metagRoot

F496397

General Info

Members	Datasets	Scaffolds	Average Seq Length
2101	937	4202	319

Family's Representative Sequence

Representative Sequence	3300037418\|Ga0395900_0391945\|Ga0395900_0391945_53_1195
Length	380
Sequence	MTAVDTSINIDVKLISSPFYLRGKAAINCRIDHPPPFDAMNPSSPSSLFAPAEHFDSHFLEQRAERPQPLSGNQMPRCGGITTMMRLPHVQSAEGLDACFVGVPFDLGTSNRTGARFGPRQVRSESVLLRPYNMATRAAPFDSLRVADIGDVAINPYNLLDSIDRIERAYREILKHGCKPLTLGGDHTIALPILRAIHAKHGKVGLIHIDAHADVNDTMFGEKIAHGTPFRRAVEEGLLDCSRVVQIGLRGTGYEAGDFDWCREQGFRVVQTEECWNKSLVPLMDEVRAQMGDGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIVRGARGLNIVGADLVEVAPPYDPFGTTALLGANLAFELLCVLPGVEYRAAK

Samples

	Sample ID	Description	Type	Environment
1	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
2	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
8	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
9	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
10	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
11	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
12	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
13	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
14	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
15	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
16	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
17	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
18	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
19	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
20	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
21	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
22	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
23	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
24	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
25	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
26	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
27	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
28	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
29	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
30	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
31	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
32	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
33	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
34	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
35	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
36	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
37	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
38	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
39	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
40	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
41	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
42	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
43	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
44	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
45	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
46	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
47	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
48	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
49	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
50	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
51	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
52	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
53	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
54	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
55	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
56	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
57	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
58	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
59	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
60	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
61	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
62	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
63	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
64	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
65	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
66	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
67	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
68	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
69	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
70	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
71	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
72	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
73	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
74	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
75	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
76	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
77	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
78	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
79	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
83	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
84	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
85	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
86	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
87	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
88	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
89	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
90	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
91	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
92	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
93	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
94	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
95	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
96	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
97	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
98	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
99	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
100	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
101	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
102	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
103	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
104	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
105	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
106	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
107	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
108	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
109	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
110	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
111	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
112	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
114	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
115	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
116	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
117	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
118	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
119	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
120	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
121	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
122	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
123	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
124	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
125	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
126	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
127	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
128	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
129	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
130	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
132	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
133	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
134	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
135	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
136	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
137	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
138	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
139	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
140	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
141	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
142	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
143	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
144	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
145	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
146	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
147	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
148	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
149	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
150	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
151	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
152	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
153	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
154	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
155	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
156	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
157	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
158	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
159	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
160	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
161	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
162	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
163	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
176	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
177	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
180	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
181	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
185	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
