_10458470	3300006195	Bacteria	787
404	Ga0075366_10686404	3300006195	Bacteria	636
405	Ga0075366_10706599	3300006195	Bacteria	626
406	Ga0097621_100039813	3300006237	Bacteria	3776
407	Ga0097621_100208823	3300006237	Bacteria	1698
408	Ga0097621_100420301	3300006237	Bacteria	1200
409	Ga0075370_10001891	3300006353	Bacteria	9407
410	Ga0075370_10002484	3300006353	Bacteria	8551
411	Ga0075370_10076249	3300006353	Bacteria	1922
412	Ga0075370_10200903	3300006353	Bacteria	1176
413	Ga0075370_10308484	3300006353	Bacteria	942
414	Ga0075370_11000072	3300006353	Bacteria	512
415	Ga0068871_101118751	3300006358	Bacteria	737
416	Ga0068871_101230783	3300006358	Bacteria	703
417	Ga0075428_100042345	3300006844	Bacteria	5006
418	Ga0075428_100112557	3300006844	Bacteria	2965
419	Ga0075428_100436746	3300006844	Bacteria	1402
420	Ga0075428_100683821	3300006844	Bacteria	1093
421	Ga0075430_100000037	3300006846	Bacteria	68528
422	Ga0075430_100087029	3300006846	Bacteria	2615
423	Ga0075430_100231344	3300006846	Bacteria	1533
424	Ga0075431_100059835	3300006847	Bacteria	3931
425	Ga0075431_100374515	3300006847	Bacteria	1429
426	Ga0075433_10811247	3300006852	Bacteria	817
427	Ga0075433_11945091	3300006852	Bacteria	504
428	Ga0075434_100253514	3300006871	Bacteria	1779
429	Ga0075434_100725586	3300006871	Bacteria	1011
430	Ga0075434_100738104	3300006871	Bacteria	1002
431	Ga0075429_100635937	3300006880	Bacteria	935
432	Ga0075429_100718999	3300006880	Bacteria	875
433	Ga0075429_100831132	3300006880	Bacteria	809
434	Ga0068865_100391186	3300006881	Bacteria	1136
435	Ga0068865_100926277	3300006881	Bacteria	759
436	Ga0075436_100143191	3300006914	Bacteria	1681
437	Ga0075436_100650566	3300006914	Bacteria	779
438	Ga0097620_100001820	3300006931	Bacteria	21717
439	Ga0097620_100255358	3300006931	Bacteria	1843
440	Ga0099824_1002092	3300006942	Bacteria	28972
441	Ga0099826_10120045	3300006948	Bacteria	1550
442	Ga0075435_100074820	3300007076	Bacteria	2772
443	Ga0075435_100290880	3300007076	Bacteria	1396
444	Ga0075435_100354633	3300007076	Bacteria	1258
445	Ga0075435_100484916	3300007076	Bacteria	1068
446	Ga0075435_101383198	3300007076	Bacteria	617
447	Ga0075435_101437198	3300007076	Bacteria	604
448	Ga0099794_10055519	3300007265	Bacteria	1914
449	Ga0099795_10062697	3300007788	Bacteria	1384
450	Ga0099795_10102503	3300007788	Bacteria	1124
451	Ga0105240_10069714	3300009093	Bacteria	4351
452	Ga0105240_10138170	3300009093	Bacteria	2916
453	Ga0105240_10285467	3300009093	Bacteria	1894
454	Ga0105240_10324308	3300009093	Bacteria	1754
455	Ga0105240_10372837	3300009093	Bacteria	1613
456	Ga0105240_10904421	3300009093	Bacteria	949
457	Ga0105240_10914286	3300009093	Bacteria	943
458	Ga0105240_11141206	3300009093	Bacteria	828
459	Ga0105240_11546654	3300009093	Bacteria	695
460	Ga0111539_10162461	3300009094	Bacteria	2612
461	Ga0111539_12823476	3300009094	Bacteria	562
462	Ga0111539_13463140	3300009094	Bacteria	507
463	Ga0105245_10366945	3300009098	Bacteria	1430
464	Ga0105245_10407285	3300009098	Bacteria	1360
465	Ga0105245_11903169	3300009098	Bacteria	648
466	Ga0105247_10082767	3300009101	Bacteria	2026
467	Ga0105247_10334966	3300009101	Bacteria	1060
468	Ga0105247_10877117	3300009101	Bacteria	691
469	Ga0105247_11017401	3300009101	Bacteria	648
470	Ga0105247_11293811	3300009101	Bacteria	585
471	Ga0114129_10075151	3300009147	Bacteria	4705
472	Ga0114129_10129694	3300009147	Bacteria	3465
473	Ga0114129_10279201	3300009147	Bacteria	2232
474	Ga0114129_11757891	3300009147	Bacteria	755
475	Ga0114129_11786437	3300009147	Bacteria	748
476	Ga0105243_10129496	3300009148	Bacteria	2139
477	Ga0105243_10133638	3300009148	Bacteria	2108
478	Ga0105243_10215088	3300009148	Bacteria	1695
479	Ga0105243_10325073	3300009148	Bacteria	1403
480	Ga0105243_12078063	3300009148	Bacteria	603
481	Ga0105243_12487544	3300009148	Bacteria	557
482	Ga0105243_12658416	3300009148	Bacteria	540
483	Ga0105241_10015190	3300009174	Bacteria	5639
484	Ga0105241_10363259	3300009174	Bacteria	1260
485	Ga0105241_10500831	3300009174	Bacteria	1083
486	Ga0105241_11316973	3300009174	Bacteria	688
487	Ga0105242_10144122	3300009176	Bacteria	2070
488	Ga0105242_10312097	3300009176	Bacteria	1439
489	Ga0105242_10595339	3300009176	Bacteria	1067
490	Ga0105242_10795696	3300009176	Bacteria	935
491	Ga0105242_10936787	3300009176	Bacteria	869
492	Ga0105242_11160411	3300009176	Bacteria	790
493	Ga0105242_12619151	3300009176	Bacteria	553
494	Ga0105248_10007493	3300009177	Bacteria	11972
495	Ga0105248_10091364	3300009177	Bacteria	3429
496	Ga0105248_10299872	3300009177	Bacteria	1809
497	Ga0105248_10501711	3300009177	Bacteria	1368
498	Ga0105248_10671839	3300009177	Bacteria	1169
499	Ga0105248_10868913	3300009177	Bacteria	1018
500	Ga0105248_11146304	3300009177	Bacteria	879
501	Ga0105248_11658218	3300009177	Bacteria	725
502	Ga0105237_10002582	3300009545	Bacteria	22325
503	Ga0105237_10059958	3300009545	Bacteria	3807
504	Ga0105237_10098862	3300009545	Bacteria	2909
505	Ga0105237_10276374	3300009545	Bacteria	1682
506	Ga0105237_10465687	3300009545	Bacteria	1270
507	Ga0105237_10725369	3300009545	Bacteria	1000
508	Ga0105237_10775115	3300009545	Bacteria	966
509	Ga0105237_11605561	3300009545	Bacteria	657
510	Ga0105237_11668273	3300009545	Bacteria	644
511	Ga0105237_11765233	3300009545	Bacteria	626
512	Ga0105238_10048232	3300009551	Bacteria	4293
513	Ga0105238_10134848	3300009551	Bacteria	2447
514	Ga0105238_10291650	3300009551	Bacteria	1614
515	Ga0105238_11022278	3300009551	Bacteria	848
516	Ga0105238_11459933	3300009551	Bacteria	712
517	Ga0105238_12820790	3300009551	Bacteria	522
518	Ga0105249_10129545	3300009553	Bacteria	2407
519	Ga0105249_10617507	3300009553	Bacteria	1140
520	Ga0105249_10945909	3300009553	Bacteria	929
521	Ga0105249_11556546	3300009553	Bacteria	733
522	Ga0105249_11625109	3300009553	Bacteria	719
523	Ga0123341_1000037	3300009765	Bacteria	60834
524	Ga0105035_126637	3300009988	Bacteria	559
525	Ga0099796_10000574	3300010159	Bacteria	6337
526	Ga0105239_10005031	3300010375	Bacteria	15611
527	Ga0105239_10026092	3300010375	Bacteria	6432
528	Ga0105239_10034721	3300010375	Bacteria	5540
529	Ga0105239_10104978	3300010375	Bacteria	3129
530	Ga0105239_10166254	3300010375	Bacteria	2467
531	Ga0105239_10169603	3300010375	Bacteria	2440
532	Ga0105239_10229010	3300010375	Bacteria	2085
533	Ga0105239_10311769	3300010375	Bacteria	1773
534	Ga0105239_10352164	3300010375	Bacteria	1662
535	Ga0105239_10619811	3300010375	Bacteria	1235
536	Ga0105239_10927726	3300010375	Bacteria	1000
537	Ga0105239_11078186	3300010375	Bacteria	924
538	Ga0105239_11296041	3300010375	Bacteria	840
539	Ga0105239_11495100	3300010375	Bacteria	780
540	Ga0105239_12259265	3300010375	Bacteria	633
541	Ga0105239_12567028	3300010375	Bacteria	594
542	Ga0105239_12859549	3300010375	Bacteria	563
543	Ga0105239_13279263	3300010375	Bacteria	527
544	Ga0105246_10010636	3300011119	Bacteria	5701
545	Ga0105246_10073260	3300011119	Bacteria	2417
546	Ga0105246_10114723	3300011119	Bacteria	1985
547	Ga0105246_10255655	3300011119	Bacteria	1393
548	Ga0105246_11096333	3300011119	Bacteria	727
549	Ga0105246_11249900	3300011119	Bacteria	686
550	Ga0105246_11733515	3300011119	Bacteria	595
551	Ga0157317_1022509	3300012475	Bacteria	570
552	Ga0157373_10038651	3300013100	Bacteria	3419
553	Ga0157371_10386092	3300013102	Bacteria	1023
554	Ga0157370_10347522	3300013104	Bacteria	1367
555	Ga0157370_10781770	3300013104	Bacteria	869
556	Ga0157370_11068408	3300013104	Bacteria	730
557	Ga0157369_10008090	3300013105	Bacteria	12057
558	Ga0157369_10128224	3300013105	Bacteria	2689
559	Ga0157369_10442115	3300013105	Bacteria	1347
560	Ga0157369_10624236	3300013105	Bacteria	1112
561	Ga0157369_10656090	3300013105	Bacteria	1082
562	Ga0157369_11941705	3300013105	Bacteria	597
563	Ga0171463_1002	3300013249	Bacteria	1274851
564	Ga0157374_10156200	3300013296	Bacteria	2220
565	Ga0157374_10733308	3300013296	Bacteria	1002
566	Ga0157374_10873901	3300013296	Bacteria	916
567	Ga0157378_10002606	3300013297	Bacteria	16048
568	Ga0157378_10224697	3300013297	Bacteria	1786
569	Ga0157378_10523739	3300013297	Bacteria	1187
570	Ga0157378_10559619	3300013297	Bacteria	1150
571	Ga0157378_11268470	3300013297	Bacteria	777
572	Ga0157378_11316628	3300013297	Bacteria	764
573	Ga0157378_11547051	3300013297	Bacteria	708
574	Ga0163162_10120108	3300013306	Bacteria	2731
575	Ga0163162_10168044	3300013306	Bacteria	2317
576	Ga0163162_10496117	3300013306	Bacteria	1352
577	Ga0163162_10864477	3300013306	Bacteria	1019
578	Ga0163162_10933611	3300013306	Bacteria	979
579	Ga0163162_11111089	3300013306	Bacteria	896
580	Ga0163162_11811749	3300013306	Bacteria	698
581	Ga0163162_11894856	3300013306	Bacteria	682
582	Ga0157372_10491651	3300013307	Bacteria	1431
583	Ga0157372_10508750	3300013307	Bacteria	1404
584	Ga0157372_10922444	3300013307	Bacteria	1013
585	Ga0157372_11680180	3300013307	Bacteria	731
586	Ga0157375_10032932	3300013308	Bacteria	4920
587	Ga0157375_10542392	3300013308	Bacteria	1325
588	Ga0157375_10618318	3300013308	Bacteria	1241
589	Ga0157375_10871382	3300013308	Bacteria	1046
590	Ga0157375_10914337	3300013308	Bacteria	1021
591	Ga0157375_12680738	3300013308	Bacteria	596
592	Ga0157375_13052074	3300013308	Bacteria	559
593	Ga0157375_13814934	3300013308	Bacteria	500
594	Ga0163163_10000002	3300014325	Bacteria	609846
595	Ga0163163_10039965	3300014325	Bacteria	4580
596	Ga0163163_10089635	3300014325	Bacteria	3088
597	Ga0163163_10188905	3300014325	Bacteria	2108
598	Ga0163163_10233630	3300014325	Bacteria	1888
599	Ga0163163_10236803	3300014325	Bacteria	1875
600	Ga0163163_10403024	3300014325	Bacteria	1426
601	Ga0163163_10450970	3300014325	Bacteria	1346
602	Ga0163163_10556471	3300014325	Bacteria	1210
603	Ga0163163_10786091	3300014325	Bacteria	1015
604	Ga0163163_12078679	3300014325	Bacteria	628
605	Ga0163163_12244518	3300014325	Bacteria	605
606	Ga0157380_10081715	3300014326	Bacteria	2644
607	Ga0157380_10222182	3300014326	Bacteria	1691
608	Ga0157380_10923960	3300014326	Bacteria	900
609	Ga0157380_11115912	3300014326	Bacteria	828
610	Ga0157380_11599818	3300014326	Bacteria	707
611	Ga0157380_12531069	3300014326	Bacteria	579
612	Ga0157380_13032270	3300014326	Bacteria	535
613	Ga0182008_10142137	3300014497	Bacteria	1201
614	Ga0157377_10042992	3300014745	Bacteria	2513
615	Ga0157377_10552740	3300014745	Bacteria	813
616	Ga0157379_10004112	3300014968	Bacteria	12413
617	Ga0157379_10023394	3300014968	Bacteria	5483
618	Ga0157379_11364101	3300014968	Bacteria	686
619	Ga0157379_11451082	3300014968	Bacteria	666
620	Ga0157376_10070257	3300014969	Bacteria	2971
621	Ga0157376_10072383	3300014969	Bacteria	2932
622	Ga0157376_10348818	3300014969	Bacteria	1416
623	Ga0157376_12083231	3300014969	Bacteria	605
624	Ga0157376_12652137	3300014969	Bacteria	541
625	Ga0157376_12790267	3300014969	Bacteria	528
626	Ga0182006_1104035	3300015261	Bacteria	1004
627	Ga0182005_1070042	3300015265	Bacteria	963
628	Ga0183363_1014	3300015690	Bacteria	78669
629	Ga0163161_10189300	3300017792	Bacteria	1581
630	Ga0163161_11480397	3300017792	Bacteria	595
631	Ga0206353_10336961	3300020082	Bacteria	653
632	Ga0214542_1017541	3300021321	Bacteria	6416
633	Ga0214543_1000022	3300021327	Bacteria	241930
634	Ga0213873_10056611	3300021358	Bacteria	1051
635	Ga0213873_10124566	3300021358	Bacteria	759
636	Ga0213872_10012424	3300021361	Bacteria	4006
637	Ga0213872_10194287	3300021361	Bacteria	872
638	Ga0213872_10437959	3300021361	Bacteria	526
639	Ga0213874_10100746	3300021377	Bacteria	960
640	Ga0213874_10105554	3300021377	Bacteria	942
641	Ga0213876_10002341	3300021384	Bacteria	11172
642	Ga0213876_10064326	3300021384	Bacteria	1936
643	Ga0213876_10711195	3300021384	Bacteria	534
644	Ga0213875_10000567	3300021388	Bacteria	30137
645	Ga0213871_10024609	3300021441	Bacteria	1526
646	Ga0224572_1015101	3300024225	Bacteria	1477
647	Ga0209566_100577	3300025225	Bacteria	23729
648	Ga0209674_102946	3300025226	Bacteria	3339
649	Ga0209147_101727	3300025229	Bacteria	7054
650	Ga0207425_1014365	3300025245	Bacteria	1800
651	Ga0209026_1003948	3300025250	Bacteria	4636
652	Ga0209129_1000376	3300025258	Bacteria	36225
653	Ga0209233_1082141	3300025261	Bacteria	570
654	Ga0209565_1071048	3300025263	Bacteria	587
655	Ga0209673_1000013	3300025273	Bacteria	571633
656	Ga0209673_1000296	3300025273	Bacteria	92350
657	Ga0209673_1001781	3300025273	Bacteria	17854
658	Ga0209673_1029369	3300025273	Bacteria	1752
659	Ga0209675_1000430	3300025291	Bacteria	33634
660	Ga0209675_1015279	3300025291	Bacteria	2291
661	Ga0209675_1083105	3300025291	Bacteria	590
662	Ga0209676_1019122	3300025292	Bacteria	2366
663	Ga0209676_1040727	3300025292	Bacteria	1306
664	Ga0209025_1000008	3300025294	Bacteria	1130876
665	Ga0209025_1000166	3300025294	Bacteria	164692
666	Ga0209564_1000041	3300025295	Bacteria	405199
667	Ga0209564_1000584	3300025295	Bacteria	57729
668	Ga0209564_1000920	3300025295	Bacteria	38309
669	Ga0209758_1000070	3300025297	Bacteria	284093
670	Ga0209758_1000218	3300025297	Bacteria	124300
671	Ga0209758_1019612	3300025297	Bacteria	3251
672	Ga0209758_1046771	3300025297	Bacteria	1556
673	Ga0209256_1000062	3300025299	Bacteria	253433
674	Ga0209256_1000073	3300025299	Bacteria	237553
675	Ga0209256_1000588	3300025299	Bacteria	50690
676	Ga0209256_1000701	3300025299	Bacteria	44561
677	Ga0209256_1001224	3300025299	Bacteria	28617
678	Ga0209256_1026063	3300025299	Bacteria	1691
679	Ga0207426_1000039	3300025302	Bacteria	439937
680	Ga0207426_1062497	3300025302	Bacteria	1066
681	Ga0209051_1002479	3300025303	Bacteria	13179
682	Ga0209257_1032296	3300025304	Bacteria	1662
683	Ga0209257_1049756	3300025304	Bacteria	1191
684	Ga0207697_10059423	3300025315	Bacteria	1589
685	Ga0207697_10187631	3300025315	Bacteria	907
686	Ga0207697_10200463	3300025315	Bacteria	878
687	Ga0207656_10159050	3300025321	Bacteria	1074
688	Ga0207653_10000615	3300025885	Bacteria	12418
689	Ga0207692_10001427	3300025898	Bacteria	8940
690	Ga0207692_10310609	3300025898	Bacteria	962
691	Ga0207642_10066517	3300025899	Bacteria	1698
692	Ga0207710_10128973	3300025900	Bacteria	1213
693	Ga0207710_10474204	3300025900	Bacteria	648
694	Ga0207710_10531815	3300025900	Bacteria	611
695	Ga0207688_10025252	3300025901	Bacteria	3262
696	Ga0207688_10233509	3300025901	Bacteria	1111
697	Ga0207688_10351845	3300025901	Bacteria	908
698	Ga0207688_10630058	3300025901	Bacteria	677
699	Ga0207680_10002785	3300025903	Bacteria	8178
700	Ga0207680_10664274	3300025903	Bacteria	746
701	Ga0207647_10006396	3300025904	Bacteria	8566
702	Ga0207647_10082426	3300025904	Bacteria	1927
703	Ga0207647_10091546	3300025904	Bacteria	1813
704	Ga0207647_10123342	3300025904	Bacteria	1526
705	Ga0207647_10141757	3300025904	Bacteria	1409
706	Ga0207647_10436762	3300025904	Bacteria	735
707	Ga0207685_10006652	3300025905	Bacteria	3164
708	Ga0207699_10001072	3300025906	Bacteria	12936
709	Ga0207699_10936902	3300025906	Bacteria	639
710	Ga0207645_10106586	3300025907	Bacteria	1812
711	Ga0207645_10594611	3300025907	Bacteria	751
712	Ga0207643_10104579	3300025908	Bacteria	1663
713	Ga0207643_10250487	3300025908	Bacteria	1091
714	Ga0207705_10016043	3300025909	Bacteria	5377
715	Ga0207705_10370599	3300025909	Bacteria	1105
716	Ga0207705_10485394	3300025909	Bacteria	959
717	Ga0207705_10776272	3300025909	Bacteria	744
718	Ga0207684_10354482	3300025910	Bacteria	1263
719	Ga0207684_11570595	3300025910	Bacteria	534
720	Ga0207707_10000002	3300025912	Bacteria	1142054
721	Ga0207707_10046627	3300025912	Bacteria	3775
722	Ga0207707_10200232	3300025912	Bacteria	1741
723	Ga0207707_10721712	3300025912	Bacteria	835
724	Ga0207707_11431328	3300025912	Bacteria	550
725	Ga0207707_11582169	3300025912	Bacteria	517
726	Ga0207695_10127664	3300025913	Bacteria	2504
727	Ga0207695_10653160	3300025913	Bacteria	933
728	Ga0207695_10847778	3300025913	Bacteria	794
729	Ga0207695_11152951	3300025913	Bacteria	655
730	Ga0207671_10003373	3300025914	Bacteria	15993
731	Ga0207671_10021630	3300025914	Bacteria	4876
732	Ga0207671_10074286	3300025914	Bacteria	2541
733	Ga0207671_10133000	3300025914	Bacteria	1911
734	Ga0207671_10310246	3300025914	Bacteria	1247
735	Ga0207671_11026713	3300025914	Bacteria	649
736	Ga0207693_10097994	3300025915	Bacteria	2299
737	Ga0207663_10019959	3300025916	Bacteria	3788
738	Ga0207660_10001673	3300025917	Bacteria	14857
739	Ga0207660_10007389	3300025917	Bacteria	7108
740	Ga0207660_10800564	3300025917	Bacteria	769
741	Ga0207660_11358848	3300025917	Bacteria	576
742	Ga0207662_10117496	3300025918	Bacteria	1664
743	Ga0207662_10617958	3300025918	Bacteria	755
744	Ga0207657_10000247	3300025919	Bacteria	57443
745	Ga0207657_10007738	3300025919	Bacteria	10972
746	Ga0207657_10023603	3300025919	Bacteria	5722
747	Ga0207657_10150277	3300025919	Bacteria	1898
748	Ga0207657_10159128	3300025919	Bacteria	1835
749	Ga0207657_10161985	3300025919	Bacteria	1816
750	Ga0207657_10282141	3300025919	Bacteria	1318
751	Ga0207657_10536839	3300025919	Bacteria	915
752	Ga0207649_10215555	3300025920	Bacteria	1364
753	Ga0207649_10283839	3300025920	Bacteria	1205
754	Ga0207649_10392450	3300025920	Bacteria	1037
755	Ga0207649_10904327	3300025920	Bacteria	692
756	Ga0207652_10000464	3300025921	Bacteria	41551
757	Ga0207652_10349359	3300025921	Bacteria	1335
758	Ga0207652_11181254	3300025921	Bacteria	667
759	Ga0207652_11402202	3300025921	Bacteria	602
760	Ga0207646_10400030	3300025922	Bacteria	1240
761	Ga0207681_10322870	3300025923	Bacteria	1228
762	Ga0207681_10347366	3300025923	Bacteria	1187
763	Ga0207681_10792114	3300025923	Bacteria	791
764	Ga0207694_10033752	3300025924	Bacteria	3921
765	Ga0207694_10071955	3300025924	Bacteria	2703
766	Ga0207694_10092795	3300025924	Bacteria	2384
767	Ga0207694_10174147	3300025924	Bacteria	1743
768	Ga0207694_10401517	3300025924	Bacteria	1140
769	Ga0207650_11514880	3300025925	Bacteria	570
770	Ga0207659_10125711	3300025926	Bacteria	1971
771	Ga0207659_10363493	3300025926	Bacteria	1203
772	Ga0207659_10435641	3300025926	Bacteria	1102
773	Ga0207659_10925903	3300025926	Bacteria	749
774	Ga0207687_10040137	3300025927	Bacteria	3207
775	Ga0207687_10663806	3300025927	Bacteria	883
776	Ga0207687_10924736	3300025927	Bacteria	747
777	Ga0207687_11349123	3300025927	Bacteria	613
778	Ga0207700_10005335	3300025928	Bacteria	7669
779	Ga0207700_10012968	3300025928	Bacteria	5400
780	Ga0207700_11055231	3300025928	Bacteria	727
781	Ga0207700_11491814	3300025928	Bacteria	600
782	Ga0207700_11519844	3300025928	Bacteria	594
783	Ga0207700_11805551	3300025928	Bacteria	537
784	Ga0207664_10082405	3300025929	Bacteria	2620
785	Ga0207664_10405489	3300025929	Bacteria	1213
