F496380

General Info

Members Datasets Scaffolds Average Seq Length
2091 876 4183 344

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0009500|Ga0495638_0009500_4025_5173
Length 382
Sequence MSGKATGAVLIRSRPAELTLPLALQCGTTFFGSFTMSKTLKFVLLSGCLSLAVGQAMAKAKDLTVISYGGASKDAQVAGFYKPYEKATGTKIIAGEWNGEMAKVKAMVDTKSVNWDVLDIEDNDLSRGCDDGLFEKIDMSRIGPVEDFIDGTVQTCGVGIFVWSNVLAYNTEKLKTAPQGWKDFWDVKKFPGKRSLRKSARGALEFALMADGVAPKDVYKELSTDAGVSRAFAKLDELKPYIQWWEAGAQPPQYLISGDVIMSSAYNGRIYAAKQSGAPLKIVWDGNLYQFDEWAIPKGTPNLDEAYKFIKFAMQPAQQKIYTEHMAYGPSNKGTISLLSPELAADLPTAPQNMQNALQMDVDFWTEHGESLEQRFIAWSSK

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
35 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
241 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
251 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
252 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
253 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
254 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
255 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
256 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
257 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
258 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
264 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
265 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
266 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
267 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
268 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
269 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
277 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
294 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
297 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
300 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
304 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
305 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
306 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
307 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
308 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
309 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
310 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
311 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
312 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
313 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
314 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
315 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
316 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
317 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
318 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
319 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
320 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
321 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
322 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
323 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
324 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
325 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
328 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
345 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
348 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
351 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
352 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
371 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
381 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
382 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
383 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
384 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
385 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
386 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
387 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
388 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
389 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
390 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
391 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
392 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
393 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
394 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
404 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
405 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
408 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
409 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
424 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
425 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
426 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
427 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
436 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
437 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
438 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
439 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
440 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
441 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
442 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
443 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
447 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
448 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
449 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
450 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
451 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
452 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
453 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
454 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
455 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
456 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
457 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
458 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
459 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
461 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
462 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
471 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
472 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
473 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
474 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
475 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
477 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
478 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
479 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
480 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
481 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
482 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
483 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
484 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
485 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
486 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
487 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
488 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
492 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
493 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
494 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
495 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
496 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
497 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
498 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
499 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
500 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
501 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
504 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
505 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
506 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
512 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
513 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
514 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
515 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
516 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
517 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
518 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
519 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
520 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
521 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
522 2511231004 Pseudomonas sp. GM102 Isolate Nodule
523 2511231006 Pseudomonas sp. GM17 Isolate Nodule
524 2511231007 Pseudomonas sp. GM18 Isolate Nodule
525 2511231008 Pseudomonas sp. GM21 Isolate Nodule
526 2511231010 Pseudomonas sp. GM25 Isolate Nodule
527 2511231011 Pseudomonas sp. GM30 Isolate Nodule
528 2511231012 Pseudomonas sp. GM33 Isolate Nodule
529 2511231014 Pseudomonas sp. GM48 Isolate Nodule
530 2511231015 Pseudomonas sp. GM49 Isolate Nodule
531 2511231016 Pseudomonas sp. GM50 Isolate Nodule
532 2511231017 Pseudomonas sp. GM55 Isolate Nodule
533 2511231018 Pseudomonas sp. GM60 Isolate Nodule
534 2511231019 Pseudomonas sp. GM67 Isolate Nodule
535 2511231020 Pseudomonas sp. GM74 Isolate Nodule
536 2511231021 Pseudomonas sp. GM78 Isolate Nodule
537 2511231022 Pseudomonas sp. GM79 Isolate Nodule
538 2511231023 Pseudomonas sp. GM80 Isolate Nodule
539 2511231024 Pseudomonas sp. GM84 Isolate Nodule
540 2511231031 Pseudomonas sp. GM16 Isolate Nodule
541 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
542 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
543 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
544 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
545 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
546 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
547 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
548 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
549 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
550 2519103095 Burkholderia sp. KJ006 Isolate Nodule
551 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
552 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
553 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
554 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
555 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
556 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
557 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
558 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
559 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
560 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
561 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
562 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
563 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
564 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
565 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
566 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
567 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
568 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
569 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
570 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
571 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
572 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
573 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
574 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
575 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
576 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
577 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
578 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
579 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
580 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
581 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
582 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
583 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
584 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
585 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
586 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
587 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
588 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
589 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
590 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
591 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
592 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
593 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
594 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
595 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
596 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
597 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
598 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
599 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
600 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
601 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
602 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
603 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
604 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
605 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
606 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
607 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
608 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
609 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
610 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
611 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
612 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
613 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
614 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
615 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
616 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
617 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
618 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
619 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
620 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
621 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
622 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
623 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
624 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
625 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
626 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
627 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
628 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
629 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
630 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
631 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
632 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
633 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
634 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
635 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
636 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
637 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
638 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
639 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
640 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
641 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
642 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
643 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
644 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
645 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
646 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
647 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
648 2643221658 Variovorax sp. Root411 Isolate Unclassified
649 2643221672 Variovorax sp. Root434 Isolate Unclassified
650 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
651 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
652 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
653 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
654 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
655 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
656 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
657 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
658 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
659 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
660 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
661 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
662 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
663 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
664 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
665 2738541277 Variovorax sp. GV051 Isolate Unclassified
666 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
667 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
668 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
669 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
670 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
671 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
672 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
673 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
674 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
675 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
676 2738543012 Acidovorax sp. CF301 Isolate Unclassified
677 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
678 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
679 2738543019 Variovorax sp. GV040 Isolate Unclassified
680 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
681 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
682 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
683 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
684 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
685 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
686 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
687 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
688 2765235841 Pseudomonas putida AA7 Isolate Unclassified
689 2773857670 Pseudomonas sp. 478 Isolate Unclassified
690 2773857673 Pseudomonas sp. 443 Isolate Unclassified
691 2784132063 Pseudomonas sp. 424 Isolate Unclassified
692 2784132072 Pseudomonas sp. 460 Isolate Unclassified
693 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
694 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
695 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
696 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
697 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
698 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
699 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
700 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
701 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
702 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
703 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
704 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
705 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
706 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
707 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
708 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
709 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
710 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
711 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
712 2816332133 Acidovorax radicis 2721A Isolate Unclassified
713 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
714 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
715 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
716 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
717 2818991436 Collimonas arenae 515 Isolate Unclassified
718 2818991450 Burkholderia sp. 604 Isolate Unclassified
719 2818991452 Burkholderia cepacia 561 Isolate Unclassified
720 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
721 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
722 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
723 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
724 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
725 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
726 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
727 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
728 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
729 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
730 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
731 2842677519 Variovorax sp. R-72495 Isolate Unclassified
732 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
733 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
734 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
735 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
736 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
737 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
738 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
739 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
740 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
741 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
742 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
743 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
744 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
745 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
746 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
747 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
748 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
749 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
750 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
751 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
752 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
753 2885198086 Variovorax sp. 679 Isolate Unclassified
754 2885211737 Variovorax sp. 553 Isolate Unclassified
755 2885266251 Ralstonia sp. SET104 Isolate Nodule
756 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
757 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
758 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
759 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