187	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
190	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
193	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
194	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
249	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
250	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
252	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
253	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
254	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
258	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
259	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
260	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
261	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
262	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
263	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
264	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
265	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
266	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
267	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
268	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
269	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
270	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
271	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
272	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
273	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
274	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
275	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
276	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
277	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
278	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
279	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
280	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
281	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
282	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
283	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
284	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
285	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
286	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
287	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
288	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
289	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
290	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
291	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
292	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
293	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
294	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
295	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
296	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
297	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
298	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
299	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
300	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
301	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
302	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
303	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
304	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
305	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
306	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
307	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
308	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
309	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
310	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
311	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
312	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
313	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
314	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
315	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
316	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
317	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
318	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
319	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
320	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
321	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
322	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
323	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
324	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
325	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
326	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
327	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
328	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
329	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
330	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
331	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
332	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
333	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
334	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
335	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
336	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
337	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
338	3300044671	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E	Metagenome	Unclassified
339	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
340	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
341	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
342	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
343	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
344	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
345	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
346	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
347	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
348	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
349	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
350	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
351	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
352	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
353	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
354	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
355	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
356	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
357	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
358	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
359	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
360	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
361	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
362	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
363	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
364	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
365	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
366	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
367	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
368	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
369	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
370	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
371	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
372	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
373	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
374	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
375	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
376	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
377	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
378	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
379	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
380	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
381	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
382	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
383	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
384	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
385	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
386	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
387	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
388	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
389	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
390	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
391	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
392	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
393	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
394	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
395	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
396	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
397	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
398	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
399	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
400	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
401	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
402	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
403	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
404	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
405	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
406	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
407	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
408	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
409	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
410	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
411	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
412	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
413	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
414	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
415	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
416	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