786	Ga0207644_10310872	3300025931	Bacteria	1272
787	Ga0207644_11082551	3300025931	Bacteria	673
788	Ga0207690_10000141	3300025932	Bacteria	57572
789	Ga0207690_10233849	3300025932	Bacteria	1412
790	Ga0207690_10477520	3300025932	Bacteria	1006
791	Ga0207690_10764160	3300025932	Bacteria	797
792	Ga0207690_11557171	3300025932	Bacteria	552
793	Ga0207706_10055929	3300025933	Bacteria	3479
794	Ga0207706_10110810	3300025933	Bacteria	2414
795	Ga0207706_10225981	3300025933	Bacteria	1638
796	Ga0207706_10607093	3300025933	Bacteria	939
797	Ga0207706_10609851	3300025933	Bacteria	937
798	Ga0207706_10625896	3300025933	Bacteria	923
799	Ga0207706_11176968	3300025933	Bacteria	638
800	Ga0207686_10104957	3300025934	Bacteria	1894
801	Ga0207686_10149336	3300025934	Bacteria	1625
802	Ga0207686_10447221	3300025934	Bacteria	993
803	Ga0207686_10494893	3300025934	Bacteria	948
804	Ga0207709_10264591	3300025935	Bacteria	1263
805	Ga0207709_10389535	3300025935	Bacteria	1062
806	Ga0207709_11821174	3300025935	Bacteria	506
807	Ga0207670_10075800	3300025936	Bacteria	2339
808	Ga0207669_10009478	3300025937	Bacteria	4641
809	Ga0207669_10012958	3300025937	Bacteria	4122
810	Ga0207669_10043909	3300025937	Bacteria	2621
811	Ga0207669_10430982	3300025937	Bacteria	1040
812	Ga0207669_11109911	3300025937	Bacteria	668
813	Ga0207704_10023176	3300025938	Bacteria	3341
814	Ga0207704_11419488	3300025938	Bacteria	595
815	Ga0207704_11949102	3300025938	Bacteria	505
816	Ga0207665_10006497	3300025939	Bacteria	7750
817	Ga0207665_10030575	3300025939	Bacteria	3560
818	Ga0207665_10205799	3300025939	Bacteria	1435
819	Ga0207665_10959331	3300025939	Bacteria	679
820	Ga0207691_10046012	3300025940	Bacteria	4012
821	Ga0207691_10079254	3300025940	Bacteria	2956
822	Ga0207711_10001341	3300025941	Bacteria	23240
823	Ga0207711_10018850	3300025941	Bacteria	5736
824	Ga0207711_10148460	3300025941	Bacteria	2114
825	Ga0207711_10403985	3300025941	Bacteria	1269
826	Ga0207711_10938619	3300025941	Bacteria	804
827	Ga0207711_11769962	3300025941	Bacteria	561
828	Ga0207689_10259801	3300025942	Bacteria	1437
829	Ga0207689_10269238	3300025942	Bacteria	1410
830	Ga0207689_10402632	3300025942	Bacteria	1141
831	Ga0207689_11674923	3300025942	Bacteria	528
832	Ga0207661_10003202	3300025944	Bacteria	11342
833	Ga0207679_10011227	3300025945	Bacteria	5789
834	Ga0207679_10496903	3300025945	Bacteria	1088
835	Ga0207667_10010886	3300025949	Bacteria	10606
836	Ga0207667_10011464	3300025949	Bacteria	10301
837	Ga0207667_10109658	3300025949	Bacteria	2847
838	Ga0207667_10219422	3300025949	Bacteria	1948
839	Ga0207667_10263151	3300025949	Bacteria	1763
840	Ga0207667_10787852	3300025949	Bacteria	948
841	Ga0207667_11619517	3300025949	Bacteria	616
842	Ga0207667_11787937	3300025949	Bacteria	579
843	Ga0207651_10381112	3300025960	Bacteria	1195
844	Ga0207712_10038467	3300025961	Bacteria	3272
845	Ga0207712_10131807	3300025961	Bacteria	1906
846	Ga0207712_10234096	3300025961	Bacteria	1476
847	Ga0207712_10250557	3300025961	Bacteria	1431
848	Ga0207712_10906187	3300025961	Bacteria	779
849	Ga0207712_10990967	3300025961	Bacteria	745
850	Ga0207712_11319443	3300025961	Bacteria	645
851	Ga0207712_11809031	3300025961	Bacteria	547
852	Ga0207668_10589204	3300025972	Bacteria	967
853	Ga0207668_10800713	3300025972	Bacteria	834
854	Ga0207668_11954878	3300025972	Bacteria	529
855	Ga0207640_10100139	3300025981	Bacteria	2030
856	Ga0207640_10257223	3300025981	Bacteria	1358
857	Ga0207658_10121941	3300025986	Bacteria	2080
858	Ga0207658_10872723	3300025986	Bacteria	818
859	Ga0207658_11310676	3300025986	Bacteria	662
860	Ga0207677_10051163	3300026023	Bacteria	2799
861	Ga0207677_10258355	3300026023	Bacteria	1418
862	Ga0207677_11050462	3300026023	Bacteria	740
863	Ga0207703_10027373	3300026035	Bacteria	4490
864	Ga0207703_10479058	3300026035	Bacteria	1166
865	Ga0207703_11353120	3300026035	Bacteria	685
866	Ga0207639_10149678	3300026041	Bacteria	1954
867	Ga0207639_10161668	3300026041	Bacteria	1888
868	Ga0207639_10164711	3300026041	Bacteria	1872
869	Ga0207639_10813625	3300026041	Bacteria	871
870	Ga0207639_11146895	3300026041	Bacteria	729
871	Ga0207639_11252024	3300026041	Bacteria	696
872	Ga0207678_10000298	3300026067	Bacteria	44861
873	Ga0207678_10006547	3300026067	Bacteria	10327
874	Ga0207678_10026749	3300026067	Bacteria	5032
875	Ga0207678_10133783	3300026067	Bacteria	2115
876	Ga0207678_10141472	3300026067	Bacteria	2053
877	Ga0207678_10469206	3300026067	Bacteria	1095
878	Ga0207678_10682491	3300026067	Bacteria	903
879	Ga0207678_10799390	3300026067	Bacteria	833
880	Ga0207678_11908516	3300026067	Bacteria	518
881	Ga0207708_10000488	3300026075	Bacteria	30463
882	Ga0207708_11320784	3300026075	Bacteria	632
883	Ga0207702_10000224	3300026078	Bacteria	66083
884	Ga0207702_10162086	3300026078	Bacteria	2043
885	Ga0207702_10186602	3300026078	Bacteria	1913
886	Ga0207702_10874852	3300026078	Bacteria	890
887	Ga0207702_10941793	3300026078	Bacteria	856
888	Ga0207702_11316602	3300026078	Bacteria	716
889	Ga0207702_11926285	3300026078	Bacteria	582
890	Ga0207702_12081629	3300026078	Bacteria	557
891	Ga0207702_12097120	3300026078	Bacteria	555
892	Ga0207641_10020766	3300026088	Bacteria	5398
893	Ga0207641_10190145	3300026088	Bacteria	1886
894	Ga0207641_10493373	3300026088	Bacteria	1188
895	Ga0207648_10001639	3300026089	Bacteria	24530
896	Ga0207648_10249087	3300026089	Bacteria	1584
897	Ga0207648_10365217	3300026089	Bacteria	1303
898	Ga0207648_10574120	3300026089	Bacteria	1038
899	Ga0207676_10011695	3300026095	Bacteria	6278
900	Ga0207676_10032138	3300026095	Bacteria	3952
901	Ga0207676_10073216	3300026095	Bacteria	2756
902	Ga0207676_10497401	3300026095	Bacteria	1157
903	Ga0207674_10003790	3300026116	Bacteria	18446
904	Ga0207674_10004426	3300026116	Bacteria	16895
905	Ga0207674_10022610	3300026116	Bacteria	6748
906	Ga0207674_10058334	3300026116	Bacteria	3911
907	Ga0207674_10649625	3300026116	Bacteria	1019
908	Ga0207674_11170017	3300026116	Bacteria	738
909	Ga0207675_100015329	3300026118	Bacteria	7152
910	Ga0207675_100094558	3300026118	Bacteria	2812
911	Ga0207675_100313940	3300026118	Bacteria	1529
912	Ga0207675_101821253	3300026118	Bacteria	628
913	Ga0207683_10055636	3300026121	Bacteria	3469
914	Ga0207683_10061835	3300026121	Bacteria	3296
915	Ga0207683_10242801	3300026121	Bacteria	1643
916	Ga0207683_10320560	3300026121	Bacteria	1420
917	Ga0207683_10497417	3300026121	Bacteria	1126
918	Ga0207683_10936226	3300026121	Bacteria	804
919	Ga0207698_10010568	3300026142	Bacteria	5942
920	Ga0207698_10379234	3300026142	Bacteria	1345
921	Ga0207698_10476157	3300026142	Bacteria	1210
922	Ga0207698_11983246	3300026142	Bacteria	596
923	Ga0209371_1002340	3300027312	Bacteria	10777
924	Ga0209589_1000018	3300027357	Bacteria	192614
925	Ga0209489_100026	3300027361	Bacteria	192614
926	Ga0209700_100035	3300027363	Bacteria	192614
927	Ga0209588_1029951	3300027671	Bacteria	1737
928	Ga0209813_10008952	3300027866	Bacteria	2545
929	Ga0209813_10024811	3300027866	Bacteria	1718
930	Ga0209813_10084030	3300027866	Bacteria	1058
931	Ga0209813_10262958	3300027866	Bacteria	659
932	Ga0268266_10000520	3300028379	Bacteria	54335
933	Ga0268266_10000677	3300028379	Bacteria	46024
934	Ga0268266_10013772	3300028379	Bacteria	6963
935	Ga0268266_10020193	3300028379	Bacteria	5678
936	Ga0268266_10020817	3300028379	Bacteria	5593
937	Ga0268266_10036179	3300028379	Bacteria	4201
938	Ga0268266_10059646	3300028379	Bacteria	3287
939	Ga0268266_10106918	3300028379	Bacteria	2474
940	Ga0268266_10125200	3300028379	Bacteria	2292
941	Ga0268266_10284891	3300028379	Bacteria	1537
942	Ga0268266_10418524	3300028379	Bacteria	1269
943	Ga0268266_10450168	3300028379	Bacteria	1224
944	Ga0268266_10790804	3300028379	Bacteria	916
945	Ga0268266_10903935	3300028379	Bacteria	854
946	Ga0268266_11003957	3300028379	Bacteria	808
947	Ga0268265_10002012	3300028380	Bacteria	16001
948	Ga0268265_10007219	3300028380	Bacteria	7508
949	Ga0268265_10082128	3300028380	Bacteria	2547
950	Ga0268265_11505718	3300028380	Bacteria	676
951	Ga0268264_10016842	3300028381	Bacteria	5983
952	Ga0268264_10078255	3300028381	Bacteria	2819
953	Ga0268264_10229027	3300028381	Bacteria	1715
954	Ga0268264_10879382	3300028381	Bacteria	898
955	Ga0268264_11556884	3300028381	Bacteria	672
956	Ga0268264_11672764	3300028381	Bacteria	647
957	Ga0268264_11795418	3300028381	Bacteria	623
958	Ga0265334_10322324	3300028573	Bacteria	529
959	Ga0265318_10018533	3300028577	Bacteria	2838
960	Ga0307515_10163787	3300028794	Bacteria	2252
961	Ga0307515_10167621	3300028794	Bacteria	2206
962	Ga0307515_10745247	3300028794	Bacteria	598
963	Ga0265338_11072167	3300028800	Bacteria	543
964	Ga0268256_1005674	3300030500	Bacteria	4834
965	Ga0307511_10000816	3300030521	Bacteria	33250
966	Ga0307512_10130021	3300030522	Bacteria	1583
967	Ga0307512_10246785	3300030522	Bacteria	895
968	Ga0265760_10005306	3300031090	Bacteria	3695
969	Ga0265760_10007611	3300031090	Bacteria	3093
970	Ga0265760_10103215	3300031090	Bacteria	903
971	Ga0265330_10035795	3300031235	Bacteria	2214
972	Ga0265330_10139317	3300031235	Bacteria	1031
973	Ga0265332_10002054	3300031238	Bacteria	10530
974	Ga0265332_10015628	3300031238	Bacteria	3351
975	Ga0265328_10110014	3300031239	Bacteria	1024
976	Ga0265320_10014980	3300031240	Bacteria	4394
977	Ga0265325_10009829	3300031241	Bacteria	5568
978	Ga0265329_10046852	3300031242	Bacteria	1380
979	Ga0265329_10093141	3300031242	Bacteria	957
980	Ga0265340_10014600	3300031247	Bacteria	4097
981	Ga0265340_10065023	3300031247	Bacteria	1737
982	Ga0265340_10228928	3300031247	Bacteria	831
983	Ga0265339_10142334	3300031249	Bacteria	1219
984	Ga0265331_10012416	3300031250	Bacteria	4613
985	Ga0265331_10210023	3300031250	Bacteria	876
986	Ga0265331_10263860	3300031250	Bacteria	772
987	Ga0265316_10032983	3300031344	Bacteria	4221
988	Ga0265316_10078142	3300031344	Bacteria	2541
989	Ga0307513_10103757	3300031456	Bacteria	2859
990	Ga0307513_10234001	3300031456	Bacteria	1648
991	Ga0307513_10301496	3300031456	Bacteria	1369
992	Ga0307513_10973470	3300031456	Bacteria	557
993	Ga0307509_10137346	3300031507	Bacteria	2387
994	Ga0307408_100418166	3300031548	Bacteria	1155
995	Ga0265313_10007132	3300031595	Bacteria	7698
996	Ga0265313_10246998	3300031595	Bacteria	729
997	Ga0307508_10000009	3300031616	Bacteria	256966
998	Ga0307508_10233971	3300031616	Bacteria	1435
999	Ga0307508_10820838	3300031616	Bacteria	549
1000	Ga0307508_10911460	3300031616	Bacteria	506
1001	Ga0265314_10080838	3300031711	Bacteria	2144
1002	Ga0265314_10112805	3300031711	Bacteria	1725
1003	Ga0265314_10414393	3300031711	Bacteria	725
1004	Ga0265342_10000011	3300031712	Bacteria	208435
1005	Ga0265342_10006364	3300031712	Bacteria	8804
1006	Ga0265342_10286633	3300031712	Bacteria	870
1007	Ga0307516_10003467	3300031730	Bacteria	20213
1008	Ga0307516_10345887	3300031730	Bacteria	1153
1009	Ga0307516_10968496	3300031730	Bacteria	521
1010	Ga0307405_11934477	3300031731	Bacteria	527
1011	Ga0307410_10287561	3300031852	Bacteria	1293
1012	Ga0307410_10316307	3300031852	Bacteria	1237
1013	Ga0307406_10020464	3300031901	Bacteria	3897
1014	Ga0307406_10080803	3300031901	Bacteria	2160
1015	Ga0307406_10632250	3300031901	Bacteria	886
1016	Ga0307406_11053062	3300031901	Bacteria	700
1017	Ga0307407_10106184	3300031903	Bacteria	1754
1018	Ga0307407_10668409	3300031903	Bacteria	780
1019	Ga0307407_10803439	3300031903	Bacteria	716
1020	Ga0307412_10672187	3300031911	Bacteria	886
1021	Ga0307409_100428380	3300031995	Bacteria	1271
1022	Ga0307409_100613927	3300031995	Bacteria	1076
1023	Ga0307409_100960498	3300031995	Bacteria	871
1024	Ga0307409_101220956	3300031995	Bacteria	776
1025	Ga0307409_102395252	3300031995	Bacteria	557
1026	Ga0307416_100303683	3300032002	Bacteria	1588
1027	Ga0307416_101042499	3300032002	Bacteria	922
1028	Ga0307416_101123996	3300032002	Bacteria	891
1029	Ga0307414_10233552	3300032004	Bacteria	1518
1030	Ga0307414_10519467	3300032004	Bacteria	1056
1031	Ga0307414_10667222	3300032004	Bacteria	938
1032	Ga0307414_11605707	3300032004	Bacteria	606
1033	Ga0307411_10517328	3300032005	Bacteria	1012
1034	Ga0307411_10690567	3300032005	Bacteria	888
1035	Ga0307415_100501644	3300032126	Bacteria	1061
1036	Ga0307415_100503987	3300032126	Bacteria	1059
1037	Ga0307415_100962667	3300032126	Bacteria	791
1038	Ga0307415_101519947	3300032126	Bacteria	641
1039	Ga0307510_10375415	3300033180	Bacteria	868
1040	Ga0373958_0019203	3300034819	Bacteria	1247
1041	Ga0373959_0094459	3300034820	Bacteria	705
1042	Ga0373934_0027888	3300035086	Bacteria	2197
1043	Ga0373934_0411615	3300035086	Bacteria	565
1044	Ga0373940_0174404	3300035088	Bacteria	696
1045	Ga0373944_0149511	3300035089	Bacteria	822
1046	Ga0373923_0095137	3300035111	Bacteria	1308
1047	Ga0373923_0202589	3300035111	Bacteria	918
1048	Ga0373936_0043729	3300035113	Bacteria	1801
1049	Ga0373936_0240320	3300035113	Bacteria	807
1050	Ga0373939_0053899	3300035114	Bacteria	1258
1051	Ga0373939_0084650	3300035114	Bacteria	1060
1052	Ga0373939_0169284	3300035114	Bacteria	808
1053	Ga0373945_0360581	3300035116	Bacteria	632
1054	Ga0373945_0437163	3300035116	Bacteria	577
1055	Ga0373953_0310148	3300035117	Bacteria	689
1056	Ga0373954_0005607	3300035118	Bacteria	5440
1057	Ga0373954_0602464	3300035118	Bacteria	545
1058	Ga0373956_0034957	3300035119	Bacteria	2215
1059	Ga0373956_0070025	3300035119	Bacteria	1600
1060	Ga0373957_0016236	3300035120	Bacteria	2576
1061	Ga0373943_0532383	3300035170	Bacteria	688
1062	Ga0373946_0021340	3300035171	Bacteria	2511
1063	Ga0373946_0169206	3300035171	Bacteria	1030
1064	Ga0373955_0019240	3300035172	Bacteria	3409
1065	Ga0373955_0024589	3300035172	Bacteria	3082
1066	Ga0373955_0210696	3300035172	Bacteria	1159
1067	Ga0373955_0742901	3300035172	Bacteria	603
1068	Ga0373942_0055202	3300035207	Bacteria	1124
1069	Ga0373942_0058024	3300035207	Bacteria	1103
1070	Ga0373961_0164103	3300035241	Bacteria	765
1071	Ga0373924_0186574	3300035410	Bacteria	913
1072	Ga0373924_0221795	3300035410	Bacteria	835
1073	Ga0373931_0075593	3300035691	Bacteria	1848
1074	Ga0373931_0433033	3300035691	Bacteria	838
1075	Ga0373931_0640897	3300035691	Bacteria	697
1076	Ga0373931_0889944	3300035691	Bacteria	598
1077	Ga0373927_0036186	3300035695	Bacteria	3211
1078	Ga0373927_0207693	3300035695	Bacteria	1286
1079	Ga0373933_0060552	3300035724	Bacteria	2283
1080	Ga0373933_0101113	3300035724	Bacteria	1789
1081	Ga0373933_1100631	3300035724	Bacteria	523
1082	Ga0373947_0087451	3300035725	Bacteria	1938
1083	Ga0373947_1229114	3300035725	Bacteria	510
1084	Ga0373937_0002711	3300036401	Bacteria	14779
1085	Ga0373937_0003961	3300036401	Bacteria	12519
1086	Ga0373937_0303893	3300036401	Bacteria	1508
1087	Ga0373925_0002572	3300037068	Bacteria	14446
1088	Ga0373925_0158257	3300037068	Bacteria	1783
1089	Ga0373925_0765943	3300037068	Bacteria	796
1090	Ga0395899_0000003	3300037312	Bacteria	1232684
1091	Ga0395899_0192180	3300037312	Bacteria	1428
1092	Ga0395899_0525956	3300037312	Bacteria	764
1093	Ga0395900_0001131	3300037418	Bacteria	33729
1094	Ga0395900_0058348	3300037418	Bacteria	3973
1095	Ga0395900_0106735	3300037418	Bacteria	2877
1096	Ga0395900_0632823	3300037418	Bacteria	1008
1097	Ga0395900_0945127	3300037418	Bacteria	784
1098	Ga0395900_1598931	3300037418	Bacteria	563
1099	Ga0395898_0038058	3300037466	Bacteria	4770
1100	Ga0395898_0060672	3300037466	Bacteria	3675
1101	Ga0395898_0159274	3300037466	Bacteria	2159
1102	Ga0395898_0171163	3300037466	Bacteria	2076
1103	Ga0395898_0226960	3300037466	Bacteria	1781
1104	Ga0395898_0308553	3300037466	Bacteria	1509
1105	Ga0395905_0125392	3300037471	Bacteria	2414
1106	Ga0395905_0138794	3300037471	Bacteria	2287
1107	Ga0395905_0267219	3300037471	Bacteria	1596
1108	Ga0395905_0331583	3300037471	Bacteria	1412
1109	Ga0395905_0775181	3300037471	Bacteria	862
1110	Ga0395905_1419826	3300037471	Bacteria	598
1111	Ga0436364_0172671	3300037853	Bacteria	1654
1112	Ga0436364_0500990	3300037853	Bacteria	2436
1113	Ga0436364_0665489	3300037853	Bacteria	3308
1114	Ga0436364_0746920	3300037853	Bacteria	575
1115	Ga0436364_0785541	3300037853	Bacteria	887
1116	Ga0436364_1027372	3300037853	Bacteria	623
1117	Ga0436364_1321283	3300037853	Bacteria	19477
1118	Ga0436364_1362436	3300037853	Bacteria	5464
1119	Ga0436364_1463824	3300037853	Bacteria	1200
1120	Ga0395901_0000044	3300038443	Bacteria	197088
1121	Ga0395901_0021148	3300038443	Bacteria	6665
1122	Ga0395901_0240733	3300038443	Bacteria	1887
1123	Ga0395901_1038707	3300038443	Bacteria	793
1124	Ga0395901_1230716	3300038443	Bacteria	713
1125	Ga0395901_1798501	3300038443	Bacteria	562
1126	Ga0436365_0521938	3300039437	Bacteria	945
1127	Ga0436365_1357977	3300039437	Bacteria	15576
1128	Ga0436365_1608922	3300039437	Bacteria	2094
1129	Ga0436365_1670112	3300039437	Bacteria	718
1130	Ga0436365_1777318	3300039437	Bacteria	2179
1131	Ga0436365_1860554	3300039437	Bacteria	1024
1132	Ga0436365_1887675	3300039437	Bacteria	2165
1133	Ga0436360_0111587	3300039438	Bacteria	869
1134	Ga0436360_0405330	3300039438	Bacteria	584
1135	Ga0436360_1264813	3300039438	Bacteria	745
1136	Ga0436361_0179462	3300039447	Bacteria	1175
1137	Ga0436361_0197281	3300039447	Bacteria	1064
1138	Ga0436361_0431568	3300039447	Bacteria	617
1139	Ga0436361_0468928	3300039447	Bacteria	2376
1140	Ga0436361_0588967	3300039447	Bacteria	653
1141	Ga0436361_0925713	3300039447	Bacteria	2171
1142	Ga0436361_0988609	3300039447	Bacteria	1283
1143	Ga0436361_1217648	3300039447	Bacteria	654
1144	Ga0436363_0332812	3300039450	Bacteria	1100
1145	Ga0436363_0499259	3300039450	Bacteria	1335
1146	Ga0436363_0607942	3300039450	Bacteria	757
1147	Ga0436363_0995396	3300039450	Bacteria	720
1148	Ga0436363_1054112	3300039450	Bacteria	1170
1149	Ga0436363_1058258	3300039450	Bacteria	595
1150	Ga0436363_1167218	3300039450	Bacteria	818
1151	Ga0436363_1406750	3300039450	Bacteria	1194
1152	Ga0436362_0126311	3300039453	Bacteria	1155
1153	Ga0436362_0330482	3300039453	Bacteria	4842
1154	Ga0436362_0591086	3300039453	Bacteria	1154
1155	Ga0436362_0652568	3300039453	Bacteria	691
1156	Ga0439436_0089484	3300041404	Bacteria	857
1157	Ga0439439_0073493	3300041406	Bacteria	918
1158	Ga0439465_0083806	3300041413	Bacteria	1084
1159	Ga0451787_553918	3300041441	Bacteria	1186
1160	Ga0451791_1281077	3300041451	Bacteria	755
1161	Ga0451791_1400659	3300041451	Bacteria	594
1162	Ga0451795_0342143	3300041456	Bacteria	885
1163	Ga0451795_0535224	3300041456	Bacteria	638
1164	Ga0451798_0253149	3300041458	Bacteria	543
1165	Ga0451800_1000476	3300041459	Bacteria	566
1166	Ga0451802_1695533	3300041460	Bacteria	1085
1167	Ga0451835_1198724	3300041492	Bacteria	635
1168	Ga0451837_1699537	3300041494	Bacteria	1670