760 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
761 2904564687 Burkholderia sp. 571 Isolate Unclassified
762 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
763 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
764 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
765 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
766 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
767 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
768 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
769 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
770 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
771 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
772 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
773 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
774 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
775 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
776 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
777 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
778 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
779 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
780 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
781 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
782 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
783 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
784 2928058823 Ralstonia sp. 1138 Isolate Unclassified
785 2928070936 Variovorax gossypii 1167 Isolate Unclassified
786 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
787 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
788 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
789 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
790 2928163908 Burkholderia sp. 567 Isolate Unclassified
791 2928170801 Burkholderia sp. 572 Isolate Unclassified
792 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
793 2928536128 Burkholderia sola 565 Isolate Unclassified
794 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
795 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
796 2929520902 Variovorax beijingensis 502 Isolate Unclassified
797 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
798 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
799 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
800 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
801 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
802 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
803 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
804 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
805 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
806 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
807 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
808 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
809 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
810 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
811 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
812 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
813 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
814 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
815 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
816 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
817 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
818 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
819 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
820 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
821 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
822 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
823 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
824 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
825 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
826 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
827 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
828 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
829 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
830 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
831 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
832 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
833 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
834 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
835 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
836 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
837 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
838 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
839 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
840 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
841 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
842 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
843 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
844 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
845 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
846 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
847 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
848 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
849 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
850 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
851 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
852 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
853 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
854 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
855 8052494512 Pseudomonas putida LD6 Isolate Unclassified
856 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
857 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
858 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
859 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
860 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
861 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
862 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
863 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
864 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
865 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
866 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
867 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
868 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
869 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
870 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
871 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
872 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
873 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
874 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
875 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
876 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.92
Metatranscriptomes 0.72
Isolates 18.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.25
Nodule 2.63
Rhizoplane 4.88
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0009500 3300046460 Bacteria 6820
2 MRS2a_Contig_12 2124908027 Bacteria 39492
3 MRS2a_Contig_757 2124908027 Bacteria 21626
4 JGI24741J21665_1000318 3300001915 Bacteria 14371
5 JGI24740J21852_10000096 3300001979 Bacteria 30943
6 JGI24740J21852_10000255 3300001979 Bacteria 22594
7 JGI24739J22299_10002978 3300001989 Bacteria 6490
8 JGI24739J22299_10006593 3300001989 Bacteria 4374
9 JGI24739J22299_10023384 3300001989 Bacteria 2185
10 JGI24735J21928_10000358 3300002067 Bacteria 15868
11 JGI24735J21928_10002227 3300002067 Bacteria 6801
12 JGI24738J21930_10000524 3300002075 Bacteria 10937
13 JGI25156J39149_1000245 3300002705 Bacteria 37450
14 JGI25156J39149_1000262 3300002705 Bacteria 35505
15 JGI25156J39149_1000303 3300002705 Bacteria 32642
16 JGI25156J39149_1001166 3300002705 Bacteria 11697
17 JGI25156J39149_1009246 3300002705 Bacteria 2410
18 JGI25162J39368_1000157 3300002737 Bacteria 75011
19 JGI25162J39368_1000324 3300002737 Bacteria 41886
20 JGI25162J39368_1000659 3300002737 Bacteria 24396
21 JGI25154J39366_1002561 3300002738 Bacteria 4585
22 JGI25154J39366_1003513 3300002738 Bacteria 3250
23 JGI25157J39369_1000510 3300002741 Bacteria 23859
24 JGI25164J39214_1000240 3300002772 Bacteria 41886
25 JGI25164J39214_1000410 3300002772 Bacteria 24396
26 JGI25152J39213_1001845 3300002773 Bacteria 8551
27 JGI25150J39212_1006514 3300002774 Bacteria 2405
28 JGI25159J45721_1002588 3300002987 Bacteria 6782
29 JGI25159J45721_1005403 3300002987 Bacteria 4016
30 JGI25151J46595_10019696 3300003187 Bacteria 2860
31 JGI25165J46597_1000045 3300003214 Bacteria 257539
32 JGI25165J46597_1000439 3300003214 Bacteria 41886
33 JGI25165J46597_1000774 3300003214 Bacteria 24396
34 JGI25165J46597_1002036 3300003214 Bacteria 7659
35 JGI25153J46596_10009694 3300003215 Bacteria 4436
36 JGI25153J46596_10018566 3300003215 Bacteria 2696
37 rootH1_10006479 3300003316 Bacteria 15227
38 rootH1_10010288 3300003316 Bacteria 5221
39 rootH1_10016494 3300003316 Bacteria 2013
40 rootH1_10016494 3300003323 Bacteria 7805
41 rootH1_10105825 3300003316 Bacteria 3557
42 rootL2_10000805 3300003322 Bacteria 46183
43 rootL2_10012684 3300003322 Bacteria 17327
44 rootL2_10048463 3300003322 Bacteria 19827
45 rootH1_10029202 3300003323 Bacteria 5391
46 JGI25160J50197_1000259 3300003354 Bacteria 39883
47 JGI25160J50197_1000307 3300003354 Bacteria 34667
48 JGI25160J50197_1022750 3300003354 Bacteria 1829
49 JGI25161J50226_1000092 3300003374 Bacteria 72932
50 JGI25161J50226_1005655 3300003374 Bacteria 2382
51 Ga0006556J51387_1028337 3300003479 Bacteria 1189
52 Ga0006556J51387_1035664 3300003479 Bacteria 1203
53 Ga0006558J51389_1024947 3300003558 Bacteria 1251
54 Ga0006560J51390_1025418 3300003565 Bacteria 1483
55 Ga0006554J51385_1034311 3300003567 Bacteria 1156
56 Ga0006562J51391_1009429 3300003578 Bacteria 2281
57 Ga0055538_1000022 3300003751 Bacteria 257539
58 Ga0055539_1000028 3300003752 Bacteria 257539
59 Ga0055539_1000071 3300003752 Bacteria 131539
60 Ga0055539_1000193 3300003752 Bacteria 50324
61 Ga0055539_1000757 3300003752 Bacteria 7893
62 Ga0055539_1005940 3300003752 Bacteria 1572
63 Ga0055533_1000025 3300003756 Bacteria 332208
64 Ga0055533_1000036 3300003756 Bacteria 257539
65 Ga0055533_1000230 3300003756 Bacteria 36818
66 Ga0055533_1000393 3300003756 Bacteria 17233
67 Ga0055533_1003590 3300003756 Bacteria 3068
68 Ga0055532_1000019 3300003758 Bacteria 286358
69 Ga0055532_1000085 3300003758 Bacteria 110554
70 Ga0055525_1000191 3300003759 Bacteria 75011
71 Ga0055525_1000495 3300003759 Bacteria 20104
72 Ga0055525_1000721 3300003759 Bacteria 11621
73 Ga0055527_1000046 3300003760 Bacteria 110554
74 Ga0055527_1000869 3300003760 Bacteria 7849
75 Ga0055527_1005864 3300003760 Bacteria 1566
76 Ga0055535_1000014 3300003761 Bacteria 286358
77 Ga0055535_1000077 3300003761 Bacteria 110554
78 Ga0055535_1007233 3300003761 Bacteria 2142
79 Ga0055542_1000111 3300003762 Bacteria 110584
80 Ga0055542_1001643 3300003762 Bacteria 10054
81 Ga0055529_1000096 3300003763 Bacteria 133329
82 Ga0055529_1000126 3300003763 Bacteria 110584
83 Ga0055526_1000801 3300003771 Bacteria 23438
84 Ga0055526_1001884 3300003771 Bacteria 14534
85 Ga0055537_1000280 3300003773 Bacteria 36696
86 Ga0055537_1001800 3300003773 Bacteria 7802
87 Ga0055524_1000093 3300003775 Bacteria 111953
88 Ga0055524_1000194 3300003775 Bacteria 66522
89 Ga0055536_1001108 3300003781 Bacteria 16921
90 Ga0055536_1001147 3300003781 Bacteria 16571
91 Ga0055536_1001184 3300003781 Bacteria 16237
92 Ga0055536_1005905 3300003781 Bacteria 5864
93 Ga0055536_1010681 3300003781 Bacteria 3610
94 Ga0055536_1024573 3300003781 Bacteria 1741
95 Ga0055534_1000358 3300003784 Bacteria 28950
96 Ga0055534_1001637 3300003784 Bacteria 8651
97 Ga0055534_1004194 3300003784 Bacteria 4252
98 Ga0055528_1000566 3300003790 Bacteria 28109
99 Ga0055528_1002296 3300003790 Bacteria 10351
100 Ga0055528_1004701 3300003790 Bacteria 6518
101 Ga0055528_1029273 3300003790 Bacteria 1495
102 Ga0055530_10000513 3300003791 Bacteria 33776
103 Ga0055530_10000832 3300003791 Bacteria 25491
104 Ga0055530_10001583 3300003791 Bacteria 16286
105 Ga0055530_10004093 3300003791 Bacteria 7771
106 Ga0055530_10013392 3300003791 Bacteria 2802
107 Ga0055530_10013460 3300003791 Bacteria 2792
108 Ga0055530_10018155 3300003791 Bacteria 2180
109 Ga0055530_10022826 3300003791 Bacteria 1812
110 Ga0055540_1000089 3300003792 Bacteria 100214
111 Ga0055540_1000426 3300003792 Bacteria 33776
112 Ga0055540_1000533 3300003792 Bacteria 28667
113 Ga0055540_1001814 3300003792 Bacteria 12108
114 Ga0055540_1013784 3300003792 Bacteria 2449
115 Ga0055531_10000286 3300003794 Bacteria 51010
116 Ga0055531_10001324 3300003794 Bacteria 18540
117 Ga0055541_1000094 3300003841 Bacteria 75011
118 Ga0055541_1002132 3300003841 Bacteria 4025
119 Ga0058692_1006519 3300003856 Bacteria 3191
120 Ga0058692_1008093 3300003856 Bacteria 2727
121 Ga0055543_1000207 3300004625 Bacteria 47618
122 Ga0065165_1002149 3300005262 Bacteria 17843
123 Ga0065165_1004597 3300005262 Bacteria 8402
124 Ga0065165_1010852 3300005262 Bacteria 3880
125 Ga0065165_1037762 3300005262 Bacteria 1461
126 Ga0065714_10001218 3300005288 Bacteria 1331
127 Ga0065714_10002430 3300005288 Bacteria 22712
128 Ga0065714_10010840 3300005288 Bacteria 2600
129 Ga0065714_10021078 3300005288 Bacteria 1553
130 Ga0065714_10064488 3300005288 Bacteria 50757
131 Ga0065714_10067004 3300005288 Bacteria 6007
132 Ga0065704_10008853 3300005289 Bacteria 2726
133 Ga0065704_10070671 3300005289 Bacteria 17914
134 Ga0065704_10083963 3300005289 Bacteria 3395
135 Ga0065712_10010181 3300005290 Bacteria 2459
136 Ga0065712_10067844 3300005290 Bacteria 26443
137 Ga0065712_10084265 3300005290 Bacteria 2778
138 Ga0065715_10016250 3300005293 Bacteria 1850
139 Ga0070658_10001405 3300005327 Bacteria 20559
140 Ga0070658_10022601 3300005327 Bacteria 5046
141 Ga0070658_10036108 3300005327 Bacteria 3982
142 Ga0070658_10071216 3300005327 Bacteria 2847
143 Ga0070676_10010982 3300005328 Bacteria 4919
144 Ga0070676_10097182 3300005328 Bacteria 1814
145 Ga0070690_100030733 3300005330 Bacteria 3341
146 Ga0070670_100011018 3300005331 Bacteria 7724
147 Ga0070670_100017925 3300005331 Bacteria 6077
148 Ga0070670_100099025 3300005331 Bacteria 2509
149 Ga0070670_100169830 3300005331 Bacteria 1891
150 Ga0070677_10005022 3300005333 Bacteria 4347
151 Ga0068869_100007271 3300005334 Bacteria 7055
152 Ga0068869_100136759 3300005334 Bacteria 1888
153 Ga0068869_100138565 3300005334 Bacteria 1877
154 Ga0070666_10003553 3300005335 Bacteria 9453
155 Ga0070666_10074905 3300005335 Bacteria 2308
156 Ga0068868_100010970 3300005338 Bacteria 6582
157 Ga0068868_100028638 3300005338 Bacteria 4260
158 Ga0068868_100039179 3300005338 Bacteria 3681
159 Ga0068868_100110295 3300005338 Bacteria 2235
160 Ga0070660_100000164 3300005339 Bacteria 43441
161 Ga0070660_100019385 3300005339 Bacteria 4985
162 Ga0070660_100236545 3300005339 Bacteria 1487
163 Ga0070661_100000054 3300005344 Bacteria 88505
164 Ga0070661_100001309 3300005344 Bacteria 17485
165 Ga0070668_100017121 3300005347 Bacteria 5424
166 Ga0070669_100001100 3300005353 Bacteria 19776
167 Ga0070669_100008744 3300005353 Bacteria 7224
168 Ga0070669_100019963 3300005353 Bacteria 4786
169 Ga0070669_100123478 3300005353 Bacteria 1979
170 Ga0070675_100004251 3300005354 Bacteria 10901
171 Ga0070675_100109729 3300005354 Bacteria 2332
172 Ga0070675_100173158 3300005354 Bacteria 1862
173 Ga0070671_100007622 3300005355 Bacteria 8657
174 Ga0070671_100033025 3300005355 Bacteria 4278
175 Ga0070671_100164475 3300005355 Bacteria 1876
176 Ga0070674_100016593 3300005356 Bacteria 4617
177 Ga0070673_100003996 3300005364 Bacteria 9278
178 Ga0070673_100031876 3300005364 Bacteria 3960
179 Ga0070688_100006220 3300005365 Bacteria 6360
180 Ga0070659_100000128 3300005366 Bacteria 57485
181 Ga0070659_100005590 3300005366 Bacteria 9032
182 Ga0070659_100041073 3300005366 Bacteria 3615
183 Ga0070659_100091599 3300005366 Bacteria 2437
184 Ga0070667_100000766 3300005367 Bacteria 30566
185 Ga0070667_100002286 3300005367 Bacteria 16863
186 Ga0070708_100028937 3300005445 Bacteria 4772
187 Ga0070663_100000010 3300005455 Bacteria 158193
188 Ga0070663_100002316 3300005455 Bacteria 10688
189 Ga0070678_100000841 3300005456 Bacteria 15595
190 Ga0070662_100007943 3300005457 Bacteria 6902
191 Ga0070662_100018821 3300005457 Bacteria 4678
192 Ga0070662_100047017 3300005457 Bacteria 3102
193 Ga0070662_100053366 3300005457 Bacteria 2926
194 Ga0070662_100167602 3300005457 Bacteria 1722
195 Ga0068867_100000172 3300005459 Bacteria 42270
196 Ga0068867_100004010 3300005459 Bacteria 10355
197 Ga0068867_100008567 3300005459 Bacteria 7217
198 Ga0068867_100020176 3300005459 Bacteria 4749
199 Ga0068867_100111028 3300005459 Bacteria 2107
200 Ga0070706_100023037 3300005467 Bacteria 5736
201 Ga0070707_100023575 3300005468 Bacteria 5820
202 Ga0068853_100000211 3300005539 Bacteria 41402
203 Ga0068853_100025562 3300005539 Bacteria 4956
204 Ga0068853_100035825 3300005539 Bacteria 4217
205 Ga0070672_100022270 3300005543 Bacteria 4650
206 Ga0070672_100032432 3300005543 Bacteria 3941
207 Ga0070665_100036370 3300005548 Bacteria 4952
208 Ga0070665_100271113 3300005548 Bacteria 1699
209 Ga0068855_100070691 3300005563 Bacteria 4060
210 Ga0068855_100115358 3300005563 Bacteria 3079
211 Ga0068855_100317555 3300005563 Bacteria 1723
212 Ga0070664_100000005 3300005564 Bacteria 222746
213 Ga0070664_100006387 3300005564 Bacteria 9508
214 Ga0070664_100047392 3300005564 Bacteria 3630
215 Ga0068857_100003285 3300005577 Bacteria 13437
216 Ga0068857_100009214 3300005577 Bacteria 8562
217 Ga0068857_100047404 3300005577 Bacteria 3815
218 Ga0068857_100211591 3300005577 Bacteria 1769
219 Ga0068854_100000032 3300005578 Bacteria 106054
220 Ga0068854_100031453 3300005578 Bacteria 3688
221 Ga0068854_100192241 3300005578 Bacteria 1600
222 Ga0068856_100000228 3300005614 Bacteria 61077
223 Ga0068856_100001084 3300005614 Bacteria 28724
224 Ga0068852_100001360 3300005616 Bacteria 16411
225 Ga0068852_100017054 3300005616 Bacteria 5688
226 Ga0068852_100109305 3300005616 Bacteria 2510
227 Ga0068852_100232263 3300005616 Bacteria 1759
228 Ga0068859_100000133 3300005617 Bacteria 70133
229 Ga0068859_100168773 3300005617 Bacteria 2269
230 Ga0068864_100000237 3300005618 Bacteria 49297
231 Ga0068861_100044628 3300005719 Bacteria 3334
232 Ga0068851_10000063 3300005834 Bacteria 60338
233 Ga0068863_100006252 3300005841 Bacteria 11696
234 Ga0068863_100012293 3300005841 Bacteria 8264
235 Ga0068858_100000395 3300005842 Bacteria 45718
236 Ga0068860_100010571 3300005843 Bacteria 9117
237 Ga0068860_100119012 3300005843 Bacteria 2528
238 Ga0068860_100167129 3300005843 Bacteria 2124
239 Ga0068862_100024753 3300005844 Bacteria 5036
240 Ga0075363_100079637 3300006048 Bacteria 1790
241 Ga0075363_100084907 3300006048 Bacteria 1736
242 Ga0075364_10020646 3300006051 Bacteria 4144
243 Ga0075364_10043952 3300006051 Bacteria 2905
244 Ga0075432_10006807 3300006058 Bacteria 3892
245 Ga0075432_10010860 3300006058 Bacteria 3095
246 Ga0070712_100056799 3300006175 Bacteria 2747
247 Ga0075362_10032054 3300006177 Bacteria 2278
248 Ga0075367_10007294 3300006178 Bacteria 5653
249 Ga0075367_10019687 3300006178 Bacteria 3747
250 Ga0075367_10083847 3300006178 Bacteria 1931
251 Ga0075369_10005888 3300006186 Bacteria 4607
252 Ga0075366_10011494 3300006195 Bacteria 5000
253 Ga0075366_10014990 3300006195 Bacteria 4432
254 Ga0075366_10015230 3300006195 Bacteria 4403
255 Ga0075366_10019616 3300006195 Bacteria 3916
256 Ga0075366_10023078 3300006195 Bacteria 3624
257 Ga0075366_10090178 3300006195 Bacteria 1836
258 Ga0097621_100010287 3300006237 Bacteria 6836
259 Ga0097621_100317273 3300006237 Bacteria 1380
260 Ga0075370_10000664 3300006353 Bacteria 13394
261 Ga0075370_10002624 3300006353 Bacteria 8388
262 Ga0075370_10005576 3300006353 Bacteria 6274
263 Ga0075370_10012316 3300006353 Bacteria 4515
264 Ga0075370_10026392 3300006353 Bacteria 3218
265 Ga0075370_10043949 3300006353 Bacteria 2525
266 Ga0075370_10068977 3300006353 Bacteria 2020
267 Ga0075429_100002596 3300006880 Bacteria 15230
268 Ga0068865_100041525 3300006881 Bacteria 3130
269 Ga0068865_100159831 3300006881 Bacteria 1718
270 Ga0097620_100000133 3300006931 Bacteria 70133
271 Ga0097620_100168781 3300006931 Bacteria 2269
272 Ga0079104_1000620 3300006946 Bacteria 34817
273 Ga0079104_1000927 3300006946 Bacteria 23453
274 Ga0099826_10004958 3300006948 Bacteria 9435
275 Ga0099826_10005078 3300006948 Bacteria 9357
276 Ga0105251_10000117 3300009011 Bacteria 79453
277 Ga0105251_10000322 3300009011 Bacteria 48000
278 Ga0105251_10001665 3300009011 Bacteria 18753
279 Ga0105251_10001678 3300009011 Bacteria 18632
280 Ga0105251_10003491 3300009011 Bacteria 11386
281 Ga0105251_10004912 3300009011 Bacteria 8915
282 Ga0105251_10014456 3300009011 Bacteria 4362
283 Ga0105251_10030340 3300009011 Bacteria 2716
284 Ga0105251_10038908 3300009011 Bacteria 2326
285 Ga0105251_10099681 3300009011 Bacteria 1328
286 Ga0105251_10100849 3300009011 Bacteria 1319
287 Ga0105244_10001557 3300009036 Bacteria 18226
288 Ga0105244_10002629 3300009036 Bacteria 13467
289 Ga0105244_10005118 3300009036 Bacteria 8800
290 Ga0105244_10005536 3300009036 Bacteria 8377
291 Ga0105244_10017153 3300009036 Bacteria 4102
292 Ga0105244_10029436 3300009036 Bacteria 2935
293 Ga0105244_10036667 3300009036 Bacteria 2567
294 Ga0105244_10040786 3300009036 Bacteria 2408
295 Ga0105244_10041841 3300009036 Bacteria 2373
296 Ga0105244_10044916 3300009036 Bacteria 2274
297 Ga0105244_10061009 3300009036 Bacteria 1899
298 Ga0105244_10065475 3300009036 Bacteria 1820
299 Ga0105244_10090530 3300009036 Bacteria 1505
300 Ga0105244_10134067 3300009036 Bacteria 1194
301 Ga0105250_10000821 3300009092 Bacteria 18499
302 Ga0105250_10005173 3300009092 Bacteria 5888
303 Ga0105250_10010771 3300009092 Bacteria 3805
304 Ga0105250_10014535 3300009092 Bacteria 3232
305 Ga0105250_10018152 3300009092 Bacteria 2853
306 Ga0105250_10027587 3300009092 Bacteria 2289
307 Ga0105250_10058593 3300009092 Bacteria 1546
308 Ga0105240_10005213 3300009093 Bacteria 19445
309 Ga0105240_10111717 3300009093 Bacteria 3305