417	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
418	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
419	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
420	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
421	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
422	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
423	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
424	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
425	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
426	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
427	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
428	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
429	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
430	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
431	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
432	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
433	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
434	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
435	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
436	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
437	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
438	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
439	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
440	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
441	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
442	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
443	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
444	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
445	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
446	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
447	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
448	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
449	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
450	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
451	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
452	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
453	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
454	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
455	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
456	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
457	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
458	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
459	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
460	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
461	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
462	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
463	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
464	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
465	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
466	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
467	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
468	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
469	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
470	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
471	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
472	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
473	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
474	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
475	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
476	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
477	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
478	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
479	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
480	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
481	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
482	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
483	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
484	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
485	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
486	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
487	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
488	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
489	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
490	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
491	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
492	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
493	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
494	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
495	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
496	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
497	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
498	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
499	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
500	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
501	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
502	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
503	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
504	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
505	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
506	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
507	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
508	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
509	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
510	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
511	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
512	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
513	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
514	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
515	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
516	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
517	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
518	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
519	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
520	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
521	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
522	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
523	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
524	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
525	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
526	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
527	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
528	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
529	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
530	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
531	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
532	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
533	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
534	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
535	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
536	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
537	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
538	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
539	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
540	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
541	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
542	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
543	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
544	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
545	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
546	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
547	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
548	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
549	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
550	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
551	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
552	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
553	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
554	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
555	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
556	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
557	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
558	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
559	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
560	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
561	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
562	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
563	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
564	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
565	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
566	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
567	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
568	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
569	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
570	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
571	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
572	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
573	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
574	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
575	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
576	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
577	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
578	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
579	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
580	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
581	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
582	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
583	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
584	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
585	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