1169	Ga0451845_0994929	3300041501	Bacteria	633
1170	Ga0451849_0771493	3300041505	Bacteria	779
1171	Ga0451851_0655650	3300041507	Bacteria	1105
1172	Ga0451843_0704410	3300041509	Bacteria	615
1173	Ga0451855_1946526	3300041511	Bacteria	558
1174	Ga0451853_0006012	3300041512	Bacteria	1040
1175	Ga0451853_0632563	3300041512	Bacteria	662
1176	Ga0439445_0026733	3300042004	Bacteria	1479
1177	Ga0439445_0044602	3300042004	Bacteria	1185
1178	Ga0439445_0078942	3300042004	Bacteria	918
1179	Ga0439448_0003740	3300042005	Bacteria	4240
1180	Ga0439448_0108756	3300042005	Bacteria	946
1181	Ga0439448_0227410	3300042005	Bacteria	656
1182	Ga0439432_203426	3300042006	Bacteria	574
1183	Ga0439449_0180058	3300042007	Bacteria	790
1184	Ga0439450_015806	3300042008	Bacteria	1551
1185	Ga0439455_0048042	3300042012	Bacteria	1109
1186	Ga0439462_0013455	3300042015	Bacteria	2097
1187	Ga0450920_032537	3300042122	Bacteria	1030
1188	Ga0450923_135368	3300042125	Bacteria	589
1189	Ga0450923_170193	3300042125	Bacteria	534
1190	Ga0450896_045325	3300042133	Bacteria	692
1191	Ga0439458_0054221	3300042157	Bacteria	993
1192	Ga0439459_0021650	3300042438	Bacteria	1237
1193	Ga0450918_074193	3300042531	Bacteria	642
1194	Ga0466972_0006944	3300044658	Bacteria	5675
1195	Ga0466972_0214345	3300044658	Bacteria	901
1196	Ga0466966_0079532	3300044684	Bacteria	2043
1197	Ga0466966_0096854	3300044684	Bacteria	1827
1198	Ga0466966_0153717	3300044684	Bacteria	1402
1199	Ga0466961_0386724	3300044693	Bacteria	850
1200	Ga0466963_0008115	3300044694	Bacteria	6287
1201	Ga0466963_0028393	3300044694	Bacteria	3591
1202	Ga0466963_0547262	3300044694	Bacteria	817
1203	Ga0466964_0000042	3300044706	Bacteria	26502
1204	Ga0466964_0003960	3300044706	Bacteria	5445
1205	Ga0466964_0062835	3300044706	Bacteria	1549
1206	Ga0466964_0216812	3300044706	Bacteria	927
1207	Ga0466971_0018497	3300044719	Bacteria	3086
1208	Ga0466971_0123837	3300044719	Bacteria	1198
1209	Ga0466971_0148221	3300044719	Bacteria	1094
1210	Ga0466968_0000823	3300044735	Bacteria	10800
1211	Ga0466968_0286992	3300044735	Bacteria	789
1212	Ga0466968_0491987	3300044735	Bacteria	610
1213	Ga0466970_0000967	3300044765	Bacteria	13827
1214	Ga0466970_0035952	3300044765	Bacteria	2623
1215	Ga0466957_0402039	3300044842	Bacteria	937
1216	Ga0466957_0409587	3300044842	Bacteria	928
1217	Ga0466957_0614825	3300044842	Bacteria	762
1218	Ga0466957_0732307	3300044842	Bacteria	699
1219	Ga0466957_0800398	3300044842	Bacteria	670
1220	Ga0466957_0933025	3300044842	Bacteria	621
1221	Ga0466957_0991421	3300044842	Bacteria	603
1222	Ga0466960_0657677	3300044901	Bacteria	626
1223	Ga0466959_0137998	3300045049	Bacteria	1725
1224	Ga0466959_0472102	3300045049	Bacteria	849
1225	Ga0451576_0618156	3300045051	Bacteria	1139
1226	Ga0466958_0000235	3300045836	Bacteria	21186
1227	Ga0466958_0000250	3300045836	Bacteria	20747
1228	Ga0466958_0030782	3300045836	Bacteria	3189
1229	Ga0466958_0300880	3300045836	Bacteria	1030
1230	Ga0466967_0004712	3300045976	Bacteria	9268
1231	Ga0466967_0196052	3300045976	Bacteria	1911
1232	Ga0466967_0502942	3300045976	Bacteria	1189
1233	Ga0495627_000697	3300046453	Bacteria	25632
1234	Ga0495592_0144530	3300046454	Bacteria	1651
1235	Ga0495603_0167489	3300046455	Bacteria	1273
1236	Ga0495590_0034232	3300046457	Bacteria	1774
1237	Ga0495629_0008183	3300046459	Bacteria	7690
1238	Ga0495629_0023265	3300046459	Bacteria	4416
1239	Ga0495629_0473869	3300046459	Bacteria	846
1240	Ga0495638_0001335	3300046460	Bacteria	22639
1241	Ga0495638_0013964	3300046460	Bacteria	5445
1242	Ga0495638_0209791	3300046460	Bacteria	1095
1243	Ga0495638_0269867	3300046460	Bacteria	929
1244	Ga0495638_0393004	3300046460	Bacteria	721
1245	Ga0495638_0434862	3300046460	Bacteria	673
1246	Ga0495641_0324564	3300046461	Bacteria	695
1247	Ga0495641_0600532	3300046461	Bacteria	503
1248	Ga0495651_0180049	3300046462	Bacteria	1497
1249	Ga0495653_0593403	3300046463	Bacteria	682
1250	Ga0495650_0212378	3300046471	Bacteria	669
1251	Ga0495580_0074635	3300046472	Bacteria	2367
1252	Ga0495580_0468250	3300046472	Bacteria	844
1253	Ga0495582_0223692	3300046473	Bacteria	1077
1254	Ga0495605_0000176	3300046474	Bacteria	80441
1255	Ga0495605_0076697	3300046474	Bacteria	1569
1256	Ga0495605_0240558	3300046474	Bacteria	777
1257	Ga0495639_0095077	3300046475	Bacteria	1402
1258	Ga0495639_0097392	3300046475	Bacteria	1386
1259	Ga0495639_0350873	3300046475	Bacteria	741
1260	Ga0495664_0023203	3300046477	Bacteria	3599
1261	Ga0495664_0026254	3300046477	Bacteria	3393
1262	Ga0495664_0159546	3300046477	Bacteria	1368
1263	Ga0495664_0252801	3300046477	Bacteria	1066
1264	Ga0495584_0000031	3300046491	Bacteria	100128
1265	Ga0495584_0033050	3300046491	Bacteria	2617
1266	Ga0495584_0139397	3300046491	Bacteria	1231
1267	Ga0495584_0158075	3300046491	Bacteria	1152
1268	Ga0495584_0192185	3300046491	Bacteria	1037
1269	Ga0495584_0483568	3300046491	Bacteria	630
1270	Ga0495585_0030548	3300046492	Bacteria	3064
1271	Ga0495585_0072674	3300046492	Bacteria	1873
1272	Ga0495594_0000020	3300046499	Bacteria	80534
1273	Ga0495594_0015757	3300046499	Bacteria	3975
1274	Ga0495594_0148019	3300046499	Bacteria	1333
1275	Ga0495607_0003075	3300046501	Bacteria	12972
1276	Ga0495607_0005290	3300046501	Bacteria	9280
1277	Ga0495583_0004102	3300046506	Bacteria	10683
1278	Ga0495583_0431407	3300046506	Bacteria	517
1279	Ga0495606_0001852	3300046507	Bacteria	26592
1280	Ga0495606_0004509	3300046507	Bacteria	13865
1281	Ga0495606_0071746	3300046507	Bacteria	2179
1282	Ga0495606_0182340	3300046507	Bacteria	1209
1283	Ga0495606_0655524	3300046507	Bacteria	507
1284	Ga0495610_0118577	3300046512	Bacteria	1163
1285	Ga0495616_0019309	3300046513	Bacteria	3720
1286	Ga0495616_0191781	3300046513	Bacteria	903
1287	Ga0495616_0239439	3300046513	Bacteria	783
1288	Ga0495628_0011771	3300046516	Bacteria	7386
1289	Ga0495628_0189798	3300046516	Bacteria	1552
1290	Ga0495628_0424917	3300046516	Bacteria	968
1291	Ga0495631_0009371	3300046518	Bacteria	4892
1292	Ga0495632_0439510	3300046519	Bacteria	567
1293	Ga0495643_0035422	3300046522	Bacteria	2748
1294	Ga0495643_0148307	3300046522	Bacteria	1164
1295	Ga0495644_0067628	3300046523	Bacteria	1342
1296	Ga0495644_0462532	3300046523	Bacteria	506
1297	Ga0495648_0002463	3300046524	Bacteria	17032
1298	Ga0495648_0347765	3300046524	Bacteria	678
1299	Ga0495663_0377500	3300046525	Bacteria	519
1300	Ga0495666_0216336	3300046526	Bacteria	878
1301	Ga0495642_0000226	3300046528	Bacteria	32285
1302	Ga0495642_0176696	3300046528	Bacteria	929
1303	Ga0495642_0386785	3300046528	Bacteria	616
1304	Ga0495652_0030433	3300046529	Bacteria	4736
1305	Ga0495640_0019131	3300046533	Bacteria	5061
1306	Ga0495587_0170704	3300046536	Bacteria	1236
1307	Ga0495598_0131939	3300046537	Bacteria	857
1308	Ga0495598_0309155	3300046537	Bacteria	600
1309	Ga0495609_0001148	3300046538	Bacteria	18247
1310	Ga0495609_0018351	3300046538	Bacteria	3241
1311	Ga0495621_0039355	3300046539	Bacteria	1653
1312	Ga0495597_0069320	3300046542	Bacteria	1522
1313	Ga0495597_0191981	3300046542	Bacteria	821
1314	Ga0495597_0270193	3300046542	Bacteria	664
1315	Ga0495645_0091791	3300046543	Bacteria	2169
1316	Ga0495645_0104244	3300046543	Bacteria	2014
1317	Ga0495622_0052971	3300046557	Bacteria	1883
1318	Ga0495633_0193007	3300046558	Bacteria	936
1319	Ga0495633_0299194	3300046558	Bacteria	731
1320	Ga0495667_0656269	3300046559	Bacteria	652
1321	Ga0495667_0760972	3300046559	Bacteria	598
1322	Ga0495656_0016327	3300046615	Bacteria	2817
1323	Ga0495656_0156587	3300046615	Bacteria	1104
1324	Ga0495668_0007848	3300046616	Bacteria	6751
1325	Ga0495668_0263932	3300046616	Bacteria	943
1326	Ga0495668_0637143	3300046616	Bacteria	589
1327	Ga0495668_0642948	3300046616	Bacteria	586
1328	Ga0495625_0000080	3300046660	Bacteria	156895
1329	Ga0495625_0025045	3300046660	Bacteria	4531
1330	Ga0495625_0408638	3300046660	Bacteria	847
1331	Ga0495625_0780122	3300046660	Bacteria	557
1332	Ga0495659_0063998	3300046664	Bacteria	1365
1333	Ga0495659_0105154	3300046664	Bacteria	1097
1334	Ga0495661_0001944	3300046665	Bacteria	16399
1335	Ga0495661_0034458	3300046665	Bacteria	3185
1336	Ga0495661_0447724	3300046665	Bacteria	622
1337	Ga0495588_0000125	3300046674	Bacteria	130469
1338	Ga0495588_0017611	3300046674	Bacteria	3474
1339	Ga0495588_0023911	3300046674	Bacteria	3031
1340	Ga0495657_0338206	3300046675	Bacteria	893
1341	Ga0495599_0078966	3300046678	Bacteria	2055
1342	Ga0495599_0472590	3300046678	Bacteria	740
1343	Ga0495599_0586202	3300046678	Bacteria	650
1344	Ga0495623_0430992	3300046679	Bacteria	705
1345	Ga0495647_0276657	3300046681	Bacteria	752
1346	Ga0495669_0100385	3300046684	Bacteria	1344
1347	Ga0495624_0212658	3300046690	Bacteria	1173
1348	Ga0495670_0020745	3300046691	Bacteria	3240
1349	Ga0495670_0713704	3300046691	Bacteria	547
1350	Ga0495671_0121343	3300046692	Bacteria	1275
1351	Ga0495649_0122177	3300046694	Bacteria	1377
1352	Ga0495649_0126251	3300046694	Bacteria	1351
1353	Ga0495589_0000171	3300046794	Bacteria	58991
1354	Ga0495589_0071088	3300046794	Bacteria	1701
1355	Ga0495589_0158834	3300046794	Bacteria	1077
1356	Ga0495589_0284924	3300046794	Bacteria	768
1357	Ga0495600_0402284	3300046809	Bacteria	852
1358	Ga0495600_0726495	3300046809	Bacteria	596
1359	Ga0495660_0000042	3300046810	Bacteria	167048
1360	Ga0495636_0023605	3300047318	Bacteria	2490
1361	Ga0495636_0081866	3300047318	Bacteria	1391
1362	Ga0495674_0291039	3300047319	Bacteria	1336
1363	Ga0495674_0489656	3300047319	Bacteria	985
1364	Ga0495672_0002336	3300047320	Bacteria	17571
1365	Ga0495672_0037305	3300047320	Bacteria	2975
1366	Ga0495672_0052669	3300047320	Bacteria	2389
1367	Ga0495672_0341437	3300047320	Bacteria	698
1368	Ga0495676_0141472	3300047321	Bacteria	1724
1369	Ga0495676_0856285	3300047321	Bacteria	583
1370	Ga0495687_000205	3300047443	Bacteria	84650
1371	Ga0495687_000361	3300047443	Bacteria	56861
1372	Ga0495687_208642	3300047443	Bacteria	614
1373	Ga0495675_0310262	3300047444	Bacteria	935
1374	Ga0495677_0018775	3300047445	Bacteria	2507
1375	Ga0495677_0025976	3300047445	Bacteria	2124
1376	Ga0495679_057603	3300047446	Bacteria	1149
1377	Ga0495685_021259	3300047447	Bacteria	2233
1378	Ga0495685_287217	3300047447	Bacteria	518
1379	Ga0495673_0018029	3300047469	Bacteria	3570
1380	Ga0495673_0033999	3300047469	Bacteria	2360
1381	Ga0495681_0324685	3300047470	Bacteria	590
1382	Ga0495684_0115399	3300047471	Bacteria	2024
1383	Ga0495686_0000132	3300047472	Bacteria	151609
1384	Ga0495686_0067170	3300047472	Bacteria	2214
1385	Ga0495686_0342353	3300047472	Bacteria	815
1386	Ga0495686_0351009	3300047472	Bacteria	802
1387	Ga0495614_0152184	3300048089	Bacteria	1032
1388	Ga0495615_0027770	3300048090	Bacteria	1331
1389	Ga0495626_0000022	3300048091	Bacteria	216166
1390	Ga0495626_0005797	3300048091	Bacteria	7126
1391	Ga0495626_0085876	3300048091	Bacteria	1391
1392	Ga0496100_0005714	3300048903	Bacteria	6727
1393	Ga0496100_0058623	3300048903	Bacteria	2528
1394	Ga0496100_0123195	3300048903	Bacteria	1817
1395	Ga0496100_0273817	3300048903	Bacteria	1256
1396	Ga0496100_0331247	3300048903	Bacteria	1146
1397	Ga0496100_0378276	3300048903	Bacteria	1075
1398	Ga0496100_0793406	3300048903	Bacteria	742
1399	Ga0496100_1226435	3300048903	Bacteria	592
1400	Ga0496101_0011214	3300048904	Bacteria	5937
1401	Ga0496101_0111802	3300048904	Bacteria	2057
1402	Ga0496101_0220417	3300048904	Bacteria	1472
1403	Ga0496101_0357517	3300048904	Bacteria	1148
1404	Ga0496101_1443241	3300048904	Bacteria	536
1405	Ga0496102_0028344	3300048905	Bacteria	5000
1406	Ga0496102_0050758	3300048905	Bacteria	3778
1407	Ga0496102_0177481	3300048905	Bacteria	2006
1408	Ga0496102_0233980	3300048905	Bacteria	1732
1409	Ga0496102_0380415	3300048905	Bacteria	1328
1410	Ga0496102_1093455	3300048905	Bacteria	717
1411	Ga0496103_0003678	3300048906	Bacteria	9323
1412	Ga0496103_0056640	3300048906	Bacteria	2434
1413	Ga0496103_0102062	3300048906	Bacteria	1816
1414	Ga0496103_0255812	3300048906	Bacteria	1127
1415	Ga0496103_0281071	3300048906	Bacteria	1070
1416	Ga0496103_0327928	3300048906	Bacteria	985
1417	Ga0496103_0397657	3300048906	Bacteria	885
1418	Ga0496104_0061207	3300048907	Bacteria	3568
1419	Ga0496104_0078837	3300048907	Bacteria	3139
1420	Ga0496104_0188211	3300048907	Bacteria	1975
1421	Ga0496104_0296111	3300048907	Bacteria	1530
1422	Ga0496104_0362146	3300048907	Bacteria	1362
1423	Ga0496104_0364459	3300048907	Bacteria	1357
1424	Ga0496105_0004150	3300048908	Bacteria	10870
1425	Ga0496105_0023986	3300048908	Bacteria	4954
1426	Ga0496105_0034391	3300048908	Bacteria	4167
1427	Ga0496105_0115131	3300048908	Bacteria	2218
1428	Ga0496105_0284870	3300048908	Bacteria	1331
1429	Ga0496105_0348456	3300048908	Bacteria	1183
1430	Ga0496106_0002352	3300048909	Bacteria	14089
1431	Ga0496106_0002393	3300048909	Bacteria	13975
1432	Ga0496106_0062427	3300048909	Bacteria	2828
1433	Ga0496106_0175256	3300048909	Bacteria	1701
1434	Ga0496106_0186445	3300048909	Bacteria	1648
1435	Ga0496106_1542092	3300048909	Bacteria	510
1436	Ga0496107_0000986	3300048910	Bacteria	16907
1437	Ga0496107_0008206	3300048910	Bacteria	7222
1438	Ga0496107_0087881	3300048910	Bacteria	2269
1439	Ga0496107_0302751	3300048910	Bacteria	1190
1440	Ga0496107_0444718	3300048910	Bacteria	963
1441	Ga0496107_0677237	3300048910	Bacteria	759
1442	Ga0496107_0911923	3300048910	Bacteria	640
1443	Ga0496108_0014213	3300048911	Bacteria	6495
1444	Ga0496108_0045174	3300048911	Bacteria	3678
1445	Ga0496108_1010309	3300048911	Bacteria	710
1446	Ga0496109_0012703	3300048912	Bacteria	7276
1447	Ga0496109_0039946	3300048912	Bacteria	4248
1448	Ga0496109_0234387	3300048912	Bacteria	1727
1449	Ga0496109_0591668	3300048912	Bacteria	1045
1450	Ga0496109_1032786	3300048912	Bacteria	759
1451	Ga0496110_0007237	3300048913	Bacteria	8843
1452	Ga0496110_0326214	3300048913	Bacteria	1398
1453	Ga0496110_0464566	3300048913	Bacteria	1153
1454	Ga0496110_0553274	3300048913	Bacteria	1045
1455	Ga0496110_0621877	3300048913	Bacteria	979
1456	Ga0496110_1023256	3300048913	Bacteria	734
1457	Ga0496110_1283462	3300048913	Bacteria	641
1458	Ga0496111_0004163	3300048914	Bacteria	9100
1459	Ga0496111_0072863	3300048914	Bacteria	2500
1460	Ga0496111_0338366	3300048914	Bacteria	1114
1461	Ga0496112_0003529	3300048915	Bacteria	12970
1462	Ga0496112_0075376	3300048915	Bacteria	3336
1463	Ga0496112_0091988	3300048915	Bacteria	3002
1464	Ga0496112_1392424	3300048915	Bacteria	616
1465	Ga0496113_0000939	3300048916	Bacteria	15474
1466	Ga0496113_0004895	3300048916	Bacteria	8294
1467	Ga0496113_0066309	3300048916	Bacteria	2734
1468	Ga0496113_0753053	3300048916	Bacteria	775
1469	Ga0496113_0826423	3300048916	Bacteria	735
1470	Ga0496113_0836077	3300048916	Bacteria	730
1471	Ga0496113_1043279	3300048916	Bacteria	643
1472	Ga0496114_0031552	3300048917	Bacteria	4359
1473	Ga0496114_0221553	3300048917	Bacteria	1661
1474	Ga0496114_0809022	3300048917	Bacteria	816
1475	Ga0496115_0019102	3300048918	Bacteria	5270
1476	Ga0496115_0042711	3300048918	Bacteria	3613
1477	Ga0496115_0089891	3300048918	Bacteria	2508
1478	Ga0496115_0143360	3300048918	Bacteria	1971
1479	Ga0496115_0147999	3300048918	Bacteria	1938
1480	Ga0496115_0176505	3300048918	Bacteria	1766
1481	Ga0496115_0344980	3300048918	Bacteria	1215
1482	Ga0496116_0286684	3300048919	Bacteria	793
1483	Ga0496117_0036249	3300048920	Bacteria	3693
1484	Ga0496117_0058499	3300048920	Bacteria	2669
1485	Ga0496117_0063625	3300048920	Bacteria	2521
1486	Ga0496117_0313167	3300048920	Bacteria	826
1487	Ga0496117_0315391	3300048920	Bacteria	821
1488	Ga0496118_0002179	3300048921	Bacteria	27254
1489	Ga0496118_0007104	3300048921	Bacteria	12018
1490	Ga0496118_0028574	3300048921	Bacteria	4693
1491	Ga0496118_0126082	3300048921	Bacteria	1657
1492	Ga0496118_0171815	3300048921	Bacteria	1323
1493	Ga0496118_0186096	3300048921	Bacteria	1248
1494	Ga0496118_0277410	3300048921	Bacteria	935
1495	Ga0496119_0030961	3300048922	Bacteria	3597
1496	Ga0496119_0184810	3300048922	Bacteria	1090
1497	Ga0496119_0198556	3300048922	Bacteria	1040
1498	Ga0496119_0234351	3300048922	Bacteria	932
1499	Ga0496119_0271097	3300048922	Bacteria	848
1500	Ga0496120_0129890	3300048923	Bacteria	1292
1501	Ga0496120_0328458	3300048923	Bacteria	693
1502	Ga0496121_0000009	3300048924	Bacteria	836971
1503	Ga0496121_0000381	3300048924	Bacteria	90593
1504	Ga0496121_0002282	3300048924	Bacteria	29839
1505	Ga0496121_0006123	3300048924	Bacteria	15114
1506	Ga0496121_0031492	3300048924	Bacteria	4844
1507	Ga0496121_0040143	3300048924	Bacteria	4110
1508	Ga0496121_0051624	3300048924	Bacteria	3461
1509	Ga0496121_0092475	3300048924	Bacteria	2358
1510	Ga0496121_0163117	3300048924	Bacteria	1627
1511	Ga0496121_0507337	3300048924	Bacteria	764
1512	Ga0496121_0850971	3300048924	Bacteria	530
1513	Ga0496122_0211857	3300048925	Bacteria	1121
1514	Ga0496122_0367131	3300048925	Bacteria	744
1515	Ga0496123_0075227	3300048926	Bacteria	2085
1516	Ga0496123_0158242	3300048926	Bacteria	1211
1517	Ga0496124_0000599	3300048927	Bacteria	60657
1518	Ga0496124_0266817	3300048927	Bacteria	1256
1519	Ga0496124_0609701	3300048927	Bacteria	708
1520	Ga0496124_0652813	3300048927	Bacteria	675
1521	Ga0496125_0000040	3300048928	Bacteria	314478
1522	Ga0496125_0102129	3300048928	Bacteria	2108
1523	Ga0496125_0175197	3300048928	Bacteria	1436
1524	Ga0496125_0253159	3300048928	Bacteria	1109
1525	Ga0496125_0478662	3300048928	Bacteria	706
1526	Ga0496125_0537415	3300048928	Bacteria	650
1527	Ga0496126_0004395	3300048929	Bacteria	16896
1528	Ga0496126_0060355	3300048929	Bacteria	3411
1529	Ga0496126_0166578	3300048929	Bacteria	1880
1530	Ga0496126_0196345	3300048929	Bacteria	1706
1531	Ga0496126_0196690	3300048929	Bacteria	1705
1532	Ga0496126_0286612	3300048929	Bacteria	1363
1533	Ga0496126_0292535	3300048929	Bacteria	1346
1534	Ga0496126_0632128	3300048929	Bacteria	840
1535	Ga0496126_0689644	3300048929	Bacteria	795
1536	Ga0496126_0806383	3300048929	Bacteria	720
1537	Ga0496126_0921406	3300048929	Bacteria	661
1538	Ga0495678_234764	3300049459	Bacteria	551
1539	Ga0495682_0078332	3300049460	Bacteria	1189
1540	Ga0501031_0147651	3300049568	Bacteria	1536
1541	Ga0501031_0339067	3300049568	Bacteria	973
1542	Ga0501032_0002079	3300049569	Bacteria	15813
1543	Ga0501032_0003954	3300049569	Bacteria	11243
1544	Ga0501032_0688927	3300049569	Bacteria	648
1545	Ga0501033_0002701	3300049570	Bacteria	14879
1546	Ga0501033_0208170	3300049570	Bacteria	1395
1547	Ga0501033_0237742	3300049570	Bacteria	1293
1548	Ga0501033_0403105	3300049570	Bacteria	954
1549	Ga0501033_0444464	3300049570	Bacteria	901
1550	Ga0501033_0707734	3300049570	Bacteria	685
1551	Ga0501033_1135165	3300049570	Bacteria	519