310 Ga0105240_10123026 3300009093 Bacteria 3122
311 Ga0105240_10139582 3300009093 Bacteria 2899
312 Ga0105240_10281122 3300009093 Bacteria 1911
313 Ga0105245_10067385 3300009098 Bacteria 3242
314 Ga0105243_10000462 3300009148 Bacteria 42016
315 Ga0105243_10001219 3300009148 Bacteria 23167
316 Ga0105243_10001748 3300009148 Bacteria 18705
317 Ga0105243_10009364 3300009148 Bacteria 7464
318 Ga0105243_10036823 3300009148 Bacteria 3800
319 Ga0105243_10037791 3300009148 Bacteria 3756
320 Ga0105243_10054574 3300009148 Bacteria 3173
321 Ga0105243_10073762 3300009148 Bacteria 2766
322 Ga0105243_10082964 3300009148 Bacteria 2621
323 Ga0105243_10105605 3300009148 Bacteria 2346
324 Ga0105241_10039712 3300009174 Bacteria 3551
325 Ga0105241_10136357 3300009174 Bacteria 1993
326 Ga0105241_10146113 3300009174 Bacteria 1930
327 Ga0105242_10000538 3300009176 Bacteria 29959
328 Ga0105242_10178128 3300009176 Bacteria 1874
329 Ga0105248_10002604 3300009177 Bacteria 20066
330 Ga0105248_10010984 3300009177 Bacteria 9991
331 Ga0105248_10693057 3300009177 Bacteria 1149
332 Ga0105237_10003049 3300009545 Bacteria 20205
333 Ga0105237_10003953 3300009545 Bacteria 17357
334 Ga0105237_10047710 3300009545 Bacteria 4305
335 Ga0105237_10086003 3300009545 Bacteria 3134
336 Ga0105237_10103097 3300009545 Bacteria 2845
337 Ga0105237_10135642 3300009545 Bacteria 2455
338 Ga0105237_10166702 3300009545 Bacteria 2202
339 Ga0105238_10024863 3300009551 Bacteria 6104
340 Ga0105238_10096794 3300009551 Bacteria 2937
341 Ga0105238_10128799 3300009551 Bacteria 2509
342 Ga0105249_10005689 3300009553 Bacteria 10779
343 Ga0105249_10008169 3300009553 Bacteria 9120
344 Ga0105249_10111510 3300009553 Bacteria 2586
345 Ga0105239_10000318 3300010375 Bacteria 71045
346 Ga0105239_10010249 3300010375 Bacteria 10495
347 Ga0105239_10018364 3300010375 Bacteria 7732
348 Ga0105239_10103621 3300010375 Bacteria 3149
349 Ga0105239_10154243 3300010375 Bacteria 2564
350 Ga0105246_10000309 3300011119 Bacteria 25912
351 Ga0105246_10003778 3300011119 Bacteria 9180
352 Ga0105246_10053843 3300011119 Bacteria 2771
353 Ga0105246_10105879 3300011119 Bacteria 2056
354 Ga0105246_10228778 3300011119 Bacteria 1463
355 Ga0105246_10348398 3300011119 Bacteria 1213
356 Ga0157345_1000134 3300012498 Bacteria 13664
357 Ga0157347_1001124 3300012502 Bacteria 2017
358 Ga0157373_10002986 3300013100 Bacteria 12794
359 Ga0157373_10008011 3300013100 Bacteria 7855
360 Ga0157373_10011526 3300013100 Bacteria 6496
361 Ga0157373_10084184 3300013100 Bacteria 2242
362 Ga0157373_10094297 3300013100 Bacteria 2108
363 Ga0157373_10115949 3300013100 Bacteria 1883
364 Ga0157373_10160511 3300013100 Bacteria 1582
365 Ga0157371_10000171 3300013102 Bacteria 94501
366 Ga0157371_10000536 3300013102 Bacteria 45189
367 Ga0157371_10000653 3300013102 Bacteria 41097
368 Ga0157371_10005613 3300013102 Bacteria 10549
369 Ga0157371_10005934 3300013102 Bacteria 10195
370 Ga0157371_10006503 3300013102 Bacteria 9624
371 Ga0157371_10154022 3300013102 Bacteria 1640
372 Ga0157370_10000109 3300013104 Bacteria 95051
373 Ga0157370_10001229 3300013104 Bacteria 32093
374 Ga0157370_10009595 3300013104 Bacteria 10303
375 Ga0157370_10012389 3300013104 Bacteria 8843
376 Ga0157370_10076150 3300013104 Bacteria 3161
377 Ga0157370_10195382 3300013104 Bacteria 1878
378 Ga0157370_10195673 3300013104 Bacteria 1876
379 Ga0157370_10232263 3300013104 Bacteria 1707
380 Ga0157369_10000326 3300013105 Bacteria 63940
381 Ga0157369_10000846 3300013105 Bacteria 39124
382 Ga0157369_10006560 3300013105 Bacteria 13465
383 Ga0157369_10007254 3300013105 Bacteria 12761
384 Ga0157369_10008522 3300013105 Bacteria 11757
385 Ga0157369_10010596 3300013105 Bacteria 10492
386 Ga0157369_10037525 3300013105 Bacteria 5305
387 Ga0157369_10050201 3300013105 Bacteria 4520
388 Ga0157369_10061685 3300013105 Bacteria 4041
389 Ga0157374_10000081 3300013296 Bacteria 95406
390 Ga0157374_10137240 3300013296 Bacteria 2372
391 Ga0157378_10019760 3300013297 Bacteria 5924
392 Ga0157378_10087622 3300013297 Bacteria 2824
393 Ga0157378_10333134 3300013297 Bacteria 1478
394 Ga0163162_10004594 3300013306 Bacteria 13302
395 Ga0163162_10005294 3300013306 Bacteria 12454
396 Ga0163162_10165860 3300013306 Bacteria 2332
397 Ga0157372_10000089 3300013307 Bacteria 94457
398 Ga0157372_10002703 3300013307 Bacteria 19175
399 Ga0157372_10038939 3300013307 Bacteria 5247
400 Ga0157372_10183068 3300013307 Bacteria 2425
401 Ga0157372_10407430 3300013307 Bacteria 1584
402 Ga0157372_10521973 3300013307 Bacteria 1384
403 Ga0157375_10000882 3300013308 Bacteria 26043
404 Ga0157375_10014707 3300013308 Bacteria 6992
405 Ga0157375_10033859 3300013308 Bacteria 4860
406 Ga0157375_10074031 3300013308 Bacteria 3426
407 Ga0157375_10261365 3300013308 Bacteria 1893
408 Ga0163163_10004911 3300014325 Bacteria 11498
409 Ga0182008_10002105 3300014497 Bacteria 12695
410 Ga0182008_10008046 3300014497 Bacteria 5778
411 Ga0182008_10039644 3300014497 Bacteria 2353
412 Ga0182008_10041840 3300014497 Bacteria 2284
413 Ga0182008_10042338 3300014497 Bacteria 2269
414 Ga0157377_10000020 3300014745 Bacteria 151620
415 Ga0157379_10005267 3300014968 Bacteria 11105
416 Ga0157379_10098830 3300014968 Bacteria 2620
417 Ga0157376_10134574 3300014969 Bacteria 2210
418 Ga0182006_1001416 3300015261 Bacteria 14507
419 Ga0182006_1002639 3300015261 Bacteria 9663
420 Ga0182006_1017294 3300015261 Bacteria 3065
421 Ga0182006_1019231 3300015261 Bacteria 2876
422 Ga0182006_1046362 3300015261 Bacteria 1688
423 Ga0182006_1056164 3300015261 Bacteria 1500
424 Ga0182007_10001896 3300015262 Bacteria 10908
425 Ga0182007_10003966 3300015262 Bacteria 6835
426 Ga0182007_10005835 3300015262 Bacteria 5352
427 Ga0182007_10015661 3300015262 Bacteria 2821
428 Ga0182007_10018236 3300015262 Bacteria 2546
429 Ga0182005_1000222 3300015265 Bacteria 37589
430 Ga0182005_1006960 3300015265 Bacteria 3420
431 Ga0182005_1007277 3300015265 Bacteria 3326
432 Ga0183361_10028 3300016635 Bacteria 59439
433 Ga0163161_10000696 3300017792 Bacteria 26770
434 Ga0163161_10064285 3300017792 Bacteria 2676
435 Ga0163161_10066042 3300017792 Bacteria 2641
436 Ga0163161_10070023 3300017792 Bacteria 2565
437 Ga0163161_10224820 3300017792 Bacteria 1455
438 Ga0206356_11809126 3300020070 Bacteria 4959
439 Ga0213872_10003159 3300021361 Bacteria 9246
440 Ga0213872_10008484 3300021361 Bacteria 4972
441 Ga0224712_10000879 3300022467 Bacteria 6437
442 Ga0209760_100155 3300025207 Bacteria 41538
443 Ga0209760_100167 3300025207 Bacteria 38282
444 Ga0209760_102263 3300025207 Bacteria 1823
445 Ga0209436_106468 3300025208 Bacteria 2562
446 Ga0209436_109740 3300025208 Bacteria 1804
447 Ga0209784_100003 3300025224 Bacteria 1379451
448 Ga0209784_100036 3300025224 Bacteria 263689
449 Ga0209784_100142 3300025224 Bacteria 66553
450 Ga0209784_100669 3300025224 Bacteria 9751
451 Ga0209566_100002 3300025225 Bacteria 2614868
452 Ga0209566_100044 3300025225 Bacteria 263689
453 Ga0209566_100577 3300025225 Bacteria 23729
454 Ga0209566_101554 3300025225 Bacteria 6215
455 Ga0209566_102167 3300025225 Bacteria 3934
456 Ga0209674_100007 3300025226 Bacteria 1077082
457 Ga0209674_100008 3300025226 Bacteria 1076909
458 Ga0209674_100065 3300025226 Bacteria 263689
459 Ga0209674_100105 3300025226 Bacteria 152701
460 Ga0209674_100167 3300025226 Bacteria 84961
461 Ga0209674_100245 3300025226 Bacteria 45941
462 Ga0209672_100002 3300025228 Bacteria 1733325
463 Ga0209672_100036 3300025228 Bacteria 287801
464 Ga0209672_100050 3300025228 Bacteria 238103
465 Ga0209672_100248 3300025228 Bacteria 40285
466 Ga0209672_100360 3300025228 Bacteria 28723
467 Ga0209147_100002 3300025229 Bacteria 2158988
468 Ga0209147_100003 3300025229 Bacteria 1733325
469 Ga0209147_100075 3300025229 Bacteria 208215
470 Ga0209147_100267 3300025229 Bacteria 47094
471 Ga0209563_100004 3300025230 Bacteria 1814108
472 Ga0209563_100033 3300025230 Bacteria 457883
473 Ga0209563_100063 3300025230 Bacteria 263689
474 Ga0209563_101780 3300025230 Bacteria 5391
475 Ga0209563_102911 3300025230 Bacteria 3701
476 Ga0207427_100005 3300025231 Bacteria 797999
477 Ga0207427_100006 3300025231 Bacteria 785415
478 Ga0207427_100569 3300025231 Bacteria 18590
479 Ga0207427_100961 3300025231 Bacteria 12266
480 Ga0207427_100996 3300025231 Bacteria 11914
481 Ga0209437_100013 3300025233 Bacteria 785457
482 Ga0209437_100082 3300025233 Bacteria 263689
483 Ga0209437_100220 3300025233 Bacteria 104235
484 Ga0209258_100002 3300025242 Bacteria 2158988
485 Ga0209258_100077 3300025242 Bacteria 264510
486 Ga0209258_100394 3300025242 Bacteria 55089
487 Ga0209258_100440 3300025242 Bacteria 47108
488 Ga0209258_100536 3300025242 Bacteria 35888
489 Ga0207425_1001198 3300025245 Bacteria 11495
490 Ga0207425_1003208 3300025245 Bacteria 5344
491 Ga0209646_1000160 3300025246 Bacteria 91529
492 Ga0209646_1000194 3300025246 Bacteria 74630
493 Ga0209026_1000020 3300025250 Bacteria 376211
494 Ga0209677_100009 3300025253 Bacteria 749530
495 Ga0209677_100015 3300025253 Bacteria 532137
496 Ga0209677_100038 3300025253 Bacteria 263689
497 Ga0209677_100089 3300025253 Bacteria 108227
498 Ga0209677_106329 3300025253 Bacteria 2827
499 Ga0209148_1000006 3300025254 Bacteria 1733325
500 Ga0209148_1000193 3300025254 Bacteria 115649
501 Ga0209148_1000231 3300025254 Bacteria 91560
502 Ga0209148_1001388 3300025254 Bacteria 12493
503 Ga0209759_1000017 3300025256 Bacteria 376232
504 Ga0209759_1000089 3300025256 Bacteria 164770
505 Ga0209759_1000096 3300025256 Bacteria 157803
506 Ga0209759_1000947 3300025256 Bacteria 20821
507 Ga0209759_1001985 3300025256 Bacteria 9801
508 Ga0209759_1002015 3300025256 Bacteria 9660
509 Ga0209759_1003209 3300025256 Bacteria 6630
510 Ga0209759_1004110 3300025256 Bacteria 5556
511 Ga0209759_1006279 3300025256 Bacteria 4019
512 Ga0209759_1015843 3300025256 Bacteria 1928
513 Ga0209129_1000030 3300025258 Bacteria 391958
514 Ga0209129_1000292 3300025258 Bacteria 47620
515 Ga0209129_1003254 3300025258 Bacteria 7207
516 Ga0209129_1011452 3300025258 Bacteria 2116
517 Ga0209233_1000021 3300025261 Bacteria 798078
518 Ga0209233_1000022 3300025261 Bacteria 785415
519 Ga0209233_1000109 3300025261 Bacteria 263689
520 Ga0209233_1000225 3300025261 Bacteria 103443
521 Ga0209565_1000019 3300025263 Bacteria 438920
522 Ga0209565_1000028 3300025263 Bacteria 348536
523 Ga0209565_1000088 3300025263 Bacteria 151644
524 Ga0209565_1001747 3300025263 Bacteria 8868
525 Ga0209455_1000076 3300025272 Bacteria 284092
526 Ga0209455_1000139 3300025272 Bacteria 138993
527 Ga0209455_1000156 3300025272 Bacteria 119871
528 Ga0209673_1000028 3300025273 Bacteria 358901
529 Ga0209673_1000064 3300025273 Bacteria 254712
530 Ga0209673_1000095 3300025273 Bacteria 197466
531 Ga0209673_1000391 3300025273 Bacteria 78867
532 Ga0209673_1001209 3300025273 Bacteria 27471
533 Ga0209673_1001728 3300025273 Bacteria 18356
534 Ga0209130_1000011 3300025284 Bacteria 431723
535 Ga0209130_1000118 3300025284 Bacteria 129005
536 Ga0209130_1000231 3300025284 Bacteria 73279
537 Ga0209130_1002417 3300025284 Bacteria 9404
538 Ga0209675_1000036 3300025291 Bacteria 254712
539 Ga0209675_1000073 3300025291 Bacteria 163009
540 Ga0209675_1000111 3300025291 Bacteria 114805
541 Ga0209675_1009317 3300025291 Bacteria 3484
542 Ga0209675_1012255 3300025291 Bacteria 2776
543 Ga0209676_1000015 3300025292 Bacteria 784458
544 Ga0209676_1000054 3300025292 Bacteria 365890
545 Ga0209676_1000088 3300025292 Bacteria 263010
546 Ga0209676_1000668 3300025292 Bacteria 48922
547 Ga0209676_1001131 3300025292 Bacteria 29266
548 Ga0209676_1001175 3300025292 Bacteria 28332
549 Ga0209676_1002145 3300025292 Bacteria 14981
550 Ga0209676_1002967 3300025292 Bacteria 11042
551 Ga0209676_1004251 3300025292 Bacteria 8082
552 Ga0209676_1029078 3300025292 Bacteria 1711
553 Ga0209025_1000493 3300025294 Bacteria 75884
554 Ga0209025_1000494 3300025294 Bacteria 75744
555 Ga0209025_1007141 3300025294 Bacteria 8435
556 Ga0209025_1008228 3300025294 Bacteria 7542
557 Ga0209025_1035524 3300025294 Bacteria 2250
558 Ga0209564_1000029 3300025295 Bacteria 505995
559 Ga0209564_1000056 3300025295 Bacteria 340873
560 Ga0209564_1000103 3300025295 Bacteria 221166
561 Ga0209564_1000610 3300025295 Bacteria 55376
562 Ga0209564_1002970 3300025295 Bacteria 12196
563 Ga0209564_1004326 3300025295 Bacteria 8762
564 Ga0209564_1007663 3300025295 Bacteria 5513
565 Ga0209758_1000037 3300025297 Bacteria 439101
566 Ga0209758_1000096 3300025297 Bacteria 231496
567 Ga0209758_1000273 3300025297 Bacteria 102784
568 Ga0209758_1010428 3300025297 Bacteria 5562
569 Ga0209050_1000024 3300025298 Bacteria 533389
570 Ga0209050_1000066 3300025298 Bacteria 305458
571 Ga0209050_1000110 3300025298 Bacteria 216664
572 Ga0209050_1000128 3300025298 Bacteria 187432
573 Ga0209050_1001031 3300025298 Bacteria 34644
574 Ga0209050_1001442 3300025298 Bacteria 25546
575 Ga0209050_1001704 3300025298 Bacteria 21968
576 Ga0209050_1002474 3300025298 Bacteria 15716
577 Ga0209050_1006696 3300025298 Bacteria 6739
578 Ga0209256_1000003 3300025299 Bacteria 1661127
579 Ga0209256_1000043 3300025299 Bacteria 340873
580 Ga0209256_1000065 3300025299 Bacteria 248104
581 Ga0209256_1011277 3300025299 Bacteria 3600
582 Ga0207426_1000021 3300025302 Bacteria 556343
583 Ga0207426_1000029 3300025302 Bacteria 473835
584 Ga0207426_1000124 3300025302 Bacteria 218145
585 Ga0207426_1000197 3300025302 Bacteria 146366
586 Ga0207426_1003095 3300025302 Bacteria 9508
587 Ga0207426_1003977 3300025302 Bacteria 7533
588 Ga0209051_1000023 3300025303 Bacteria 437371
589 Ga0209051_1000041 3300025303 Bacteria 311155
590 Ga0209051_1000044 3300025303 Bacteria 305458
591 Ga0209051_1000069 3300025303 Bacteria 219208
592 Ga0209051_1000791 3300025303 Bacteria 33280
593 Ga0209051_1000921 3300025303 Bacteria 29186
594 Ga0209051_1001655 3300025303 Bacteria 17996
595 Ga0209051_1007118 3300025303 Bacteria 6178
596 Ga0209051_1015177 3300025303 Bacteria 3556
597 Ga0209051_1032577 3300025303 Bacteria 1985
598 Ga0209257_1000069 3300025304 Bacteria 339826
599 Ga0209257_1000082 3300025304 Bacteria 305458
600 Ga0209257_1000093 3300025304 Bacteria 263088
601 Ga0209257_1002425 3300025304 Bacteria 18609
602 Ga0207697_10102014 3300025315 Bacteria 1223
603 Ga0207656_10000006 3300025321 Bacteria 395044
604 Ga0207696_1000064 3300025711 Bacteria 238379
605 Ga0207696_1000094 3300025711 Bacteria 184065
606 Ga0207696_1000319 3300025711 Bacteria 51975
607 Ga0207696_1000324 3300025711 Bacteria 51146
608 Ga0207696_1000663 3300025711 Bacteria 24393
609 Ga0207696_1001391 3300025711 Bacteria 13228
610 Ga0207696_1012000 3300025711 Bacteria 3088
611 Ga0207655_1000107 3300025728 Bacteria 178758
612 Ga0207655_1000473 3300025728 Bacteria 52002
613 Ga0207655_1000486 3300025728 Bacteria 51236
614 Ga0207655_1000598 3300025728 Bacteria 44045
615 Ga0207655_1000870 3300025728 Bacteria 31981
616 Ga0207655_1000970 3300025728 Bacteria 29569
617 Ga0207655_1001041 3300025728 Bacteria 27873
618 Ga0207655_1005270 3300025728 Bacteria 8871
619 Ga0207655_1005542 3300025728 Bacteria 8559
620 Ga0207655_1007265 3300025728 Bacteria 7209
621 Ga0207655_1039167 3300025728 Bacteria 2063
622 Ga0207655_1070462 3300025728 Bacteria 1302
623 Ga0207713_1000010 3300025735 Bacteria 528374
624 Ga0207713_1000813 3300025735 Bacteria 28855
625 Ga0207713_1000938 3300025735 Bacteria 26164
626 Ga0207713_1001206 3300025735 Bacteria 21649
627 Ga0207713_1001539 3300025735 Bacteria 18152
628 Ga0207713_1002162 3300025735 Bacteria 14591
629 Ga0207713_1002390 3300025735 Bacteria 13713
630 Ga0207713_1003517 3300025735 Bacteria 10620
631 Ga0207713_1004381 3300025735 Bacteria 9172
632 Ga0207713_1004908 3300025735 Bacteria 8548
633 Ga0207713_1007881 3300025735 Bacteria 6208
634 Ga0207713_1014410 3300025735 Bacteria 4112
635 Ga0207713_1020169 3300025735 Bacteria 3238
636 Ga0207713_1027430 3300025735 Bacteria 2587
637 Ga0207713_1027794 3300025735 Bacteria 2563
638 Ga0207713_1029587 3300025735 Bacteria 2451
639 Ga0207682_10003083 3300025893 Bacteria 7308
640 Ga0207680_10001739 3300025903 Bacteria 10269
641 Ga0207680_10142175 3300025903 Bacteria 1592
642 Ga0207647_10002848 3300025904 Bacteria 13036
643 Ga0207647_10008852 3300025904 Bacteria 7182
644 Ga0207647_10009413 3300025904 Bacteria 6942
645 Ga0207647_10014350 3300025904 Bacteria 5462
646 Ga0207647_10087052 3300025904 Bacteria 1867
647 Ga0207645_10016209 3300025907 Bacteria 4936
648 Ga0207705_10000481 3300025909 Bacteria 34247
649 Ga0207705_10098413 3300025909 Bacteria 2149
650 Ga0207705_10372676 3300025909 Bacteria 1102
651 Ga0207684_10010582 3300025910 Bacteria 8107
652 Ga0207695_10002182 3300025913 Bacteria 29559
653 Ga0207695_10002534 3300025913 Bacteria 26839
654 Ga0207695_10008601 3300025913 Bacteria 12754
655 Ga0207695_10015259 3300025913 Bacteria 9056
656 Ga0207695_10060425 3300025913 Bacteria 3923
657 Ga0207695_10088352 3300025913 Bacteria 3120
658 Ga0207695_10237618 3300025913 Bacteria 1724
659 Ga0207695_10465824 3300025913 Bacteria 1146
660 Ga0207695_10468479 3300025913 Bacteria 1142
661 Ga0207671_10000159 3300025914 Bacteria 105261
662 Ga0207671_10003249 3300025914 Bacteria 16348
663 Ga0207671_10086586 3300025914 Bacteria 2355
664 Ga0207671_10141947 3300025914 Bacteria 1851
665 Ga0207671_10171948 3300025914 Bacteria 1683
666 Ga0207693_10077606 3300025915 Bacteria 2601
667 Ga0207662_10090404 3300025918 Bacteria 1882
668 Ga0207657_10000247 3300025919 Bacteria 57443
669 Ga0207657_10019658 3300025919 Bacteria 6404
670 Ga0207657_10028239 3300025919 Bacteria 5121
671 Ga0207649_10000087 3300025920 Bacteria 78222
672 Ga0207649_10000197 3300025920 Bacteria 50000
673 Ga0207681_10000254 3300025923 Bacteria 40622
674 Ga0207681_10007441 3300025923 Bacteria 6708
675 Ga0207681_10027151 3300025923 Bacteria 3699
676 Ga0207694_10109935 3300025924 Bacteria 2192
677 Ga0207694_10178248 3300025924 Bacteria 1722
678 Ga0207650_10000591 3300025925 Bacteria 29057
679 Ga0207650_10000699 3300025925 Bacteria 26228
680 Ga0207659_10000102 3300025926 Bacteria 50407
681 Ga0207687_10069133 3300025927 Bacteria 2517
682 Ga0207687_10245586 3300025927 Bacteria 1421
683 Ga0207644_10010203 3300025931 Bacteria 6189
684 Ga0207644_10109573 3300025931 Bacteria 2086
685 Ga0207644_10191027 3300025931 Bacteria 1610
686 Ga0207690_10000141 3300025932 Bacteria 57572
687 Ga0207690_10002514 3300025932 Bacteria 11085
688 Ga0207690_10013708 3300025932 Bacteria 4878
689 Ga0207690_10071115 3300025932 Bacteria 2398
690 Ga0207690_10078815 3300025932 Bacteria 2294
691 Ga0207706_10000395 3300025933 Bacteria 47041
692 Ga0207706_10004682 3300025933 Bacteria 12825
693 Ga0207706_10006827 3300025933 Bacteria 10552
694 Ga0207706_10008668 3300025933 Bacteria 9370
695 Ga0207706_10010702 3300025933 Bacteria 8378
696 Ga0207706_10051266 3300025933 Bacteria 3644
697 Ga0207706_10136314 3300025933 Bacteria 2159
698 Ga0207686_10001265 3300025934 Bacteria 14545
699 Ga0207686_10008567 3300025934 Bacteria 5525
700 Ga0207709_10000409 3300025935 Bacteria 41995
701 Ga0207709_10000426 3300025935 Bacteria 40351
702 Ga0207709_10000506 3300025935 Bacteria 34436
703 Ga0207709_10001129 3300025935 Bacteria 19501
704 Ga0207709_10002429 3300025935 Bacteria 11715
705 Ga0207709_10006978 3300025935 Bacteria 6314
706 Ga0207709_10016681 3300025935 Bacteria 4087
707 Ga0207709_10018294 3300025935 Bacteria 3923
708 Ga0207709_10097041 3300025935 Bacteria 1940
709 Ga0207709_10157526 3300025935 Bacteria 1580
710 Ga0207669_10131327 3300025937 Bacteria 1721
711 Ga0207669_10267052 3300025937 Bacteria 1283
712 Ga0207691_10013323 3300025940 Bacteria 7876
713 Ga0207711_10002914 3300025941 Bacteria 15001
714 Ga0207711_10091209 3300025941 Bacteria 2680
715 Ga0207689_10073311 3300025942 Bacteria 2813
716 Ga0207689_10073845 3300025942 Bacteria 2802
717 Ga0207679_10000020 3300025945 Bacteria 225727
718 Ga0207679_10000027 3300025945 Bacteria 196811
719 Ga0207679_10333926 3300025945 Bacteria 1316
720 Ga0207667_10008616 3300025949 Bacteria 12097
721 Ga0207667_10015470 3300025949 Bacteria 8665
722 Ga0207667_10019417 3300025949 Bacteria 7589
723 Ga0207667_10247896 3300025949 Bacteria 1822
724 Ga0207667_10378318 3300025949 Bacteria 1443
725 Ga0207651_10000537 3300025960 Bacteria 15920
726 Ga0207651_10160795 3300025960 Bacteria 1760
727 Ga0207712_10007211 3300025961 Bacteria 7012
728 Ga0207712_10067214 3300025961 Bacteria 2564
729 Ga0207668_10043033 3300025972 Bacteria 3061
730 Ga0207640_10000017 3300025981 Bacteria 208145
731 Ga0207640_10004424 3300025981 Bacteria 7625
732 Ga0207640_10010712 3300025981 Bacteria 5170
733 Ga0207640_10213616 3300025981 Bacteria 1471
734 Ga0207658_10000319 3300025986 Bacteria 48401
735 Ga0207658_10000720 3300025986 Bacteria 28611
736 Ga0207677_10005900 3300026023 Bacteria 6666
737 Ga0207677_10056378 3300026023 Bacteria 2692
738 Ga0207677_10062644 3300026023 Bacteria 2581
739 Ga0207677_10098350 3300026023 Bacteria 2146
740 Ga0207703_10000787 3300026035 Bacteria 31183
741 Ga0207639_10000238 3300026041 Bacteria 41262
742 Ga0207639_10054946 3300026041 Bacteria 3046
743 Ga0207678_10000008 3300026067 Bacteria 168926
744 Ga0207678_10000298 3300026067 Bacteria 44861
745 Ga0207702_10000017 3300026078 Bacteria 222964
746 Ga0207702_10000529 3300026078 Bacteria 42649
747 Ga0207641_10016446 3300026088 Bacteria 6057
748 Ga0207641_10023218 3300026088 Bacteria 5111
749 Ga0207648_10000026 3300026089 Bacteria 131314
750 Ga0207648_10014892 3300026089 Bacteria 7169
751 Ga0207648_10017528 3300026089 Bacteria 6511
752 Ga0207648_10023609 3300026089 Bacteria 5505
753 Ga0207648_10094386 3300026089 Bacteria 2616
754 Ga0207648_10315087 3300026089 Bacteria 1405
755 Ga0207676_10000485 3300026095 Bacteria 33413
756 Ga0207674_10001101 3300026116 Bacteria 35116
757 Ga0207674_10007158 3300026116 Bacteria 13035
758 Ga0207674_10083875 3300026116 Bacteria 3185
759 Ga0207674_10096126 3300026116 Bacteria 2948
760 Ga0207674_10159421 3300026116 Bacteria 2211
761 Ga0207674_10405881 3300026116 Bacteria 1317
762 Ga0207675_100027877 3300026118 Bacteria 5261
763 Ga0207675_100156999 3300026118 Bacteria 2168
764 Ga0207683_10002119 3300026121 Bacteria 17431
765 Ga0207683_10089383 3300026121 Bacteria 2741