586	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
587	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
588	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
589	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
590	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
591	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
592	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
593	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
594	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
595	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
596	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
597	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
598	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
599	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
600	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
601	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
602	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
603	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
604	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
605	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
606	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
607	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
608	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
609	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
610	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
611	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
612	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
613	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
614	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
615	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
616	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
617	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
618	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
619	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
620	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
621	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
622	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
623	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
624	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
625	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
626	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
627	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
628	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
629	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
630	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
631	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
632	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
633	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
634	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
635	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
636	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
637	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
638	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
639	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
640	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
641	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
642	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
643	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
644	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
645	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
646	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
647	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
648	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
649	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
650	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
651	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
652	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
653	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
654	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
655	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
656	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
657	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
658	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
659	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
660	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
661	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
662	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
663	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
664	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
665	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
666	2643221557	Ensifer sp. Root558	Isolate	Unclassified
667	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
668	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
669	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
670	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
671	2643221592	Rhizobacter sp. Root16D2	Isolate	Unclassified
672	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
673	2643221610	Ensifer sp. Root74	Isolate	Unclassified
674	2643221625	Rhizobacter sp. Root29	Isolate	Unclassified
675	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
676	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
677	2643221648	Rhizobacter sp. Root1238	Isolate	Unclassified
678	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
679	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
680	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
681	2643221658	Variovorax sp. Root411	Isolate	Unclassified
682	2643221668	Ensifer sp. Root423	Isolate	Unclassified
683	2643221672	Variovorax sp. Root434	Isolate	Unclassified
684	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
685	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
686	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
687	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
688	2643221723	Ensifer sp. Root278	Isolate	Unclassified
689	2643221726	Ensifer sp. Root954	Isolate	Unclassified
690	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
691	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
692	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
693	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
694	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
695	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
696	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
697	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
698	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
699	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
700	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
701	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
702	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
703	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
704	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
705	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
706	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
707	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
708	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
709	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
710	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
711	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
712	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
713	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
714	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
715	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
716	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
717	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
718	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
719	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
720	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
721	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
722	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
723	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
724	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
725	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
726	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
727	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
728	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
729	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
730	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
731	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
732	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
733	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
734	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
735	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
736	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
737	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
738	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
739	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
740	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
741	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
742	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
743	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
744	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
745	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
746	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
747	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
748	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
749	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
750	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
751	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
752	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
753	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