1552	Ga0501034_0000014	3300049571	Bacteria	297798
1553	Ga0501034_0005595	3300049571	Bacteria	13687
1554	Ga0501034_0083104	3300049571	Bacteria	3204
1555	Ga0501034_0371242	3300049571	Bacteria	1357
1556	Ga0501034_0535493	3300049571	Bacteria	1082
1557	Ga0501034_1004960	3300049571	Bacteria	718
1558	Ga0501034_1052146	3300049571	Bacteria	696
1559	Ga0501034_1112809	3300049571	Bacteria	670
1560	Ga0501036_0015554	3300049572	Bacteria	6357
1561	Ga0501036_0062936	3300049572	Bacteria	3142
1562	Ga0501036_0308253	3300049572	Bacteria	1324
1563	Ga0501036_0759120	3300049572	Bacteria	800
1564	Ga0501036_0775324	3300049572	Bacteria	790
1565	Ga0501036_1388916	3300049572	Bacteria	570
1566	Ga0501037_0009360	3300049573	Bacteria	7191
1567	Ga0501037_0016608	3300049573	Bacteria	5417
1568	Ga0501037_0199879	3300049573	Bacteria	1413
1569	Ga0501038_0000719	3300049574	Bacteria	29592
1570	Ga0501038_0011679	3300049574	Bacteria	8009
1571	Ga0501038_0104817	3300049574	Bacteria	2350
1572	Ga0501038_1072603	3300049574	Bacteria	589
1573	Ga0501039_0000087	3300049575	Bacteria	69688
1574	Ga0501039_0001526	3300049575	Bacteria	17059
1575	Ga0501039_0624643	3300049575	Bacteria	844
1576	Ga0501040_0123202	3300049576	Bacteria	1820
1577	Ga0501040_0530040	3300049576	Bacteria	850
1578	Ga0501043_0004493	3300049579	Bacteria	11332
1579	Ga0501043_0094987	3300049579	Bacteria	2343
1580	Ga0501043_0315659	3300049579	Bacteria	1192
1581	Ga0501043_0351807	3300049579	Bacteria	1119
1582	Ga0501046_0000870	3300049580	Bacteria	29401
1583	Ga0501046_0002770	3300049580	Bacteria	16315
1584	Ga0501047_0000684	3300049581	Bacteria	35329
1585	Ga0501047_0011736	3300049581	Bacteria	8286
1586	Ga0501047_0114526	3300049581	Bacteria	2578
1587	Ga0501047_0290414	3300049581	Bacteria	1479
1588	Ga0501047_0339715	3300049581	Bacteria	1339
1589	Ga0501047_1041116	3300049581	Bacteria	632
1590	Ga0501048_0015120	3300049582	Bacteria	5703
1591	Ga0501048_0087357	3300049582	Bacteria	2200
1592	Ga0501067_0015906	3300049583	Bacteria	4161
1593	Ga0501067_0018916	3300049583	Bacteria	3810
1594	Ga0501068_0009168	3300049584	Bacteria	5527
1595	Ga0501069_0000622	3300049585	Bacteria	16341
1596	Ga0501070_0002545	3300049586	Bacteria	15974
1597	Ga0501070_0139068	3300049586	Bacteria	2005
1598	Ga0501070_0153896	3300049586	Bacteria	1897
1599	Ga0501070_0207495	3300049586	Bacteria	1609
1600	Ga0501070_0756477	3300049586	Bacteria	765
1601	Ga0501070_1296693	3300049586	Bacteria	556
1602	Ga0501071_0908359	3300049587	Bacteria	679
1603	Ga0501072_0720541	3300049588	Bacteria	783
1604	Ga0501073_0000348	3300049589	Bacteria	31113
1605	Ga0501073_0029773	3300049589	Bacteria	3902
1606	Ga0501073_0035653	3300049589	Bacteria	3535
1607	Ga0501073_0675546	3300049589	Bacteria	713
1608	Ga0501074_0002564	3300049590	Bacteria	12689
1609	Ga0501076_0161604	3300049592	Bacteria	1825
1610	Ga0501076_0600523	3300049592	Bacteria	908
1611	Ga0501076_0850093	3300049592	Bacteria	753
1612	Ga0501221_160232	3300049704	Bacteria	602
1613	Ga0501079_0035976	3300049741	Bacteria	3813
1614	Ga0501079_1553098	3300049741	Bacteria	521
1615	Ga0501080_0000010	3300049742	Bacteria	115062
1616	Ga0501080_0001541	3300049742	Bacteria	19461
1617	Ga0501080_0173598	3300049742	Bacteria	1987
1618	Ga0501081_0145215	3300049743	Bacteria	1702
1619	Ga0501083_0005861	3300049744	Bacteria	8696
1620	Ga0501083_0467327	3300049744	Unclassified	821
1621	Ga0501035_0000034	3300049822	Bacteria	174589
1622	Ga0501035_0001162	3300049822	Bacteria	27461
1623	Ga0501035_0003287	3300049822	Bacteria	15494
1624	Ga0501035_0179323	3300049822	Bacteria	1826
1625	Ga0501035_0313232	3300049822	Bacteria	1320
1626	Ga0501035_0440838	3300049822	Bacteria	1079
1627	Ga0501035_0641945	3300049822	Bacteria	861
1628	Ga0501035_0870387	3300049822	Bacteria	715
1629	Ga0501035_1118450	3300049822	Bacteria	614
1630	Ga0501044_0000473	3300049823	Bacteria	49016
1631	Ga0501044_0023437	3300049823	Bacteria	6565
1632	Ga0501044_0102864	3300049823	Bacteria	2871
1633	Ga0501044_0143389	3300049823	Bacteria	2376
1634	Ga0501044_0214081	3300049823	Bacteria	1880
1635	Ga0501044_0214911	3300049823	Bacteria	1876
1636	Ga0501044_0215922	3300049823	Bacteria	1870
1637	Ga0501044_0836937	3300049823	Bacteria	798
1638	nmdc:mga03683_271971_c1	3300050489	Bacteria	790
1639	nmdc:mga03683_38989_c1	3300050489	Bacteria	1343
1640	nmdc:mga03683_40877_c1	3300050489	Bacteria	1573
1641	nmdc:mga03683_436_c1	3300050489	Bacteria	12047
1642	nmdc:mga03683_456740_c1	3300050489	Bacteria	615
1643	nmdc:mga03683_57504_c1	3300050489	Bacteria	1637
1644	nmdc:mga03683_640091_c1	3300050489	Bacteria	523
1645	nmdc:mga03683_650386_c1	3300050489	Bacteria	519
1646	nmdc:mga03n38_125162_c1	3300050490	Bacteria	1268
1647	nmdc:mga03n38_16046_c1	3300050490	Bacteria	2906
1648	nmdc:mga03n38_364_c1	3300050490	Bacteria	11088
1649	nmdc:mga03n38_745209_c1	3300050490	Bacteria	567
1650	nmdc:mga03n38_87326_c1	3300050490	Bacteria	1478
1651	nmdc:mga00v17_1042372_c1	3300050491	Bacteria	514
1652	nmdc:mga00v17_316676_c1	3300050491	Bacteria	1014
1653	nmdc:mga00v17_318498_c1	3300050491	Bacteria	1011
1654	nmdc:mga00v17_57414_c1	3300050491	Bacteria	2381
1655	nmdc:mga00v17_61418_c1	3300050491	Bacteria	2310
1656	nmdc:mga00v17_81686_c1	3300050491	Bacteria	2019
1657	nmdc:mga0yw44_1064799_c1	3300050492	Bacteria	547
1658	nmdc:mga0yw44_1206_c1	3300050492	Bacteria	10117
1659	nmdc:mga0yw44_130410_c1	3300050492	Bacteria	1627
1660	nmdc:mga0yw44_16659_c1	3300050492	Bacteria	3978
1661	nmdc:mga0yw44_254867_c1	3300050492	Bacteria	1168
1662	nmdc:mga0yw44_29866_c1	3300050492	Bacteria	3152
1663	nmdc:mga0yw44_3737_c1	3300050492	Bacteria	5578
1664	nmdc:mga0yw44_3835_c1	3300050492	Bacteria	6755
1665	nmdc:mga0yw44_3912_c1	3300050492	Bacteria	6716
1666	nmdc:mga0yw44_40628_c1	3300050492	Bacteria	2765
1667	nmdc:mga0yw44_427708_c1	3300050492	Bacteria	897
1668	nmdc:mga0yw44_48014_c1	3300050492	Bacteria	2572
1669	nmdc:mga0yw44_544991_c1	3300050492	Bacteria	788
1670	nmdc:mga0yw44_58709_c1	3300050492	Bacteria	2351
1671	nmdc:mga0yw44_958423_c1	3300050492	Bacteria	580
1672	nmdc:mga0k408_131359_c2	3300050493	Bacteria	1180
1673	nmdc:mga0k408_186908_c2	3300050493	Bacteria	838
1674	nmdc:mga0k408_225569_c1	3300050493	Bacteria	1119
1675	nmdc:mga0k408_299716_c1	3300050493	Bacteria	959
1676	nmdc:mga0k408_32060_c1	3300050493	Bacteria	3002
1677	nmdc:mga0k408_341985_c1	3300050493	Bacteria	892
1678	nmdc:mga0k408_403057_c1	3300050493	Bacteria	814
1679	nmdc:mga0k408_406497_c1	3300050493	Bacteria	810
1680	nmdc:mga0k408_507382_c1	3300050493	Bacteria	714
1681	nmdc:mga0k408_604_c1	3300050493	Bacteria	19838
1682	nmdc:mga0k408_610363_c1	3300050493	Bacteria	643
1683	nmdc:mga0k408_742504_c1	3300050493	Bacteria	574
1684	nmdc:mga0k408_88306_c1	3300050493	Bacteria	1821
1685	nmdc:mga06z11_1019582_c1	3300050494	Bacteria	504
1686	nmdc:mga06z11_1472_c1	3300050494	Bacteria	8770
1687	nmdc:mga06z11_226309_c1	3300050494	Bacteria	1094
1688	nmdc:mga06z11_279469_c1	3300050494	Bacteria	989
1689	nmdc:mga06z11_407017_c1	3300050494	Bacteria	819
1690	nmdc:mga06z11_44581_c1	3300050494	Bacteria	2237
1691	nmdc:mga06z11_479481_c1	3300050494	Bacteria	753
1692	nmdc:mga06z11_55239_c1	3300050494	Bacteria	2050
1693	nmdc:mga06z11_697143_c1	3300050494	Bacteria	618
1694	nmdc:mga06z11_7483_c1	3300050494	Bacteria	4496
1695	nmdc:mga06z11_792207_c1	3300050494	Bacteria	578
1696	nmdc:mga06z11_7962_c1	3300050494	Bacteria	4391
1697	nmdc:mga06z11_8289_c1	3300050494	Bacteria	4325
1698	nmdc:mga06z11_83858_c1	3300050494	Bacteria	1716
1699	nmdc:mga04h51_441267_c1	3300050495	Bacteria	550
1700	nmdc:mga07m45_14798_c1	3300050496	Bacteria	4165
1701	nmdc:mga07m45_25973_c1	3300050496	Bacteria	3217
1702	nmdc:mga07m45_30279_c1	3300050496	Bacteria	2997
1703	nmdc:mga07m45_41120_c1	3300050496	Bacteria	2588
1704	nmdc:mga07m45_471847_c1	3300050496	Bacteria	727
1705	nmdc:mga07m45_491085_c1	3300050496	Bacteria	711
1706	nmdc:mga07m45_569678_c1	3300050496	Bacteria	654
1707	nmdc:mga07m45_689829_c1	3300050496	Bacteria	588
1708	nmdc:mga07m45_93689_c1	3300050496	Bacteria	1722
1709	nmdc:mga05p37_135264_c1	3300050507	Bacteria	3023
1710	nmdc:mga05p37_316594_c1	3300050507	Bacteria	1848
1711	nmdc:mga05p37_31857_c1	3300050507	Bacteria	6444
1712	nmdc:mga05p37_60656_c1	3300050507	Bacteria	4656
1713	nmdc:mga09592_738303_c1	3300050508	Bacteria	836
1714	nmdc:mga0qj67_34_c1	3300050509	Bacteria	96663
1715	nmdc:mga0qj67_69183_c1	3300050509	Bacteria	2815
1716	nmdc:mga06r32_1367435_c1	3300050510	Bacteria	650
1717	nmdc:mga06r32_15803_c1	3300050510	Bacteria	6863
1718	nmdc:mga08y16_196576_c1	3300050511	Bacteria	2090
1719	nmdc:mga08y16_854603_c1	3300050511	Bacteria	899
1720	nmdc:mga0n895_1858447_c1	3300050512	Bacteria	562
1721	nmdc:mga0n895_42454_c1	3300050512	Bacteria	4424
1722	nmdc:mga0n895_685409_c1	3300050512	Bacteria	1022
1723	nmdc:mga0rr50_1059462_c1	3300050513	Bacteria	690
1724	nmdc:mga0rr50_1254142_c1	3300050513	Bacteria	629
1725	nmdc:mga0rr50_189808_c1	3300050513	Bacteria	1683
1726	nmdc:mga0rr50_689414_c1	3300050513	Bacteria	872
1727	nmdc:mga08x19_158370_c1	3300050514	Bacteria	1537
1728	nmdc:mga08x19_423833_c1	3300050514	Bacteria	935
1729	nmdc:mga0sz30_180238_c1	3300050516	Bacteria	937
1730	nmdc:mga0sz30_261982_c1	3300050516	Bacteria	770
1731	nmdc:mga0sz30_3381_c1	3300050516	Bacteria	5738
1732	nmdc:mga0sz30_35406_c1	3300050516	Bacteria	2083
1733	nmdc:mga0sz30_373730_c1	3300050516	Bacteria	638
1734	nmdc:mga0sz30_428737_c1	3300050516	Bacteria	593
1735	nmdc:mga0sz30_89279_c1	3300050516	Bacteria	1340
1736	Ga0495601_0150909	3300053077	Bacteria	1517
1737	Ga0495601_0156943	3300053077	Bacteria	1486
1738	Ga0495612_0047541	3300053078	Bacteria	1758
1739	Ga0495655_0015653	3300053083	Bacteria	1616
1740	Ga0495595_0051585	3300053084	Bacteria	1907
1741	Ga0495595_0326278	3300053084	Bacteria	773
1742	Ga0495595_0430042	3300053084	Bacteria	670
1743	Ga0495595_0526960	3300053084	Bacteria	603
1744	Ga0495619_0085951	3300053085	Bacteria	2125
1745	Ga0495619_0227754	3300053085	Bacteria	1291
1746	Ga0500578_0242970	3300053086	Bacteria	1087
1747	Ga0500578_0430362	3300053086	Bacteria	755
1748	Ga0500578_0469763	3300053086	Bacteria	713
1749	Ga0500578_0567535	3300053086	Bacteria	629
1750	Ga0500643_063612	3300053087	Bacteria	1032
1751	Ga0500643_074275	3300053087	Bacteria	941
1752	Ga0500643_096084	3300053087	Bacteria	805
1753	Ga0500644_0239499	3300053088	Bacteria	762
1754	Ga0500644_0258886	3300053088	Bacteria	736
1755	Ga0500644_0289856	3300053088	Bacteria	698
1756	Ga0500644_0541316	3300053088	Bacteria	514
1757	Ga0500646_0015111	3300053090	Bacteria	2009
1758	Ga0500646_0045760	3300053090	Bacteria	1247
1759	Ga0500646_0046237	3300053090	Bacteria	1241
1760	Ga0500646_0072309	3300053090	Bacteria	1037
1761	Ga0500646_0271872	3300053090	Bacteria	601
1762	Ga0500583_0007058	3300053092	Bacteria	3920
1763	Ga0500583_0322569	3300053092	Bacteria	753
1764	Ga0500583_0342804	3300053092	Bacteria	725
1765	Ga0500651_0237651	3300053093	Bacteria	1063
1766	Ga0500651_0689711	3300053093	Bacteria	547
1767	Ga0500641_0001478	3300053096	Bacteria	8375
1768	Ga0500641_0006965	3300053096	Bacteria	4023
1769	Ga0500641_0011912	3300053096	Bacteria	3165
1770	Ga0500641_0095152	3300053096	Bacteria	1274
1771	Ga0500648_138933	3300053097	Bacteria	1308
1772	Ga0500650_0064754	3300053098	Bacteria	1708
1773	Ga0500650_0154485	3300053098	Bacteria	1060
1774	Ga0500650_0233654	3300053098	Bacteria	829
1775	Ga0500650_0246561	3300053098	Bacteria	802
1776	Ga0500650_0251405	3300053098	Bacteria	793
1777	Ga0500650_0408310	3300053098	Bacteria	587
1778	Ga0500555_066582	3300053103	Bacteria	958
1779	Ga0500555_082025	3300053103	Bacteria	838
1780	Ga0500555_131739	3300053103	Bacteria	620
1781	Ga0500556_0003827	3300053104	Bacteria	4365
1782	Ga0500556_0005375	3300053104	Bacteria	3618
1783	Ga0500556_0027382	3300053104	Bacteria	1903
1784	Ga0500562_000898	3300053108	Bacteria	7232
1785	Ga0500562_066399	3300053108	Bacteria	972
1786	Ga0500562_083895	3300053108	Bacteria	863
1787	Ga0500572_212182	3300053111	Bacteria	634
1788	Ga0500593_005484	3300053117	Bacteria	5009
1789	Ga0500594_0013478	3300053118	Bacteria	1943
1790	Ga0500594_0038219	3300053118	Bacteria	1300
1791	Ga0500594_0082013	3300053118	Bacteria	966
1792	Ga0500595_000664	3300053119	Bacteria	20632
1793	Ga0500595_001967	3300053119	Bacteria	10553
1794	Ga0500595_010292	3300053119	Bacteria	3722
1795	Ga0500595_036001	3300053119	Bacteria	1625
1796	Ga0500595_038946	3300053119	Bacteria	1541
1797	Ga0500608_268058	3300053122	Bacteria	655
1798	Ga0500642_0000551	3300053130	Bacteria	11333
1799	Ga0500642_0036422	3300053130	Bacteria	2096
1800	Ga0500642_0190937	3300053130	Bacteria	956
1801	Ga0500642_0315995	3300053130	Bacteria	702
1802	Ga0500655_005232	3300053133	Bacteria	2341
1803	Ga0500658_0112554	3300053134	Bacteria	1199
1804	Ga0500658_0219776	3300053134	Bacteria	871
1805	Ga0500559_0010054	3300053136	Bacteria	4074
1806	Ga0500559_0142900	3300053136	Bacteria	1121
1807	Ga0500559_0207293	3300053136	Bacteria	924
1808	Ga0500559_0277646	3300053136	Bacteria	788
1809	Ga0500561_0280149	3300053137	Bacteria	531
1810	Ga0500568_0001159	3300053139	Bacteria	17637
1811	Ga0500568_0017806	3300053139	Bacteria	3126
1812	Ga0500568_0040774	3300053139	Bacteria	1867
1813	Ga0500568_0358395	3300053139	Bacteria	529
1814	Ga0500573_0089051	3300053140	Bacteria	1745
1815	Ga0500577_0005676	3300053142	Bacteria	3383
1816	Ga0500577_0140859	3300053142	Bacteria	1017
1817	Ga0500588_0123138	3300053146	Bacteria	916
1818	Ga0500588_0210730	3300053146	Bacteria	722
1819	Ga0500589_192997	3300053147	Bacteria	789
1820	Ga0500603_168410	3300053150	Bacteria	686
1821	Ga0500604_0002247	3300053151	Bacteria	5285
1822	Ga0500604_0004822	3300053151	Bacteria	3576
1823	Ga0500604_0011237	3300053151	Bacteria	2402
1824	Ga0500616_0001753	3300053153	Bacteria	19893
1825	Ga0500616_0019480	3300053153	Bacteria	3824
1826	Ga0500616_0061141	3300053153	Bacteria	1951
1827	Ga0500616_0079351	3300053153	Bacteria	1653
1828	Ga0500616_0195412	3300053153	Bacteria	900
1829	Ga0500620_300375	3300053155	Bacteria	520
1830	Ga0500622_0005907	3300053156	Bacteria	7220
1831	Ga0500622_0008503	3300053156	Bacteria	5736
1832	Ga0500622_0015773	3300053156	Bacteria	4044
1833	Ga0500622_0306126	3300053156	Bacteria	675
1834	Ga0500627_0002241	3300053158	Bacteria	5670
1835	Ga0500634_0094342	3300053161	Bacteria	1511
1836	Ga0500636_0004933	3300053177	Bacteria	7580
1837	Ga0500636_0009497	3300053177	Bacteria	5655
1838	Ga0500636_0134532	3300053177	Bacteria	1373
1839	Ga0500636_0435932	3300053177	Bacteria	597
1840	Ga0500611_020431	3300053727	Bacteria	1250
1841	Ga0500611_180646	3300053727	Bacteria	591
1842	Ga0500645_002001	3300053730	Bacteria	9564
1843	Ga0500645_030452	3300053730	Bacteria	1623
1844	Ga0500609_002328	3300053731	Bacteria	2710
1845	Ga0500596_012712	3300053735	Bacteria	1275
1846	Ga0501084_0040643	3300054114	Bacteria	3891
1847	Ga0501084_1294655	3300054114	Bacteria	611
1848	Ga0501082_0003888	3300060353	Bacteria	13041
1849	Ga0501082_0051236	3300060353	Bacteria	3558
1850	Ga0466962_0007922	3300061719	Bacteria	5095
1851	Ga0466962_0192725	3300061719	Bacteria	995
1852	Ga0466962_0288256	3300061719	Bacteria	811
1853	Ga0530510_0790544	3300061734	Bacteria	724
1854	2503201117	2503198000	Bacteria	6884444
1855	2509118772	2508501123	Bacteria	6283661
1856	2509150878	2508501128	Bacteria	8613869
1857	2509392555	2509276021	Bacteria	7634384
1858	2509443366	2509276033	Bacteria	7180565
1859	2511123449	2510917020	Bacteria	5657507
1860	2512931993	2512875016	Bacteria	6529530
1861	2512959965	2512875024	Bacteria	7195110
1862	2513577392	2513237085	Bacteria	7695351
1863	2513692623	2513237101	Bacteria	7952346
1864	2513718653	2513237104	Bacteria	10034502
1865	2513912497	2513237144	Bacteria	7530820
1866	2513926148	2513237146	Bacteria	7166346
1867	2514036025	2513237164	Bacteria	7563725
1868	2514420157	2513237305	Bacteria	7293571
1869	2515744240	2515154134	Bacteria	7220242
1870	2517076506	2516653085	Bacteria	7346596
1871	2524536170	2524023228	Bacteria	10118060
1872	2530645629	2529292951	Bacteria	6916614
1873	2585227928	2582581299	Bacteria	6518058
1874	2585527746	2585427526	Bacteria	7258840
1875	2585537640	2585427528	Bacteria	6842387
1876	2585835590	2585427593	Bacteria	7141551
1877	2585994729	2585427633	Bacteria	6413184
1878	2585999211	2585427634	Bacteria	6455027
1879	2587917490	2585428106	Bacteria	5179711
1880	2599417624	2599185170	Bacteria	7295545
1881	2599735430	2599185239	Bacteria	8686614
1882	2643801307	2643221556	Bacteria	7251154
1883	2643805240	2643221557	Bacteria	7184309
1884	2643925049	2643221583	Bacteria	5218014
1885	2644064084	2643221610	Bacteria	7480339
1886	2644288897	2643221651	Bacteria	4798932
1887	2644375690	2643221668	Bacteria	7306521
1888	2644415916	2643221675	Bacteria	7473456
1889	2644448957	2643221680	Bacteria	7473610
1890	2644471725	2643221684	Bacteria	7145183
1891	2644493680	2643221688	Bacteria	5260751
1892	2644686519	2643221726	Bacteria	7455827
1893	2644736921	2643221734	Bacteria	5365412
1894	2671123424	2667528175	Bacteria	7532676
1895	2719385886	2718217927	Bacteria	6972593
1896	2719665700	2718217997	Bacteria	6740740
1897	2720492120	2718218199	Bacteria	6740745
1898	2720613385	2718218232	Bacteria	6720332
1899	2720620262	2718218233	Bacteria	6662049
1900	2720631687	2718218235	Bacteria	6630699
1901	2720775415	2718218269	Bacteria	6906114
1902	2721399665	2718218423	Bacteria	6438183
1903	2723027033	2721755556	Bacteria	6745503
1904	2723560645	2721755684	Bacteria	6859907
1905	2723567234	2721755685	Bacteria	6704835
1906	2723575672	2721755686	Bacteria	7343952
1907	2723844993	2721755755	Bacteria	8322773
1908	2724038478	2721755809	Bacteria	6438790
1909	2724090022	2721755819	Bacteria	6906405
1910	2724104499	2721755822	Bacteria	6726041
1911	2724110293	2721755823	Bacteria	6752556
1912	2725948563	2724679232	Bacteria	7646494
1913	2728754650	2728368998	Bacteria	8720350
1914	2730107969	2728369352	Bacteria	6745171
1915	2739036603	2738541333	Bacteria	7106503
1916	2776272393	2775506902	Bacteria	6208009
1917	2776284333	2775506904	Bacteria	5954060
1918	2793082149
1919	2793294774	2791355256	Bacteria	6798008
1920	2793330631	2791355261	Bacteria	6661293
1921	2793335960	2791355262	Bacteria	6774204
1922	2793341622	2791355263	Bacteria	6872478
1923	2793352975	2791355265	Bacteria	6539969
1924	2793361069	2791355266	Bacteria	7116587
1925	2793369163	2791355267	Bacteria	7222458
1926	2805925799	2802429605	Bacteria	6875453
1927	2805933477	2802429606	Bacteria	6346811
1928	2806046153	2802429633	Bacteria	7341974
1929	2806054533	2802429634	Bacteria	7083200
1930	2806060537	2802429635	Bacteria	7650140