766 Ga0207698_10041790 3300026142 Bacteria 3420
767 Ga0207698_10298149 3300026142 Bacteria 1499
768 Ga0209281_1000016 3300027111 Bacteria 588107
769 Ga0209281_1000019 3300027111 Bacteria 576164
770 Ga0209389_1000173 3300027296 Bacteria 51663
771 Ga0209371_1000127 3300027312 Bacteria 127069
772 Ga0209371_1000172 3300027312 Bacteria 96352
773 Ga0209371_1000508 3300027312 Bacteria 37263
774 Ga0209996_1001442 3300027395 Bacteria 2870
775 Ga0209982_1007606 3300027552 Bacteria 1584
776 Ga0209970_1007151 3300027614 Bacteria 1830
777 Ga0209282_1000348 3300027666 Bacteria 22795
778 Ga0209971_1002846 3300027682 Bacteria 4134
779 Ga0209998_10026107 3300027717 Bacteria 1275
780 Ga0207428_10009684 3300027907 Bacteria 8633
781 Ga0207428_10027978 3300027907 Bacteria 4688
782 Ga0207428_10055829 3300027907 Bacteria 3139
783 Ga0268266_10068148 3300028379 Bacteria 3080
784 Ga0268266_10093489 3300028379 Bacteria 2638
785 Ga0268266_10130537 3300028379 Bacteria 2247
786 Ga0268266_10191301 3300028379 Bacteria 1868
787 Ga0268265_10005792 3300028380 Bacteria 8430
788 Ga0268264_10009966 3300028381 Bacteria 7869
789 Ga0268264_10054091 3300028381 Bacteria 3351
790 Ga0307517_10004249 3300028786 Bacteria 22093
791 Ga0307515_10000093 3300028794 Bacteria 212053
792 Ga0307515_10000110 3300028794 Bacteria 195560
793 Ga0307515_10000877 3300028794 Bacteria 69170
794 Ga0307515_10001261 3300028794 Bacteria 57708
795 Ga0307515_10002007 3300028794 Bacteria 45041
796 Ga0307515_10040589 3300028794 Bacteria 7353
797 Ga0307515_10050976 3300028794 Bacteria 6184
798 Ga0265338_10000386 3300028800 Bacteria 78975
799 Ga0268256_1000104 3300030500 Bacteria 127069
800 Ga0268256_1000144 3300030500 Bacteria 96352
801 Ga0268256_1000729 3300030500 Bacteria 24217
802 Ga0307511_10088287 3300030521 Bacteria 2122
803 Ga0307511_10113431 3300030521 Bacteria 1713
804 Ga0307512_10038081 3300030522 Bacteria 4052
805 Ga0307512_10077111 3300030522 Bacteria 2424
806 Ga0316176_1069742 3300030732 Bacteria 3457
807 Ga0314311_1168052 3300030733 Bacteria 7304
808 Ga0316178_1161259 3300030735 Bacteria 4532
809 Ga0316180_1142351 3300030736 Bacteria 3800
810 Ga0316183_1033245 3300030742 Bacteria 1345
811 Ga0316181_1133507 3300030744 Bacteria 3629
812 Ga0265332_10000003 3300031238 Bacteria 482849
813 Ga0265332_10025464 3300031238 Bacteria 2598
814 Ga0307513_10010816 3300031456 Bacteria 11398
815 Ga0307513_10106370 3300031456 Bacteria 2811
816 Ga0307513_10110223 3300031456 Bacteria 2748
817 Ga0307509_10006186 3300031507 Bacteria 16221
818 Ga0307509_10026498 3300031507 Bacteria 6461
819 Ga0307509_10268570 3300031507 Bacteria 1475
820 Ga0307408_100000065 3300031548 Bacteria 122365
821 Ga0307408_100003588 3300031548 Bacteria 10569
822 Ga0307408_100015545 3300031548 Bacteria 5068
823 Ga0307408_100021658 3300031548 Bacteria 4353
824 Ga0307408_100103649 3300031548 Bacteria 2172
825 Ga0307408_100220415 3300031548 Bacteria 1547
826 Ga0307408_100247074 3300031548 Bacteria 1469
827 Ga0307508_10000016 3300031616 Bacteria 206976
828 Ga0307508_10000140 3300031616 Bacteria 85941
829 Ga0307508_10018488 3300031616 Bacteria 6334
830 Ga0307514_10000877 3300031649 Bacteria 47219
831 Ga0307514_10004196 3300031649 Bacteria 13347
832 Ga0307514_10039237 3300031649 Bacteria 3741
833 Ga0307514_10043009 3300031649 Bacteria 3549
834 Ga0265342_10187251 3300031712 Bacteria 1131
835 Ga0307516_10002441 3300031730 Bacteria 24864
836 Ga0307516_10003824 3300031730 Bacteria 19076
837 Ga0307516_10006003 3300031730 Bacteria 14352
838 Ga0307516_10013603 3300031730 Bacteria 8649
839 Ga0307516_10178301 3300031730 Bacteria 1860
840 Ga0307516_10270970 3300031730 Bacteria 1384
841 Ga0307405_10039282 3300031731 Bacteria 2859
842 Ga0307405_10062624 3300031731 Bacteria 2356
843 Ga0307413_10253075 3300031824 Bacteria 1308
844 Ga0307518_10053496 3300031838 Bacteria 2934
845 Ga0307410_10055864 3300031852 Bacteria 2682
846 Ga0307412_10000010 3300031911 Bacteria 421262
847 Ga0307412_10034576 3300031911 Bacteria 3221
848 Ga0307412_10036527 3300031911 Bacteria 3148
849 Ga0307409_100174727 3300031995 Bacteria 1894
850 Ga0307409_100196657 3300031995 Bacteria 1800
851 Ga0307416_100052861 3300032002 Bacteria 3255
852 Ga0307416_100118695 3300032002 Bacteria 2351
853 Ga0307414_10004281 3300032004 Bacteria 7744
854 Ga0307414_10133789 3300032004 Bacteria 1929
855 Ga0307414_10281085 3300032004 Bacteria 1398
856 Ga0307411_10077192 3300032005 Bacteria 2280
857 Ga0307510_10000187 3300033180 Bacteria 53246
858 Ga0307510_10006272 3300033180 Bacteria 14188
859 Ga0307510_10006971 3300033180 Bacteria 13473
860 Ga0307510_10175073 3300033180 Bacteria 1718
861 Ga0373950_0002336 3300034818 Bacteria 2600
862 Ga0373934_0006888 3300035086 Bacteria 4219
863 Ga0373940_0037309 3300035088 Bacteria 1322
864 Ga0373923_0062999 3300035111 Bacteria 1579
865 Ga0373939_0000037 3300035114 Bacteria 48605
866 Ga0373955_0029000 3300035172 Bacteria 2874
867 Ga0373931_0001897 3300035691 Bacteria 9143
868 Ga0373931_0002028 3300035691 Bacteria 8917
869 Ga0373931_0114416 3300035691 Bacteria 1535
870 Ga0373935_0088824 3300035692 Bacteria 2020
871 Ga0373927_0159895 3300035695 Bacteria 1476
872 Ga0373947_0194819 3300035725 Bacteria 1324
873 Ga0373937_0006049 3300036401 Bacteria 10422
874 Ga0373937_0375975 3300036401 Bacteria 1347
875 Ga0373925_0039592 3300037068 Bacteria 3487
876 Ga0373925_0115052 3300037068 Bacteria 2082
877 Ga0373925_0209846 3300037068 Bacteria 1551
878 Ga0395899_0000065 3300037312 Bacteria 205510
879 Ga0395899_0000949 3300037312 Bacteria 27181
880 Ga0395899_0011417 3300037312 Bacteria 6800
881 Ga0395900_0000015 3300037418 Bacteria 384313
882 Ga0395900_0000339 3300037418 Bacteria 69082
883 Ga0395900_0015382 3300037418 Bacteria 7799
884 Ga0395900_0063987 3300037418 Bacteria 3781
885 Ga0395900_0312241 3300037418 Bacteria 1555
886 Ga0395900_0373331 3300037418 Bacteria 1395
887 Ga0395898_0000201 3300037466 Bacteria 153821
888 Ga0395898_0000565 3300037466 Bacteria 69082
889 Ga0395898_0005860 3300037466 Bacteria 13216
890 Ga0395898_0020148 3300037466 Bacteria 6775
891 Ga0395898_0361649 3300037466 Bacteria 1384
892 Ga0395905_0000249 3300037471 Bacteria 80584
893 Ga0395905_0000362 3300037471 Bacteria 64482
894 Ga0395905_0002979 3300037471 Bacteria 18377
895 Ga0395905_0004181 3300037471 Bacteria 15097
896 Ga0395905_0006964 3300037471 Bacteria 11301
897 Ga0395905_0017916 3300037471 Bacteria 6727
898 Ga0395905_0074441 3300037471 Bacteria 3182
899 Ga0395901_0000144 3300038443 Bacteria 91753
900 Ga0395901_0000173 3300038443 Bacteria 83610
901 Ga0395901_0000994 3300038443 Bacteria 30620
902 Ga0395901_0023954 3300038443 Bacteria 6262
903 Ga0395901_0032507 3300038443 Bacteria 5382
904 Ga0395901_0327616 3300038443 Bacteria 1584
905 Ga0237819_01700 3300038705 Bacteria 5337
906 Ga0436361_0484292 3300039447 Bacteria 2076
907 Ga0436361_0796200 3300039447 Bacteria 43724
908 Ga0436361_1040758 3300039447 Bacteria 13192
909 Ga0436361_1193823 3300039447 Bacteria 2993
910 Ga0439436_0007922 3300041404 Bacteria 3263
911 Ga0439436_0019183 3300041404 Bacteria 2042
912 Ga0439438_027977 3300041405 Bacteria 1518
913 Ga0439439_0004833 3300041406 Bacteria 3052
914 Ga0439447_005033 3300041407 Bacteria 4448
915 Ga0439447_023174 3300041407 Bacteria 1619
916 Ga0439447_038852 3300041407 Bacteria 1167
917 Ga0439466_0002560 3300041411 Bacteria 7124
918 Ga0439466_0015043 3300041411 Bacteria 2812
919 Ga0439466_0016242 3300041411 Bacteria 2694
920 Ga0439466_0038921 3300041411 Bacteria 1595
921 Ga0439465_0004938 3300041413 Bacteria 4286
922 Ga0439448_0000594 3300042005 Bacteria 8513
923 Ga0439432_000853 3300042006 Bacteria 11404
924 Ga0439432_008511 3300042006 Bacteria 3599
925 Ga0439432_015665 3300042006 Bacteria 2556
926 Ga0439432_016372 3300042006 Bacteria 2496
927 Ga0439432_029940 3300042006 Bacteria 1767
928 Ga0439432_066417 3300042006 Bacteria 1104
929 Ga0439449_0002330 3300042007 Bacteria 7447
930 Ga0439449_0003272 3300042007 Bacteria 6317
931 Ga0439449_0004938 3300042007 Bacteria 5134
932 Ga0439449_0035067 3300042007 Bacteria 1868
933 Ga0439451_005405 3300042009 Bacteria 2605
934 Ga0439452_000363 3300042010 Bacteria 27675
935 Ga0439452_000802 3300042010 Bacteria 14855
936 Ga0439452_001022 3300042010 Bacteria 12401
937 Ga0439452_001323 3300042010 Bacteria 10376
938 Ga0439452_010564 3300042010 Bacteria 2679
939 Ga0439452_018406 3300042010 Bacteria 1860
940 Ga0439452_019160 3300042010 Bacteria 1814
941 Ga0439456_000065 3300042013 Bacteria 37775
942 Ga0439456_005876 3300042013 Bacteria 2496
943 Ga0439456_007043 3300042013 Bacteria 2302
944 Ga0439463_000144 3300042016 Bacteria 18232
945 Ga0439463_007777 3300042016 Bacteria 2647
946 Ga0439463_008630 3300042016 Bacteria 2511
947 Ga0450911_000003 3300042115 Bacteria 237055
948 Ga0450911_003599 3300042115 Bacteria 2695
949 Ga0450920_001211 3300042122 Bacteria 4231
950 Ga0450922_001299 3300042124 Bacteria 2467
951 Ga0450923_000782 3300042125 Bacteria 3817
952 Ga0450898_001867 3300042134 Bacteria 2850
953 Ga0450900_004819 3300042136 Bacteria 1568
954 Ga0450902_001955 3300042137 Bacteria 2875
955 Ga0450904_000150 3300042139 Bacteria 15391
956 Ga0450905_001432 3300042142 Bacteria 3046
957 Ga0450889_006579 3300042144 Bacteria 1167
958 Ga0450906_003409 3300042145 Bacteria 3420
959 Ga0450907_000540 3300042146 Bacteria 10292
960 Ga0450907_002642 3300042146 Bacteria 3349
961 Ga0450910_002929 3300042147 Bacteria 2250
962 Ga0439446_0000481 3300042156 Bacteria 7937
963 Ga0439446_0024220 3300042156 Bacteria 1731
964 Ga0439446_0034809 3300042156 Bacteria 1467
965 Ga0439458_0021340 3300042157 Bacteria 1499
966 Ga0450909_000824 3300042185 Bacteria 4211
967 Ga0439434_0012745 3300042435 Bacteria 2490
968 Ga0439464_0000313 3300042439 Bacteria 9258
969 Ga0439464_0008969 3300042439 Bacteria 2624
970 Ga0439464_0016785 3300042439 Bacteria 1982
971 Ga0439464_0029299 3300042439 Bacteria 1538
972 Ga0450918_000189 3300042531 Bacteria 13732
973 Ga0450918_001117 3300042531 Bacteria 5507
974 Ga0450893_0005262 3300042532 Bacteria 2073
975 Ga0451577_0000068 3300042876 Bacteria 241923
976 Ga0451577_0004102 3300042876 Bacteria 15626
977 Ga0451577_0097453 3300042876 Bacteria 2626
978 Ga0439440_0005573 3300042993 Bacteria 2504
979 Ga0439440_0027292 3300042993 Bacteria 1326
980 Ga0466969_0000130 3300044656 Bacteria 40952
981 Ga0466969_0000774 3300044656 Bacteria 17419
982 Ga0466969_0006882 3300044656 Bacteria 6052
983 Ga0466969_0025191 3300044656 Bacteria 3060
984 Ga0466969_0066239 3300044656 Bacteria 1744
985 Ga0466969_0069374 3300044656 Bacteria 1697
986 Ga0466972_0054028 3300044658 Bacteria 1933
987 Ga0453683_0005629 3300044673 Bacteria 8706
988 Ga0466965_0003316 3300044683 Bacteria 7043
989 Ga0466965_0013446 3300044683 Bacteria 3861
990 Ga0466965_0158621 3300044683 Bacteria 1185
991 Ga0466966_0000043 3300044684 Bacteria 93998
992 Ga0466966_0004527 3300044684 Bacteria 9168
993 Ga0466966_0007667 3300044684 Bacteria 7153
994 Ga0466966_0019585 3300044684 Bacteria 4452
995 Ga0466966_0101531 3300044684 Bacteria 1778
996 Ga0466961_0000920 3300044693 Bacteria 18222
997 Ga0466961_0001128 3300044693 Bacteria 16382
998 Ga0466961_0002127 3300044693 Bacteria 12319
999 Ga0466961_0021155 3300044693 Bacteria 4187
1000 Ga0466961_0026736 3300044693 Bacteria 3710
1001 Ga0466961_0050859 3300044693 Bacteria 2646
1002 Ga0466963_0004705 3300044694 Bacteria 7970
1003 Ga0466963_0090769 3300044694 Bacteria 2080
1004 Ga0466964_0005328 3300044706 Bacteria 4776
1005 Ga0466964_0014846 3300044706 Bacteria 2964
1006 Ga0453684_0000279 3300044712 Bacteria 220016
1007 Ga0466971_0006592 3300044719 Bacteria 5045
1008 Ga0466971_0008728 3300044719 Bacteria 4423
1009 Ga0466971_0131437 3300044719 Bacteria 1162
1010 Ga0466970_0022787 3300044765 Bacteria 3268
1011 Ga0466970_0034955 3300044765 Bacteria 2661
1012 Ga0466970_0067904 3300044765 Bacteria 1915
1013 Ga0466970_0074330 3300044765 Bacteria 1829
1014 Ga0466957_0000125 3300044842 Bacteria 32524
1015 Ga0466957_0002301 3300044842 Bacteria 10230
1016 Ga0466957_0036811 3300044842 Bacteria 2943
1017 Ga0466957_0110366 3300044842 Bacteria 1743
1018 Ga0466959_0001078 3300045049 Bacteria 16311
1019 Ga0466959_0062504 3300045049 Bacteria 2705
1020 Ga0466959_0104811 3300045049 Bacteria 2022
1021 Ga0466959_0118640 3300045049 Bacteria 1882
1022 Ga0451576_0020743 3300045051 Bacteria 7152
1023 Ga0451576_0356183 3300045051 Bacteria 1532
1024 Ga0466958_0004194 3300045836 Bacteria 7576
1025 Ga0466958_0017050 3300045836 Bacteria 4192
1026 Ga0466958_0080675 3300045836 Bacteria 2002
1027 Ga0466967_0025420 3300045976 Bacteria 4883
1028 Ga0466967_0082503 3300045976 Bacteria 2905
1029 Ga0466967_0432260 3300045976 Bacteria 1284
1030 Ga0466967_0568894 3300045976 Bacteria 1116
1031 Ga0495617_000312 3300046452 Bacteria 27368
1032 Ga0495617_001572 3300046452 Bacteria 9860
1033 Ga0495617_072333 3300046452 Bacteria 1133
1034 Ga0495627_000236 3300046453 Bacteria 58365
1035 Ga0495627_001946 3300046453 Bacteria 10727
1036 Ga0495627_016706 3300046453 Bacteria 2507
1037 Ga0495627_030860 3300046453 Bacteria 1697
1038 Ga0495627_035185 3300046453 Bacteria 1561
1039 Ga0495627_041902 3300046453 Bacteria 1404
1040 Ga0495592_0000068 3300046454 Bacteria 94711
1041 Ga0495592_0000495 3300046454 Bacteria 28713
1042 Ga0495592_0000653 3300046454 Bacteria 24059
1043 Ga0495592_0039202 3300046454 Bacteria 3560
1044 Ga0495592_0055085 3300046454 Bacteria 2943
1045 Ga0495603_0019370 3300046455 Bacteria 4118
1046 Ga0495603_0023280 3300046455 Bacteria 3750
1047 Ga0495603_0118365 3300046455 Bacteria 1544
1048 Ga0495603_0125262 3300046455 Bacteria 1497
1049 Ga0495590_0000282 3300046457 Bacteria 27332
1050 Ga0495590_0001651 3300046457 Bacteria 9512
1051 Ga0495590_0008346 3300046457 Bacteria 3957
1052 Ga0495590_0017479 3300046457 Bacteria 2580
1053 Ga0495590_0036494 3300046457 Bacteria 1714
1054 Ga0495590_0046718 3300046457 Bacteria 1510
1055 Ga0495591_000262 3300046458 Bacteria 50259
1056 Ga0495591_000469 3300046458 Bacteria 32137
1057 Ga0495591_001094 3300046458 Bacteria 18055
1058 Ga0495591_001638 3300046458 Bacteria 13516
1059 Ga0495591_002854 3300046458 Bacteria 9286
1060 Ga0495591_008375 3300046458 Bacteria 4242
1061 Ga0495591_018996 3300046458 Bacteria 2313
1062 Ga0495591_026972 3300046458 Bacteria 1776
1063 Ga0495629_0003772 3300046459 Bacteria 11411
1064 Ga0495629_0004324 3300046459 Bacteria 10652
1065 Ga0495629_0013122 3300046459 Bacteria 5984
1066 Ga0495629_0028930 3300046459 Bacteria 3933
1067 Ga0495629_0045349 3300046459 Bacteria 3085
1068 Ga0495629_0061963 3300046459 Bacteria 2614
1069 Ga0495629_0066392 3300046459 Bacteria 2518
1070 Ga0495638_0008544 3300046460 Bacteria 7250
1071 Ga0495638_0035802 3300046460 Bacteria 3163
1072 Ga0495638_0045873 3300046460 Bacteria 2747
1073 Ga0495638_0048501 3300046460 Bacteria 2658
1074 Ga0495651_0038351 3300046462 Bacteria 3731
1075 Ga0495653_0000618 3300046463 Bacteria 27190
1076 Ga0495653_0013150 3300046463 Bacteria 6748
1077 Ga0495653_0018599 3300046463 Bacteria 5639
1078 Ga0495653_0042238 3300046463 Bacteria 3552
1079 Ga0495653_0057119 3300046463 Bacteria 2972
1080 Ga0495653_0086179 3300046463 Bacteria 2308
1081 Ga0495653_0117870 3300046463 Bacteria 1896
1082 Ga0495653_0157649 3300046463 Bacteria 1579
1083 Ga0495650_0000573 3300046471 Bacteria 51370
1084 Ga0495650_0001314 3300046471 Bacteria 25084
1085 Ga0495650_0002443 3300046471 Bacteria 15028
1086 Ga0495650_0003346 3300046471 Bacteria 11794
1087 Ga0495650_0004385 3300046471 Bacteria 9702
1088 Ga0495650_0030133 3300046471 Bacteria 2461
1089 Ga0495580_0001239 3300046472 Bacteria 22517
1090 Ga0495580_0014628 3300046472 Bacteria 5947
1091 Ga0495580_0151740 3300046472 Bacteria 1605
1092 Ga0495582_0002174 3300046473 Bacteria 10973
1093 Ga0495582_0027300 3300046473 Bacteria 3128
1094 Ga0495582_0031428 3300046473 Bacteria 2917
1095 Ga0495605_0000093 3300046474 Bacteria 113652
1096 Ga0495605_0000278 3300046474 Bacteria 57625
1097 Ga0495605_0000305 3300046474 Bacteria 52699
1098 Ga0495605_0001018 3300046474 Bacteria 18905
1099 Ga0495605_0001040 3300046474 Bacteria 18575
1100 Ga0495605_0004177 3300046474 Bacteria 8512
1101 Ga0495605_0005940 3300046474 Bacteria 7058
1102 Ga0495605_0006910 3300046474 Bacteria 6481
1103 Ga0495605_0007501 3300046474 Bacteria 6186
1104 Ga0495605_0007944 3300046474 Bacteria 6007
1105 Ga0495605_0025823 3300046474 Bacteria 3058
1106 Ga0495605_0031805 3300046474 Bacteria 2693
1107 Ga0495605_0067513 3300046474 Bacteria 1696
1108 Ga0495605_0069763 3300046474 Bacteria 1663
1109 Ga0495639_0004844 3300046475 Bacteria 5774
1110 Ga0495664_0001346 3300046477 Bacteria 12931
1111 Ga0495664_0011252 3300046477 Bacteria 5041
1112 Ga0495664_0032868 3300046477 Bacteria 3046
1113 Ga0495584_0000056 3300046491 Bacteria 81387
1114 Ga0495584_0000489 3300046491 Bacteria 27287
1115 Ga0495584_0006118 3300046491 Bacteria 6329
1116 Ga0495584_0011886 3300046491 Bacteria 4450
1117 Ga0495584_0017373 3300046491 Bacteria 3663
1118 Ga0495584_0027360 3300046491 Bacteria 2889
1119 Ga0495584_0040290 3300046491 Bacteria 2358
1120 Ga0495584_0138705 3300046491 Bacteria 1234
1121 Ga0495584_0196845 3300046491 Bacteria 1024
1122 Ga0495585_0003870 3300046492 Bacteria 9953
1123 Ga0495585_0037640 3300046492 Bacteria 2724
1124 Ga0495585_0046006 3300046492 Bacteria 2434
1125 Ga0495585_0063864 3300046492 Bacteria 2020
1126 Ga0495585_0076749 3300046492 Bacteria 1814
1127 Ga0495594_0094393 3300046499 Bacteria 1678
1128 Ga0495596_0000396 3300046500 Bacteria 27748
1129 Ga0495596_0005638 3300046500 Bacteria 5881
1130 Ga0495596_0022104 3300046500 Bacteria 2591
1131 Ga0495607_0000925 3300046501 Bacteria 27392
1132 Ga0495607_0001353 3300046501 Bacteria 21858
1133 Ga0495607_0001462 3300046501 Bacteria 21038
1134 Ga0495607_0001795 3300046501 Bacteria 18324
1135 Ga0495607_0003005 3300046501 Bacteria 13169
1136 Ga0495607_0004797 3300046501 Bacteria 9875
1137 Ga0495607_0005083 3300046501 Bacteria 9520
1138 Ga0495607_0005913 3300046501 Bacteria 8679
1139 Ga0495607_0008612 3300046501 Bacteria 6958
1140 Ga0495607_0018272 3300046501 Bacteria 4473
1141 Ga0495607_0020439 3300046501 Bacteria 4186
1142 Ga0495607_0029495 3300046501 Bacteria 3375
1143 Ga0495607_0051154 3300046501 Bacteria 2401
1144 Ga0495607_0056762 3300046501 Bacteria 2246
1145 Ga0495607_0057546 3300046501 Bacteria 2227
1146 Ga0495607_0062506 3300046501 Bacteria 2110
1147 Ga0495607_0074390 3300046501 Bacteria 1885
1148 Ga0495583_0000017 3300046506 Bacteria 310888
1149 Ga0495583_0000504 3300046506 Bacteria 56210
1150 Ga0495583_0001130 3300046506 Bacteria 29275
1151 Ga0495583_0003223 3300046506 Bacteria 12758
1152 Ga0495583_0004382 3300046506 Bacteria 10145
1153 Ga0495583_0004491 3300046506 Bacteria 9959
1154 Ga0495583_0006751 3300046506 Bacteria 7423
1155 Ga0495583_0007854 3300046506 Bacteria 6626
1156 Ga0495583_0017743 3300046506 Bacteria 3769
1157 Ga0495583_0031200 3300046506 Bacteria 2586
1158 Ga0495583_0085776 3300046506 Bacteria 1362
1159 Ga0495583_0090970 3300046506 Bacteria 1313
1160 Ga0495606_0000588 3300046507 Bacteria 57713
1161 Ga0495606_0000631 3300046507 Bacteria 55444
1162 Ga0495606_0000785 3300046507 Bacteria 48544
1163 Ga0495606_0000946 3300046507 Bacteria 42763
1164 Ga0495606_0019775 3300046507 Bacteria 4991
1165 Ga0495606_0028052 3300046507 Bacteria 3977
1166 Ga0495606_0035371 3300046507 Bacteria 3414
1167 Ga0495606_0040006 3300046507 Bacteria 3153
1168 Ga0495606_0042615 3300046507 Bacteria 3033
1169 Ga0495606_0053360 3300046507 Bacteria 2623
1170 Ga0495606_0102643 3300046507 Bacteria 1738
1171 Ga0495606_0122561 3300046507 Bacteria 1554
1172 Ga0495608_0040426 3300046511 Bacteria 3124
1173 Ga0495610_0000480 3300046512 Bacteria 41208
1174 Ga0495610_0018488 3300046512 Bacteria 3933
1175 Ga0495610_0020029 3300046512 Bacteria 3725
1176 Ga0495610_0020513 3300046512 Bacteria 3667
1177 Ga0495610_0033514 3300046512 Bacteria 2654
1178 Ga0495610_0038894 3300046512 Bacteria 2410
1179 Ga0495616_0005268 3300046513 Bacteria 7978
1180 Ga0495616_0007515 3300046513 Bacteria 6523
1181 Ga0495616_0009686 3300046513 Bacteria 5616
1182 Ga0495616_0020963 3300046513 Bacteria 3548
1183 Ga0495618_0010009 3300046514 Bacteria 5734
1184 Ga0495618_0031352 3300046514 Bacteria 3325
1185 Ga0495618_0054030 3300046514 Bacteria 2540
1186 Ga0495620_0000033 3300046515 Bacteria 118157
1187 Ga0495620_0000153 3300046515 Bacteria 56187
1188 Ga0495620_0000996 3300046515 Bacteria 17517
1189 Ga0495620_0002688 3300046515 Bacteria 10260
1190 Ga0495620_0004172 3300046515 Bacteria 8185
1191 Ga0495620_0012094 3300046515 Bacteria 4477
1192 Ga0495620_0019309 3300046515 Bacteria 3354
1193 Ga0495620_0019600 3300046515 Bacteria 3322
1194 Ga0495620_0025532 3300046515 Bacteria 2793
1195 Ga0495628_0006813 3300046516 Bacteria 9932
1196 Ga0495628_0019444 3300046516 Bacteria 5615
1197 Ga0495628_0030972 3300046516 Bacteria 4328
1198 Ga0495628_0054934 3300046516 Bacteria 3138
1199 Ga0495628_0058495 3300046516 Bacteria 3028
1200 Ga0495628_0070894 3300046516 Bacteria 2716
1201 Ga0495628_0109910 3300046516 Bacteria 2121
1202 Ga0495628_0244164 3300046516 Bacteria 1342
1203 Ga0495630_0018528 3300046517 Bacteria 5115
1204 Ga0495630_0019723 3300046517 Bacteria 4960
1205 Ga0495630_0023771 3300046517 Bacteria 4529
1206 Ga0495631_0002074 3300046518 Bacteria 11657
1207 Ga0495631_0002336 3300046518 Bacteria 10803
1208 Ga0495631_0004757 3300046518 Bacteria 7168
1209 Ga0495631_0030491 3300046518 Bacteria 2446
1210 Ga0495632_0000399 3300046519 Bacteria 40815
1211 Ga0495632_0002587 3300046519 Bacteria 13646
1212 Ga0495632_0003864 3300046519 Bacteria 10421
1213 Ga0495632_0005877 3300046519 Bacteria 8013
1214 Ga0495632_0005925 3300046519 Bacteria 7969
1215 Ga0495632_0009194 3300046519 Bacteria 5974
1216 Ga0495632_0023548 3300046519 Bacteria 3287
1217 Ga0495632_0023631 3300046519 Bacteria 3279
1218 Ga0495632_0048035 3300046519 Bacteria 2114
1219 Ga0495632_0067557 3300046519 Bacteria 1723
1220 Ga0495637_0000314 3300046520 Bacteria 37706
1221 Ga0495637_0000785 3300046520 Bacteria 21339
1222 Ga0495637_0001269 3300046520 Bacteria 15244
1223 Ga0495637_0004926 3300046520 Bacteria 6876
1224 Ga0495637_0014196 3300046520 Bacteria 3761
1225 Ga0495637_0017506 3300046520 Bacteria 3337