754	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
755	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
756	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
757	2818991436	Collimonas arenae 515	Isolate	Unclassified
758	2818991450	Burkholderia sp. 604	Isolate	Unclassified
759	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
760	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
761	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
762	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
763	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
764	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
765	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
766	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
767	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
768	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
769	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
770	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
771	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
772	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
773	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
774	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
775	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
776	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
777	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
778	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
779	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
780	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
781	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
782	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
783	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
784	2856287931	Paraburkholderia bannensis BE22	Isolate	Rhizosphere
785	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
786	2857542790	Achromobacter sp. R-72367	Isolate	Unclassified
787	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
788	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
789	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
790	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
791	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
792	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
793	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
794	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
795	2883291878	Hypericibacter terrae R5913	Isolate	Rhizosphere
796	2883354860	Hypericibacter adhaerens R5959	Isolate	Rhizosphere
797	2885198086	Variovorax sp. 679	Isolate	Unclassified
798	2885211737	Variovorax sp. 553	Isolate	Unclassified
799	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
800	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
801	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
802	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
803	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
804	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
805	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
806	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
807	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
808	2904564687	Burkholderia sp. 571	Isolate	Unclassified
809	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
810	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
811	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
812	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
813	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
814	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
815	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
816	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
817	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
818	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
819	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
820	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
821	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
822	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
823	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
824	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
825	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
826	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
827	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
828	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
829	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
830	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
831	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
832	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
833	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
834	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
835	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
836	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
837	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
838	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
839	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
840	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
841	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
842	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
843	2928163908	Burkholderia sp. 567	Isolate	Unclassified
844	2928170801	Burkholderia sp. 572	Isolate	Unclassified
845	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
846	2928536128	Burkholderia sola 565	Isolate	Unclassified
847	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
848	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
849	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
850	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
851	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
852	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
853	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
854	2937967321	Serratia sp. YC16	Isolate	Unclassified
855	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
856	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
857	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
858	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
859	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
860	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
861	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
862	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
863	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
864	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
865	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
866	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
867	2952252522	Salinicola sp. DM10	Isolate	Unclassified
868	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
869	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
870	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
871	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
872	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
873	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
874	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
875	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
876	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
877	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
878	2984568884	Acinetobacter baylyi SORGH_AS893	Isolate	Aerial Root
879	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
880	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
881	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
882	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
883	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
884	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
885	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
886	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
887	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
888	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
889	3007803356	Pseudomonas sp. CM27	Isolate	Unclassified
890	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
891	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
892	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
893	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
894	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
895	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
896	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
897	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
898	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
899	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
900	8011350971	Pseudomonas sp. 30_B	Isolate	Rhizosphere
901	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
902	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
903	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
904	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
905	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
906	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
907	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
908	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
909	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
910	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
911	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
912	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
913	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
914	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
915	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
916	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
917	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
918	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
919	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
920	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
921	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
922	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