1931	2806065005	2802429636	Bacteria	7597525
1932	2806072264	2802429637	Bacteria	7067217
1933	2819611011	2818991448	Bacteria	6772224
1934	2819630550	2818991452	Bacteria	8442785
1935	2838021374	2838016132	Bacteria	6577831
1936	2838038163	2838035591	Bacteria	7166484
1937	2838043544	2838042994	Bacteria	6046894
1938	2838053455	2838048938	Bacteria	6044578
1939	2838065714	2838061910	Bacteria	6794874
1940	2838074553	2838068647	Bacteria	6208656
1941	2838667152	2838661181	Bacteria	7385261
1942	2838682114	2838680041	Bacteria	6545511
1943	2838691890	2838686498	Bacteria	7807632
1944	2838696686	2838694306	Bacteria	6853137
1945	2838710075	2838707686	Bacteria	6619912
1946	2838732963	2838729681	Bacteria	7400765
1947	2838745841	2838742623	Bacteria	7396178
1948	2841766238	2841760612	Bacteria	6454112
1949	2841855700	2841851746	Bacteria	7532261
1950	2841864434	2841864319	Bacteria	6742987
1951	2842078248	2842077413	Bacteria	6508645
1952	2842119244	2842118031	Bacteria	7033875
1953	2842157308	2842156927	Bacteria	6894975
1954	2842167966	2842163707	Bacteria	6916235
1955	2842181108	2842180545	Bacteria	6888678
1956	2842194417	2842192696	Bacteria	6147454
1957	2842205942	2842205361	Bacteria	6340321
1958	2842230834	2842229732	Bacteria	7475766
1959	2842239487	2842237096	Bacteria	6620661
1960	2842245060	2842243621	Bacteria	7421798
1961	2842258873	2842257432	Bacteria	7401195
1962	2842265949	2842264693	Bacteria	6472963
1963	2842276457	2842271015	Bacteria	7807131
1964	2842279399	2842278818	Bacteria	6340002
1965	2842291910	2842291075	Bacteria	7076806
1966	2842304403	2842304105	Bacteria	7023636
1967	2842314331	2842311132	Bacteria	6616990
1968	2842317813	2842317721	Bacteria	6793725
1969	2842345218	2842341865	Bacteria	7003929
1970	2842364662	2842363717	Bacteria	6844742
1971	2842372681	2842370503	Bacteria	7038661
1972	2842378306	2842377471	Bacteria	7140707
1973	2842385753	2842384541	Bacteria	7057858
1974	2842398782	2842395702	Bacteria	6780583
1975	2842427456	2842422224	Bacteria	6239196
1976	2842429414	2842428310	Bacteria	6767288
1977	2842436027	2842434925	Bacteria	6502746
1978	2842442374	2842441272	Bacteria	6769273
1979	2842450665	2842447887	Bacteria	6754142
1980	2842463835	2842462802	Bacteria	6588055
1981	2842470356	2842469257	Bacteria	6752936
1982	2844106004	2844104063	Bacteria	6440972
1983	2844459054	2844454524	Bacteria	7952546
1984	2851246360	2851246043	Bacteria	6439203
1985	2869164954	2869162929	Bacteria	6399702
1986	2871488957	2871488783	Bacteria	6929816
1987	2871496419	2871495908	Bacteria	6935695
1988	2874605295	2874604998	Bacteria	7834745
1989	2876397839	2876392853	Bacteria	6660880
1990	2878739031	2878738818	Bacteria	7136951
1991	2878753719	2878753008	Bacteria	6922523
1992	2878760647	2878760144	Bacteria	6823465
1993	2878767728	2878767105	Bacteria	6898628
1994	2881149720	2881147464	Bacteria	7779814
1995	2881166600	2881161766	Bacteria	7127907
1996	2881846532	2881845957	Bacteria	6611900
1997	2881854183	2881853255	Bacteria	6698367
1998	2882636557	2882632389	Bacteria	8154593
1999	2882919639	2882912400	Bacteria	6801539
2000	2885313918	2885312484	Bacteria	6415165
2001	2885345566	2885342637	Bacteria	7011821
2002	2889039748	2889033259	Bacteria	9099371
2003	2896391122	2896384573	Bacteria	7700774
2004	2903495616	2903492973	Bacteria	13473544
2005	2903541213	2903540706	Bacteria	7062119
2006	2903772445	2903768456	Bacteria	9749579
2007	2904664490	2904659560	Bacteria	6685615
2008	2904697470	2904690495	Bacteria	9412302
2009	2904705215
2010	2908762074	2908756301	Bacteria	8864324
2011	2909044954	2909042592	Bacteria	6499737
2012	2920761286	2920760137	Bacteria	7427611
2013	2924776393	2924776078	Bacteria	7492003
2014	2924789929	2924784321	Bacteria	7416538
2015	2928157526	2928157003	Bacteria	7522202
2016	2928165340	2928163908	Bacteria	7561269
2017	2928174316	2928170801	Bacteria	8785406
2018	2928526026	2928521798	Bacteria	4960112
2019	2933020546	2933016740	Bacteria	6355406
2020	2933571677	2933570622	Bacteria	7023390
2021	2933605045	2933599457	Bacteria	5858799
2022	2935634403	2935630451	Bacteria	8169952
2023	2935905575	2935901341	Bacteria	7341747
2024	2936372590	2936367885	Bacteria	7324495
2025	2936376413	2936375103	Bacteria	6652732
2026	2936387134	2936381700	Bacteria	7006523
2027	2937995069	2937994558	Bacteria	7036190
2028	2941508889	2941507105	Bacteria	8166816
2029	2941516718	2941515067	Bacteria	8166720
2030	2941525188	2941523033	Bacteria	8169134
2031	2954011880	2954011201	Bacteria	4762601
2032	2958165666	2958165035	Bacteria	6906348
2033	2961119489	2961114664	Bacteria	6680456
2034	2961164125	2961163497	Bacteria	6901077
2035	2961170907	2961170736	Bacteria	7072258
2036	2965018809	2965018300	Bacteria	6883036
2037	2965019686	2965018300	Bacteria	6883036
2038	2968003486	2967996073	Bacteria	6787468
2039	2968004253	2968003550	Bacteria	6929263
2040	2968115744	2968110612	Bacteria	6814636
2041	2968172528	2968171901	Bacteria	6894245
2042	2970503497	2970503327	Bacteria	7099517
2043	2970555500	2970554993	Bacteria	6814252
2044	2977822934	2977821940	Bacteria	6906439
2045	2977832604	2977828996	Bacteria	7007971
2046	2977927468	2977922695	Bacteria	6956781
2047	2979815726	2979808191	Bacteria	7179355
2048	2981990565	2981990288	Bacteria	7590678
2049	2987660133	2987659509	Bacteria	6966464
2050	2989355328	2989349275	Bacteria	6349068
2051	3004169213	3004167301	Bacteria	8330599
2052	3004189181	3004188549	Bacteria	6952365
2053	3004335053	3004334049	Bacteria	8449246
2054	637075088	637000159	Bacteria	7596297
2055	642418458	641736154	Bacteria	7689995
2056	8004375290	8004374579	Bacteria	6898112
2057	8005280667	8005275841	Bacteria	6929066
2058	8005287011	8005282627	Bacteria	6675747
2059	8005293188	8005289223	Bacteria	6634003
2060	8005309832	8005307578	Bacteria	7395396
2061	8005379328	8005376324	Bacteria	6590079
2062	8005388424	8005382845	Bacteria	6732062
2063	8005434540	8005430974	Bacteria	6689030
2064	8005500428	8005497431	Bacteria	6477605
2065	8005557603	8005556819	Bacteria	6908598
2066	8005574338	8005570704	Bacteria	6957481
2067	8005621804	8005619151	Bacteria	7030230
2068	8005626621	8005626139	Bacteria	6534237
2069	8005651656	8005645114	Bacteria	6950293
2070	8005671846	8005668836	Bacteria	6953162
2071	8006965838	8006964411	Bacteria	8966052
2072	8006986483	8006984368	Bacteria	9651211
2073	8006995940	8006994254	Bacteria	8309700
2074	8018179737	8018176218	Bacteria	6896178
2075	8018846423	8018845410	Bacteria	8933938
2076	8021120921	8021120328	Bacteria	8782274
2077	8023685277	8023680758	Bacteria	7729763
2078	8047675850	8047673197	Bacteria	7395230
2079	8054560717	8054558443	Bacteria	5204801
2080	8056376720	8056375014	Bacteria	7006639
2081	8056387925	8056382006	Bacteria	6408074
2082	8056673774	8056673599	Bacteria	7871253
2083	8056691733	8056689827	Bacteria	6712655
2084	nmdc:mga05p37_103851_c1
2085	JGI24740J21852_10041907
2086	JGI24740J21852_10054674
2087	JGI24740J21852_10098950
2088	JGI24739J22299_10007431
2089	JGI24739J22299_10128685
2090	JGI24737J22298_10065588
2091	JGI24743J22301_10066113
2092	JGI24735J21928_10071275
2093	JGI24033J26618_1050241
2094	JGI24742J22300_10098037
2095	JGI25152J39213_1005749
2096	JGI25150J39212_1020455
2097	JGI25151J46595_10000019
2098	JGI25151J46595_10000039
2099	JGI25151J46595_10005366
2100	JGI25406J46586_10000580
2101	JGI25406J46586_10003693
2102	JGI25406J46586_10255405
2103	JGI25153J46596_10020719
2104	rootH2_10081585
2105	rootL2_10012908
2106	rootL2_10012936
2107	rootL2_10026479
2108	rootH1_10034705
2109	rootH1_10072664
2110	JGI25160J50197_1022447
2111	JGI25161J50226_1001412
2112	JGI25404J52841_10006637
2113	JGI25404J52841_10009203
2114	JGI25404J52841_10024006
2115	JGI25404J52841_10095234
2116	Ga0055532_1001352
2117	Ga0055526_1000490
2118	Ga0055526_1001293
2119	Ga0055526_1008753
2120	Ga0055524_1000104
2121	Ga0055524_1000377
2122	Ga0055524_1001266
2123	Ga0055524_1008537
2124	Ga0055524_1017124
2125	Ga0055528_1001616
2126	Ga0055528_1003033
2127	Ga0055541_1018105
2128	Ga0058692_1005805
2129	JGI25405J52794_10032168
2130	Ga0055543_1000668
2131	Ga0065165_1083718
2132	Ga0070658_10071259
2133	Ga0070658_10217097
2134	Ga0070658_10351064
2135	Ga0070658_10444708
2136	Ga0070658_10493897
2137	Ga0070658_11123377
2138	Ga0070676_10412974
2139	Ga0070676_10520939
2140	Ga0070676_10838125
2141	Ga0070683_100957039
2142	Ga0070683_101577434
2143	Ga0070690_100065286
2144	Ga0070690_100275338
2145	Ga0070670_100092493
2146	Ga0070670_100159970
2147	Ga0070670_100633992
2148	Ga0068869_100009913
2149	Ga0068869_100206253
2150	Ga0068869_100234842
2151	Ga0068869_102087818
2152	Ga0068869_102123220
2153	Ga0070666_10065588
2154	Ga0070666_10313099
2155	Ga0070666_10958734
2156	Ga0070680_100000131
2157	Ga0070680_100003117
2158	Ga0070680_100070560
2159	Ga0070682_100068407
2160	Ga0070682_100674523
2161	Ga0068868_100197515
2162	Ga0068868_100530745
2163	Ga0068868_101799724
2164	Ga0070660_100000164
2165	Ga0070660_100090610
2166	Ga0070660_100165571
2167	Ga0070660_100297898
2168	Ga0070660_100408726
2169	Ga0070660_100498956
2170	Ga0070660_100525728
2171	Ga0070660_100818530
2172	Ga0070660_100928051
2173	Ga0070689_100143370
2174	Ga0070689_101355895
2175	Ga0070691_10509583
2176	Ga0070691_10885391
2177	Ga0070687_100046647
2178	Ga0070687_100149968
2179	Ga0070661_100124797
2180	Ga0070661_100288824
2181	Ga0070661_100528707
2182	Ga0070661_100662386
2183	Ga0070661_101254517
2184	Ga0070692_10841781
2185	Ga0070668_100050008
2186	Ga0070668_100232228
2187	Ga0070668_100410551
2188	Ga0070668_100704700
2189	Ga0070668_100726372
2190	Ga0070668_100826353
2191	Ga0070669_100271489
2192	Ga0070669_100375452
2193	Ga0070669_101973631
2194	Ga0070675_100192528
2195	Ga0070675_100221143
2196	Ga0070675_100896733
2197	Ga0070671_100007126
2198	Ga0070671_100246197
2199	Ga0070671_100283253
2200	Ga0070671_100430471
2201	Ga0070674_100014571
2202	Ga0070674_100079943
2203	Ga0070674_100115388
2204	Ga0070674_100278062
2205	Ga0070674_100491646
2206	Ga0070674_101089866
2207	Ga0070674_101621353
2208	Ga0070673_100032500
2209	Ga0070673_100467822
2210	Ga0070673_101174097
2211	Ga0070688_100260774
2212	Ga0070659_100000128
2213	Ga0070659_100037717
2214	Ga0070659_100040147
2215	Ga0070659_100058500
2216	Ga0070659_100340358
2217	Ga0070659_101222068
2218	Ga0070667_100344369
2219	Ga0070667_101890677
2220	Ga0070703_10001384
2221	Ga0070709_10001085
2222	Ga0070709_10673790
2223	Ga0070709_10900162
2224	Ga0070714_100033077
2225	Ga0070714_100042322
2226	Ga0070714_100209117
2227	Ga0070714_102004465
2228	Ga0070713_100008466
2229	Ga0070713_100032474
2230	Ga0070713_100182121
2231	Ga0070710_10001483
2232	Ga0070710_10154041
2233	Ga0070710_10511341
2234	Ga0070710_10678838
2235	Ga0070701_10137612
2236	Ga0070711_100000833
2237	Ga0070711_100063722
2238	Ga0070711_101322626
2239	Ga0070705_100002172
2240	Ga0070700_100002573
2241	Ga0070700_100006013
2242	Ga0070694_100920355
2243	Ga0070708_100040322
2244	Ga0070708_100957685
2245	Ga0070708_101538185
2246	Ga0070708_101710009
2247	Ga0070663_100002316
2248	Ga0070663_100007077
2249	Ga0070663_100022076
2250	Ga0070663_100099940
2251	Ga0070663_100167588
2252	Ga0070663_100414280
2253	Ga0070663_101052165
2254	Ga0070663_101337014
2255	Ga0070678_100150815
2256	Ga0070678_100859734
2257	Ga0070678_100967874
2258	Ga0070678_100984242
2259	Ga0070662_100048934
2260	Ga0070662_100154769
2261	Ga0070662_100684533
2262	Ga0070662_100722546
2263	Ga0070662_100746758
2264	Ga0070662_101622982
2265	Ga0070681_10000021
2266	Ga0070681_10198217
2267	Ga0070681_10408286
2268	Ga0070681_10690369
2269	Ga0068867_100100996
2270	Ga0068867_100219772
2271	Ga0068867_101138940
2272	Ga0068867_101294565
2273	Ga0070685_10321077
2274	Ga0070706_100465656
2275	Ga0070706_100529174
2276	Ga0070706_101214053
2277	Ga0070706_102020930
2278	Ga0070707_100325697
2279	Ga0070707_100954358
2280	Ga0070707_102281822
2281	Ga0070698_100298207
2282	Ga0070698_101139874
2283	Ga0070699_100000444
2284	Ga0070699_102050258
2285	Ga0070679_100000848
2286	Ga0070679_100156663
2287	Ga0070679_100713184
2288	Ga0070684_100926684
2289	Ga0070684_102124160
2290	Ga0070697_100928432
2291	Ga0068853_100211606
2292	Ga0068853_100220773
2293	Ga0068853_100805484
2294	Ga0068853_101840253
2295	Ga0070672_100091058
2296	Ga0070672_100286076
2297	Ga0070686_100657338
2298	Ga0070695_100070926
2299	Ga0070696_100000123
2300	Ga0070696_100112212
2301	Ga0070696_100222159
2302	Ga0070693_100008394
2303	Ga0070693_100165569
2304	Ga0070665_100004851
2305	Ga0070665_100014726
2306	Ga0070665_100022028
2307	Ga0070665_100023861
2308	Ga0070665_100034562
2309	Ga0070665_100043926
2310	Ga0070665_100049039
2311	Ga0070665_100110571
2312	Ga0070665_100272212
2313	Ga0070665_100323155
2314	Ga0070665_100480746
2315	Ga0070665_100788778
2316	Ga0070665_101708048
2317	Ga0070704_100000095
2318	Ga0068855_100255514
2319	Ga0068855_100528922
2320	Ga0068855_100626380
2321	Ga0068855_100643355
2322	Ga0068855_100659921
2323	Ga0068855_102027822
2324	Ga0070664_100050158
2325	Ga0070664_100294796
2326	Ga0070664_100736825
2327	Ga0070664_100845793
2328	Ga0068857_100003759
2329	Ga0068857_100093791
2330	Ga0068857_100140907
2331	Ga0068857_100424867
2332	Ga0068854_100101000
2333	Ga0068854_100242606
2334	Ga0068856_100000013
2335	Ga0068856_100197605
2336	Ga0068856_100340158
2337	Ga0068856_100765400
2338	Ga0070702_100051399
2339	Ga0070702_100130670
2340	Ga0070702_100239090
2341	Ga0070702_100618555
2342	Ga0068852_100001360
2343	Ga0068852_100005224
2344	Ga0068852_100032253
2345	Ga0068852_100146541
2346	Ga0068852_100324416
2347	Ga0068859_100001820
2348	Ga0068859_100255350
2349	Ga0068864_100031215
2350	Ga0068864_100033280
2351	Ga0068864_100049303
2352	Ga0068864_100524834
2353	Ga0068866_10053091
2354	Ga0068866_10301356
2355	Ga0068861_100004883
2356	Ga0068861_100076485
2357	Ga0068861_100400345
2358	Ga0068861_100509272
2359	Ga0068861_102231249
2360	Ga0068851_10156582
2361	Ga0068851_10166511
2362	Ga0068870_10068896
2363	Ga0068870_10369650
2364	Ga0068863_100385737
2365	Ga0068863_100794768
2366	Ga0068858_100003992
2367	Ga0068858_100209639
2368	Ga0068858_100350008
2369	Ga0068858_100956261
2370	Ga0068860_100002696
2371	Ga0068860_100086532
2372	Ga0068860_100386960
2373	Ga0068860_100565889
2374	Ga0068860_100977962
2375	Ga0068862_100083453
2376	Ga0068862_100132303
2377	Ga0068862_100527555
2378	Ga0068862_100671179
2379	Ga0068862_100714777
2380	Ga0068862_100744304
2381	Ga0068862_100765090
2382	Ga0068862_100904907
2383	Ga0081455_10002516
2384	Ga0081455_10005510
2385	Ga0081455_10007059
2386	Ga0081455_10011303
2387	Ga0081455_10096781
2388	Ga0081455_10353122
2389	Ga0081455_10967520
2390	Ga0081538_10009365
2391	Ga0081538_10023382
2392	Ga0081538_10080152
2393	Ga0081540_1004444
2394	Ga0081540_1005727
2395	Ga0081540_1008113
2396	Ga0081540_1011527
2397	Ga0081540_1012092
2398	Ga0081540_1054003
2399	Ga0081540_1250835
2400	Ga0081539_10000321
2401	Ga0081539_10000747
2402	Ga0081539_10036458
2403	Ga0081539_10061707
2404	Ga0081539_10247343
2405	Ga0070717_10158236
2406	Ga0070717_10442351
2407	Ga0070717_10477302
2408	Ga0070717_10682416
2409	Ga0070717_10927950
2410	Ga0070717_11083283
2411	Ga0070717_11516741
2412	Ga0075365_10001032
2413	Ga0075365_10003599
2414	Ga0075365_10003713
2415	Ga0075365_10027545
2416	Ga0075365_10121151
2417	Ga0075365_10173966
2418	Ga0075365_10254937
2419	Ga0075365_10285878
2420	Ga0075365_10353774
2421	Ga0075365_10389614
2422	Ga0075365_10430996
2423	Ga0075365_10668668
2424	Ga0075365_11013684
2425	Ga0075368_10086400
2426	Ga0075368_10123903
2427	Ga0075368_10129371
2428	Ga0075368_10177505
2429	Ga0075368_10183979
2430	Ga0075368_10184082
2431	Ga0075368_10325817
2432	Ga0075368_10456266
2433	Ga0075363_100003578
2434	Ga0075363_100009475
2435	Ga0075363_100030992
2436	Ga0075363_100077529
2437	Ga0075363_100354336
2438	Ga0075363_100378440
2439	Ga0075363_100947053
2440	Ga0075364_10028877
2441	Ga0075364_10081820
2442	Ga0075364_10104366
2443	Ga0075364_10145504
2444	Ga0075364_10394820
2445	Ga0075364_10581388
2446	Ga0070715_10004391
2447	Ga0070716_100002916
2448	Ga0070712_100006043
2449	Ga0070712_100088087
2450	Ga0070712_100531868
2451	Ga0075362_10000141
2452	Ga0075362_10023752
2453	Ga0075362_10040280
2454	Ga0075362_10060225
2455	Ga0075362_10149629
2456	Ga0075362_10190172
2457	Ga0075362_10243297
2458	Ga0075362_10261832
2459	Ga0075367_10002608
2460	Ga0075367_10005099
2461	Ga0075367_10007744
2462	Ga0075367_10010345
2463	Ga0075367_10058646
2464	Ga0075367_10163966
2465	Ga0075367_10279259
2466	Ga0075367_10320019
2467	Ga0075367_10521145
2468	Ga0075367_10547267
2469	Ga0075367_10903326
2470	Ga0075367_11041271
2471	Ga0075369_10001683
2472	Ga0075369_10099812
2473	Ga0075369_10247360
2474	Ga0075369_10446726
2475	Ga0075366_10005088
2476	Ga0075366_10046334
2477	Ga0075366_10058002
2478	Ga0075366_10086837
2479	Ga0075366_10089071
2480	Ga0075366_10213473
2481	Ga0075366_10233198
2482	Ga0075366_10319550
2483	Ga0075366_10351545
2484	Ga0075366_10427579
2485	Ga0075366_10458470
2486	Ga0075366_10686404
2487	Ga0075366_10706599
2488	Ga0097621_100039813
2489	Ga0097621_100208823
2490	Ga0097621_100420301
2491	Ga0075370_10001891
2492	Ga0075370_10002484
2493	Ga0075370_10076249
2494	Ga0075370_10200903
2495	Ga0075370_10308484
2496	Ga0075370_11000072
2497	Ga0068871_101118751
2498	Ga0068871_101230783
2499	Ga0075428_100042345
2500	Ga0075428_100112557
2501	Ga0075428_100436746
2502	Ga0075428_100683821
2503	Ga0075430_100000037
2504	Ga0075430_100087029
2505	Ga0075430_100231344
2506	Ga0075431_100059835
2507	Ga0075431_100374515
2508	Ga0075433_10811247
2509	Ga0075433_11945091
2510	Ga0075434_100253514
2511	Ga0075434_100725586
2512	Ga0075434_100738104
2513	Ga0075429_100635937
2514	Ga0075429_100718999
2515	Ga0075429_100831132
2516	Ga0068865_100391186
2517	Ga0068865_100926277
2518	Ga0075436_100143191
2519	Ga0075436_100650566
2520	Ga0097620_100001820
2521	Ga0097620_100255358
2522	Ga0099824_1002092
2523	Ga0099826_10120045
2524	Ga0075435_100074820
2525	Ga0075435_100290880
2526	Ga0075435_100354633
2527	Ga0075435_100484916
2528	Ga0075435_101383198
2529	Ga0075435_101437198
2530	Ga0099794_10055519
2531	Ga0099795_10062697
2532	Ga0099795_10102503
2533	Ga0105240_10069714
2534	Ga0105240_10138170
2535	Ga0105240_10285467
2536	Ga0105240_10324308
2537	Ga0105240_10372837
2538	Ga0105240_10904421
2539	Ga0105240_10914286
2540	Ga0105240_11141206
2541	Ga0105240_11546654
2542	Ga0111539_10162461
2543	Ga0111539_12823476
2544	Ga0111539_13463140
2545	Ga0105245_10366945
2546	Ga0105245_10407285
2547	Ga0105245_11903169
2548	Ga0105247_10082767
2549	Ga0105247_10334966
2550	Ga0105247_10877117
2551	Ga0105247_11017401