1226 Ga0495637_0018047 3300046520 Bacteria 3276
1227 Ga0495637_0023594 3300046520 Bacteria 2793
1228 Ga0495637_0031870 3300046520 Bacteria 2328
1229 Ga0495637_0052207 3300046520 Bacteria 1707
1230 Ga0495643_0000652 3300046522 Bacteria 41014
1231 Ga0495643_0001069 3300046522 Bacteria 27292
1232 Ga0495643_0044091 3300046522 Bacteria 2424
1233 Ga0495643_0055489 3300046522 Bacteria 2117
1234 Ga0495643_0058008 3300046522 Bacteria 2061
1235 Ga0495643_0071659 3300046522 Bacteria 1818
1236 Ga0495643_0093519 3300046522 Bacteria 1548
1237 Ga0495644_0001495 3300046523 Bacteria 9529
1238 Ga0495648_0002015 3300046524 Bacteria 19253
1239 Ga0495648_0002072 3300046524 Bacteria 18977
1240 Ga0495648_0006578 3300046524 Bacteria 9450
1241 Ga0495648_0007030 3300046524 Bacteria 9074
1242 Ga0495648_0007653 3300046524 Bacteria 8614
1243 Ga0495648_0014809 3300046524 Bacteria 5682
1244 Ga0495648_0016612 3300046524 Bacteria 5299
1245 Ga0495648_0049367 3300046524 Bacteria 2580
1246 Ga0495648_0084674 3300046524 Bacteria 1793
1247 Ga0495648_0129367 3300046524 Bacteria 1344
1248 Ga0495666_0000218 3300046526 Bacteria 24459
1249 Ga0495666_0001420 3300046526 Bacteria 11618
1250 Ga0495666_0036544 3300046526 Bacteria 2392
1251 Ga0495642_0000568 3300046528 Bacteria 18555
1252 Ga0495642_0001611 3300046528 Bacteria 9847
1253 Ga0495642_0029065 3300046528 Bacteria 2205
1254 Ga0495652_0003975 3300046529 Bacteria 14326
1255 Ga0495652_0013167 3300046529 Bacteria 7447
1256 Ga0495652_0032431 3300046529 Bacteria 4568
1257 Ga0495654_0000256 3300046530 Bacteria 48724
1258 Ga0495654_0000797 3300046530 Bacteria 24203
1259 Ga0495654_0001161 3300046530 Bacteria 18826
1260 Ga0495654_0002272 3300046530 Bacteria 12429
1261 Ga0495654_0003778 3300046530 Bacteria 9167
1262 Ga0495654_0005966 3300046530 Bacteria 6998
1263 Ga0495654_0019625 3300046530 Bacteria 3535
1264 Ga0495654_0023298 3300046530 Bacteria 3206
1265 Ga0495654_0037906 3300046530 Bacteria 2413
1266 Ga0495654_0058023 3300046530 Bacteria 1868
1267 Ga0495665_0000297 3300046531 Bacteria 25024
1268 Ga0495665_0004466 3300046531 Bacteria 7550
1269 Ga0495665_0015988 3300046531 Bacteria 4043
1270 Ga0495640_0022856 3300046533 Bacteria 4566
1271 Ga0495586_0003839 3300046535 Bacteria 8054
1272 Ga0495586_0220276 3300046535 Bacteria 1078
1273 Ga0495587_0000887 3300046536 Bacteria 19783
1274 Ga0495587_0009541 3300046536 Bacteria 6213
1275 Ga0495587_0050152 3300046536 Bacteria 2469
1276 Ga0495609_0000166 3300046538 Bacteria 69064
1277 Ga0495609_0000226 3300046538 Bacteria 55095
1278 Ga0495609_0000635 3300046538 Bacteria 27336
1279 Ga0495609_0000646 3300046538 Bacteria 27115
1280 Ga0495609_0020103 3300046538 Bacteria 3085
1281 Ga0495597_0000235 3300046542 Bacteria 49912
1282 Ga0495597_0000417 3300046542 Bacteria 36672
1283 Ga0495597_0006757 3300046542 Bacteria 5905
1284 Ga0495597_0031398 3300046542 Bacteria 2417
1285 Ga0495597_0037219 3300046542 Bacteria 2186
1286 Ga0495597_0038172 3300046542 Bacteria 2153
1287 Ga0495597_0045922 3300046542 Bacteria 1937
1288 Ga0495597_0083606 3300046542 Bacteria 1363
1289 Ga0495645_0000569 3300046543 Bacteria 25279
1290 Ga0495645_0028467 3300046543 Bacteria 4060
1291 Ga0495645_0032847 3300046543 Bacteria 3785
1292 Ga0495645_0040065 3300046543 Bacteria 3417
1293 Ga0495645_0091898 3300046543 Bacteria 2167
1294 Ga0495622_0001689 3300046557 Bacteria 10913
1295 Ga0495622_0003620 3300046557 Bacteria 7254
1296 Ga0495622_0026013 3300046557 Bacteria 2734
1297 Ga0495633_0000291 3300046558 Bacteria 57655
1298 Ga0495633_0033243 3300046558 Bacteria 2487
1299 Ga0495633_0071113 3300046558 Bacteria 1623
1300 Ga0495633_0077709 3300046558 Bacteria 1545
1301 Ga0495656_0001226 3300046615 Bacteria 8352
1302 Ga0495668_0003374 3300046616 Bacteria 12022
1303 Ga0495668_0044860 3300046616 Bacteria 2457
1304 Ga0495668_0060606 3300046616 Bacteria 2087
1305 Ga0495668_0073506 3300046616 Bacteria 1877
1306 Ga0495634_0002702 3300046642 Bacteria 14592
1307 Ga0495634_0004936 3300046642 Bacteria 10314
1308 Ga0495634_0005374 3300046642 Bacteria 9868
1309 Ga0495634_0012453 3300046642 Bacteria 6154
1310 Ga0495611_0001848 3300046648 Bacteria 10109
1311 Ga0495611_0001988 3300046648 Bacteria 9692
1312 Ga0495611_0002355 3300046648 Bacteria 8705
1313 Ga0495611_0020930 3300046648 Bacteria 2820
1314 Ga0495625_0000292 3300046660 Bacteria 77369
1315 Ga0495625_0000499 3300046660 Bacteria 58578
1316 Ga0495625_0016660 3300046660 Bacteria 5774
1317 Ga0495625_0019756 3300046660 Bacteria 5216
1318 Ga0495625_0079977 3300046660 Bacteria 2277
1319 Ga0495625_0085419 3300046660 Bacteria 2190
1320 Ga0495625_0167718 3300046660 Bacteria 1467
1321 Ga0495635_0000456 3300046663 Bacteria 25905
1322 Ga0495635_0001641 3300046663 Bacteria 15085
1323 Ga0495635_0033108 3300046663 Bacteria 3585
1324 Ga0495635_0063104 3300046663 Bacteria 2544
1325 Ga0495659_0000023 3300046664 Bacteria 71429
1326 Ga0495659_0000925 3300046664 Bacteria 10412
1327 Ga0495659_0003441 3300046664 Bacteria 5051
1328 Ga0495661_0000277 3300046665 Bacteria 58877
1329 Ga0495661_0000294 3300046665 Bacteria 56661
1330 Ga0495661_0000320 3300046665 Bacteria 53065
1331 Ga0495661_0000340 3300046665 Bacteria 51118
1332 Ga0495661_0011211 3300046665 Bacteria 6082
1333 Ga0495661_0014060 3300046665 Bacteria 5365
1334 Ga0495661_0018097 3300046665 Bacteria 4640
1335 Ga0495661_0045807 3300046665 Bacteria 2672
1336 Ga0495661_0103022 3300046665 Bacteria 1603
1337 Ga0495657_0006504 3300046675 Bacteria 9136
1338 Ga0495657_0113591 3300046675 Bacteria 1713
1339 Ga0495599_0003290 3300046678 Bacteria 9423
1340 Ga0495599_0007760 3300046678 Bacteria 6513
1341 Ga0495599_0048956 3300046678 Bacteria 2649
1342 Ga0495623_0004070 3300046679 Bacteria 9626
1343 Ga0495623_0010555 3300046679 Bacteria 5976
1344 Ga0495623_0015967 3300046679 Bacteria 4852
1345 Ga0495623_0068972 3300046679 Bacteria 2204
1346 Ga0495646_0000243 3300046680 Bacteria 27371
1347 Ga0495646_0001228 3300046680 Bacteria 15033
1348 Ga0495646_0043802 3300046680 Bacteria 2738
1349 Ga0495646_0044515 3300046680 Bacteria 2714
1350 Ga0495646_0065516 3300046680 Bacteria 2151
1351 Ga0495646_0115433 3300046680 Bacteria 1524
1352 Ga0495658_0014229 3300046683 Bacteria 4061
1353 Ga0495669_0000831 3300046684 Bacteria 13135
1354 Ga0495669_0010212 3300046684 Bacteria 3965
1355 Ga0495613_0002898 3300046689 Bacteria 12836
1356 Ga0495613_0013545 3300046689 Bacteria 6053
1357 Ga0495613_0071760 3300046689 Bacteria 2524
1358 Ga0495613_0145053 3300046689 Bacteria 1695
1359 Ga0495624_0000171 3300046690 Bacteria 47952
1360 Ga0495624_0000254 3300046690 Bacteria 42085
1361 Ga0495624_0003268 3300046690 Bacteria 12079
1362 Ga0495624_0004299 3300046690 Bacteria 10461
1363 Ga0495624_0004667 3300046690 Bacteria 9977
1364 Ga0495624_0035913 3300046690 Bacteria 3197
1365 Ga0495670_0003447 3300046691 Bacteria 7772
1366 Ga0495670_0006087 3300046691 Bacteria 5917
1367 Ga0495670_0030009 3300046691 Bacteria 2700
1368 Ga0495670_0042270 3300046691 Bacteria 2274
1369 Ga0495671_0000085 3300046692 Bacteria 88500
1370 Ga0495671_0000524 3300046692 Bacteria 29130
1371 Ga0495671_0000578 3300046692 Bacteria 27299
1372 Ga0495671_0002967 3300046692 Bacteria 10552
1373 Ga0495671_0007435 3300046692 Bacteria 6244
1374 Ga0495671_0007820 3300046692 Bacteria 6053
1375 Ga0495671_0014313 3300046692 Bacteria 4272
1376 Ga0495671_0025909 3300046692 Bacteria 3044
1377 Ga0495671_0107160 3300046692 Bacteria 1364
1378 Ga0495649_0003283 3300046694 Bacteria 11012
1379 Ga0495649_0003444 3300046694 Bacteria 10670
1380 Ga0495649_0003768 3300046694 Bacteria 10057
1381 Ga0495649_0003794 3300046694 Bacteria 10019
1382 Ga0495649_0005402 3300046694 Bacteria 8132
1383 Ga0495649_0006332 3300046694 Bacteria 7369
1384 Ga0495649_0006720 3300046694 Bacteria 7129
1385 Ga0495649_0009136 3300046694 Bacteria 5910
1386 Ga0495649_0022428 3300046694 Bacteria 3533
1387 Ga0495649_0023876 3300046694 Bacteria 3414
1388 Ga0495649_0028988 3300046694 Bacteria 3066
1389 Ga0495649_0046412 3300046694 Bacteria 2365
1390 Ga0495649_0078393 3300046694 Bacteria 1767
1391 Ga0495589_0002545 3300046794 Bacteria 10148
1392 Ga0495589_0002823 3300046794 Bacteria 9614
1393 Ga0495589_0018649 3300046794 Bacteria 3557
1394 Ga0495589_0030473 3300046794 Bacteria 2716
1395 Ga0495589_0033222 3300046794 Bacteria 2592
1396 Ga0495600_0001703 3300046809 Bacteria 12276
1397 Ga0495600_0054935 3300046809 Bacteria 2601
1398 Ga0495660_0001629 3300046810 Bacteria 15065
1399 Ga0495660_0001669 3300046810 Bacteria 14867
1400 Ga0495660_0002273 3300046810 Bacteria 12352
1401 Ga0495660_0003074 3300046810 Bacteria 10411
1402 Ga0495660_0004724 3300046810 Bacteria 8222
1403 Ga0495660_0013886 3300046810 Bacteria 4668
1404 Ga0495660_0024236 3300046810 Bacteria 3456
1405 Ga0495660_0038613 3300046810 Bacteria 2653
1406 Ga0495660_0078900 3300046810 Bacteria 1730
1407 Ga0495660_0107746 3300046810 Bacteria 1425
1408 Ga0495660_0110513 3300046810 Bacteria 1403
1409 Ga0495581_0003179 3300047315 Bacteria 9398
1410 Ga0495581_0083227 3300047315 Bacteria 1853
1411 Ga0495604_0000743 3300047317 Bacteria 27359
1412 Ga0495604_0007577 3300047317 Bacteria 8590
1413 Ga0495604_0015036 3300047317 Bacteria 6174
1414 Ga0495604_0021582 3300047317 Bacteria 5141
1415 Ga0495604_0109302 3300047317 Bacteria 2018
1416 Ga0495604_0115680 3300047317 Bacteria 1948
1417 Ga0495604_0123123 3300047317 Bacteria 1874
1418 Ga0495636_0000155 3300047318 Bacteria 27322
1419 Ga0495636_0004693 3300047318 Bacteria 5360
1420 Ga0495674_0001228 3300047319 Bacteria 24865
1421 Ga0495674_0041468 3300047319 Bacteria 4111
1422 Ga0495674_0096234 3300047319 Bacteria 2523
1423 Ga0495674_0098580 3300047319 Bacteria 2488
1424 Ga0495674_0099150 3300047319 Bacteria 2480
1425 Ga0495672_0000401 3300047320 Bacteria 52696
1426 Ga0495672_0000450 3300047320 Bacteria 48960
1427 Ga0495672_0000537 3300047320 Bacteria 42948
1428 Ga0495672_0001156 3300047320 Bacteria 26677
1429 Ga0495672_0001307 3300047320 Bacteria 24818
1430 Ga0495672_0007072 3300047320 Bacteria 8510
1431 Ga0495672_0012994 3300047320 Bacteria 5766
1432 Ga0495672_0021249 3300047320 Bacteria 4236
1433 Ga0495672_0030026 3300047320 Bacteria 3415
1434 Ga0495672_0031641 3300047320 Bacteria 3301
1435 Ga0495672_0039332 3300047320 Bacteria 2875
1436 Ga0495672_0050690 3300047320 Bacteria 2448
1437 Ga0495672_0059877 3300047320 Bacteria 2201
1438 Ga0495672_0061533 3300047320 Bacteria 2163
1439 Ga0495672_0089308 3300047320 Bacteria 1696
1440 Ga0495672_0090258 3300047320 Bacteria 1684
1441 Ga0495672_0195883 3300047320 Bacteria 1013
1442 Ga0495676_0000125 3300047321 Bacteria 58716
1443 Ga0495676_0000749 3300047321 Bacteria 27029
1444 Ga0495676_0031365 3300047321 Bacteria 4496
1445 Ga0495676_0038095 3300047321 Bacteria 3996
1446 Ga0495676_0067540 3300047321 Bacteria 2765
1447 Ga0495676_0121897 3300047321 Bacteria 1895
1448 Ga0495676_0224834 3300047321 Bacteria 1292
1449 Ga0495680_0001285 3300047322 Bacteria 27369
1450 Ga0495680_0004391 3300047322 Bacteria 13499
1451 Ga0495680_0005516 3300047322 Bacteria 11883
1452 Ga0495680_0019239 3300047322 Bacteria 5773
1453 Ga0495680_0052691 3300047322 Bacteria 3171
1454 Ga0495680_0066205 3300047322 Bacteria 2765
1455 Ga0495683_0000016 3300047323 Bacteria 191396
1456 Ga0495683_0000196 3300047323 Bacteria 57478
1457 Ga0495683_0002598 3300047323 Bacteria 10843
1458 Ga0495683_0002747 3300047323 Bacteria 10479
1459 Ga0495683_0004781 3300047323 Bacteria 7608
1460 Ga0495683_0011333 3300047323 Bacteria 4692
1461 Ga0495683_0014561 3300047323 Bacteria 4098
1462 Ga0495683_0020243 3300047323 Bacteria 3433
1463 Ga0495683_0030411 3300047323 Bacteria 2754
1464 Ga0495683_0038403 3300047323 Bacteria 2424
1465 Ga0495683_0043180 3300047323 Bacteria 2271
1466 Ga0495683_0089305 3300047323 Bacteria 1495
1467 Ga0495687_000029 3300047443 Bacteria 293244
1468 Ga0495687_000912 3300047443 Bacteria 30787
1469 Ga0495687_005852 3300047443 Bacteria 7696
1470 Ga0495687_011381 3300047443 Bacteria 4791
1471 Ga0495687_035246 3300047443 Bacteria 2252
1472 Ga0495687_051328 3300047443 Bacteria 1751
1473 Ga0495675_0000949 3300047444 Bacteria 17605
1474 Ga0495675_0004283 3300047444 Bacteria 8635
1475 Ga0495675_0006849 3300047444 Bacteria 6997
1476 Ga0495675_0022992 3300047444 Bacteria 3973
1477 Ga0495675_0058841 3300047444 Bacteria 2436
1478 Ga0495679_000260 3300047446 Bacteria 43871
1479 Ga0495679_000414 3300047446 Bacteria 31798
1480 Ga0495679_000615 3300047446 Bacteria 24021
1481 Ga0495679_000821 3300047446 Bacteria 19743
1482 Ga0495679_010099 3300047446 Bacteria 3730
1483 Ga0495673_0000789 3300047469 Bacteria 29813
1484 Ga0495673_0000901 3300047469 Bacteria 27282
1485 Ga0495673_0002663 3300047469 Bacteria 12336
1486 Ga0495673_0002701 3300047469 Bacteria 12199
1487 Ga0495673_0003685 3300047469 Bacteria 9987
1488 Ga0495673_0004115 3300047469 Bacteria 9223
1489 Ga0495673_0007001 3300047469 Bacteria 6551
1490 Ga0495673_0016291 3300047469 Bacteria 3803
1491 Ga0495673_0035670 3300047469 Bacteria 2288
1492 Ga0495673_0037017 3300047469 Bacteria 2232
1493 Ga0495673_0038139 3300047469 Bacteria 2188
1494 Ga0495673_0043759 3300047469 Bacteria 2001
1495 Ga0495673_0057602 3300047469 Bacteria 1677
1496 Ga0495673_0059498 3300047469 Bacteria 1642
1497 Ga0495673_0083499 3300047469 Bacteria 1318
1498 Ga0495681_0000612 3300047470 Bacteria 27346
1499 Ga0495681_0003435 3300047470 Bacteria 11023
1500 Ga0495681_0003898 3300047470 Bacteria 10287
1501 Ga0495681_0004614 3300047470 Bacteria 9363
1502 Ga0495681_0052603 3300047470 Bacteria 1909
1503 Ga0495681_0055849 3300047470 Bacteria 1839
1504 Ga0495681_0075672 3300047470 Bacteria 1514
1505 Ga0495684_0003850 3300047471 Bacteria 11692
1506 Ga0495684_0044256 3300047471 Bacteria 3408
1507 Ga0495684_0190367 3300047471 Bacteria 1517
1508 Ga0495686_0040163 3300047472 Bacteria 2985
1509 Ga0495686_0092223 3300047472 Bacteria 1837
1510 Ga0495686_0099700 3300047472 Bacteria 1753
1511 Ga0495593_0005649 3300047673 Bacteria 7382
1512 Ga0495593_0006424 3300047673 Bacteria 6893
1513 Ga0495593_0009556 3300047673 Bacteria 5628
1514 Ga0495593_0011140 3300047673 Bacteria 5172
1515 Ga0495593_0017833 3300047673 Bacteria 3997
1516 Ga0495593_0027489 3300047673 Bacteria 3131
1517 Ga0495593_0040711 3300047673 Bacteria 2500
1518 Ga0495602_0001338 3300048088 Bacteria 24322
1519 Ga0495602_0002523 3300048088 Bacteria 18651
1520 Ga0495602_0027804 3300048088 Bacteria 5426
1521 Ga0495602_0032099 3300048088 Bacteria 4950
1522 Ga0495602_0287063 3300048088 Bacteria 1209
1523 Ga0495614_0000052 3300048089 Bacteria 35767
1524 Ga0495614_0001367 3300048089 Bacteria 10529
1525 Ga0495626_0000283 3300048091 Bacteria 55345
1526 Ga0495626_0000887 3300048091 Bacteria 26500
1527 Ga0495626_0000935 3300048091 Bacteria 25400
1528 Ga0495626_0002034 3300048091 Bacteria 14827
1529 Ga0495626_0003227 3300048091 Bacteria 10573
1530 Ga0495626_0003237 3300048091 Bacteria 10542
1531 Ga0495626_0008951 3300048091 Bacteria 5434
1532 Ga0495626_0045240 3300048091 Bacteria 2056
1533 Ga0496100_0000199 3300048903 Bacteria 32913
1534 Ga0496101_0001503 3300048904 Bacteria 13954
1535 Ga0496101_0026040 3300048904 Bacteria 4064
1536 Ga0496102_0005613 3300048905 Bacteria 10648
1537 Ga0496102_0016611 3300048905 Bacteria 6434
1538 Ga0496102_0066671 3300048905 Bacteria 3299
1539 Ga0496102_0161450 3300048905 Bacteria 2108
1540 Ga0496104_0021738 3300048907 Bacteria 5891
1541 Ga0496104_0037376 3300048907 Bacteria 4541
1542 Ga0496104_0045980 3300048907 Bacteria 4107
1543 Ga0496104_0072134 3300048907 Bacteria 3283
1544 Ga0496104_0255638 3300048907 Bacteria 1664
1545 Ga0496105_0007454 3300048908 Bacteria 8470
1546 Ga0496105_0035282 3300048908 Bacteria 4116
1547 Ga0496105_0100040 3300048908 Bacteria 2394
1548 Ga0496107_0038024 3300048910 Bacteria 3455
1549 Ga0496107_0266112 3300048910 Bacteria 1276
1550 Ga0496108_0198653 3300048911 Bacteria 1740
1551 Ga0496109_0062241 3300048912 Bacteria 3412
1552 Ga0496109_0268638 3300048912 Bacteria 1607
1553 Ga0496110_0214686 3300048913 Bacteria 1749
1554 Ga0496112_0002167 3300048915 Bacteria 15599
1555 Ga0496112_0149916 3300048915 Bacteria 2299
1556 Ga0496114_0004974 3300048917 Bacteria 10369
1557 Ga0496114_0208002 3300048917 Bacteria 1715
1558 Ga0496115_0252232 3300048918 Bacteria 1453
1559 Ga0496116_0000401 3300048919 Bacteria 62910
1560 Ga0496116_0009277 3300048919 Bacteria 8411
1561 Ga0496116_0025205 3300048919 Bacteria 4376
1562 Ga0496116_0065871 3300048919 Bacteria 2321
1563 Ga0496117_0001058 3300048920 Bacteria 41996
1564 Ga0496117_0001828 3300048920 Bacteria 28862
1565 Ga0496117_0003306 3300048920 Bacteria 18852
1566 Ga0496117_0003621 3300048920 Bacteria 17800
1567 Ga0496117_0003735 3300048920 Bacteria 17441
1568 Ga0496117_0031436 3300048920 Bacteria 4051
1569 Ga0496117_0032301 3300048920 Bacteria 3979
1570 Ga0496117_0044107 3300048920 Bacteria 3233
1571 Ga0496117_0100955 3300048920 Bacteria 1826
1572 Ga0496117_0111635 3300048920 Bacteria 1701
1573 Ga0496118_0001636 3300048921 Bacteria 33036
1574 Ga0496118_0031339 3300048921 Bacteria 4409
1575 Ga0496118_0050171 3300048921 Bacteria 3206
1576 Ga0496118_0058392 3300048921 Bacteria 2883
1577 Ga0496118_0060547 3300048921 Bacteria 2810
1578 Ga0496118_0066657 3300048921 Bacteria 2627
1579 Ga0496119_0000071 3300048922 Bacteria 153652
1580 Ga0496119_0004894 3300048922 Bacteria 13102
1581 Ga0496120_0002379 3300048923 Bacteria 19199
1582 Ga0496120_0108689 3300048923 Bacteria 1452
1583 Ga0496120_0112717 3300048923 Bacteria 1418
1584 Ga0496121_0000688 3300048924 Bacteria 63017
1585 Ga0496121_0004830 3300048924 Bacteria 17744
1586 Ga0496121_0006262 3300048924 Bacteria 14887
1587 Ga0496121_0006586 3300048924 Bacteria 14326
1588 Ga0496121_0017614 3300048924 Bacteria 7278
1589 Ga0496121_0020676 3300048924 Bacteria 6496
1590 Ga0496121_0022467 3300048924 Bacteria 6121
1591 Ga0496121_0056232 3300048924 Bacteria 3269
1592 Ga0496121_0062034 3300048924 Bacteria 3064
1593 Ga0496121_0297996 3300048924 Bacteria 1095
1594 Ga0496122_0009639 3300048925 Bacteria 10109
1595 Ga0496122_0010620 3300048925 Bacteria 9458
1596 Ga0496122_0033734 3300048925 Bacteria 4204
1597 Ga0496122_0042036 3300048925 Bacteria 3602
1598 Ga0496122_0044741 3300048925 Bacteria 3450
1599 Ga0496122_0109303 3300048925 Bacteria 1820
1600 Ga0496122_0137119 3300048925 Bacteria 1539
1601 Ga0496122_0211277 3300048925 Bacteria 1123
1602 Ga0496123_0002423 3300048926 Bacteria 23210
1603 Ga0496123_0002964 3300048926 Bacteria 19767
1604 Ga0496123_0003571 3300048926 Bacteria 17247
1605 Ga0496123_0066850 3300048926 Bacteria 2274
1606 Ga0496123_0068553 3300048926 Bacteria 2233
1607 Ga0496124_0000730 3300048927 Bacteria 53903
1608 Ga0496124_0005106 3300048927 Bacteria 14948
1609 Ga0496124_0006203 3300048927 Bacteria 13098
1610 Ga0496124_0008292 3300048927 Bacteria 10883
1611 Ga0496124_0010955 3300048927 Bacteria 9117
1612 Ga0496124_0011716 3300048927 Bacteria 8748
1613 Ga0496124_0040328 3300048927 Bacteria 4040
1614 Ga0496124_0058143 3300048927 Bacteria 3253
1615 Ga0496124_0084326 3300048927 Bacteria 2606
1616 Ga0496124_0104103 3300048927 Bacteria 2295
1617 Ga0496124_0147033 3300048927 Bacteria 1853
1618 Ga0496125_0001109 3300048928 Bacteria 41385
1619 Ga0496125_0006175 3300048928 Bacteria 13054
1620 Ga0496125_0028311 3300048928 Bacteria 5065
1621 Ga0496125_0063359 3300048928 Bacteria 2949
1622 Ga0496125_0064483 3300048928 Bacteria 2910
1623 Ga0496125_0145106 3300048928 Bacteria 1642
1624 Ga0496126_0000572 3300048929 Bacteria 70289
1625 Ga0496126_0008779 3300048929 Bacteria 10849
1626 Ga0496126_0113043 3300048929 Bacteria 2364
1627 Ga0496126_0143106 3300048929 Bacteria 2056
1628 Ga0496126_0154010 3300048929 Bacteria 1968
1629 Ga0501307_000415 3300049162 Bacteria 2841
1630 Ga0495678_000238 3300049459 Bacteria 62224
1631 Ga0495678_000268 3300049459 Bacteria 57604
1632 Ga0495678_003223 3300049459 Bacteria 10232
1633 Ga0495678_003866 3300049459 Bacteria 8992
1634 Ga0495678_013988 3300049459 Bacteria 3747
1635 Ga0495682_0000198 3300049460 Bacteria 48570
1636 Ga0495682_0000247 3300049460 Bacteria 42775
1637 Ga0495682_0000640 3300049460 Bacteria 23367
1638 Ga0495682_0006882 3300049460 Bacteria 4571
1639 Ga0495682_0018358 3300049460 Bacteria 2634
1640 Ga0495682_0020758 3300049460 Bacteria 2465
1641 Ga0495682_0036236 3300049460 Bacteria 1816
1642 Ga0501314_000567 3300049530 Bacteria 2331
1643 Ga0501032_0067527 3300049569 Bacteria 2388
1644 Ga0501034_0000165 3300049571 Bacteria 123084
1645 Ga0501034_0212403 3300049571 Bacteria 1890
1646 Ga0501040_0081797 3300049576 Bacteria 2238
1647 Ga0501043_0000072 3300049579 Bacteria 89021
1648 Ga0501046_0000112 3300049580 Bacteria 86313
1649 Ga0501047_0000138 3300049581 Bacteria 89028
1650 Ga0501048_0094967 3300049582 Bacteria 2103
1651 Ga0501072_0002501 3300049588 Bacteria 13768
1652 Ga0501075_0099860 3300049591 Bacteria 2204
1653 Ga0501076_0007160 3300049592 Bacteria 8109
1654 Ga0501077_0122857 3300049593 Bacteria 1646
1655 Ga0501281_01164 3300049777 Bacteria 2098
1656 Ga0501035_0325425 3300049822 Bacteria 1291
1657 Ga0501226_000033 3300049853 Bacteria 72088
1658 nmdc:mga03683_21537_c1 3300050489 Bacteria 2487
1659 nmdc:mga03n38_106562_c1 3300050490 Bacteria 1359
1660 nmdc:mga00v17_38161_c1 3300050491 Bacteria 2871
1661 nmdc:mga0k408_27457_c1 3300050493 Bacteria 3233
1662 nmdc:mga0k408_30939_c1 3300050493 Bacteria 3054
1663 nmdc:mga0k408_423_c1 3300050493 Bacteria 23086
1664 nmdc:mga0k408_460_c1 3300050493 Bacteria 22325
1665 nmdc:mga0k408_9093_c1 3300050493 Bacteria 5349
1666 nmdc:mga06z11_145298_c1 3300050494 Bacteria 1344
1667 nmdc:mga07m45_171_c2 3300050496 Bacteria 24206
1668 nmdc:mga07m45_191_c1 3300050496 Bacteria 24330
1669 nmdc:mga07m45_204_c1 3300050496 Bacteria 23423
1670 nmdc:mga07m45_23413_c1 3300050496 Bacteria 3376
1671 Ga0500610_0057620 3300053079 Bacteria 2027
1672 Ga0500578_0000719 3300053086 Bacteria 39279
1673 Ga0500643_041040 3300053087 Bacteria 1361
1674 Ga0500651_0003767 3300053093 Bacteria 8359
1675 Ga0500651_0118787 3300053093 Bacteria 1607
1676 Ga0500571_003409 3300053110 Bacteria 8152
1677 Ga0500593_003822 3300053117 Bacteria 5767
1678 Ga0500594_0001511 3300053118 Bacteria 5055
1679 Ga0500595_000392 3300053119 Bacteria 28126