2552	Ga0105247_11293811
2553	Ga0114129_10075151
2554	Ga0114129_10129694
2555	Ga0114129_10279201
2556	Ga0114129_11757891
2557	Ga0114129_11786437
2558	Ga0105243_10129496
2559	Ga0105243_10133638
2560	Ga0105243_10215088
2561	Ga0105243_10325073
2562	Ga0105243_12078063
2563	Ga0105243_12487544
2564	Ga0105243_12658416
2565	Ga0105241_10015190
2566	Ga0105241_10363259
2567	Ga0105241_10500831
2568	Ga0105241_11316973
2569	Ga0105242_10144122
2570	Ga0105242_10312097
2571	Ga0105242_10595339
2572	Ga0105242_10795696
2573	Ga0105242_10936787
2574	Ga0105242_11160411
2575	Ga0105242_12619151
2576	Ga0105248_10007493
2577	Ga0105248_10091364
2578	Ga0105248_10299872
2579	Ga0105248_10501711
2580	Ga0105248_10671839
2581	Ga0105248_10868913
2582	Ga0105248_11146304
2583	Ga0105248_11658218
2584	Ga0105237_10002582
2585	Ga0105237_10059958
2586	Ga0105237_10098862
2587	Ga0105237_10276374
2588	Ga0105237_10465687
2589	Ga0105237_10725369
2590	Ga0105237_10775115
2591	Ga0105237_11605561
2592	Ga0105237_11668273
2593	Ga0105237_11765233
2594	Ga0105238_10048232
2595	Ga0105238_10134848
2596	Ga0105238_10291650
2597	Ga0105238_11022278
2598	Ga0105238_11459933
2599	Ga0105238_12820790
2600	Ga0105249_10129545
2601	Ga0105249_10617507
2602	Ga0105249_10945909
2603	Ga0105249_11556546
2604	Ga0105249_11625109
2605	Ga0123341_1000037
2606	Ga0105035_126637
2607	Ga0099796_10000574
2608	Ga0105239_10005031
2609	Ga0105239_10026092
2610	Ga0105239_10034721
2611	Ga0105239_10104978
2612	Ga0105239_10166254
2613	Ga0105239_10169603
2614	Ga0105239_10229010
2615	Ga0105239_10311769
2616	Ga0105239_10352164
2617	Ga0105239_10619811
2618	Ga0105239_10927726
2619	Ga0105239_11078186
2620	Ga0105239_11296041
2621	Ga0105239_11495100
2622	Ga0105239_12259265
2623	Ga0105239_12567028
2624	Ga0105239_12859549
2625	Ga0105239_13279263
2626	Ga0105246_10010636
2627	Ga0105246_10073260
2628	Ga0105246_10114723
2629	Ga0105246_10255655
2630	Ga0105246_11096333
2631	Ga0105246_11249900
2632	Ga0105246_11733515
2633	Ga0157317_1022509
2634	Ga0157373_10038651
2635	Ga0157371_10386092
2636	Ga0157370_10347522
2637	Ga0157370_10781770
2638	Ga0157370_11068408
2639	Ga0157369_10008090
2640	Ga0157369_10128224
2641	Ga0157369_10442115
2642	Ga0157369_10624236
2643	Ga0157369_10656090
2644	Ga0157369_11941705
2645	Ga0171463_1002
2646	Ga0157374_10156200
2647	Ga0157374_10733308
2648	Ga0157374_10873901
2649	Ga0157378_10002606
2650	Ga0157378_10224697
2651	Ga0157378_10523739
2652	Ga0157378_10559619
2653	Ga0157378_11268470
2654	Ga0157378_11316628
2655	Ga0157378_11547051
2656	Ga0163162_10120108
2657	Ga0163162_10168044
2658	Ga0163162_10496117
2659	Ga0163162_10864477
2660	Ga0163162_10933611
2661	Ga0163162_11111089
2662	Ga0163162_11811749
2663	Ga0163162_11894856
2664	Ga0157372_10491651
2665	Ga0157372_10508750
2666	Ga0157372_10922444
2667	Ga0157372_11680180
2668	Ga0157375_10032932
2669	Ga0157375_10542392
2670	Ga0157375_10618318
2671	Ga0157375_10871382
2672	Ga0157375_10914337
2673	Ga0157375_12680738
2674	Ga0157375_13052074
2675	Ga0157375_13814934
2676	Ga0163163_10000002
2677	Ga0163163_10039965
2678	Ga0163163_10089635
2679	Ga0163163_10188905
2680	Ga0163163_10233630
2681	Ga0163163_10236803
2682	Ga0163163_10403024
2683	Ga0163163_10450970
2684	Ga0163163_10556471
2685	Ga0163163_10786091
2686	Ga0163163_12078679
2687	Ga0163163_12244518
2688	Ga0157380_10081715
2689	Ga0157380_10222182
2690	Ga0157380_10923960
2691	Ga0157380_11115912
2692	Ga0157380_11599818
2693	Ga0157380_12531069
2694	Ga0157380_13032270
2695	Ga0182008_10142137
2696	Ga0157377_10042992
2697	Ga0157377_10552740
2698	Ga0157379_10004112
2699	Ga0157379_10023394
2700	Ga0157379_11364101
2701	Ga0157379_11451082
2702	Ga0157376_10070257
2703	Ga0157376_10072383
2704	Ga0157376_10348818
2705	Ga0157376_12083231
2706	Ga0157376_12652137
2707	Ga0157376_12790267
2708	Ga0182006_1104035
2709	Ga0182005_1070042
2710	Ga0183363_1014
2711	Ga0163161_10189300
2712	Ga0163161_11480397
2713	Ga0206353_10336961
2714	Ga0214542_1017541
2715	Ga0214543_1000022
2716	Ga0213873_10056611
2717	Ga0213873_10124566
2718	Ga0213872_10012424
2719	Ga0213872_10194287
2720	Ga0213872_10437959
2721	Ga0213874_10100746
2722	Ga0213874_10105554
2723	Ga0213876_10002341
2724	Ga0213876_10064326
2725	Ga0213876_10711195
2726	Ga0213875_10000567
2727	Ga0213871_10024609
2728	Ga0224572_1015101
2729	Ga0209566_100577
2730	Ga0209674_102946
2731	Ga0209147_101727
2732	Ga0207425_1014365
2733	Ga0209026_1003948
2734	Ga0209129_1000376
2735	Ga0209233_1082141
2736	Ga0209565_1071048
2737	Ga0209673_1000013
2738	Ga0209673_1000296
2739	Ga0209673_1001781
2740	Ga0209673_1029369
2741	Ga0209675_1000430
2742	Ga0209675_1015279
2743	Ga0209675_1083105
2744	Ga0209676_1019122
2745	Ga0209676_1040727
2746	Ga0209025_1000008
2747	Ga0209025_1000166
2748	Ga0209564_1000041
2749	Ga0209564_1000584
2750	Ga0209564_1000920
2751	Ga0209758_1000070
2752	Ga0209758_1000218
2753	Ga0209758_1019612
2754	Ga0209758_1046771
2755	Ga0209256_1000062
2756	Ga0209256_1000073
2757	Ga0209256_1000588
2758	Ga0209256_1000701
2759	Ga0209256_1001224
2760	Ga0209256_1026063
2761	Ga0207426_1000039
2762	Ga0207426_1062497
2763	Ga0209051_1002479
2764	Ga0209257_1032296
2765	Ga0209257_1049756
2766	Ga0207697_10059423
2767	Ga0207697_10187631
2768	Ga0207697_10200463
2769	Ga0207656_10159050
2770	Ga0207653_10000615
2771	Ga0207692_10001427
2772	Ga0207692_10310609
2773	Ga0207642_10066517
2774	Ga0207710_10128973
2775	Ga0207710_10474204
2776	Ga0207710_10531815
2777	Ga0207688_10025252
2778	Ga0207688_10233509
2779	Ga0207688_10351845
2780	Ga0207688_10630058
2781	Ga0207680_10002785
2782	Ga0207680_10664274
2783	Ga0207647_10006396
2784	Ga0207647_10082426
2785	Ga0207647_10091546
2786	Ga0207647_10123342
2787	Ga0207647_10141757
2788	Ga0207647_10436762
2789	Ga0207685_10006652
2790	Ga0207699_10001072
2791	Ga0207699_10936902
2792	Ga0207645_10106586
2793	Ga0207645_10594611
2794	Ga0207643_10104579
2795	Ga0207643_10250487
2796	Ga0207705_10016043
2797	Ga0207705_10370599
2798	Ga0207705_10485394
2799	Ga0207705_10776272
2800	Ga0207684_10354482
2801	Ga0207684_11570595
2802	Ga0207707_10000002
2803	Ga0207707_10046627
2804	Ga0207707_10200232
2805	Ga0207707_10721712
2806	Ga0207707_11431328
2807	Ga0207707_11582169
2808	Ga0207695_10127664
2809	Ga0207695_10653160
2810	Ga0207695_10847778
2811	Ga0207695_11152951
2812	Ga0207671_10003373
2813	Ga0207671_10021630
2814	Ga0207671_10074286
2815	Ga0207671_10133000
2816	Ga0207671_10310246
2817	Ga0207671_11026713
2818	Ga0207693_10097994
2819	Ga0207663_10019959
2820	Ga0207660_10001673
2821	Ga0207660_10007389
2822	Ga0207660_10800564
2823	Ga0207660_11358848
2824	Ga0207662_10117496
2825	Ga0207662_10617958
2826	Ga0207657_10000247
2827	Ga0207657_10007738
2828	Ga0207657_10023603
2829	Ga0207657_10150277
2830	Ga0207657_10159128
2831	Ga0207657_10161985
2832	Ga0207657_10282141
2833	Ga0207657_10536839
2834	Ga0207649_10215555
2835	Ga0207649_10283839
2836	Ga0207649_10392450
2837	Ga0207649_10904327
2838	Ga0207652_10000464
2839	Ga0207652_10349359
2840	Ga0207652_11181254
2841	Ga0207652_11402202
2842	Ga0207646_10400030
2843	Ga0207681_10322870
2844	Ga0207681_10347366
2845	Ga0207681_10792114
2846	Ga0207694_10033752
2847	Ga0207694_10071955
2848	Ga0207694_10092795
2849	Ga0207694_10174147
2850	Ga0207694_10401517
2851	Ga0207650_11514880
2852	Ga0207659_10125711
2853	Ga0207659_10363493
2854	Ga0207659_10435641
2855	Ga0207659_10925903
2856	Ga0207687_10040137
2857	Ga0207687_10663806
2858	Ga0207687_10924736
2859	Ga0207687_11349123
2860	Ga0207700_10005335
2861	Ga0207700_10012968
2862	Ga0207700_11055231
2863	Ga0207700_11491814
2864	Ga0207700_11519844
2865	Ga0207700_11805551
2866	Ga0207664_10082405
2867	Ga0207664_10405489
2868	Ga0207644_10310872
2869	Ga0207644_11082551
2870	Ga0207690_10000141
2871	Ga0207690_10233849
2872	Ga0207690_10477520
2873	Ga0207690_10764160
2874	Ga0207690_11557171
2875	Ga0207706_10055929
2876	Ga0207706_10110810
2877	Ga0207706_10225981
2878	Ga0207706_10607093
2879	Ga0207706_10609851
2880	Ga0207706_10625896
2881	Ga0207706_11176968
2882	Ga0207686_10104957
2883	Ga0207686_10149336
2884	Ga0207686_10447221
2885	Ga0207686_10494893
2886	Ga0207709_10264591
2887	Ga0207709_10389535
2888	Ga0207709_11821174
2889	Ga0207670_10075800
2890	Ga0207669_10009478
2891	Ga0207669_10012958
2892	Ga0207669_10043909
2893	Ga0207669_10430982
2894	Ga0207669_11109911
2895	Ga0207704_10023176
2896	Ga0207704_11419488
2897	Ga0207704_11949102
2898	Ga0207665_10006497
2899	Ga0207665_10030575
2900	Ga0207665_10205799
2901	Ga0207665_10959331
2902	Ga0207691_10046012
2903	Ga0207691_10079254
2904	Ga0207711_10001341
2905	Ga0207711_10018850
2906	Ga0207711_10148460
2907	Ga0207711_10403985
2908	Ga0207711_10938619
2909	Ga0207711_11769962
2910	Ga0207689_10259801
2911	Ga0207689_10269238
2912	Ga0207689_10402632
2913	Ga0207689_11674923
2914	Ga0207661_10003202
2915	Ga0207679_10011227
2916	Ga0207679_10496903
2917	Ga0207667_10010886
2918	Ga0207667_10011464
2919	Ga0207667_10109658
2920	Ga0207667_10219422
2921	Ga0207667_10263151
2922	Ga0207667_10787852
2923	Ga0207667_11619517
2924	Ga0207667_11787937
2925	Ga0207651_10381112
2926	Ga0207712_10038467
2927	Ga0207712_10131807
2928	Ga0207712_10234096
2929	Ga0207712_10250557
2930	Ga0207712_10906187
2931	Ga0207712_10990967
2932	Ga0207712_11319443
2933	Ga0207712_11809031
2934	Ga0207668_10589204
2935	Ga0207668_10800713
2936	Ga0207668_11954878
2937	Ga0207640_10100139
2938	Ga0207640_10257223
2939	Ga0207658_10121941
2940	Ga0207658_10872723
2941	Ga0207658_11310676
2942	Ga0207677_10051163
2943	Ga0207677_10258355
2944	Ga0207677_11050462
2945	Ga0207703_10027373
2946	Ga0207703_10479058
2947	Ga0207703_11353120
2948	Ga0207639_10149678
2949	Ga0207639_10161668
2950	Ga0207639_10164711
2951	Ga0207639_10813625
2952	Ga0207639_11146895
2953	Ga0207639_11252024
2954	Ga0207678_10000298
2955	Ga0207678_10006547
2956	Ga0207678_10026749
2957	Ga0207678_10133783
2958	Ga0207678_10141472
2959	Ga0207678_10469206
2960	Ga0207678_10682491
2961	Ga0207678_10799390
2962	Ga0207678_11908516
2963	Ga0207708_10000488
2964	Ga0207708_11320784
2965	Ga0207702_10000224
2966	Ga0207702_10162086
2967	Ga0207702_10186602
2968	Ga0207702_10874852
2969	Ga0207702_10941793
2970	Ga0207702_11316602
2971	Ga0207702_11926285
2972	Ga0207702_12081629
2973	Ga0207702_12097120
2974	Ga0207641_10020766
2975	Ga0207641_10190145
2976	Ga0207641_10493373
2977	Ga0207648_10001639
2978	Ga0207648_10249087
2979	Ga0207648_10365217
2980	Ga0207648_10574120
2981	Ga0207676_10011695
2982	Ga0207676_10032138
2983	Ga0207676_10073216
2984	Ga0207676_10497401
2985	Ga0207674_10003790
2986	Ga0207674_10004426
2987	Ga0207674_10022610
2988	Ga0207674_10058334
2989	Ga0207674_10649625
2990	Ga0207674_11170017
2991	Ga0207675_100015329
2992	Ga0207675_100094558
2993	Ga0207675_100313940
2994	Ga0207675_101821253
2995	Ga0207683_10055636
2996	Ga0207683_10061835
2997	Ga0207683_10242801
2998	Ga0207683_10320560
2999	Ga0207683_10497417
3000	Ga0207683_10936226
3001	Ga0207698_10010568
3002	Ga0207698_10379234
3003	Ga0207698_10476157
3004	Ga0207698_11983246
3005	Ga0209371_1002340
3006	Ga0209589_1000018
3007	Ga0209489_100026
3008	Ga0209700_100035
3009	Ga0209588_1029951
3010	Ga0209813_10008952
3011	Ga0209813_10024811
3012	Ga0209813_10084030
3013	Ga0209813_10262958
3014	Ga0268266_10000520
3015	Ga0268266_10000677
3016	Ga0268266_10013772
3017	Ga0268266_10020193
3018	Ga0268266_10020817
3019	Ga0268266_10036179
3020	Ga0268266_10059646
3021	Ga0268266_10106918
3022	Ga0268266_10125200
3023	Ga0268266_10284891
3024	Ga0268266_10418524
3025	Ga0268266_10450168
3026	Ga0268266_10790804
3027	Ga0268266_10903935
3028	Ga0268266_11003957
3029	Ga0268265_10002012
3030	Ga0268265_10007219
3031	Ga0268265_10082128
3032	Ga0268265_11505718
3033	Ga0268264_10016842
3034	Ga0268264_10078255
3035	Ga0268264_10229027
3036	Ga0268264_10879382
3037	Ga0268264_11556884
3038	Ga0268264_11672764
3039	Ga0268264_11795418
3040	Ga0265334_10322324
3041	Ga0265318_10018533
3042	Ga0307515_10163787
3043	Ga0307515_10167621
3044	Ga0307515_10745247
3045	Ga0265338_11072167
3046	Ga0268256_1005674
3047	Ga0307511_10000816
3048	Ga0307512_10130021
3049	Ga0307512_10246785
3050	Ga0265760_10005306
3051	Ga0265760_10007611
3052	Ga0265760_10103215
3053	Ga0265330_10035795
3054	Ga0265330_10139317
3055	Ga0265332_10002054
3056	Ga0265332_10015628
3057	Ga0265328_10110014
3058	Ga0265320_10014980
3059	Ga0265325_10009829
3060	Ga0265329_10046852
3061	Ga0265329_10093141
3062	Ga0265340_10014600
3063	Ga0265340_10065023
3064	Ga0265340_10228928
3065	Ga0265339_10142334
3066	Ga0265331_10012416
3067	Ga0265331_10210023
3068	Ga0265331_10263860
3069	Ga0265316_10032983
3070	Ga0265316_10078142
3071	Ga0307513_10103757
3072	Ga0307513_10234001
3073	Ga0307513_10301496
3074	Ga0307513_10973470
3075	Ga0307509_10137346
3076	Ga0307408_100418166
3077	Ga0265313_10007132
3078	Ga0265313_10246998
3079	Ga0307508_10000009
3080	Ga0307508_10233971
3081	Ga0307508_10820838
3082	Ga0307508_10911460
3083	Ga0265314_10080838
3084	Ga0265314_10112805
3085	Ga0265314_10414393
3086	Ga0265342_10000011
3087	Ga0265342_10006364
3088	Ga0265342_10286633
3089	Ga0307516_10003467
3090	Ga0307516_10345887
3091	Ga0307516_10968496
3092	Ga0307405_11934477
3093	Ga0307410_10287561
3094	Ga0307410_10316307
3095	Ga0307406_10020464
3096	Ga0307406_10080803
3097	Ga0307406_10632250
3098	Ga0307406_11053062
3099	Ga0307407_10106184
3100	Ga0307407_10668409
3101	Ga0307407_10803439
3102	Ga0307412_10672187
3103	Ga0307409_100428380
3104	Ga0307409_100613927
3105	Ga0307409_100960498
3106	Ga0307409_101220956
3107	Ga0307409_102395252
3108	Ga0307416_100303683
3109	Ga0307416_101042499
3110	Ga0307416_101123996
3111	Ga0307414_10233552
3112	Ga0307414_10519467
3113	Ga0307414_10667222
3114	Ga0307414_11605707
3115	Ga0307411_10517328
3116	Ga0307411_10690567
3117	Ga0307415_100501644
3118	Ga0307415_100503987
3119	Ga0307415_100962667
3120	Ga0307415_101519947
3121	Ga0307510_10375415
3122	Ga0373958_0019203
3123	Ga0373959_0094459
3124	Ga0373934_0027888
3125	Ga0373934_0411615
3126	Ga0373940_0174404
3127	Ga0373944_0149511
3128	Ga0373923_0095137
3129	Ga0373923_0202589
3130	Ga0373936_0043729
3131	Ga0373936_0240320
3132	Ga0373939_0053899
3133	Ga0373939_0084650
3134	Ga0373939_0169284
3135	Ga0373945_0360581
3136	Ga0373945_0437163
3137	Ga0373953_0310148
3138	Ga0373954_0005607
3139	Ga0373954_0602464
3140	Ga0373956_0034957
3141	Ga0373956_0070025
3142	Ga0373957_0016236
3143	Ga0373943_0532383
3144	Ga0373946_0021340
3145	Ga0373946_0169206
3146	Ga0373955_0019240
3147	Ga0373955_0024589
3148	Ga0373955_0210696
3149	Ga0373955_0742901
3150	Ga0373942_0055202
3151	Ga0373942_0058024
3152	Ga0373961_0164103
3153	Ga0373924_0186574
3154	Ga0373924_0221795
3155	Ga0373931_0075593
3156	Ga0373931_0433033
3157	Ga0373931_0640897
3158	Ga0373931_0889944
3159	Ga0373927_0036186
3160	Ga0373927_0207693
3161	Ga0373933_0060552
3162	Ga0373933_0101113
3163	Ga0373933_1100631
3164	Ga0373947_0087451
3165	Ga0373947_1229114
3166	Ga0373937_0002711
3167	Ga0373937_0003961
3168	Ga0373937_0303893
3169	Ga0373925_0002572
3170	Ga0373925_0158257
3171	Ga0373925_0765943
3172	Ga0395899_0000003
3173	Ga0395899_0192180
3174	Ga0395899_0525956
3175	Ga0395900_0001131
3176	Ga0395900_0058348
3177	Ga0395900_0106735
3178	Ga0395900_0632823
3179	Ga0395900_0945127
3180	Ga0395900_1598931
3181	Ga0395898_0038058
3182	Ga0395898_0060672
3183	Ga0395898_0159274
3184	Ga0395898_0171163
3185	Ga0395898_0226960
3186	Ga0395898_0308553
3187	Ga0395905_0125392
3188	Ga0395905_0138794
3189	Ga0395905_0267219
3190	Ga0395905_0331583
3191	Ga0395905_0775181
3192	Ga0395905_1419826
3193	Ga0436364_0172671
3194	Ga0436364_0500990
3195	Ga0436364_0665489
3196	Ga0436364_0746920
3197	Ga0436364_0785541
3198	Ga0436364_1027372
3199	Ga0436364_1321283
3200	Ga0436364_1362436
3201	Ga0436364_1463824
3202	Ga0395901_0000044
3203	Ga0395901_0021148
3204	Ga0395901_0240733
3205	Ga0395901_1038707
3206	Ga0395901_1230716
3207	Ga0395901_1798501
3208	Ga0436365_0521938
3209	Ga0436365_1357977
3210	Ga0436365_1608922
3211	Ga0436365_1670112
3212	Ga0436365_1777318
3213	Ga0436365_1860554
3214	Ga0436365_1887675
3215	Ga0436360_0111587
3216	Ga0436360_0405330
3217	Ga0436360_1264813
3218	Ga0436361_0179462
3219	Ga0436361_0197281
3220	Ga0436361_0431568
3221	Ga0436361_0468928
3222	Ga0436361_0588967
3223	Ga0436361_0925713
3224	Ga0436361_0988609
3225	Ga0436361_1217648
3226	Ga0436363_0332812
3227	Ga0436363_0499259
3228	Ga0436363_0607942
3229	Ga0436363_0995396
3230	Ga0436363_1054112
3231	Ga0436363_1058258
3232	Ga0436363_1167218
3233	Ga0436363_1406750
3234	Ga0436362_0126311
3235	Ga0436362_0330482
3236	Ga0436362_0591086
3237	Ga0436362_0652568
3238	Ga0439436_0089484
3239	Ga0439439_0073493
3240	Ga0439465_0083806
3241	Ga0451787_553918
3242	Ga0451791_1281077
3243	Ga0451791_1400659
3244	Ga0451795_0342143
3245	Ga0451795_0535224
3246	Ga0451798_0253149
3247	Ga0451800_1000476
3248	Ga0451802_1695533
3249	Ga0451835_1198724
3250	Ga0451837_1699537
3251	Ga0451845_0994929
3252	Ga0451849_0771493
3253	Ga0451851_0655650
3254	Ga0451843_0704410
3255	Ga0451855_1946526
3256	Ga0451853_0006012
3257	Ga0451853_0632563
3258	Ga0439445_0026733
3259	Ga0439445_0044602
3260	Ga0439445_0078942
3261	Ga0439448_0003740
3262	Ga0439448_0108756
3263	Ga0439448_0227410
3264	Ga0439432_203426
3265	Ga0439449_0180058
3266	Ga0439450_015806
3267	Ga0439455_0048042
3268	Ga0439462_0013455
3269	Ga0450920_032537
3270	Ga0450923_135368
3271	Ga0450923_170193
3272	Ga0450896_045325
3273	Ga0439458_0054221
3274	Ga0439459_0021650
3275	Ga0450918_074193
3276	Ga0466972_0006944
3277	Ga0466972_0214345
3278	Ga0466966_0079532
3279	Ga0466966_0096854
3280	Ga0466966_0153717
3281	Ga0466961_0386724
3282	Ga0466963_0008115
3283	Ga0466963_0028393
3284	Ga0466963_0547262
3285	Ga0466964_0000042
3286	Ga0466964_0003960
3287	Ga0466964_0062835
3288	Ga0466964_0216812
3289	Ga0466971_0018497
3290	Ga0466971_0123837
3291	Ga0466971_0148221
3292	Ga0466968_0000823
3293	Ga0466968_0286992
3294	Ga0466968_0491987
3295	Ga0466970_0000967
3296	Ga0466970_0035952
3297	Ga0466957_0402039
3298	Ga0466957_0409587
3299	Ga0466957_0614825
3300	Ga0466957_0732307
3301	Ga0466957_0800398
3302	Ga0466957_0933025
3303	Ga0466957_0991421
3304	Ga0466960_0657677
3305	Ga0466959_0137998
3306	Ga0466959_0472102
3307	Ga0451576_0618156
3308	Ga0466958_0000235
3309	Ga0466958_0000250
3310	Ga0466958_0030782
3311	Ga0466958_0300880
3312	Ga0466967_0004712
3313	Ga0466967_0196052
3314	Ga0466967_0502942
3315	Ga0495627_000697
3316	Ga0495592_0144530
3317	Ga0495603_0167489
3318	Ga0495590_0034232
3319	Ga0495629_0008183
3320	Ga0495629_0023265
3321	Ga0495629_0473869
3322	Ga0495638_0001335
3323	Ga0495638_0013964
3324	Ga0495638_0209791
3325	Ga0495638_0269867
3326	Ga0495638_0393004
3327	Ga0495638_0434862
3328	Ga0495641_0324564
3329	Ga0495641_0600532
3330	Ga0495651_0180049
3331	Ga0495653_0593403
3332	Ga0495650_0212378
3333	Ga0495580_0074635
3334	Ga0495580_0468250
3335	Ga0495582_0223692
3336	Ga0495605_0000176
3337	Ga0495605_0076697
3338	Ga0495605_0240558
3339	Ga0495639_0095077
3340	Ga0495639_0097392
3341	Ga0495639_0350873
3342	Ga0495664_0023203
3343	Ga0495664_0026254
3344	Ga0495664_0159546
3345	Ga0495664_0252801
3346	Ga0495584_0000031
3347	Ga0495584_0033050
3348	Ga0495584_0139397
3349	Ga0495584_0158075
3350	Ga0495584_0192185
3351	Ga0495584_0483568
3352	Ga0495585_0030548
3353	Ga0495585_0072674
3354	Ga0495594_0000020
3355	Ga0495594_0015757
3356	Ga0495594_0148019
3357	Ga0495607_0003075
3358	Ga0495607_0005290
3359	Ga0495583_0004102
3360	Ga0495583_0431407
3361	Ga0495606_0001852
3362	Ga0495606_0004509
3363	Ga0495606_0071746
3364	Ga0495606_0182340
3365	Ga0495606_0655524
3366	Ga0495610_0118577
3367	Ga0495616_0019309
3368	Ga0495616_0191781
3369	Ga0495616_0239439
3370	Ga0495628_0011771
3371	Ga0495628_0189798
3372	Ga0495628_0424917
3373	Ga0495631_0009371
3374	Ga0495632_0439510
3375	Ga0495643_0035422
3376	Ga0495643_0148307
3377	Ga0495644_0067628
3378	Ga0495644_0462532
3379	Ga0495648_0002463
3380	Ga0495648_0347765
3381	Ga0495663_0377500
3382	Ga0495666_0216336
3383	Ga0495642_0000226
3384	Ga0495642_0176696
3385	Ga0495642_0386785
3386	Ga0495652_0030433
3387	Ga0495640_0019131
3388	Ga0495587_0170704
3389	Ga0495598_0131939
3390	Ga0495598_0309155
3391	Ga0495609_0001148
3392	Ga0495609_0018351
3393	Ga0495621_0039355
3394	Ga0495597_0069320
3395	Ga0495597_0191981
3396	Ga0495597_0270193
3397	Ga0495645_0091791
3398	Ga0495645_0104244
3399	Ga0495622_0052971
3400	Ga0495633_0193007
3401	Ga0495633_0299194
3402	Ga0495667_0656269
3403	Ga0495667_0760972
3404	Ga0495656_0016327
3405	Ga0495656_0156587
3406	Ga0495668_0007848
3407	Ga0495668_0263932
3408	Ga0495668_0637143
3409	Ga0495668_0642948
3410	Ga0495625_0000080
3411	Ga0495625_0025045
3412	Ga0495625_0408638
3413	Ga0495625_0780122
3414	Ga0495659_0063998
3415	Ga0495659_0105154
3416	Ga0495661_0001944
3417	Ga0495661_0034458
3418	Ga0495661_0447724
3419	Ga0495588_0000125
3420	Ga0495588_0017611
3421	Ga0495588_0023911
3422	Ga0495657_0338206
3423	Ga0495599_0078966
3424	Ga0495599_0472590
3425	Ga0495599_0586202
3426	Ga0495623_0430992
3427	Ga0495647_0276657
3428	Ga0495669_0100385
3429	Ga0495624_0212658
3430	Ga0495670_0020745
3431	Ga0495670_0713704
3432	Ga0495671_0121343
3433	Ga0495649_0122177
3434	Ga0495649_0126251
3435	Ga0495589_0000171
3436	Ga0495589_0071088
3437	Ga0495589_0158834
3438	Ga0495589_0284924
3439	Ga0495600_0402284
3440	Ga0495600_0726495
3441	Ga0495660_0000042
3442	Ga0495636_0023605
3443	Ga0495636_0081866
3444	Ga0495674_0291039
3445	Ga0495674_0489656
3446	Ga0495672_0002336
3447	Ga0495672_0037305
3448	Ga0495672_0052669
3449	Ga0495672_0341437
3450	Ga0495676_0141472
3451	Ga0495676_0856285
3452	Ga0495687_000205
3453	Ga0495687_000361
3454	Ga0495687_208642
3455	Ga0495675_0310262
3456	Ga0495677_0018775
3457	Ga0495677_0025976
3458	Ga0495679_057603
3459	Ga0495685_021259
3460	Ga0495685_287217
3461	Ga0495673_0018029
3462	Ga0495673_0033999
3463	Ga0495681_0324685
3464	Ga0495684_0115399
3465	Ga0495686_0000132
3466	Ga0495686_0067170
3467	Ga0495686_0342353
3468	Ga0495686_0351009
3469	Ga0495614_0152184
3470	Ga0495615_0027770
3471	Ga0495626_0000022
3472	Ga0495626_0005797
3473	Ga0495626_0085876
3474	Ga0496100_0005714
3475	Ga0496100_0058623
3476	Ga0496100_0123195
3477	Ga0496100_0273817
3478	Ga0496100_0331247
3479	Ga0496100_0378276
3480	Ga0496100_0793406
3481	Ga0496100_1226435
3482	Ga0496101_0011214
3483	Ga0496101_0111802
3484	Ga0496101_0220417
3485	Ga0496101_0357517
3486	Ga0496101_1443241
3487	Ga0496102_0028344
3488	Ga0496102_0050758
3489	Ga0496102_0177481
3490	Ga0496102_0233980
3491	Ga0496102_0380415
3492	Ga0496102_1093455
3493	Ga0496103_0003678
3494	Ga0496103_0056640
3495	Ga0496103_0102062
3496	Ga0496103_0255812
3497	Ga0496103_0281071
3498	Ga0496103_0327928
3499	Ga0496103_0397657
3500	Ga0496104_0061207
3501	Ga0496104_0078837
3502	Ga0496104_0188211
3503	Ga0496104_0296111
3504	Ga0496104_0362146
3505	Ga0496104_0364459
3506	Ga0496105_0004150
3507	Ga0496105_0023986
3508	Ga0496105_0034391
3509	Ga0496105_0115131
3510	Ga0496105_0284870
3511	Ga0496105_0348456
3512	Ga0496106_0002352
3513	Ga0496106_0002393
3514	Ga0496106_0062427
3515	Ga0496106_0175256
3516	Ga0496106_0186445
3517	Ga0496106_1542092
3518	Ga0496107_0000986
3519	Ga0496107_0008206
3520	Ga0496107_0087881
3521	Ga0496107_0302751
3522	Ga0496107_0444718
3523	Ga0496107_0677237
3524	Ga0496107_0911923
3525	Ga0496108_0014213
3526	Ga0496108_0045174
3527	Ga0496108_1010309
3528	Ga0496109_0012703
3529	Ga0496109_0039946
3530	Ga0496109_0234387
3531	Ga0496109_0591668
3532	Ga0496109_1032786
3533	Ga0496110_0007237
3534	Ga0496110_0326214
3535	Ga0496110_0464566
3536	Ga0496110_0553274
3537	Ga0496110_0621877
3538	Ga0496110_1023256
3539	Ga0496110_1283462
3540	Ga0496111_0004163
3541	Ga0496111_0072863
3542	Ga0496111_0338366
3543	Ga0496112_0003529
3544	Ga0496112_0075376
3545	Ga0496112_0091988
3546	Ga0496112_1392424
3547	Ga0496113_0000939
3548	Ga0496113_0004895
3549	Ga0496113_0066309
3550	Ga0496113_0753053
3551	Ga0496113_0826423
3552	Ga0496113_0836077
3553	Ga0496113_1043279
3554	Ga0496114_0031552
3555	Ga0496114_0221553
3556	Ga0496114_0809022
3557	Ga0496115_0019102
3558	Ga0496115_0042711
3559	Ga0496115_0089891
3560	Ga0496115_0143360
3561	Ga0496115_0147999
3562	Ga0496115_0176505
3563	Ga0496115_0344980
3564	Ga0496116_0286684
3565	Ga0496117_0036249
3566	Ga0496117_0058499
3567	Ga0496117_0063625
3568	Ga0496117_0313167
3569	Ga0496117_0315391
3570	Ga0496118_0002179
3571	Ga0496118_0007104
3572	Ga0496118_0028574
3573	Ga0496118_0126082
3574	Ga0496118_0171815
3575	Ga0496118_0186096
3576	Ga0496118_0277410
3577	Ga0496119_0030961
3578	Ga0496119_0184810
3579	Ga0496119_0198556
3580	Ga0496119_0234351
3581	Ga0496119_0271097
3582	Ga0496120_0129890
3583	Ga0496120_0328458
3584	Ga0496121_0000009
3585	Ga0496121_0000381
3586	Ga0496121_0002282
3587	Ga0496121_0006123
3588	Ga0496121_0031492
3589	Ga0496121_0040143
3590	Ga0496121_0051624
3591	Ga0496121_0092475
3592	Ga0496121_0163117
3593	Ga0496121_0507337
3594	Ga0496121_0850971
3595	Ga0496122_0211857
3596	Ga0496122_0367131
3597	Ga0496123_0075227
3598	Ga0496123_0158242
3599	Ga0496124_0000599
3600	Ga0496124_0266817
3601	Ga0496124_0609701
3602	Ga0496124_0652813
3603	Ga0496125_0000040
3604	Ga0496125_0102129
3605	Ga0496125_0175197
3606	Ga0496125_0253159
3607	Ga0496125_0478662
3608	Ga0496125_0537415
3609	Ga0496126_0004395
3610	Ga0496126_0060355
3611	Ga0496126_0166578
3612	Ga0496126_0196345
3613	Ga0496126_0196690
3614	Ga0496126_0286612
3615	Ga0496126_0292535
3616	Ga0496126_0632128
3617	Ga0496126_0689644
3618	Ga0496126_0806383
3619	Ga0496126_0921406
3620	Ga0495678_234764
3621	Ga0495682_0078332
3622	Ga0501031_0147651
3623	Ga0501031_0339067
3624	Ga0501032_0002079
3625	Ga0501032_0003954
3626	Ga0501032_0688927
3627	Ga0501033_0002701
3628	Ga0501033_0208170
3629	Ga0501033_0237742
3630	Ga0501033_0403105
3631	Ga0501033_0444464
3632	Ga0501033_0707734
3633	Ga0501033_1135165
3634	Ga0501034_0000014
3635	Ga0501034_0005595
3636	Ga0501034_0083104
3637	Ga0501034_0371242
3638	Ga0501034_0535493
3639	Ga0501034_1004960
3640	Ga0501034_1052146
3641	Ga0501034_1112809
3642	Ga0501036_0015554
3643	Ga0501036_0062936
3644	Ga0501036_0308253
3645	Ga0501036_0759120
3646	Ga0501036_0775324
3647	Ga0501036_1388916
3648	Ga0501037_0009360
3649	Ga0501037_0016608
3650	Ga0501037_0199879
3651	Ga0501038_0000719
3652	Ga0501038_0011679
3653	Ga0501038_0104817
3654	Ga0501038_1072603
3655	Ga0501039_0000087
3656	Ga0501039_0001526
3657	Ga0501039_0624643
3658	Ga0501040_0123202
3659	Ga0501040_0530040
3660	Ga0501043_0004493
3661	Ga0501043_0094987
3662	Ga0501043_0315659
3663	Ga0501043_0351807
3664	Ga0501046_0000870
3665	Ga0501046_0002770
3666	Ga0501047_0000684
3667	Ga0501047_0011736
3668	Ga0501047_0114526
3669	Ga0501047_0290414
3670	Ga0501047_0339715
3671	Ga0501047_1041116
3672	Ga0501048_0015120
3673	Ga0501048_0087357
3674	Ga0501067_0015906
3675	Ga0501067_0018916
3676	Ga0501068_0009168
3677	Ga0501069_0000622
3678	Ga0501070_0002545
3679	Ga0501070_0139068
3680	Ga0501070_0153896
3681	Ga0501070_0207495
3682	Ga0501070_0756477
3683	Ga0501070_1296693
3684	Ga0501071_0908359
3685	Ga0501072_0720541
3686	Ga0501073_0000348
3687	Ga0501073_0029773
3688	Ga0501073_0035653
3689	Ga0501073_0675546
3690	Ga0501074_0002564
3691	Ga0501076_0161604
3692	Ga0501076_0600523
3693	Ga0501076_0850093
3694	Ga0501221_160232
3695	Ga0501079_0035976
3696	Ga0501079_1553098
3697	Ga0501080_0000010
3698	Ga0501080_0001541
3699	Ga0501080_0173598
3700	Ga0501081_0145215
3701	Ga0501083_0005861
3702	Ga0501083_0467327
3703	Ga0501035_0000034
3704	Ga0501035_0001162
3705	Ga0501035_0003287
3706	Ga0501035_0179323
3707	Ga0501035_0313232
3708	Ga0501035_0440838
3709	Ga0501035_0641945
3710	Ga0501035_0870387
3711	Ga0501035_1118450
3712	Ga0501044_0000473
3713	Ga0501044_0023437
3714	Ga0501044_0102864
3715	Ga0501044_0143389
3716	Ga0501044_0214081
3717	Ga0501044_0214911
3718	Ga0501044_0215922
3719	Ga0501044_0836937
3720	nmdc:mga03683_271971_c1
3721	nmdc:mga03683_38989_c1
3722	nmdc:mga03683_40877_c1
3723	nmdc:mga03683_436_c1
3724	nmdc:mga03683_456740_c1
3725	nmdc:mga03683_57504_c1
3726	nmdc:mga03683_640091_c1
3727	nmdc:mga03683_650386_c1
3728	nmdc:mga03n38_125162_c1
3729	nmdc:mga03n38_16046_c1
3730	nmdc:mga03n38_364_c1
3731	nmdc:mga03n38_745209_c1
3732	nmdc:mga03n38_87326_c1
3733	nmdc:mga00v17_1042372_c1
3734	nmdc:mga00v17_316676_c1
3735	nmdc:mga00v17_318498_c1
3736	nmdc:mga00v17_57414_c1
3737	nmdc:mga00v17_61418_c1
3738	nmdc:mga00v17_81686_c1
3739	nmdc:mga0yw44_1064799_c1
3740	nmdc:mga0yw44_1206_c1
3741	nmdc:mga0yw44_130410_c1
3742	nmdc:mga0yw44_16659_c1
3743	nmdc:mga0yw44_254867_c1
3744	nmdc:mga0yw44_29866_c1
3745	nmdc:mga0yw44_3737_c1
3746	nmdc:mga0yw44_3835_c1
3747	nmdc:mga0yw44_3912_c1
3748	nmdc:mga0yw44_40628_c1
3749	nmdc:mga0yw44_427708_c1
3750	nmdc:mga0yw44_48014_c1
3751	nmdc:mga0yw44_544991_c1
3752	nmdc:mga0yw44_58709_c1
3753	nmdc:mga0yw44_958423_c1
3754	nmdc:mga0k408_131359_c2
3755	nmdc:mga0k408_186908_c2
3756	nmdc:mga0k408_225569_c1
3757	nmdc:mga0k408_299716_c1
3758	nmdc:mga0k408_32060_c1
3759	nmdc:mga0k408_341985_c1
3760	nmdc:mga0k408_403057_c1
3761	nmdc:mga0k408_406497_c1
3762	nmdc:mga0k408_507382_c1
3763	nmdc:mga0k408_604_c1
3764	nmdc:mga0k408_610363_c1
3765	nmdc:mga0k408_742504_c1
3766	nmdc:mga0k408_88306_c1
3767	nmdc:mga06z11_1019582_c1
3768	nmdc:mga06z11_1472_c1
3769	nmdc:mga06z11_226309_c1
3770	nmdc:mga06z11_279469_c1
3771	nmdc:mga06z11_407017_c1
3772	nmdc:mga06z11_44581_c1
3773	nmdc:mga06z11_479481_c1
3774	nmdc:mga06z11_55239_c1
3775	nmdc:mga06z11_697143_c1
3776	nmdc:mga06z11_7483_c1
3777	nmdc:mga06z11_792207_c1
3778	nmdc:mga06z11_7962_c1
3779	nmdc:mga06z11_8289_c1
3780	nmdc:mga06z11_83858_c1
3781	nmdc:mga04h51_441267_c1
3782	nmdc:mga07m45_14798_c1
3783	nmdc:mga07m45_25973_c1
3784	nmdc:mga07m45_30279_c1
3785	nmdc:mga07m45_41120_c1
3786	nmdc:mga07m45_471847_c1
3787	nmdc:mga07m45_491085_c1
3788	nmdc:mga07m45_569678_c1
3789	nmdc:mga07m45_689829_c1
3790	nmdc:mga07m45_93689_c1
3791	nmdc:mga05p37_135264_c1
3792	nmdc:mga05p37_316594_c1
3793	nmdc:mga05p37_31857_c1
3794	nmdc:mga05p37_60656_c1
3795	nmdc:mga09592_738303_c1
3796	nmdc:mga0qj67_34_c1
3797	nmdc:mga0qj67_69183_c1
3798	nmdc:mga06r32_1367435_c1
3799	nmdc:mga06r32_15803_c1
3800	nmdc:mga08y16_196576_c1
3801	nmdc:mga08y16_854603_c1
3802	nmdc:mga0n895_1858447_c1
3803	nmdc:mga0n895_42454_c1
3804	nmdc:mga0n895_685409_c1
3805	nmdc:mga0rr50_1059462_c1
3806	nmdc:mga0rr50_1254142_c1
3807	nmdc:mga0rr50_189808_c1
3808	nmdc:mga0rr50_689414_c1
3809	nmdc:mga08x19_158370_c1
3810	nmdc:mga08x19_423833_c1
3811	nmdc:mga0sz30_180238_c1
3812	nmdc:mga0sz30_261982_c1
3813	nmdc:mga0sz30_3381_c1
3814	nmdc:mga0sz30_35406_c1
3815	nmdc:mga0sz30_373730_c1
3816	nmdc:mga0sz30_428737_c1
3817	nmdc:mga0sz30_89279_c1
3818	Ga0495601_0150909
3819	Ga0495601_0156943
3820	Ga0495612_0047541
3821	Ga0495655_0015653
3822	Ga0495595_0051585
3823	Ga0495595_0326278
3824	Ga0495595_0430042
3825	Ga0495595_0526960
3826	Ga0495619_0085951
3827	Ga0495619_0227754
3828	Ga0500578_0242970
3829	Ga0500578_0430362
3830	Ga0500578_0469763
3831	Ga0500578_0567535
3832	Ga0500643_063612
3833	Ga0500643_074275
3834	Ga0500643_096084
3835	Ga0500644_0239499
3836	Ga0500644_0258886
3837	Ga0500644_0289856
3838	Ga0500644_0541316
3839	Ga0500646_0015111
3840	Ga0500646_0045760
3841	Ga0500646_0046237
3842	Ga0500646_0072309
3843	Ga0500646_0271872
3844	Ga0500583_0007058
3845	Ga0500583_0322569
3846	Ga0500583_0342804
3847	Ga0500651_0237651
3848	Ga0500651_0689711
3849	Ga0500641_0001478
3850	Ga0500641_0006965
3851	Ga0500641_0011912
3852	Ga0500641_0095152
3853	Ga0500648_138933
3854	Ga0500650_0064754
3855	Ga0500650_0154485
3856	Ga0500650_0233654
3857	Ga0500650_0246561
3858	Ga0500650_0251405
3859	Ga0500650_0408310
3860	Ga0500555_066582
3861	Ga0500555_082025
3862	Ga0500555_131739
3863	Ga0500556_0003827
3864	Ga0500556_0005375
3865	Ga0500556_0027382
3866	Ga0500562_000898
3867	Ga0500562_066399
3868	Ga0500562_083895
3869	Ga0500572_212182
3870	Ga0500593_005484
3871	Ga0500594_0013478
3872	Ga0500594_0038219
3873	Ga0500594_0082013
3874	Ga0500595_000664
3875	Ga0500595_001967
3876	Ga0500595_010292
3877	Ga0500595_036001
3878	Ga0500595_038946
3879	Ga0500608_268058
3880	Ga0500642_0000551
3881	Ga0500642_0036422
3882	Ga0500642_0190937
3883	Ga0500642_0315995
3884	Ga0500655_005232
3885	Ga0500658_0112554
3886	Ga0500658_0219776
3887	Ga0500559_0010054
3888	Ga0500559_0142900
3889	Ga0500559_0207293
3890	Ga0500559_0277646
3891	Ga0500561_0280149
3892	Ga0500568_0001159
3893	Ga0500568_0017806
3894	Ga0500568_0040774
3895	Ga0500568_0358395
3896	Ga0500573_0089051
3897	Ga0500577_0005676
3898	Ga0500577_0140859
3899	Ga0500588_0123138
3900	Ga0500588_0210730
3901	Ga0500589_192997
3902	Ga0500603_168410
3903	Ga0500604_0002247
3904	Ga0500604_0004822
3905	Ga0500604_0011237
3906	Ga0500616_0001753
3907	Ga0500616_0019480
3908	Ga0500616_0061141
3909	Ga0500616_0079351
3910	Ga0500616_0195412
3911	Ga0500620_300375
3912	Ga0500622_0005907
3913	Ga0500622_0008503
3914	Ga0500622_0015773
3915	Ga0500622_0306126
3916	Ga0500627_0002241
3917	Ga0500634_0094342
3918	Ga0500636_0004933
3919	Ga0500636_0009497
3920	Ga0500636_0134532
3921	Ga0500636_0435932
3922	Ga0500611_020431
3923	Ga0500611_180646
3924	Ga0500645_002001
3925	Ga0500645_030452
3926	Ga0500609_002328
3927	Ga0500596_012712
3928	Ga0501084_0040643
3929	Ga0501084_1294655
3930	Ga0501082_0003888
3931	Ga0501082_0051236
3932	Ga0466962_0007922
3933	Ga0466962_0192725
3934	Ga0466962_0288256
3935	Ga0530510_0790544
3936	2503201117
3937	2509118772
3938	2509150878
3939	2509392555
3940	2509443366
3941	2511123449
3942	2512931993
3943	2512959965
3944	2513577392
3945	2513692623
3946	2513718653
3947	2513912497
3948	2513926148
3949	2514036025
3950	2514420157
3951	2515744240
3952	2517076506
3953	2524536170
3954	2530645629
3955	2585227928
3956	2585527746
3957	2585537640
3958	2585835590
3959	2585994729
3960	2585999211
3961	2587917490
3962	2599417624
3963	2599735430
3964	2643801307
3965	2643805240
3966	2643925049
3967	2644064084
3968	2644288897
3969	2644375690
3970	2644415916
3971	2644448957
3972	2644471725
3973	2644493680
3974	2644686519
3975	2644736921
3976	2671123424
3977	2719385886
3978	2719665700
3979	2720492120
3980	2720613385
3981	2720620262
3982	2720631687
3983	2720775415
3984	2721399665
3985	2723027033
3986	2723560645
3987	2723567234
3988	2723575672
3989	2723844993
3990	2724038478
3991	2724090022
3992	2724104499
3993	2724110293
3994	2725948563
3995	2728754650
3996	2730107969
3997	2739036603
3998	2776272393
3999	2776284333
4000	2793082149
4001	2793294774
4002	2793330631
4003	2793335960
4004	2793341622
4005	2793352975
4006	2793361069
4007	2793369163
4008	2805925799
4009	2805933477
4010	2806046153
4011	2806054533
4012	2806060537
4013	2806065005
4014	2806072264
4015	2819611011
4016	2819630550
4017	2838021374
4018	2838038163
4019	2838043544
4020	2838053455
4021	2838065714
4022	2838074553
4023	2838667152
4024	2838682114
4025	2838691890
4026	2838696686
4027	2838710075
4028	2838732963
4029	2838745841
4030	2841766238
4031	2841855700
4032	2841864434
4033	2842078248
4034	2842119244
4035	2842157308
4036	2842167966
4037	2842181108
4038	2842194417
4039	2842205942
4040	2842230834
4041	2842239487
4042	2842245060
4043	2842258873
4044	2842265949
4045	2842276457
4046	2842279399
4047	2842291910
4048	2842304403
4049	2842314331
4050	2842317813
4051	2842345218
4052	2842364662
4053	2842372681
4054	2842378306
4055	2842385753
4056	2842398782
4057	2842427456
4058	2842429414
4059	2842436027
4060	2842442374
4061	2842450665
4062	2842463835
4063	2842470356
4064	2844106004
4065	2844459054
4066	2851246360
4067	2869164954
4068	2871488957
4069	2871496419
4070	2874605295
4071	2876397839
4072	2878739031
4073	2878753719
4074	2878760647
4075	2878767728
4076	2881149720
4077	2881166600
4078	2881846532
4079	2881854183
4080	2882636557
4081	2882919639
4082	2885313918
4083	2885345566
4084	2889039748
4085	2896391122
4086	2903495616
4087	2903541213
4088	2903772445
4089	2904664490
4090	2904697470
4091	2904705215
4092	2908762074
4093	2909044954
4094	2920761286
4095	2924776393
4096	2924789929
4097	2928157526
4098	2928165340
4099	2928174316
4100	2928526026
4101	2933020546
4102	2933571677
4103	2933605045
4104	2935634403
4105	2935905575
4106	2936372590
4107	2936376413
4108	2936387134
4109	2937995069
4110	2941508889
4111	2941516718
4112	2941525188
4113	2954011880
4114	2958165666
4115	2961119489
4116	2961164125
4117	2961170907
4118	2965018809
4119	2965019686
4120	2968003486
4121	2968004253
4122	2968115744
4123	2968172528
4124	2970503497
4125	2970555500
4126	2977822934
4127	2977832604
4128	2977927468
4129	2979815726
4130	2981990565
4131	2987660133
4132	2989355328
4133	3004169213
4134	3004189181
4135	3004335053
4136	637075088
4137	642418458
4138	8004375290
4139	8005280667
4140	8005287011
4141	8005293188
4142	8005309832
4143	8005379328
4144	8005388424
4145	8005434540
4146	8005500428
4147	8005557603
4148	8005574338
4149	8005621804
4150	8005626621
4151	8005651656
4152	8005671846
4153	8006965838
4154	8006986483
4155	8006995940
4156	8018179737
4157	8018846423
4158	8021120921
4159	8023685277
4160	8047675850
4161	8054560717
4162	8056376720
4163	8056387925
4164	8056673774
4165	8056691733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