1680 Ga0500607_047047 3300053121 Bacteria 2310
1681 Ga0500618_013837 3300053125 Bacteria 2075
1682 Ga0500628_024023 3300053129 Bacteria 1262
1683 Ga0500642_0017415 3300053130 Bacteria 2753
1684 Ga0500652_001816 3300053131 Bacteria 6467
1685 Ga0500658_0000179 3300053134 Bacteria 30449
1686 Ga0500658_0014926 3300053134 Bacteria 2879
1687 Ga0500658_0041763 3300053134 Bacteria 1840
1688 Ga0500659_0001403 3300053135 Bacteria 15295
1689 Ga0500559_0000356 3300053136 Bacteria 34103
1690 Ga0500568_0023121 3300053139 Bacteria 2647
1691 Ga0500568_0028190 3300053139 Bacteria 2342
1692 Ga0500573_0134326 3300053140 Bacteria 1368
1693 Ga0500619_007105 3300053154 Bacteria 2629
1694 Ga0500622_0000262 3300053156 Bacteria 53796
1695 Ga0500622_0018045 3300053156 Bacteria 3752
1696 Ga0500634_0052195 3300053161 Bacteria 2196
1697 Ga0500634_0084240 3300053161 Bacteria 1630
1698 Ga0501084_0074943 3300054114 Bacteria 2835
1699 Ga0590071_008839 3300059421 Bacteria 2367
1700 Ga0587083_0002979 3300059505 Bacteria 2187
1701 Ga0587067_000186 3300059640 Bacteria 4578
1702 Ga0587068_005160 3300059641 Bacteria 1767
1703 Ga0587072_000587 3300059643 Bacteria 3816
1704 Ga0587076_004789 3300059645 Bacteria 1713
1705 Ga0466962_0007398 3300061719 Bacteria 5268
1706 Ga0466962_0014320 3300061719 Bacteria 3821
1707 Ga0466962_0053511 3300061719 Bacteria 1929
1708 Ga0530510_0172150 3300061734 Bacteria 1604
1709 2501072969 2501025501 Bacteria 7768574
1710 2501083438 2501025502 Bacteria 9641094
1711 2501413472 2501025504 Bacteria 8008976
1712 2509131917 2508501125 Bacteria 7208311
1713 2510250441 2510065045 Bacteria 7761063
1714 2511087726 2510917013 Bacteria 9951648
1715 2511101771 2510917014 Bacteria 8296963
1716 2511106249 2510917015 Bacteria 7950052
1717 2511242852 2511231002 Bacteria 5042903
1718 2511256898 2511231004 Bacteria 6669789
1719 2511265739 2511231006 Bacteria 6794709
1720 2511270970 2511231007 Bacteria 6306603
1721 2511279771 2511231008 Bacteria 6624100
1722 2511292934 2511231010 Bacteria 6373152
1723 2511296896 2511231011 Bacteria 6149768
1724 2511304599 2511231012 Bacteria 6738011
1725 2511313579 2511231014 Bacteria 6462302
1726 2511317283 2511231015 Bacteria 6598026
1727 2511325465 2511231016 Bacteria 6704427
1728 2511331332 2511231017 Bacteria 6503007
1729 2511337403 2511231018 Bacteria 6436256
1730 2511341766 2511231019 Bacteria 6520662
1731 2511351428 2511231020 Bacteria 6115223
1732 2511357673 2511231021 Bacteria 7302637
1733 2511360554 2511231022 Bacteria 6719296
1734 2511370942 2511231023 Bacteria 6808468
1735 2511373666 2511231024 Bacteria 5835885
1736 2511411644 2511231031 Bacteria 6558529
1737 2511827344 2511231156 Bacteria 6845832
1738 2512327515 2512047018 Bacteria 6663241
1739 2512345940 2512047030 Bacteria 9031815
1740 2513226494 2513020051 Bacteria 6053213
1741 2513553502 2513237082 Bacteria 8640282
1742 2513554911 2513237082 Bacteria 8640282
1743 2513559571 2513237083 Bacteria 8410967
1744 2513563026 2513237083 Bacteria 8410967
1745 2513960449 2513237151 Bacteria 6309801
1746 2514054040 2513237166 Bacteria 10373764
1747 2516018003 2515154189 Bacteria 9629850
1748 2519461329 2519103095 Bacteria 6629912
1749 2527078954 2526164713 Bacteria 6780608
1750 2547372097 2547132103 Bacteria 5115736
1751 2547375470 2547132103 Bacteria 5115736
1752 2554812991 2554235132 Bacteria 6772433
1753 2555246716 2554235231 Bacteria 5215788
1754 2555672535 2554235341 Bacteria 6867980
1755 2563058328 2562617112 Bacteria 10918404
1756 2583795033 2582580891 Bacteria 6800976
1757 2585290159 2582581311 Bacteria 6763856
1758 2587734355 2585428058 Bacteria 6853932
1759 2587757555 2585428062 Bacteria 6842168
1760 2588293946 2588253510 Bacteria 6901809
1761 2597028342 2596583598 Bacteria 5251611
1762 2597860594 2597489887 Bacteria 6666321
1763 2599330823 2599185155 Bacteria 5827168
1764 2599356263 2599185160 Bacteria 6844013
1765 2599362340 2599185161 Bacteria 6960462
1766 2599369354 2599185162 Bacteria 6957254
1767 2599375449 2599185163 Bacteria 6995158
1768 2599381368 2599185164 Bacteria 6841688
1769 2599387116 2599185165 Bacteria 6843250
1770 2599394307 2599185166 Bacteria 6959206
1771 2599400831 2599185167 Bacteria 6353609
1772 2599406072 2599185168 Bacteria 6997636
1773 2599444357 2599185178 Bacteria 5365746
1774 2599450158 2599185179 Bacteria 6611171
1775 2599463096 2599185181 Bacteria 6844519
1776 2599467485 2599185182 Bacteria 6883168
1777 2599486170 2599185185 Bacteria 6652270
1778 2599492113 2599185186 Bacteria 6831633
1779 2599502364 2599185188 Bacteria 6164180
1780 2599512230 2599185190 Bacteria 6285678
1781 2599517211 2599185191 Bacteria 6297582
1782 2599616974 2599185212 Bacteria 6765997
1783 2599626141 2599185214 Bacteria 8209958
1784 2599675780 2599185226 Bacteria 8233575
1785 2599682336 2599185227 Bacteria 8246414
1786 2599695987 2599185229 Bacteria 8216126
1787 2599735435 2599185239 Bacteria 8686614
1788 2599745813 2599185240 Bacteria 7968121
1789 2599768469 2599185248 Bacteria 6696816
1790 2599804953 2599185257 Bacteria 6492581
1791 2599878745 2599185288 Bacteria 6666191
1792 2599885889 2599185289 Bacteria 6778765
1793 2599892408 2599185290 Bacteria 6289611
1794 2599897603 2599185291 Bacteria 6775623
1795 2599933938 2599185300 Bacteria 6062622
1796 2599945753 2599185302 Bacteria 5954930
1797 2599951108 2599185303 Bacteria 6512725
1798 2599956747 2599185304 Bacteria 5951361
1799 2599961490 2599185305 Bacteria 6748700
1800 2599965733 2599185306 Bacteria 6637356
1801 2599974741 2599185307 Bacteria 6194719
1802 2599978593 2599185308 Bacteria 6621546
1803 2599984838 2599185309 Bacteria 5969593
1804 2599988077 2599185310 Bacteria 6014457
1805 2599993732 2599185311 Bacteria 6354990
1806 2599998867 2599185312 Bacteria 5912071
1807 2600008528 2599185313 Bacteria 6658188
1808 2600012660 2599185314 Bacteria 6621749
1809 2600018709 2599185315 Bacteria 6771107
1810 2600025144 2599185316 Bacteria 6320029
1811 2600030029 2599185317 Bacteria 6435722
1812 2600036584 2599185318 Bacteria 6961590
1813 2600041893 2599185319 Bacteria 6637840
1814 2600046405 2599185320 Bacteria 5963263
1815 2600053119 2599185321 Bacteria 6764560
1816 2600062827 2599185322 Bacteria 6763055
1817 2600066078 2599185323 Bacteria 6688755
1818 2600073656 2599185324 Bacteria 6590677
1819 2600079649 2599185325 Bacteria 6324919
1820 2600207721 2599185355 Bacteria 7968906
1821 2600215724 2599185356 Bacteria 6843884
1822 2600359686 2600254930 Bacteria 6431253
1823 2600366250 2600254931 Bacteria 6734225
1824 2600446003 2600254954 Bacteria 5100516
1825 2600811580 2600255067 Bacteria 6795583
1826 2601628544 2600255283 Bacteria 6061572
1827 2601775891 2600255313 Bacteria 6842543
1828 2601801078 2600255318 Bacteria 6383414
1829 2602011378 2600255389 Bacteria 5275336
1830 2606073172 2603880185 Bacteria 6379190
1831 2606125966 2603880199 Bacteria 6377649
1832 2608383444 2606217733 Bacteria 6360972
1833 2621297126 2619619299 Bacteria 6649820
1834 2624483119 2623620443 Bacteria 6427864
1835 2624494649 2623620446 Bacteria 6500345
1836 2643842352 2643221565 Bacteria 6216018
1837 2643955930 2643221589 Bacteria 6250934
1838 2643969810 2643221592 Bacteria 6608788
1839 2644020724 2643221602 Bacteria 6249926
1840 2644141931 2643221625 Bacteria 6512927
1841 2644162098 2643221628 Bacteria 5745828
1842 2644186233 2643221633 Bacteria 6733554
1843 2644246427 2643221644 Bacteria 6865017
1844 2644273309 2643221648 Bacteria 6521465
1845 2644283379 2643221650 Bacteria 7029547
1846 2644304199 2643221654 Bacteria 5273570
1847 2644326767 2643221658 Bacteria 6064537
1848 2644399977 2643221672 Bacteria 6322190
1849 2652546477 2651869719 Bacteria 6047974
1850 2671089244 2667528170 Bacteria 6786960
1851 2671098979 2667528171 Bacteria 6900659
1852 2671128748 2667528176 Bacteria 6724917
1853 2671771959 2671180172 Bacteria 6495783
1854 2676745173 2675903129 Bacteria 7964495
1855 2677901284 2675903420 Bacteria 6247433
1856 2678265856 2675903515 Bacteria 6580491
1857 2713475133 2711768613 Bacteria 11048459
1858 2715750112 2713897148 Bacteria 5883533
1859 2715756513 2713897149 Bacteria 6506249
1860 2718636321 2718217725 Bacteria 5758958
1861 2719639587 2718217991 Bacteria 7829542
1862 2738671945 2738541265 Bacteria 6594665
1863 2738690330 2738541271 Bacteria 5657310
1864 2738721569 2738541277 Bacteria 7458140
1865 2738750339 2738541282 Bacteria 6593925
1866 2738812034 2738541294 Bacteria 6925949
1867 2738824135 2738541296 Bacteria 7285013
1868 2738836526 2738541298 Bacteria 7286732
1869 2738859379 2738541303 Bacteria 6591772
1870 2738878147 2738541306 Bacteria 7284992
1871 2738899394 2738541309 Bacteria 6926455
1872 2739189763 2738543002 Bacteria 7284546
1873 2739198768 2738543004 Bacteria 6381073
1874 2739199336 2738543004 Bacteria 6381073
1875 2739224741 2738543008 Bacteria 7282815
1876 2739243678 2738543012 Bacteria 7115078
1877 2739261496 2738543015 Bacteria 6750701
1878 2739266104 2738543016 Bacteria 5657564
1879 2739281238 2738543019 Bacteria 7459457
1880 2739289794 2738543020 Bacteria 5718238
1881 2739295106 2738543021 Bacteria 5718241
1882 2739312802 2738543025 Bacteria 6600348
1883 2743740144 2740892503 Bacteria 6855563
1884 2745007088 2744054620 Bacteria 6551379
1885 2746090768 2744054900 Bacteria 8399525
1886 2746092371 2744054901 Bacteria 8397047
1887 2753567514 2751185846 Bacteria 7242164
1888 2753570230 2751185846 Bacteria 7242164
1889 2765586338 2765235841 Bacteria 6137024
1890 2774123670 2773857670 Bacteria 6407454
1891 2774135855 2773857673 Bacteria 6513460
1892 2784262109 2784132063 Bacteria 6262788
1893 2784317520 2784132072 Bacteria 6596533
1894 2792832690 2791355137 Bacteria 9654227
1895 2794598549 2791355520 Bacteria 5948615
1896 2807410572 2806310737 Bacteria 5751088
1897 2807458917 2806310745 Bacteria 5742165
1898 2808858126 2808606361 Bacteria 6136259
1899 2808906403 2808606373 Bacteria 4423627
1900 2808925979 2808606376 Bacteria 6248667
1901 2808932266 2808606377 Bacteria 6646337
1902 2808938297 2808606378 Bacteria 6177535
1903 2808943302 2808606379 Bacteria 5022697
1904 2808948134 2808606380 Bacteria 6248705
1905 2808954387 2808606381 Bacteria 6646461
1906 2808960816 2808606382 Bacteria 6841132
1907 2808966611 2808606383 Bacteria 6138645
1908 2808975853 2808606385 Bacteria 6711065
1909 2808992962 2808606388 Bacteria 6706662
1910 2809001441 2808606389 Bacteria 6138126
1911 2809216896 2808606445 Bacteria 6057339
1912 2812369155 2811994881 Bacteria 6298475
1913 2816474107 2816332133 Bacteria 7249298
1914 2817258882 2816332253 Bacteria 6764532
1915 2817280688 2816332256 Bacteria 6891714
1916 2817454804 2816332286 Bacteria 6853759
1917 2817493761 2816332298 Bacteria 6852809
1918 2819545089 2818991436 Bacteria 5376622
1919 2819625127 2818991450 Bacteria 6962147
1920 2819630545 2818991452 Bacteria 8442785
1921 2819654843 2818991456 Bacteria 6123676
1922 2819704101 2818991464 Bacteria 6907494
1923 2823421906 2823421272 Bacteria 5372474
1924 2825655393 2825651385 Bacteria 6715909
1925 2826582124 2826581358 Bacteria 5963467
1926 2831272317 2831265667 Bacteria 7184833
1927 2834034477 2834028612 Bacteria 6354979
1928 2838059477 2838054893 Bacteria 7451788
1929 2842326119 2842324504 Bacteria 9364110
1930 2842351360 2842348783 Bacteria 9002918
1931 2842455439 2842454564 Bacteria 8730687
1932 2842679486 2842677519 Bacteria 5615038
1933 2842808009 2842805378 Bacteria 5385175
1934 2842821198 2842815866 Bacteria 5947510
1935 2842833171 2842832357 Bacteria 5959113
1936 2842845410 2842843487 Bacteria 6004777
1937 2842852452 2842849001 Bacteria 5924277
1938 2842855328 2842854478 Bacteria 6143501
1939 2843691371 2843690924 Bacteria 5169057
1940 2843694140 2843690924 Bacteria 5169057
1941 2844666703 2844665904 Bacteria 6817974
1942 2844671509 2844665904 Bacteria 6817974
1943 2852616042 2852612431 Bacteria 6885235
1944 2852662536 2852657418 Bacteria 6472974
1945 2852671010 2852667396 Bacteria 6885555
1946 2856289699 2856287931 Bacteria 7223934
1947 2857364431 2857357740 Bacteria 9937880
1948 2857577830 2857576091 Bacteria 5465855
1949 2860341424 2860339153 Bacteria 6846989
1950 2860872741 2860867994 Bacteria 5645326
1951 2863426037 2863421361 Bacteria 7300805
1952 2870074987 2870068957 Bacteria 8925310
1953 2878035057 2878029506 Bacteria 6418441
1954 2880235700 2880230671 Bacteria 6140320
1955 2883088306 2883087390 Bacteria 9532701
1956 2885202678 2885198086 Bacteria 7212419
1957 2885216331 2885211737 Bacteria 7212420
1958 2885268554 2885266251 Bacteria 4796748
1959 2900578707 2900577576 Bacteria 5438534
1960 2900639379 2900634093 Bacteria 10263517
1961 2904489662 2904483920 Bacteria 7545285
1962 2904519241 2904518522 Bacteria 6068986
1963 2904555466 2904550169 Bacteria 6221258
1964 2904565367 2904564687 Bacteria 7609577
1965 2904571937 2904571731 Bacteria 7608790
1966 2904615512 2904615490 Bacteria 10047340
1967 2908452280 2908446538 Bacteria 6829095
1968 2912968611 2912963787 Bacteria 5646108
1969 2913042266 2913036834 Bacteria 6704877
1970 2917076422 2917070673 Bacteria 6868303
1971 2919065858 2919063839 Bacteria 6302690
1972 2919155656 2919155634 Bacteria 4860545
1973 2919389479 2919385768 Bacteria 5897293
1974 2919457263 2919456309 Bacteria 6586567
1975 2919462539 2919462493 Bacteria 5817112
1976 2919486693 2919481497 Bacteria 6907839
1977 2919488446 2919487758 Bacteria 5929766
1978 2919506500 2919501602 Bacteria 5286340
1979 2919533984 2919527303 Bacteria 7718827
1980 2919700857 2919697872 Bacteria 6553725
1981 2919704435 2919704043 Bacteria 5560311
1982 2921649904 2921643360 Bacteria 11448031
1983 2921650179 2921643360 Bacteria 11448031
1984 2923159236 2923153595 Bacteria 6870622
1985 2923523236 2923519811 Bacteria 6298479
1986 2923591936 2923586266 Bacteria 6565975
1987 2926068184 2926063275 Bacteria 5285848
1988 2928063162 2928058823 Bacteria 5520022
1989 2928075611 2928070936 Bacteria 8062541
1990 2928089530 2928084124 Bacteria 7159212
1991 2928112949 2928108538 Bacteria 7360024
1992 2928139878 2928135762 Bacteria 7259641
1993 2928157533 2928157003 Bacteria 7522202
1994 2928158576 2928157003 Bacteria 7522202
1995 2928165345 2928163908 Bacteria 7561269
1996 2928167167 2928163908 Bacteria 7561269
1997 2928174310 2928170801 Bacteria 8785406
1998 2928506960 2928503688 Bacteria 7268108
1999 2928537256 2928536128 Bacteria 7657547
2000 2929149652 2929144301 Bacteria 6622272
2001 2929194853 2929189879 Bacteria 5930554
2002 2929525760 2929520902 Bacteria 6765052
2003 2931372942 2931369376 Bacteria 6847892
2004 2931396131 2931390751 Bacteria 6273349
2005 2931397774 2931396565 Bacteria 7251677
2006 2935358605 2935353572 Unclassified 6955622
2007 2939642164 2939636861 Bacteria 6297853
2008 2939653951 2939651529 Bacteria 5895393
2009 2945909553 2945909444 Bacteria 7065066
2010 2945931203 2945928738 Bacteria 6053221
2011 2945940799 2945934425 Bacteria 7444609
2012 2945949670 2945945610 Bacteria 5951079
2013 2945966502 2945961074 Bacteria 7342064
2014 2945975331 2945972063 Bacteria 6086495
2015 2945988468 2945984333 Bacteria 7358892
2016 2946007238 2946006987 Bacteria 6705746
2017 2946027617 2946027586 Bacteria 6049274
2018 2969309886 2969304461 Bacteria 6601805
2019 2974294367 2974289157 Bacteria 6080362
2020 2981990570 2981990288 Bacteria 7590678
2021 2981992047 2981990288 Bacteria 7590678
2022 2984286911 2984286254 Bacteria 6702062
2023 2988731200 2988728565 Bacteria 6124362
2024 2990707930 2990703756 Bacteria 7715990
2025 2998145112 2998139840 Bacteria 6073514
2026 2998346408 2998344455 Bacteria 4222996
2027 3007255525 3007252601 Bacteria 4559114
2028 3007320377 3007315729 Bacteria 5076637
2029 3007398884 3007395558 Bacteria 6755444
2030 3007425422 3007419365 Bacteria 7026924
2031 3007516901 3007511990 Bacteria 6481491
2032 3007614176 3007614139 Bacteria 6053559
2033 3007622242 3007619802 Bacteria 6411688
2034 3007803784 3007803356 Bacteria 5931491
2035 3007858140 3007855910 Bacteria 5637581
2036 3007866572 3007861166 Bacteria 6045338
2037 3007867040 3007866637 Bacteria 5899198
2038 3007873381 3007872151 Bacteria 5268868
2039 637322973 637000220 Bacteria 7074893
2040 640486693 640427133 Bacteria 4567418
2041 642421838 641736151 Bacteria 7477263
2042 642418463 641736154 Bacteria 7689995
2043 642594173 642555112 Bacteria 8676562
2044 642596077 642555112 Bacteria 8676562
2045 642617914 642555113 Bacteria 8214658
2046 651174544 651053060 Bacteria 4689946
2047 8003956157 8003955200 Bacteria 8601927
2048 8003956586 8003955200 Bacteria 8601927
2049 8011353578 8011350971 Bacteria 6158957
2050 8011354146 8011350971 Bacteria 6158957
2051 8015693325 8015687852 Bacteria 6613826
2052 8018846417 8018845410 Bacteria 8933938
2053 8019770071 8019769354 Bacteria 6924660
2054 8019777965 8019775933 Bacteria 6858656
2055 8020808409 8020807995 Bacteria 6801506
2056 8020943983 8020938398 Bacteria 7472757
2057 8020948681 8020945358 Bacteria 8467355
2058 8020956086 8020953355 Bacteria 7439080
2059 8021120926 8021120328 Bacteria 8782274
2060 8029995785 8029995093 Bacteria 5990776
2061 8034966308 8034962539 Bacteria 4884839
2062 8039101626 8039098773 Bacteria 6602928
2063 8039103649 8039098773 Bacteria 6602928
2064 8040168102 8040167225 Bacteria 6542727
2065 8040174368 8040173305 Bacteria 6827067
2066 8052499550 8052494512 Bacteria 5765634
2067 8054291671 8054285046 Bacteria 6919322
2068 8054508629 8054503363 Bacteria 6101651
2069 8054934271 8054929484 Bacteria 5599761
2070 8055270084 8055266321 Bacteria 7999742
2071 8055272060 8055266321 Bacteria 7999742
2072 8055307810 8055301274 Bacteria 8587385
2073 8055308983 8055301274 Bacteria 8587385
2074 8055776575 8055770955 Bacteria 6827675
2075 8055823604 8055817908 Bacteria 6609162
2076 8055879280 8055878733 Bacteria 5907058
2077 8055879315 8055878733 Bacteria 5907058
2078 8055881810 8055878733 Bacteria 5907058
2079 8055882358 8055878733 Bacteria 5907058
2080 8056115864 8056115690 Bacteria 5527654
2081 8056121176 8056120720 Bacteria 5758328
2082 8056131318 8056125926 Bacteria 6228218
2083 8056137033 8056131705 Bacteria 6107031
2084 8056137894 8056137416 Bacteria 6147080
2085 8056148475 8056143049 Bacteria 6307666
2086 8056160553 8056155041 Bacteria 6486948
2087 8056163330 8056161164 Bacteria 6106669
2088 8056171457 8056166840 Bacteria 5820959
2089 8056177701 8056172158 Bacteria 6133900
2090 8056181713 8056177738 Bacteria 6748268
2091 8056570180 8056569372 Bacteria 5997322
2092 8057801630 8057798959 Bacteria 6713499
2093 Ga0495638_0009500
2094 MRS2a_Contig_12
2095 MRS2a_Contig_757
2096 JGI24741J21665_1000318
2097 JGI24740J21852_10000096
2098 JGI24740J21852_10000255
2099 JGI24739J22299_10002978
2100 JGI24739J22299_10006593
2101 JGI24739J22299_10023384
2102 JGI24735J21928_10000358
2103 JGI24735J21928_10002227
2104 JGI24738J21930_10000524
2105 JGI25156J39149_1000245
2106 JGI25156J39149_1000262
2107 JGI25156J39149_1000303
2108 JGI25156J39149_1001166
2109 JGI25156J39149_1009246
2110 JGI25162J39368_1000157
2111 JGI25162J39368_1000324
2112 JGI25162J39368_1000659
2113 JGI25154J39366_1002561
2114 JGI25154J39366_1003513
2115 JGI25157J39369_1000510
2116 JGI25164J39214_1000240
2117 JGI25164J39214_1000410
2118 JGI25152J39213_1001845
2119 JGI25150J39212_1006514
2120 JGI25159J45721_1002588
2121 JGI25159J45721_1005403
2122 JGI25151J46595_10019696
2123 JGI25165J46597_1000045
2124 JGI25165J46597_1000439
2125 JGI25165J46597_1000774
2126 JGI25165J46597_1002036
2127 JGI25153J46596_10009694
2128 JGI25153J46596_10018566
2129 rootH1_10006479
2130 rootH1_10010288
2131 rootH1_10016494
2132 rootH1_10105825
2133 rootL2_10000805
2134 rootL2_10012684
2135 rootL2_10048463
2136 rootH1_10029202
2137 JGI25160J50197_1000259
2138 JGI25160J50197_1000307
2139 JGI25160J50197_1022750
2140 JGI25161J50226_1000092
2141 JGI25161J50226_1005655
2142 Ga0006556J51387_1028337
2143 Ga0006556J51387_1035664
2144 Ga0006558J51389_1024947
2145 Ga0006560J51390_1025418
2146 Ga0006554J51385_1034311
2147 Ga0006562J51391_1009429
2148 Ga0055538_1000022
2149 Ga0055539_1000028
2150 Ga0055539_1000071
2151 Ga0055539_1000193
2152 Ga0055539_1000757
2153 Ga0055539_1005940
2154 Ga0055533_1000025
2155 Ga0055533_1000036
2156 Ga0055533_1000230
2157 Ga0055533_1000393
2158 Ga0055533_1003590
2159 Ga0055532_1000019
2160 Ga0055532_1000085
2161 Ga0055525_1000191
2162 Ga0055525_1000495
2163 Ga0055525_1000721
2164 Ga0055527_1000046
2165 Ga0055527_1000869
2166 Ga0055527_1005864
2167 Ga0055535_1000014
2168 Ga0055535_1000077
2169 Ga0055535_1007233
2170 Ga0055542_1000111
2171 Ga0055542_1001643
2172 Ga0055529_1000096
2173 Ga0055529_1000126
2174 Ga0055526_1000801
2175 Ga0055526_1001884
2176 Ga0055537_1000280
2177 Ga0055537_1001800
2178 Ga0055524_1000093
2179 Ga0055524_1000194
2180 Ga0055536_1001108
2181 Ga0055536_1001147
2182 Ga0055536_1001184
2183 Ga0055536_1005905
2184 Ga0055536_1010681
2185 Ga0055536_1024573
2186 Ga0055534_1000358
2187 Ga0055534_1001637
2188 Ga0055534_1004194
2189 Ga0055528_1000566
2190 Ga0055528_1002296
2191 Ga0055528_1004701
2192 Ga0055528_1029273
2193 Ga0055530_10000513
2194 Ga0055530_10000832
2195 Ga0055530_10001583
2196 Ga0055530_10004093
2197 Ga0055530_10013392
2198 Ga0055530_10013460
2199 Ga0055530_10018155
2200 Ga0055530_10022826
2201 Ga0055540_1000089
2202 Ga0055540_1000426
2203 Ga0055540_1000533
2204 Ga0055540_1001814
2205 Ga0055540_1013784
2206 Ga0055531_10000286
2207 Ga0055531_10001324
2208 Ga0055541_1000094
2209 Ga0055541_1002132
2210 Ga0058692_1006519
2211 Ga0058692_1008093
2212 Ga0055543_1000207
2213 Ga0065165_1002149
2214 Ga0065165_1004597
2215 Ga0065165_1010852
2216 Ga0065165_1037762
2217 Ga0065714_10001218
2218 Ga0065714_10002430
2219 Ga0065714_10010840
2220 Ga0065714_10021078
2221 Ga0065714_10064488
2222 Ga0065714_10067004
2223 Ga0065704_10008853
2224 Ga0065704_10070671
2225 Ga0065704_10083963
2226 Ga0065712_10010181
2227 Ga0065712_10067844
2228 Ga0065712_10084265
2229 Ga0065715_10016250
2230 Ga0070658_10001405
2231 Ga0070658_10022601
2232 Ga0070658_10036108
2233 Ga0070658_10071216
2234 Ga0070676_10010982
2235 Ga0070676_10097182
2236 Ga0070690_100030733
2237 Ga0070670_100011018
2238 Ga0070670_100017925
2239 Ga0070670_100099025
2240 Ga0070670_100169830
2241 Ga0070677_10005022
2242 Ga0068869_100007271