35

82

0.98 PF13412

HTH_24

Winged helix-turn-helix DNA-binding

35

81

0.98 PF12840

HTH_20

Helix-turn-helix domain

33

83

0.97 PF12802

MarR_2

MarR family

35

88

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7p6f-assembly1.cif.gz_BBB	1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus	0.9455	3	77
3f6o-assembly1.cif.gz_B	crystal structure of arsr family transcriptional regulator, rha00566	0.9285	4	92
3f6o-assembly1.cif.gz_A	crystal structure of arsr family transcriptional regulator, rha00566	0.9261	1	92
4kmf-assembly1.cif.gz_A-2	crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna	0.9197	16	73
4lb5-assembly1.cif.gz_B	crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)	0.9185	20	72

ID	Description	Score	Start	End	Superfamily
af_Q4DZU8_467_618_3.30.230.130	Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2	0.9678	29	72	3.30.230.130
af_Q57824_147_206_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9615	14	71	1.10.10.10
af_Q58793_245_317_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9457	10	72	1.10.10.10
af_I6Y1A7_25_116_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9412	2	82	1.10.10.10
af_Q2FXF7_1_94_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9359	1	87	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A8B3LHI3-F1-model_v4	Transcriptional regulator	1.004	8	107	GO:0003700
AF-A0A6L5FAJ4-F1-model_v4	Metalloregulator ArsR/SmtB family transcription factor	0.9849	6	104	GO:0003700
AF-A0A8B3LHI3-F1-model_v4	Transcriptional regulator	0.9847	8	107	GO:0003700
AF-A0A5C1WG48-F1-model_v4	Winged helix-turn-helix transcriptional regulator	0.9845	6	107	GO:0003700
AF-A0A857C336-F1-model_v4	Metalloregulator ArsR/SmtB family transcription factor	0.9791	2	107	GO:0003700

F496366

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01022

HTH_5

Bacterial regulatory protein, arsR family

35

82

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

35

81

0.98

PF12840

HTH_20

Helix-turn-helix domain

33

83

0.97

PF12802

MarR_2

MarR family

35

88

0.89

Structural Annotation

Top 5 Hits

Map