2243 Ga0068869_100136759
2244 Ga0068869_100138565
2245 Ga0070666_10003553
2246 Ga0070666_10074905
2247 Ga0068868_100010970
2248 Ga0068868_100028638
2249 Ga0068868_100039179
2250 Ga0068868_100110295
2251 Ga0070660_100000164
2252 Ga0070660_100019385
2253 Ga0070660_100236545
2254 Ga0070661_100000054
2255 Ga0070661_100001309
2256 Ga0070668_100017121
2257 Ga0070669_100001100
2258 Ga0070669_100008744
2259 Ga0070669_100019963
2260 Ga0070669_100123478
2261 Ga0070675_100004251
2262 Ga0070675_100109729
2263 Ga0070675_100173158
2264 Ga0070671_100007622
2265 Ga0070671_100033025
2266 Ga0070671_100164475
2267 Ga0070674_100016593
2268 Ga0070673_100003996
2269 Ga0070673_100031876
2270 Ga0070688_100006220
2271 Ga0070659_100000128
2272 Ga0070659_100005590
2273 Ga0070659_100041073
2274 Ga0070659_100091599
2275 Ga0070667_100000766
2276 Ga0070667_100002286
2277 Ga0070708_100028937
2278 Ga0070663_100000010
2279 Ga0070663_100002316
2280 Ga0070678_100000841
2281 Ga0070662_100007943
2282 Ga0070662_100018821
2283 Ga0070662_100047017
2284 Ga0070662_100053366
2285 Ga0070662_100167602
2286 Ga0068867_100000172
2287 Ga0068867_100004010
2288 Ga0068867_100008567
2289 Ga0068867_100020176
2290 Ga0068867_100111028
2291 Ga0070706_100023037
2292 Ga0070707_100023575
2293 Ga0068853_100000211
2294 Ga0068853_100025562
2295 Ga0068853_100035825
2296 Ga0070672_100022270
2297 Ga0070672_100032432
2298 Ga0070665_100036370
2299 Ga0070665_100271113
2300 Ga0068855_100070691
2301 Ga0068855_100115358
2302 Ga0068855_100317555
2303 Ga0070664_100000005
2304 Ga0070664_100006387
2305 Ga0070664_100047392
2306 Ga0068857_100003285
2307 Ga0068857_100009214
2308 Ga0068857_100047404
2309 Ga0068857_100211591
2310 Ga0068854_100000032
2311 Ga0068854_100031453
2312 Ga0068854_100192241
2313 Ga0068856_100000228
2314 Ga0068856_100001084
2315 Ga0068852_100001360
2316 Ga0068852_100017054
2317 Ga0068852_100109305
2318 Ga0068852_100232263
2319 Ga0068859_100000133
2320 Ga0068859_100168773
2321 Ga0068864_100000237
2322 Ga0068861_100044628
2323 Ga0068851_10000063
2324 Ga0068863_100006252
2325 Ga0068863_100012293
2326 Ga0068858_100000395
2327 Ga0068860_100010571
2328 Ga0068860_100119012
2329 Ga0068860_100167129
2330 Ga0068862_100024753
2331 Ga0075363_100079637
2332 Ga0075363_100084907
2333 Ga0075364_10020646
2334 Ga0075364_10043952
2335 Ga0075432_10006807
2336 Ga0075432_10010860
2337 Ga0070712_100056799
2338 Ga0075362_10032054
2339 Ga0075367_10007294
2340 Ga0075367_10019687
2341 Ga0075367_10083847
2342 Ga0075369_10005888
2343 Ga0075366_10011494
2344 Ga0075366_10014990
2345 Ga0075366_10015230
2346 Ga0075366_10019616
2347 Ga0075366_10023078
2348 Ga0075366_10090178
2349 Ga0097621_100010287
2350 Ga0097621_100317273
2351 Ga0075370_10000664
2352 Ga0075370_10002624
2353 Ga0075370_10005576
2354 Ga0075370_10012316
2355 Ga0075370_10026392
2356 Ga0075370_10043949
2357 Ga0075370_10068977
2358 Ga0075429_100002596
2359 Ga0068865_100041525
2360 Ga0068865_100159831
2361 Ga0097620_100000133
2362 Ga0097620_100168781
2363 Ga0079104_1000620
2364 Ga0079104_1000927
2365 Ga0099826_10004958
2366 Ga0099826_10005078
2367 Ga0105251_10000117
2368 Ga0105251_10000322
2369 Ga0105251_10001665
2370 Ga0105251_10001678
2371 Ga0105251_10003491
2372 Ga0105251_10004912
2373 Ga0105251_10014456
2374 Ga0105251_10030340
2375 Ga0105251_10038908
2376 Ga0105251_10099681
2377 Ga0105251_10100849
2378 Ga0105244_10001557
2379 Ga0105244_10002629
2380 Ga0105244_10005118
2381 Ga0105244_10005536
2382 Ga0105244_10017153
2383 Ga0105244_10029436
2384 Ga0105244_10036667
2385 Ga0105244_10040786
2386 Ga0105244_10041841
2387 Ga0105244_10044916
2388 Ga0105244_10061009
2389 Ga0105244_10065475
2390 Ga0105244_10090530
2391 Ga0105244_10134067
2392 Ga0105250_10000821
2393 Ga0105250_10005173
2394 Ga0105250_10010771
2395 Ga0105250_10014535
2396 Ga0105250_10018152
2397 Ga0105250_10027587
2398 Ga0105250_10058593
2399 Ga0105240_10005213
2400 Ga0105240_10111717
2401 Ga0105240_10123026
2402 Ga0105240_10139582
2403 Ga0105240_10281122
2404 Ga0105245_10067385
2405 Ga0105243_10000462
2406 Ga0105243_10001219
2407 Ga0105243_10001748
2408 Ga0105243_10009364
2409 Ga0105243_10036823
2410 Ga0105243_10037791
2411 Ga0105243_10054574
2412 Ga0105243_10073762
2413 Ga0105243_10082964
2414 Ga0105243_10105605
2415 Ga0105241_10039712
2416 Ga0105241_10136357
2417 Ga0105241_10146113
2418 Ga0105242_10000538
2419 Ga0105242_10178128
2420 Ga0105248_10002604
2421 Ga0105248_10010984
2422 Ga0105248_10693057
2423 Ga0105237_10003049
2424 Ga0105237_10003953
2425 Ga0105237_10047710
2426 Ga0105237_10086003
2427 Ga0105237_10103097
2428 Ga0105237_10135642
2429 Ga0105237_10166702
2430 Ga0105238_10024863
2431 Ga0105238_10096794
2432 Ga0105238_10128799
2433 Ga0105249_10005689
2434 Ga0105249_10008169
2435 Ga0105249_10111510
2436 Ga0105239_10000318
2437 Ga0105239_10010249
2438 Ga0105239_10018364
2439 Ga0105239_10103621
2440 Ga0105239_10154243
2441 Ga0105246_10000309
2442 Ga0105246_10003778
2443 Ga0105246_10053843
2444 Ga0105246_10105879
2445 Ga0105246_10228778
2446 Ga0105246_10348398
2447 Ga0157345_1000134
2448 Ga0157347_1001124
2449 Ga0157373_10002986
2450 Ga0157373_10008011
2451 Ga0157373_10011526
2452 Ga0157373_10084184
2453 Ga0157373_10094297
2454 Ga0157373_10115949
2455 Ga0157373_10160511
2456 Ga0157371_10000171
2457 Ga0157371_10000536
2458 Ga0157371_10000653
2459 Ga0157371_10005613
2460 Ga0157371_10005934
2461 Ga0157371_10006503
2462 Ga0157371_10154022
2463 Ga0157370_10000109
2464 Ga0157370_10001229
2465 Ga0157370_10009595
2466 Ga0157370_10012389
2467 Ga0157370_10076150
2468 Ga0157370_10195382
2469 Ga0157370_10195673
2470 Ga0157370_10232263
2471 Ga0157369_10000326
2472 Ga0157369_10000846
2473 Ga0157369_10006560
2474 Ga0157369_10007254
2475 Ga0157369_10008522
2476 Ga0157369_10010596
2477 Ga0157369_10037525
2478 Ga0157369_10050201
2479 Ga0157369_10061685
2480 Ga0157374_10000081
2481 Ga0157374_10137240
2482 Ga0157378_10019760
2483 Ga0157378_10087622
2484 Ga0157378_10333134
2485 Ga0163162_10004594
2486 Ga0163162_10005294
2487 Ga0163162_10165860
2488 Ga0157372_10000089
2489 Ga0157372_10002703
2490 Ga0157372_10038939
2491 Ga0157372_10183068
2492 Ga0157372_10407430
2493 Ga0157372_10521973
2494 Ga0157375_10000882
2495 Ga0157375_10014707
2496 Ga0157375_10033859
2497 Ga0157375_10074031
2498 Ga0157375_10261365
2499 Ga0163163_10004911
2500 Ga0182008_10002105
2501 Ga0182008_10008046
2502 Ga0182008_10039644
2503 Ga0182008_10041840
2504 Ga0182008_10042338
2505 Ga0157377_10000020
2506 Ga0157379_10005267
2507 Ga0157379_10098830
2508 Ga0157376_10134574
2509 Ga0182006_1001416
2510 Ga0182006_1002639
2511 Ga0182006_1017294
2512 Ga0182006_1019231
2513 Ga0182006_1046362
2514 Ga0182006_1056164
2515 Ga0182007_10001896
2516 Ga0182007_10003966
2517 Ga0182007_10005835
2518 Ga0182007_10015661
2519 Ga0182007_10018236
2520 Ga0182005_1000222
2521 Ga0182005_1006960
2522 Ga0182005_1007277
2523 Ga0183361_10028
2524 Ga0163161_10000696
2525 Ga0163161_10064285
2526 Ga0163161_10066042
2527 Ga0163161_10070023
2528 Ga0163161_10224820
2529 Ga0206356_11809126
2530 Ga0213872_10003159
2531 Ga0213872_10008484
2532 Ga0224712_10000879
2533 Ga0209760_100155
2534 Ga0209760_100167
2535 Ga0209760_102263
2536 Ga0209436_106468
2537 Ga0209436_109740
2538 Ga0209784_100003
2539 Ga0209784_100036
2540 Ga0209784_100142
2541 Ga0209784_100669
2542 Ga0209566_100002
2543 Ga0209566_100044
2544 Ga0209566_100577
2545 Ga0209566_101554
2546 Ga0209566_102167
2547 Ga0209674_100007
2548 Ga0209674_100008
2549 Ga0209674_100065
2550 Ga0209674_100105
2551 Ga0209674_100167
2552 Ga0209674_100245
2553 Ga0209672_100002
2554 Ga0209672_100036
2555 Ga0209672_100050
2556 Ga0209672_100248
2557 Ga0209672_100360
2558 Ga0209147_100002
2559 Ga0209147_100003
2560 Ga0209147_100075
2561 Ga0209147_100267
2562 Ga0209563_100004
2563 Ga0209563_100033
2564 Ga0209563_100063
2565 Ga0209563_101780
2566 Ga0209563_102911
2567 Ga0207427_100005
2568 Ga0207427_100006
2569 Ga0207427_100569
2570 Ga0207427_100961
2571 Ga0207427_100996
2572 Ga0209437_100013
2573 Ga0209437_100082
2574 Ga0209437_100220
2575 Ga0209258_100002
2576 Ga0209258_100077
2577 Ga0209258_100394
2578 Ga0209258_100440
2579 Ga0209258_100536
2580 Ga0207425_1001198
2581 Ga0207425_1003208
2582 Ga0209646_1000160
2583 Ga0209646_1000194
2584 Ga0209026_1000020
2585 Ga0209677_100009
2586 Ga0209677_100015
2587 Ga0209677_100038
2588 Ga0209677_100089
2589 Ga0209677_106329
2590 Ga0209148_1000006
2591 Ga0209148_1000193
2592 Ga0209148_1000231
2593 Ga0209148_1001388
2594 Ga0209759_1000017
2595 Ga0209759_1000089
2596 Ga0209759_1000096
2597 Ga0209759_1000947
2598 Ga0209759_1001985
2599 Ga0209759_1002015
2600 Ga0209759_1003209
2601 Ga0209759_1004110
2602 Ga0209759_1006279
2603 Ga0209759_1015843
2604 Ga0209129_1000030
2605 Ga0209129_1000292
2606 Ga0209129_1003254
2607 Ga0209129_1011452
2608 Ga0209233_1000021
2609 Ga0209233_1000022
2610 Ga0209233_1000109
2611 Ga0209233_1000225
2612 Ga0209565_1000019
2613 Ga0209565_1000028
2614 Ga0209565_1000088
2615 Ga0209565_1001747
2616 Ga0209455_1000076
2617 Ga0209455_1000139
2618 Ga0209455_1000156
2619 Ga0209673_1000028
2620 Ga0209673_1000064
2621 Ga0209673_1000095
2622 Ga0209673_1000391
2623 Ga0209673_1001209
2624 Ga0209673_1001728
2625 Ga0209130_1000011
2626 Ga0209130_1000118
2627 Ga0209130_1000231
2628 Ga0209130_1002417
2629 Ga0209675_1000036
2630 Ga0209675_1000073
2631 Ga0209675_1000111
2632 Ga0209675_1009317
2633 Ga0209675_1012255
2634 Ga0209676_1000015
2635 Ga0209676_1000054
2636 Ga0209676_1000088
2637 Ga0209676_1000668
2638 Ga0209676_1001131
2639 Ga0209676_1001175
2640 Ga0209676_1002145
2641 Ga0209676_1002967
2642 Ga0209676_1004251
2643 Ga0209676_1029078
2644 Ga0209025_1000493
2645 Ga0209025_1000494
2646 Ga0209025_1007141
2647 Ga0209025_1008228
2648 Ga0209025_1035524
2649 Ga0209564_1000029
2650 Ga0209564_1000056
2651 Ga0209564_1000103
2652 Ga0209564_1000610
2653 Ga0209564_1002970
2654 Ga0209564_1004326
2655 Ga0209564_1007663
2656 Ga0209758_1000037
2657 Ga0209758_1000096
2658 Ga0209758_1000273
2659 Ga0209758_1010428
2660 Ga0209050_1000024
2661 Ga0209050_1000066
2662 Ga0209050_1000110
2663 Ga0209050_1000128
2664 Ga0209050_1001031
2665 Ga0209050_1001442
2666 Ga0209050_1001704
2667 Ga0209050_1002474
2668 Ga0209050_1006696
2669 Ga0209256_1000003
2670 Ga0209256_1000043
2671 Ga0209256_1000065
2672 Ga0209256_1011277
2673 Ga0207426_1000021
2674 Ga0207426_1000029
2675 Ga0207426_1000124
2676 Ga0207426_1000197
2677 Ga0207426_1003095
2678 Ga0207426_1003977
2679 Ga0209051_1000023
2680 Ga0209051_1000041
2681 Ga0209051_1000044
2682 Ga0209051_1000069
2683 Ga0209051_1000791
2684 Ga0209051_1000921
2685 Ga0209051_1001655
2686 Ga0209051_1007118
2687 Ga0209051_1015177
2688 Ga0209051_1032577
2689 Ga0209257_1000069
2690 Ga0209257_1000082
2691 Ga0209257_1000093
2692 Ga0209257_1002425
2693 Ga0207697_10102014
2694 Ga0207656_10000006
2695 Ga0207696_1000064
2696 Ga0207696_1000094
2697 Ga0207696_1000319
2698 Ga0207696_1000324
2699 Ga0207696_1000663
2700 Ga0207696_1001391
2701 Ga0207696_1012000
2702 Ga0207655_1000107
2703 Ga0207655_1000473
2704 Ga0207655_1000486
2705 Ga0207655_1000598
2706 Ga0207655_1000870
2707 Ga0207655_1000970
2708 Ga0207655_1001041
2709 Ga0207655_1005270
2710 Ga0207655_1005542
2711 Ga0207655_1007265
2712 Ga0207655_1039167
2713 Ga0207655_1070462
2714 Ga0207713_1000010
2715 Ga0207713_1000813
2716 Ga0207713_1000938
2717 Ga0207713_1001206
2718 Ga0207713_1001539
2719 Ga0207713_1002162
2720 Ga0207713_1002390
2721 Ga0207713_1003517
2722 Ga0207713_1004381
2723 Ga0207713_1004908
2724 Ga0207713_1007881
2725 Ga0207713_1014410
2726 Ga0207713_1020169
2727 Ga0207713_1027430
2728 Ga0207713_1027794
2729 Ga0207713_1029587
2730 Ga0207682_10003083
2731 Ga0207680_10001739
2732 Ga0207680_10142175
2733 Ga0207647_10002848
2734 Ga0207647_10008852
2735 Ga0207647_10009413
2736 Ga0207647_10014350
2737 Ga0207647_10087052
2738 Ga0207645_10016209
2739 Ga0207705_10000481
2740 Ga0207705_10098413
2741 Ga0207705_10372676
2742 Ga0207684_10010582
2743 Ga0207695_10002182
2744 Ga0207695_10002534
2745 Ga0207695_10008601
2746 Ga0207695_10015259
2747 Ga0207695_10060425
2748 Ga0207695_10088352
2749 Ga0207695_10237618
2750 Ga0207695_10465824
2751 Ga0207695_10468479
2752 Ga0207671_10000159
2753 Ga0207671_10003249
2754 Ga0207671_10086586
2755 Ga0207671_10141947
2756 Ga0207671_10171948
2757 Ga0207693_10077606
2758 Ga0207662_10090404
2759 Ga0207657_10000247
2760 Ga0207657_10019658
2761 Ga0207657_10028239
2762 Ga0207649_10000087
2763 Ga0207649_10000197
2764 Ga0207681_10000254
2765 Ga0207681_10007441
2766 Ga0207681_10027151
2767 Ga0207694_10109935
2768 Ga0207694_10178248
2769 Ga0207650_10000591
2770 Ga0207650_10000699
2771 Ga0207659_10000102
2772 Ga0207687_10069133
2773 Ga0207687_10245586
2774 Ga0207644_10010203
2775 Ga0207644_10109573
2776 Ga0207644_10191027
2777 Ga0207690_10000141
2778 Ga0207690_10002514
2779 Ga0207690_10013708
2780 Ga0207690_10071115
2781 Ga0207690_10078815
2782 Ga0207706_10000395
2783 Ga0207706_10004682
2784 Ga0207706_10006827
2785 Ga0207706_10008668
2786 Ga0207706_10010702
2787 Ga0207706_10051266
2788 Ga0207706_10136314
2789 Ga0207686_10001265
2790 Ga0207686_10008567
2791 Ga0207709_10000409
2792 Ga0207709_10000426
2793 Ga0207709_10000506
2794 Ga0207709_10001129
2795 Ga0207709_10002429
2796 Ga0207709_10006978
2797 Ga0207709_10016681
2798 Ga0207709_10018294
2799 Ga0207709_10097041
2800 Ga0207709_10157526
2801 Ga0207669_10131327
2802 Ga0207669_10267052
2803 Ga0207691_10013323
2804 Ga0207711_10002914
2805 Ga0207711_10091209
2806 Ga0207689_10073311
2807 Ga0207689_10073845
2808 Ga0207679_10000020
2809 Ga0207679_10000027
2810 Ga0207679_10333926
2811 Ga0207667_10008616
2812 Ga0207667_10015470
2813 Ga0207667_10019417
2814 Ga0207667_10247896
2815 Ga0207667_10378318
2816 Ga0207651_10000537
2817 Ga0207651_10160795
2818 Ga0207712_10007211
2819 Ga0207712_10067214
2820 Ga0207668_10043033
2821 Ga0207640_10000017
2822 Ga0207640_10004424
2823 Ga0207640_10010712
2824 Ga0207640_10213616
2825 Ga0207658_10000319
2826 Ga0207658_10000720
2827 Ga0207677_10005900
2828 Ga0207677_10056378
2829 Ga0207677_10062644
2830 Ga0207677_10098350
2831 Ga0207703_10000787
2832 Ga0207639_10000238
2833 Ga0207639_10054946
2834 Ga0207678_10000008
2835 Ga0207678_10000298
2836 Ga0207702_10000017
2837 Ga0207702_10000529
2838 Ga0207641_10016446
2839 Ga0207641_10023218
2840 Ga0207648_10000026
2841 Ga0207648_10014892
2842 Ga0207648_10017528
2843 Ga0207648_10023609
2844 Ga0207648_10094386
2845 Ga0207648_10315087
2846 Ga0207676_10000485
2847 Ga0207674_10001101
2848 Ga0207674_10007158
2849 Ga0207674_10083875
2850 Ga0207674_10096126
2851 Ga0207674_10159421
2852 Ga0207674_10405881
2853 Ga0207675_100027877
2854 Ga0207675_100156999
2855 Ga0207683_10002119
2856 Ga0207683_10089383
2857 Ga0207698_10041790
2858 Ga0207698_10298149
2859 Ga0209281_1000016
2860 Ga0209281_1000019
2861 Ga0209389_1000173
2862 Ga0209371_1000127
2863 Ga0209371_1000172
2864 Ga0209371_1000508
2865 Ga0209996_1001442
2866 Ga0209982_1007606
2867 Ga0209970_1007151
2868 Ga0209282_1000348
2869 Ga0209971_1002846
2870 Ga0209998_10026107
2871 Ga0207428_10009684
2872 Ga0207428_10027978
2873 Ga0207428_10055829
2874 Ga0268266_10068148
2875 Ga0268266_10093489
2876 Ga0268266_10130537
2877 Ga0268266_10191301
2878 Ga0268265_10005792
2879 Ga0268264_10009966
2880 Ga0268264_10054091
2881 Ga0307517_10004249
2882 Ga0307515_10000093
2883 Ga0307515_10000110
2884 Ga0307515_10000877
2885 Ga0307515_10001261
2886 Ga0307515_10002007
2887 Ga0307515_10040589
2888 Ga0307515_10050976
2889 Ga0265338_10000386
2890 Ga0268256_1000104
2891 Ga0268256_1000144
2892 Ga0268256_1000729
2893 Ga0307511_10088287
2894 Ga0307511_10113431
2895 Ga0307512_10038081
2896 Ga0307512_10077111
2897 Ga0316176_1069742
2898 Ga0314311_1168052
2899 Ga0316178_1161259
2900 Ga0316180_1142351
2901 Ga0316183_1033245
2902 Ga0316181_1133507
2903 Ga0265332_10000003
2904 Ga0265332_10025464
2905 Ga0307513_10010816
2906 Ga0307513_10106370
2907 Ga0307513_10110223
2908 Ga0307509_10006186
2909 Ga0307509_10026498
2910 Ga0307509_10268570
2911 Ga0307408_100000065
2912 Ga0307408_100003588
2913 Ga0307408_100015545
2914 Ga0307408_100021658
2915 Ga0307408_100103649
2916 Ga0307408_100220415
2917 Ga0307408_100247074
2918 Ga0307508_10000016
2919 Ga0307508_10000140
2920 Ga0307508_10018488
2921 Ga0307514_10000877
2922 Ga0307514_10004196
2923 Ga0307514_10039237
2924 Ga0307514_10043009
2925 Ga0265342_10187251
2926 Ga0307516_10002441
2927 Ga0307516_10003824
2928 Ga0307516_10006003
2929 Ga0307516_10013603
2930 Ga0307516_10178301
2931 Ga0307516_10270970
2932 Ga0307405_10039282
2933 Ga0307405_10062624
2934 Ga0307413_10253075
2935 Ga0307518_10053496
2936 Ga0307410_10055864
2937 Ga0307412_10000010
2938 Ga0307412_10034576
2939 Ga0307412_10036527
2940 Ga0307409_100174727
2941 Ga0307409_100196657
2942 Ga0307416_100052861
2943 Ga0307416_100118695
2944 Ga0307414_10004281
2945 Ga0307414_10133789
2946 Ga0307414_10281085
2947 Ga0307411_10077192
2948 Ga0307510_10000187
2949 Ga0307510_10006272
2950 Ga0307510_10006971
2951 Ga0307510_10175073
2952 Ga0373950_0002336
2953 Ga0373934_0006888
2954 Ga0373940_0037309
2955 Ga0373923_0062999
2956 Ga0373939_0000037
2957 Ga0373955_0029000
2958 Ga0373931_0001897
2959 Ga0373931_0002028
2960 Ga0373931_0114416
2961 Ga0373935_0088824
2962 Ga0373927_0159895
2963 Ga0373947_0194819
2964 Ga0373937_0006049
2965 Ga0373937_0375975
2966 Ga0373925_0039592
2967 Ga0373925_0115052
2968 Ga0373925_0209846
2969 Ga0395899_0000065
2970 Ga0395899_0000949
2971 Ga0395899_0011417
2972 Ga0395900_0000015
2973 Ga0395900_0000339
2974 Ga0395900_0015382
2975 Ga0395900_0063987
2976 Ga0395900_0312241
2977 Ga0395900_0373331
2978 Ga0395898_0000201
2979 Ga0395898_0000565
2980 Ga0395898_0005860
2981 Ga0395898_0020148
2982 Ga0395898_0361649
2983 Ga0395905_0000249
2984 Ga0395905_0000362
2985 Ga0395905_0002979
2986 Ga0395905_0004181
2987 Ga0395905_0006964
2988 Ga0395905_0017916
2989 Ga0395905_0074441
2990 Ga0395901_0000144
2991 Ga0395901_0000173
2992 Ga0395901_0000994
2993 Ga0395901_0023954
2994 Ga0395901_0032507
2995 Ga0395901_0327616
2996 Ga0237819_01700
2997 Ga0436361_0484292
2998 Ga0436361_0796200
2999 Ga0436361_1040758
3000 Ga0436361_1193823
3001 Ga0439436_0007922
3002 Ga0439436_0019183
3003 Ga0439438_027977
3004 Ga0439439_0004833
3005 Ga0439447_005033
3006 Ga0439447_023174
3007 Ga0439447_038852
3008 Ga0439466_0002560
3009 Ga0439466_0015043
3010 Ga0439466_0016242
3011 Ga0439466_0038921
3012 Ga0439465_0004938
3013 Ga0439448_0000594
3014 Ga0439432_000853
3015 Ga0439432_008511
3016 Ga0439432_015665
3017 Ga0439432_016372
3018 Ga0439432_029940
3019 Ga0439432_066417
3020 Ga0439449_0002330
3021 Ga0439449_0003272
3022 Ga0439449_0004938
3023 Ga0439449_0035067
3024 Ga0439451_005405
3025 Ga0439452_000363
3026 Ga0439452_000802
3027 Ga0439452_001022
3028 Ga0439452_001323
3029 Ga0439452_010564
3030 Ga0439452_018406
3031 Ga0439452_019160
3032 Ga0439456_000065
3033 Ga0439456_005876
3034 Ga0439456_007043
3035 Ga0439463_000144
3036 Ga0439463_007777
3037 Ga0439463_008630
3038 Ga0450911_000003
3039 Ga0450911_003599
3040 Ga0450920_001211
3041 Ga0450922_001299
3042 Ga0450923_000782
3043 Ga0450898_001867
3044 Ga0450900_004819
3045 Ga0450902_001955
3046 Ga0450904_000150
3047 Ga0450905_001432
3048 Ga0450889_006579
3049 Ga0450906_003409
3050 Ga0450907_000540
3051 Ga0450907_002642
3052 Ga0450910_002929
3053 Ga0439446_0000481
3054 Ga0439446_0024220
3055 Ga0439446_0034809
3056 Ga0439458_0021340
3057 Ga0450909_000824
3058 Ga0439434_0012745
3059 Ga0439464_0000313
3060 Ga0439464_0008969
3061 Ga0439464_0016785
3062 Ga0439464_0029299
3063 Ga0450918_000189
3064 Ga0450918_001117
3065 Ga0450893_0005262
3066 Ga0451577_0000068
3067 Ga0451577_0004102
3068 Ga0451577_0097453
3069 Ga0439440_0005573
3070 Ga0439440_0027292
3071 Ga0466969_0000130
3072 Ga0466969_0000774
3073 Ga0466969_0006882
3074 Ga0466969_0025191
3075 Ga0466969_0066239
3076 Ga0466969_0069374
3077 Ga0466972_0054028
3078 Ga0453683_0005629
3079 Ga0466965_0003316
3080 Ga0466965_0013446
3081 Ga0466965_0158621
3082 Ga0466966_0000043
3083 Ga0466966_0004527
3084 Ga0466966_0007667
3085 Ga0466966_0019585
3086 Ga0466966_0101531
3087 Ga0466961_0000920
3088 Ga0466961_0001128
3089 Ga0466961_0002127
3090 Ga0466961_0021155
3091 Ga0466961_0026736
3092 Ga0466961_0050859
3093 Ga0466963_0004705
3094 Ga0466963_0090769
3095 Ga0466964_0005328
3096 Ga0466964_0014846
3097 Ga0453684_0000279
3098 Ga0466971_0006592
3099 Ga0466971_0008728
3100 Ga0466971_0131437
3101 Ga0466970_0022787
3102 Ga0466970_0034955
3103 Ga0466970_0067904
3104 Ga0466970_0074330
3105 Ga0466957_0000125
3106 Ga0466957_0002301
3107 Ga0466957_0036811
3108 Ga0466957_0110366
3109 Ga0466959_0001078
3110 Ga0466959_0062504
3111 Ga0466959_0104811
3112 Ga0466959_0118640
3113 Ga0451576_0020743
3114 Ga0451576_0356183
3115 Ga0466958_0004194
3116 Ga0466958_0017050
3117 Ga0466958_0080675
3118 Ga0466967_0025420
3119 Ga0466967_0082503
3120 Ga0466967_0432260
3121 Ga0466967_0568894
3122 Ga0495617_000312
3123 Ga0495617_001572
3124 Ga0495617_072333
3125 Ga0495627_000236
3126 Ga0495627_001946
3127 Ga0495627_016706
3128 Ga0495627_030860
3129 Ga0495627_035185
3130 Ga0495627_041902
3131 Ga0495592_0000068
3132 Ga0495592_0000495
3133 Ga0495592_0000653
3134 Ga0495592_0039202
3135 Ga0495592_0055085
3136 Ga0495603_0019370
3137 Ga0495603_0023280
3138 Ga0495603_0118365
3139 Ga0495603_0125262
3140 Ga0495590_0000282
3141 Ga0495590_0001651
3142 Ga0495590_0008346
3143 Ga0495590_0017479
3144 Ga0495590_0036494
3145 Ga0495590_0046718
3146 Ga0495591_000262
3147 Ga0495591_000469
3148 Ga0495591_001094
3149 Ga0495591_001638
3150 Ga0495591_002854
3151 Ga0495591_008375
3152 Ga0495591_018996
3153 Ga0495591_026972
3154 Ga0495629_0003772
3155 Ga0495629_0004324
3156 Ga0495629_0013122
3157 Ga0495629_0028930
3158 Ga0495629_0045349
3159 Ga0495629_0061963
3160 Ga0495629_0066392
3161 Ga0495638_0008544
3162 Ga0495638_0035802
3163 Ga0495638_0045873
3164 Ga0495638_0048501
3165 Ga0495651_0038351
3166 Ga0495653_0000618
3167 Ga0495653_0013150
3168 Ga0495653_0018599
3169 Ga0495653_0042238
3170 Ga0495653_0057119
3171 Ga0495653_0086179
3172 Ga0495653_0117870
3173 Ga0495653_0157649
3174 Ga0495650_0000573
3175 Ga0495650_0001314
3176 Ga0495650_0002443
3177 Ga0495650_0003346
3178 Ga0495650_0004385
3179 Ga0495650_0030133
3180 Ga0495580_0001239
3181 Ga0495580_0014628
3182 Ga0495580_0151740
3183 Ga0495582_0002174
3184 Ga0495582_0027300
3185 Ga0495582_0031428
3186 Ga0495605_0000093
3187 Ga0495605_0000278
3188 Ga0495605_0000305
3189 Ga0495605_0001018
3190 Ga0495605_0001040
3191 Ga0495605_0004177
3192 Ga0495605_0005940
3193 Ga0495605_0006910
3194 Ga0495605_0007501
3195 Ga0495605_0007944
3196 Ga0495605_0025823
3197 Ga0495605_0031805
3198 Ga0495605_0067513
3199 Ga0495605_0069763
3200 Ga0495639_0004844
3201 Ga0495664_0001346
3202 Ga0495664_0011252
3203 Ga0495664_0032868
3204 Ga0495584_0000056
3205 Ga0495584_0000489
3206 Ga0495584_0006118
3207 Ga0495584_0011886
3208 Ga0495584_0017373
3209 Ga0495584_0027360
3210 Ga0495584_0040290
3211 Ga0495584_0138705
3212 Ga0495584_0196845
3213 Ga0495585_0003870
3214 Ga0495585_0037640
3215 Ga0495585_0046006
3216 Ga0495585_0063864
3217 Ga0495585_0076749
3218 Ga0495594_0094393
3219 Ga0495596_0000396
3220 Ga0495596_0005638
3221 Ga0495596_0022104
3222 Ga0495607_0000925
3223 Ga0495607_0001353
3224 Ga0495607_0001462
3225 Ga0495607_0001795
3226 Ga0495607_0003005
3227 Ga0495607_0004797
3228 Ga0495607_0005083
3229 Ga0495607_0005913
3230 Ga0495607_0008612
3231 Ga0495607_0018272
3232 Ga0495607_0020439
3233 Ga0495607_0029495
3234 Ga0495607_0051154
3235 Ga0495607_0056762
3236 Ga0495607_0057546
3237 Ga0495607_0062506
3238 Ga0495607_0074390
3239 Ga0495583_0000017
3240 Ga0495583_0000504
3241 Ga0495583_0001130
3242 Ga0495583_0003223
3243 Ga0495583_0004382
3244 Ga0495583_0004491
3245 Ga0495583_0006751
3246 Ga0495583_0007854
3247 Ga0495583_0017743
3248 Ga0495583_0031200
3249 Ga0495583_0085776
3250 Ga0495583_0090970
3251 Ga0495606_0000588
3252 Ga0495606_0000631
3253 Ga0495606_0000785
3254 Ga0495606_0000946
3255 Ga0495606_0019775
3256 Ga0495606_0028052
3257 Ga0495606_0035371
3258 Ga0495606_0040006
3259 Ga0495606_0042615
3260 Ga0495606_0053360
3261 Ga0495606_0102643
3262 Ga0495606_0122561
3263 Ga0495608_0040426
3264 Ga0495610_0000480
3265 Ga0495610_0018488
3266 Ga0495610_0020029
3267 Ga0495610_0020513
3268 Ga0495610_0033514
3269 Ga0495610_0038894
3270 Ga0495616_0005268
3271 Ga0495616_0007515
3272 Ga0495616_0009686
3273 Ga0495616_0020963
3274 Ga0495618_0010009
3275 Ga0495618_0031352
3276 Ga0495618_0054030
3277 Ga0495620_0000033
3278 Ga0495620_0000153
3279 Ga0495620_0000996
3280 Ga0495620_0002688
3281 Ga0495620_0004172
3282 Ga0495620_0012094
3283 Ga0495620_0019309
3284 Ga0495620_0019600
3285 Ga0495620_0025532
3286 Ga0495628_0006813
3287 Ga0495628_0019444
3288 Ga0495628_0030972
3289 Ga0495628_0054934
3290 Ga0495628_0058495
3291 Ga0495628_0070894
3292 Ga0495628_0109910
3293 Ga0495628_0244164
3294 Ga0495630_0018528
3295 Ga0495630_0019723
3296 Ga0495630_0023771
3297 Ga0495631_0002074
3298 Ga0495631_0002336
3299 Ga0495631_0004757
3300 Ga0495631_0030491
3301 Ga0495632_0000399
3302 Ga0495632_0002587
3303 Ga0495632_0003864
3304 Ga0495632_0005877
3305 Ga0495632_0005925
3306 Ga0495632_0009194
3307 Ga0495632_0023548
3308 Ga0495632_0023631
3309 Ga0495632_0048035
3310 Ga0495632_0067557
3311 Ga0495637_0000314
3312 Ga0495637_0000785
3313 Ga0495637_0001269
3314 Ga0495637_0004926
3315 Ga0495637_0014196
3316 Ga0495637_0017506
3317 Ga0495637_0018047
3318 Ga0495637_0023594
3319 Ga0495637_0031870
3320 Ga0495637_0052207
3321 Ga0495643_0000652
3322 Ga0495643_0001069
3323 Ga0495643_0044091
3324 Ga0495643_0055489
3325 Ga0495643_0058008
3326 Ga0495643_0071659
3327 Ga0495643_0093519
3328 Ga0495644_0001495
3329 Ga0495648_0002015
3330 Ga0495648_0002072
3331 Ga0495648_0006578
3332 Ga0495648_0007030
3333 Ga0495648_0007653
3334 Ga0495648_0014809
3335 Ga0495648_0016612
3336 Ga0495648_0049367
3337 Ga0495648_0084674
3338 Ga0495648_0129367
3339 Ga0495666_0000218
3340 Ga0495666_0001420
3341 Ga0495666_0036544
3342 Ga0495642_0000568
3343 Ga0495642_0001611
3344 Ga0495642_0029065
3345 Ga0495652_0003975
3346 Ga0495652_0013167
3347 Ga0495652_0032431
3348 Ga0495654_0000256
3349 Ga0495654_0000797
3350 Ga0495654_0001161
3351 Ga0495654_0002272
3352 Ga0495654_0003778
3353 Ga0495654_0005966
3354 Ga0495654_0019625
3355 Ga0495654_0023298
3356 Ga0495654_0037906
3357 Ga0495654_0058023
3358 Ga0495665_0000297
3359 Ga0495665_0004466
3360 Ga0495665_0015988
3361 Ga0495640_0022856
3362 Ga0495586_0003839
3363 Ga0495586_0220276
3364 Ga0495587_0000887
3365 Ga0495587_0009541
3366 Ga0495587_0050152
3367 Ga0495609_0000166
3368 Ga0495609_0000226
3369 Ga0495609_0000635
3370 Ga0495609_0000646
3371 Ga0495609_0020103
3372 Ga0495597_0000235
3373 Ga0495597_0000417
3374 Ga0495597_0006757
3375 Ga0495597_0031398
3376 Ga0495597_0037219
3377 Ga0495597_0038172
3378 Ga0495597_0045922
3379 Ga0495597_0083606
3380 Ga0495645_0000569
3381 Ga0495645_0028467
3382 Ga0495645_0032847
3383 Ga0495645_0040065
3384 Ga0495645_0091898
3385 Ga0495622_0001689
3386 Ga0495622_0003620
3387 Ga0495622_0026013
3388 Ga0495633_0000291
3389 Ga0495633_0033243
3390 Ga0495633_0071113
3391 Ga0495633_0077709
3392 Ga0495656_0001226
3393 Ga0495668_0003374
3394 Ga0495668_0044860
3395 Ga0495668_0060606
3396 Ga0495668_0073506
3397 Ga0495634_0002702
3398 Ga0495634_0004936
3399 Ga0495634_0005374
3400 Ga0495634_0012453
3401 Ga0495611_0001848
3402 Ga0495611_0001988
3403 Ga0495611_0002355
3404 Ga0495611_0020930
3405 Ga0495625_0000292
3406 Ga0495625_0000499
3407 Ga0495625_0016660
3408 Ga0495625_0019756
3409 Ga0495625_0079977
3410 Ga0495625_0085419
3411 Ga0495625_0167718
3412 Ga0495635_0000456
3413 Ga0495635_0001641
3414 Ga0495635_0033108
3415 Ga0495635_0063104
3416 Ga0495659_0000023
3417 Ga0495659_0000925
3418 Ga0495659_0003441
3419 Ga0495661_0000277
3420 Ga0495661_0000294
3421 Ga0495661_0000320
3422 Ga0495661_0000340
3423 Ga0495661_0011211
3424 Ga0495661_0014060
3425 Ga0495661_0018097
3426 Ga0495661_0045807
3427 Ga0495661_0103022
3428 Ga0495657_0006504
3429 Ga0495657_0113591
3430 Ga0495599_0003290
3431 Ga0495599_0007760
3432 Ga0495599_0048956
3433 Ga0495623_0004070
3434 Ga0495623_0010555
3435 Ga0495623_0015967
3436 Ga0495623_0068972
3437 Ga0495646_0000243
3438 Ga0495646_0001228
3439 Ga0495646_0043802
3440 Ga0495646_0044515
3441 Ga0495646_0065516
3442 Ga0495646_0115433
3443 Ga0495658_0014229
3444 Ga0495669_0000831
3445 Ga0495669_0010212
3446 Ga0495613_0002898
3447 Ga0495613_0013545
3448 Ga0495613_0071760
3449 Ga0495613_0145053
3450 Ga0495624_0000171
3451 Ga0495624_0000254
3452 Ga0495624_0003268
3453 Ga0495624_0004299
3454 Ga0495624_0004667
3455 Ga0495624_0035913
3456 Ga0495670_0003447
3457 Ga0495670_0006087
3458 Ga0495670_0030009
3459 Ga0495670_0042270
3460 Ga0495671_0000085
3461 Ga0495671_0000524
3462 Ga0495671_0000578
3463 Ga0495671_0002967
3464 Ga0495671_0007435
3465 Ga0495671_0007820
3466 Ga0495671_0014313
3467 Ga0495671_0025909
3468 Ga0495671_0107160
3469 Ga0495649_0003283
3470 Ga0495649_0003444
3471 Ga0495649_0003768
3472 Ga0495649_0003794
3473 Ga0495649_0005402
3474 Ga0495649_0006332
3475 Ga0495649_0006720
3476 Ga0495649_0009136
3477 Ga0495649_0022428
3478 Ga0495649_0023876
3479 Ga0495649_0028988
3480 Ga0495649_0046412
3481 Ga0495649_0078393
3482 Ga0495589_0002545
3483 Ga0495589_0002823
3484 Ga0495589_0018649
3485 Ga0495589_0030473
3486 Ga0495589_0033222
3487 Ga0495600_0001703
3488 Ga0495600_0054935
3489 Ga0495660_0001629
3490 Ga0495660_0001669
3491 Ga0495660_0002273
3492 Ga0495660_0003074
3493 Ga0495660_0004724
3494 Ga0495660_0013886
3495 Ga0495660_0024236
3496 Ga0495660_0038613
3497 Ga0495660_0078900
3498 Ga0495660_0107746
3499 Ga0495660_0110513
3500 Ga0495581_0003179
3501 Ga0495581_0083227
3502 Ga0495604_0000743
3503 Ga0495604_0007577
3504 Ga0495604_0015036
3505 Ga0495604_0021582
3506 Ga0495604_0109302
3507 Ga0495604_0115680
3508 Ga0495604_0123123
3509 Ga0495636_0000155
3510 Ga0495636_0004693
3511 Ga0495674_0001228
3512 Ga0495674_0041468
3513 Ga0495674_0096234
3514 Ga0495674_0098580
3515 Ga0495674_0099150
3516 Ga0495672_0000401
3517 Ga0495672_0000450
3518 Ga0495672_0000537
3519 Ga0495672_0001156
3520 Ga0495672_0001307
3521 Ga0495672_0007072
3522 Ga0495672_0012994
3523 Ga0495672_0021249
3524 Ga0495672_0030026
3525 Ga0495672_0031641
3526 Ga0495672_0039332
3527 Ga0495672_0050690
3528 Ga0495672_0059877
3529 Ga0495672_0061533
3530 Ga0495672_0089308
3531 Ga0495672_0090258
3532 Ga0495672_0195883
3533 Ga0495676_0000125
3534 Ga0495676_0000749
3535 Ga0495676_0031365
3536 Ga0495676_0038095
3537 Ga0495676_0067540
3538 Ga0495676_0121897
3539 Ga0495676_0224834
3540 Ga0495680_0001285
3541 Ga0495680_0004391
3542 Ga0495680_0005516
3543 Ga0495680_0019239
3544 Ga0495680_0052691
3545 Ga0495680_0066205
3546 Ga0495683_0000016
3547 Ga0495683_0000196
3548 Ga0495683_0002598
3549 Ga0495683_0002747
3550 Ga0495683_0004781
3551 Ga0495683_0011333
3552 Ga0495683_0014561
3553 Ga0495683_0020243
3554 Ga0495683_0030411
3555 Ga0495683_0038403
3556 Ga0495683_0043180
3557 Ga0495683_0089305
3558 Ga0495687_000029
3559 Ga0495687_000912
3560 Ga0495687_005852
3561 Ga0495687_011381
3562 Ga0495687_035246
3563 Ga0495687_051328
3564 Ga0495675_0000949
3565 Ga0495675_0004283
3566 Ga0495675_0006849
3567 Ga0495675_0022992
3568 Ga0495675_0058841
3569 Ga0495679_000260
3570 Ga0495679_000414
3571 Ga0495679_000615
3572 Ga0495679_000821
3573 Ga0495679_010099
3574 Ga0495673_0000789
3575 Ga0495673_0000901
3576 Ga0495673_0002663
3577 Ga0495673_0002701
3578 Ga0495673_0003685
3579 Ga0495673_0004115
3580 Ga0495673_0007001
3581 Ga0495673_0016291
3582 Ga0495673_0035670
3583 Ga0495673_0037017
3584 Ga0495673_0038139
3585 Ga0495673_0043759
3586 Ga0495673_0057602
3587 Ga0495673_0059498
3588 Ga0495673_0083499
3589 Ga0495681_0000612
3590 Ga0495681_0003435
3591 Ga0495681_0003898
3592 Ga0495681_0004614
3593 Ga0495681_0052603
3594 Ga0495681_0055849
3595 Ga0495681_0075672
3596 Ga0495684_0003850
3597 Ga0495684_0044256
3598 Ga0495684_0190367
3599 Ga0495686_0040163
3600 Ga0495686_0092223
3601 Ga0495686_0099700
3602 Ga0495593_0005649
3603 Ga0495593_0006424
3604 Ga0495593_0009556
3605 Ga0495593_0011140
3606 Ga0495593_0017833
3607 Ga0495593_0027489
3608 Ga0495593_0040711
3609 Ga0495602_0001338
3610 Ga0495602_0002523
3611 Ga0495602_0027804
3612 Ga0495602_0032099
3613 Ga0495602_0287063
3614 Ga0495614_0000052
3615 Ga0495614_0001367
3616 Ga0495626_0000283
3617 Ga0495626_0000887
3618 Ga0495626_0000935
3619 Ga0495626_0002034
3620 Ga0495626_0003227
3621 Ga0495626_0003237
3622 Ga0495626_0008951
3623 Ga0495626_0045240
3624 Ga0496100_0000199
3625 Ga0496101_0001503
3626 Ga0496101_0026040
3627 Ga0496102_0005613
3628 Ga0496102_0016611
3629 Ga0496102_0066671
3630 Ga0496102_0161450
3631 Ga0496104_0021738
3632 Ga0496104_0037376
3633 Ga0496104_0045980
3634 Ga0496104_0072134
3635 Ga0496104_0255638
3636 Ga0496105_0007454
3637 Ga0496105_0035282
3638 Ga0496105_0100040
3639 Ga0496107_0038024
3640 Ga0496107_0266112
3641 Ga0496108_0198653
3642 Ga0496109_0062241
3643 Ga0496109_0268638
3644 Ga0496110_0214686
3645 Ga0496112_0002167
3646 Ga0496112_0149916
3647 Ga0496114_0004974
3648 Ga0496114_0208002
3649 Ga0496115_0252232
3650 Ga0496116_0000401
3651 Ga0496116_0009277
3652 Ga0496116_0025205
3653 Ga0496116_0065871
3654 Ga0496117_0001058
3655 Ga0496117_0001828
3656 Ga0496117_0003306
3657 Ga0496117_0003621
3658 Ga0496117_0003735
3659 Ga0496117_0031436
3660 Ga0496117_0032301
3661 Ga0496117_0044107
3662 Ga0496117_0100955
3663 Ga0496117_0111635
3664 Ga0496118_0001636
3665 Ga0496118_0031339
3666 Ga0496118_0050171
3667 Ga0496118_0058392
3668 Ga0496118_0060547
3669 Ga0496118_0066657
3670 Ga0496119_0000071
3671 Ga0496119_0004894
3672 Ga0496120_0002379
3673 Ga0496120_0108689
3674 Ga0496120_0112717
3675 Ga0496121_0000688
3676 Ga0496121_0004830
3677 Ga0496121_0006262
3678 Ga0496121_0006586
3679 Ga0496121_0017614
3680 Ga0496121_0020676
3681 Ga0496121_0022467
3682 Ga0496121_0056232
3683 Ga0496121_0062034
3684 Ga0496121_0297996
3685 Ga0496122_0009639
3686 Ga0496122_0010620
3687 Ga0496122_0033734
3688 Ga0496122_0042036
3689 Ga0496122_0044741
3690 Ga0496122_0109303
3691 Ga0496122_0137119
3692 Ga0496122_0211277
3693 Ga0496123_0002423
3694 Ga0496123_0002964
3695 Ga0496123_0003571
3696 Ga0496123_0066850
3697 Ga0496123_0068553
3698 Ga0496124_0000730
3699 Ga0496124_0005106
3700 Ga0496124_0006203
3701 Ga0496124_0008292
3702 Ga0496124_0010955
3703 Ga0496124_0011716
3704 Ga0496124_0040328
3705 Ga0496124_0058143
3706 Ga0496124_0084326
3707 Ga0496124_0104103
3708 Ga0496124_0147033
3709 Ga0496125_0001109
3710 Ga0496125_0006175
3711 Ga0496125_0028311
3712 Ga0496125_0063359
3713 Ga0496125_0064483
3714 Ga0496125_0145106
3715 Ga0496126_0000572
3716 Ga0496126_0008779
3717 Ga0496126_0113043
3718 Ga0496126_0143106
3719 Ga0496126_0154010
3720 Ga0501307_000415
3721 Ga0495678_000238
3722 Ga0495678_000268
3723 Ga0495678_003223
3724 Ga0495678_003866
3725 Ga0495678_013988
3726 Ga0495682_0000198
3727 Ga0495682_0000247
3728 Ga0495682_0000640
3729 Ga0495682_0006882
3730 Ga0495682_0018358
3731 Ga0495682_0020758
3732 Ga0495682_0036236
3733 Ga0501314_000567
3734 Ga0501032_0067527
3735 Ga0501034_0000165
3736 Ga0501034_0212403
3737 Ga0501040_0081797
3738 Ga0501043_0000072
3739 Ga0501046_0000112
3740 Ga0501047_0000138
3741 Ga0501048_0094967
3742 Ga0501072_0002501
3743 Ga0501075_0099860
3744 Ga0501076_0007160
3745 Ga0501077_0122857
3746 Ga0501281_01164
3747 Ga0501035_0325425
3748 Ga0501226_000033
3749 nmdc:mga03683_21537_c1
3750 nmdc:mga03n38_106562_c1
3751 nmdc:mga00v17_38161_c1
3752 nmdc:mga0k408_27457_c1
3753 nmdc:mga0k408_30939_c1
3754 nmdc:mga0k408_423_c1
3755 nmdc:mga0k408_460_c1
3756 nmdc:mga0k408_9093_c1
3757 nmdc:mga06z11_145298_c1
3758 nmdc:mga07m45_171_c2
3759 nmdc:mga07m45_191_c1
3760 nmdc:mga07m45_204_c1
3761 nmdc:mga07m45_23413_c1
3762 Ga0500610_0057620
3763 Ga0500578_0000719
3764 Ga0500643_041040
3765 Ga0500651_0003767
3766 Ga0500651_0118787
3767 Ga0500571_003409
3768 Ga0500593_003822
3769 Ga0500594_0001511
3770 Ga0500595_000392
3771 Ga0500607_047047
3772 Ga0500618_013837
3773 Ga0500628_024023
3774 Ga0500642_0017415
3775 Ga0500652_001816
3776 Ga0500658_0000179
3777 Ga0500658_0014926
3778 Ga0500658_0041763
3779 Ga0500659_0001403
3780 Ga0500559_0000356
3781 Ga0500568_0023121
3782 Ga0500568_0028190
3783 Ga0500573_0134326
3784 Ga0500619_007105
3785 Ga0500622_0000262
3786 Ga0500622_0018045
3787 Ga0500634_0052195
3788 Ga0500634_0084240
3789 Ga0501084_0074943
3790 Ga0590071_008839
3791 Ga0587083_0002979
3792 Ga0587067_000186
3793 Ga0587068_005160
3794 Ga0587072_000587
3795 Ga0587076_004789
3796 Ga0466962_0007398
3797 Ga0466962_0014320
3798 Ga0466962_0053511
3799 Ga0530510_0172150
3800 2501072969
3801 2501083438
3802 2501413472
3803 2509131917
3804 2510250441
3805 2511087726
3806 2511101771
3807 2511106249
3808 2511242852
3809 2511256898
3810 2511265739
3811 2511270970
3812 2511279771
3813 2511292934
3814 2511296896
3815 2511304599
3816 2511313579
3817 2511317283
3818 2511325465
3819 2511331332
3820 2511337403
3821 2511341766
3822 2511351428
3823 2511357673
3824 2511360554
3825 2511370942
3826 2511373666
3827 2511411644
3828 2511827344
3829 2512327515
3830 2512345940
3831 2513226494
3832 2513553502
3833 2513554911
3834 2513559571
3835 2513563026
3836 2513960449
3837 2514054040
3838 2516018003
3839 2519461329
3840 2527078954
3841 2547372097
3842 2547375470
3843 2554812991
3844 2555246716
3845 2555672535
3846 2563058328
3847 2583795033
3848 2585290159
3849 2587734355
3850 2587757555
3851 2588293946
3852 2597028342
3853 2597860594
3854 2599330823
3855 2599356263
3856 2599362340
3857 2599369354
3858 2599375449
3859 2599381368
3860 2599387116
3861 2599394307
3862 2599400831
3863 2599406072
3864 2599444357
3865 2599450158
3866 2599463096
3867 2599467485
3868 2599486170
3869 2599492113
3870 2599502364
3871 2599512230
3872 2599517211
3873 2599616974
3874 2599626141
3875 2599675780
3876 2599682336
3877 2599695987
3878 2599735435
3879 2599745813
3880 2599768469
3881 2599804953
3882 2599878745
3883 2599885889
3884 2599892408
3885 2599897603
3886 2599933938
3887 2599945753
3888 2599951108
3889 2599956747
3890 2599961490
3891 2599965733
3892 2599974741
3893 2599978593
3894 2599984838
3895 2599988077
3896 2599993732
3897 2599998867
3898 2600008528
3899 2600012660
3900 2600018709
3901 2600025144
3902 2600030029
3903 2600036584
3904 2600041893
3905 2600046405
3906 2600053119
3907 2600062827
3908 2600066078
3909 2600073656
3910 2600079649
3911 2600207721
3912 2600215724
3913 2600359686
3914 2600366250
3915 2600446003
3916 2600811580
3917 2601628544
3918 2601775891
3919 2601801078
3920 2602011378
3921 2606073172
3922 2606125966
3923 2608383444
3924 2621297126
3925 2624483119
3926 2624494649
3927 2643842352
3928 2643955930
3929 2643969810
3930 2644020724
3931 2644141931
3932 2644162098
3933 2644186233
3934 2644246427
3935 2644273309
3936 2644283379
3937 2644304199
3938 2644326767
3939 2644399977
3940 2652546477
3941 2671089244
3942 2671098979
3943 2671128748
3944 2671771959
3945 2676745173
3946 2677901284
3947 2678265856
3948 2713475133
3949 2715750112
3950 2715756513
3951 2718636321
3952 2719639587
3953 2738671945
3954 2738690330
3955 2738721569
3956 2738750339
3957 2738812034
3958 2738824135
3959 2738836526
3960 2738859379
3961 2738878147
3962 2738899394
3963 2739189763
3964 2739198768
3965 2739199336
3966 2739224741
3967 2739243678
3968 2739261496
3969 2739266104
3970 2739281238
3971 2739289794
3972 2739295106
3973 2739312802
3974 2743740144
3975 2745007088
3976 2746090768
3977 2746092371
3978 2753567514
3979 2753570230
3980 2765586338
3981 2774123670
3982 2774135855
3983 2784262109
3984 2784317520
3985 2792832690
3986 2794598549
3987 2807410572
3988 2807458917
3989 2808858126
3990 2808906403
3991 2808925979
3992 2808932266
3993 2808938297
3994 2808943302
3995 2808948134
3996 2808954387
3997 2808960816
3998 2808966611
3999 2808975853
4000 2808992962
4001 2809001441
4002 2809216896
4003 2812369155
4004 2816474107
4005 2817258882
4006 2817280688
4007 2817454804
4008 2817493761
4009 2819545089
4010 2819625127
4011 2819630545
4012 2819654843
4013 2819704101
4014 2823421906
4015 2825655393
4016 2826582124
4017 2831272317
4018 2834034477
4019 2838059477
4020 2842326119
4021 2842351360
4022 2842455439
4023 2842679486
4024 2842808009
4025 2842821198
4026 2842833171
4027 2842845410
4028 2842852452
4029 2842855328
4030 2843691371
4031 2843694140
4032 2844666703
4033 2844671509
4034 2852616042
4035 2852662536
4036 2852671010
4037 2856289699
4038 2857364431
4039 2857577830
4040 2860341424
4041 2860872741
4042 2863426037
4043 2870074987
4044 2878035057
4045 2880235700
4046 2883088306
4047 2885202678
4048 2885216331
4049 2885268554
4050 2900578707
4051 2900639379
4052 2904489662
4053 2904519241
4054 2904555466
4055 2904565367
4056 2904571937
4057 2904615512
4058 2908452280
4059 2912968611
4060 2913042266
4061 2917076422
4062 2919065858
4063 2919155656
4064 2919389479
4065 2919457263
4066 2919462539
4067 2919486693
4068 2919488446
4069 2919506500
4070 2919533984
4071 2919700857
4072 2919704435
4073 2921649904
4074 2921650179
4075 2923159236
4076 2923523236
4077 2923591936
4078 2926068184
4079 2928063162
4080 2928075611
4081 2928089530
4082 2928112949
4083 2928139878
4084 2928157533
4085 2928158576
4086 2928165345
4087 2928167167
4088 2928174310
4089 2928506960
4090 2928537256
4091 2929149652
4092 2929194853
4093 2929525760
4094 2931372942
4095 2931396131
4096 2931397774
4097 2935358605
4098 2939642164
4099 2939653951
4100 2945909553
4101 2945931203
4102 2945940799
4103 2945949670
4104 2945966502
4105 2945975331
4106 2945988468
4107 2946007238
4108 2946027617
4109 2969309886
4110 2974294367
4111 2981990570
4112 2981992047
4113 2984286911
4114 2988731200
4115 2990707930
4116 2998145112
4117 2998346408
4118 3007255525
4119 3007320377
4120 3007398884
4121 3007425422
4122 3007516901
4123 3007614176
4124 3007622242
4125 3007803784
4126 3007858140
4127 3007866572
4128 3007867040
4129 3007873381
4130 637322973
4131 640486693
4132 642421838
4133 642418463
4134 642594173
4135 642596077
4136 642617914
4137 651174544
4138 8003956157
4139 8003956586
4140 8011353578
4141 8011354146
4142 8015693325
4143 8018846417
4144 8019770071
4145 8019777965
4146 8020808409
4147 8020943983
4148 8020948681
4149 8020956086
4150 8021120926
4151 8029995785
4152 8034966308
4153 8039101626
4154 8039103649
4155 8040168102
4156 8040174368
4157 8052499550
4158 8054291671
4159 8054508629
4160 8054934271
4161 8055270084
4162 8055272060
4163 8055307810
4164 8055308983
4165 8055776575
4166 8055823604
4167 8055879280
4168 8055879315
4169 8055881810
4170 8055882358
4171 8056115864
4172 8056121176
4173 8056131318
4174 8056137033
4175 8056137894
4176 8056148475
4177 8056160553
4178 8056163330
4179 8056171457
4180 8056177701
4181 8056181713
4182 8056570180
4183 8057801630

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

79

351

0.93

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

67

320

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dgv-assembly1.cif.gz_A igabasnfr fluorescent gaba sensor precursor 0.9115 26 301
4eq7-assembly1.cif.gz_A structure of atu4243-gaba receptor 0.9087 26 347
4i1d-assembly1.cif.gz_A the crystal structure of an abc transporter substrate-binding protein from bradyrhizobium japonicum usda 110 0.9035 24 344
4i1d-assembly1.cif.gz_A the crystal structure of an abc transporter substrate-binding protein from bradyrhizobium japonicum usda 110 0.8955 24 344
4eq7-assembly1.cif.gz_A structure of atu4243-gaba receptor 0.8874 26 347
ID Description Score Start End Superfamily
4eq7B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9133 128 247 3.40.190.10
5l9iB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8805 26 325 3.40.190.10
6hlzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8723 129 247 3.40.190.10
4eq7B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8706 128 247 3.40.190.10
4euoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8665 26 347 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7T8M6L4-F1-model_v4 deleted 0.9756 26 347
AF-A0A3D3PSS3-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9703 133 347
AF-A0A829T6B1-F1-model_v4 deleted 0.9654 75 347
AF-A0A3D3PSS3-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9615 133 347
AF-H0FVI9-F1-model_v4 Spermidine/putrescine-binding periplasmic protein 0.9542 122 347 GO:0042597

Map