923	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
924	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
925	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
926	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
927	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
928	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
929	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
930	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
931	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
932	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
933	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
934	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
935	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
936	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
937	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	80.25
Metatranscriptomes	0.24
Isolates	19.51

Biome Distribution

Category	Percentage (%)
Aerial Root	0.1
Bulb	0
Endosphere	17.94
Nodule	2.76
Rhizoplane	5.66
Rhizosphere	59.16
Stem	0
Stem Tuber	0
Unclassified	0.05

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0395900_0391945	3300037418	Bacteria	1355
2	MRS2a_Contig_76	2124908027	Bacteria	17203
3	MRS2a_Contig_923	2124908027	Bacteria	2002
4	JGI24740J21852_10000408	3300001979	Bacteria	18450
5	JGI24740J21852_10005990	3300001979	Bacteria	5085
6	JGI24739J22299_10001939	3300001989	Bacteria	7911
7	JGI24739J22299_10002298	3300001989	Bacteria	7358
8	JGI24739J22299_10015272	3300001989	Bacteria	2789
9	JGI24739J22299_10027161	3300001989	Bacteria	2003
10	JGI24737J22298_10010148	3300001990	Bacteria	3119
11	JGI24735J21928_10001688	3300002067	Bacteria	7795
12	JGI24735J21928_10013207	3300002067	Bacteria	2600
13	JGI24738J21930_10013961	3300002075	Bacteria	1728
14	JGI25156J39149_1000694	3300002705	Bacteria	18064
15	JGI25156J39149_1000808	3300002705	Bacteria	16016
16	JGI25156J39149_1001250	3300002705	Bacteria	11114
17	JGI25156J39149_1003923	3300002705	Bacteria	4712
18	JGI25162J39368_1000037	3300002737	Bacteria	179339
19	JGI25162J39368_1000087	3300002737	Bacteria	107005
20	JGI25162J39368_1000157	3300002737	Bacteria	75011
21	JGI25162J39368_1000396	3300002737	Bacteria	36464
22	JGI25154J39366_1000262	3300002738	Bacteria	33718
23	JGI25157J39369_1000172	3300002741	Bacteria	54469
24	JGI25157J39369_1000865	3300002741	Bacteria	14703
25	JGI25163J39215_1000066	3300002771	Bacteria	47667
26	JGI25163J39215_1000110	3300002771	Bacteria	34458
27	JGI25163J39215_1002113	3300002771	Bacteria	2321
28	JGI25164J39214_1000020	3300002772	Bacteria	179339
29	JGI25164J39214_1000065	3300002772	Bacteria	107006
30	JGI25164J39214_1000263	3300002772	Bacteria	39612
31	JGI25152J39213_1000928	3300002773	Bacteria	14374
32	JGI25152J39213_1001845	3300002773	Bacteria	8551
33	JGI25152J39213_1004924	3300002773	Bacteria	4052
34	JGI25150J39212_1000601	3300002774	Bacteria	13950
35	JGI25150J39212_1004403	3300002774	Bacteria	3136
36	JGI25159J45721_1000475	3300002987	Bacteria	18465
37	JGI25151J46595_10000909	3300003187	Bacteria	23173
38	JGI25151J46595_10001696	3300003187	Bacteria	14374
39	JGI25151J46595_10021628	3300003187	Bacteria	2687
40	JGI25165J46597_1000020	3300003214	Bacteria	370477
41	JGI25165J46597_1000045	3300003214	Bacteria	257539
42	JGI25165J46597_1000077	3300003214	Bacteria	179339
43	JGI25165J46597_1000091	3300003214	Bacteria	167941
44	JGI25165J46597_1000473	3300003214	Bacteria	39640
45	JGI25153J46596_10000012	3300003215	Bacteria	308056
46	JGI25153J46596_10001260	3300003215	Bacteria	15227
47	JGI25153J46596_10001655	3300003215	Bacteria	13201
48	JGI25153J46596_10002628	3300003215	Bacteria	10276
49	rootH2_10118054	3300003320	Bacteria	5973
50	JGI25160J50197_1000899	3300003354	Bacteria	15656
51	JGI25161J50226_1002821	3300003374	Bacteria	4262
52	Ga0006562J51391_1041821	3300003578	Bacteria	3290
53	Ga0006562J51391_1041822	3300003578	Bacteria	2530
54	Ga0006562J51391_1064349	3300003578	Bacteria	2311
55	Ga0006562J51391_1151119	3300003578	Bacteria	2318
56	Ga0055538_1000022	3300003751	Bacteria	257539
57	Ga0055538_1000027	3300003751	Bacteria	216576
58	Ga0055539_1000028	3300003752	Bacteria	257539
59	Ga0055539_1000036	3300003752	Bacteria	216576
60	Ga0055539_1000064	3300003752	Bacteria	139066
61	Ga0055539_1001064	3300003752	Bacteria	5832
62	Ga0055533_1000036	3300003756	Bacteria	257539
63	Ga0055533_1000046	3300003756	Bacteria	216576
64	Ga0055533_1000074	3300003756	Bacteria	139066
65	Ga0055533_1000750	3300003756	Bacteria	10388
66	Ga0055533_1001582	3300003756	Bacteria	5912
67	Ga0055532_1000001	3300003758	Bacteria	1119836
68	Ga0055532_1000032	3300003758	Bacteria	216568
69	Ga0055532_1000339	3300003758	Bacteria	25427
70	Ga0055532_1000445	3300003758	Bacteria	19341
71	Ga0055532_1001174	3300003758	Bacteria	7902
72	Ga0055525_1000092	3300003759	Bacteria	139066
73	Ga0055525_1000191	3300003759	Bacteria	75011
74	Ga0055525_1000217	3300003759	Bacteria	62978
75	Ga0055527_1000002	3300003760	Bacteria	830488
76	Ga0055527_1000185	3300003760	Bacteria	41750
77	Ga0055527_1000256	3300003760	Bacteria	32772
78	Ga0055527_1000406	3300003760	Bacteria	18025
79	Ga0055527_1001507	3300003760	Bacteria	4798
80	Ga0055527_1003921	3300003760	Bacteria	2120
81	Ga0055535_1000001	3300003761	Bacteria	1119836
82	Ga0055535_1000386	3300003761	Bacteria	41750
83	Ga0055535_1001005	3300003761	Bacteria	18025
84	Ga0055535_1001016	3300003761	Bacteria	17848
85	Ga0055535_1001049	3300003761	Bacteria	17324
86	Ga0055535_1001643	3300003761	Bacteria	10436
87	Ga0055535_1005867	3300003761	Bacteria	2601
88	Ga0055542_1000001	3300003762	Bacteria	1119836
89	Ga0055542_1000423	3300003762	Bacteria	40916
90	Ga0055542_1000564	3300003762	Bacteria	32773
91	Ga0055542_1001012	3300003762	Bacteria	17905
92	Ga0055542_1001507	3300003762	Bacteria	11308
93	Ga0055542_1002559	3300003762	Bacteria	5815
94	Ga0055529_1000001	3300003763	Bacteria	826680
95	Ga0055529_1000116	3300003763	Bacteria	117929
96	Ga0055529_1000533	3300003763	Bacteria	32772
97	Ga0055529_1000699	3300003763	Bacteria	22603
98	Ga0055526_1001431	3300003771	Bacteria	17005
99	Ga0055526_1001651	3300003771	Bacteria	15656
100	Ga0055526_1001876	3300003771	Bacteria	14563
101	Ga0055526_1010601	3300003771	Bacteria	4266
102	Ga0055537_1000280	3300003773	Bacteria	36696
103	Ga0055537_1000682	3300003773	Bacteria	17808
104	Ga0055537_1005616	3300003773	Bacteria	3328
105	Ga0055524_1001173	3300003775	Bacteria	15656
106	Ga0055524_1005981	3300003775	Bacteria	5349
107	Ga0055536_1000041	3300003781	Bacteria	127266
108	Ga0055536_1000042	3300003781	Bacteria	125029
109	Ga0055536_1022285	3300003781	Bacteria	1895
110	Ga0055534_1000358	3300003784	Bacteria	28950
111	Ga0055534_1000744	3300003784	Bacteria	15656
112	Ga0055528_1000566	3300003790	Bacteria	28109
113	Ga0055528_1000843	3300003790	Bacteria	20858
114	Ga0055528_1001301	3300003790	Bacteria	15656
115	Ga0055528_1012325	3300003790	Bacteria	3327
116	Ga0055530_10000063	3300003791	Bacteria	94619
117	Ga0055530_10001280	3300003791	Bacteria	19002
118	Ga0055530_10004550	3300003791	Bacteria	7083
119	Ga0055530_10032635	3300003791	Bacteria	1352
120	Ga0055540_1000318	3300003792	Bacteria	42704
121	Ga0055540_1000431	3300003792	Bacteria	33319
122	Ga0055540_1000936	3300003792	Bacteria	19002
123	Ga0055540_1011947	3300003792	Bacteria	2759
124	Ga0055531_10000548	3300003794	Bacteria	33319
125	Ga0055531_10005876	3300003794	Bacteria	7083
126	Ga0055531_10010388	3300003794	Bacteria	4632
127	Ga0055531_10011907	3300003794	Bacteria	4141
128	Ga0055531_10012470	3300003794	Bacteria	3997
129	Ga0055531_10027232	3300003794	Bacteria	2012
130	Ga0055541_1000024	3300003841	Bacteria	216576
131	Ga0055541_1000046	3300003841	Bacteria	139066
132	Ga0055541_1000094	3300003841	Bacteria	75011
133	Ga0058692_1006587	3300003856	Bacteria	3166
134	Ga0055543_1003421	3300004625	Bacteria	4702
135	Ga0058859_11722582	3300004798	Bacteria	1496
136	Ga0065165_1000952	3300005262	Bacteria	36509
137	Ga0065165_1001963	3300005262	Bacteria	19492
138	Ga0065165_1004597	3300005262	Bacteria	8402
139	Ga0065714_10001100	3300005288	Bacteria	3136
140	Ga0065714_10003469	3300005288	Bacteria	13610
141	Ga0065714_10005452	3300005288	Bacteria	9688
142	Ga0065714_10007547	3300005288	Bacteria	5444
143	Ga0065714_10016005	3300005288	Bacteria	2489
144	Ga0065704_10005489	3300005289	Bacteria	3353
145	Ga0065712_10072537	3300005290	Bacteria	4713
146	Ga0065715_10009282	3300005293	Bacteria	3434
147	Ga0065707_10007575	3300005295	Bacteria	3024
148	Ga0070658_10022601	3300005327	Bacteria	5046
149	Ga0070658_10103685	3300005327	Bacteria	2352
150	Ga0070676_10021599	3300005328	Bacteria	3603
151	Ga0070676_10030334	3300005328	Bacteria	3083
152	Ga0070676_10089289	3300005328	Bacteria	1885
153	Ga0070690_100111807	3300005330	Bacteria	1824
154	Ga0070670_100096664	3300005331	Bacteria	2541
155	Ga0068869_100007271	3300005334	Bacteria	7055
156	Ga0070666_10003553	3300005335	Bacteria	9453
157	Ga0068868_100005038	3300005338	Bacteria	9276
158	Ga0068868_100010970	3300005338	Bacteria	6582
159	Ga0068868_100017499	3300005338	Bacteria	5343
160	Ga0068868_100078558	3300005338	Bacteria	2642
161	Ga0070660_100000351	3300005339	Bacteria	30754
162	Ga0070687_100044747	3300005343	Bacteria	2256
163	Ga0070661_100000008	3300005344	Bacteria	183494
164	Ga0070668_100017121	3300005347	Bacteria	5424
165	Ga0070669_100000618	3300005353	Bacteria	26267
166	Ga0070675_100004251	3300005354	Bacteria	10901
167	Ga0070671_100003057	3300005355	Bacteria	13012
168	Ga0070671_100048649	3300005355	Bacteria	3526
169	Ga0070671_100055001	3300005355	Bacteria	3310
170	Ga0070674_100003115	3300005356	Bacteria	9235
171	Ga0070674_100023607	3300005356	Bacteria	3982
172	Ga0070674_100029859	3300005356	Bacteria	3598
173	Ga0070673_100003996	3300005364	Bacteria	9278
174	Ga0070673_100004321	3300005364	Bacteria	8975
175	Ga0070688_100006220	3300005365	Bacteria	6360
176	Ga0070688_100127477	3300005365	Bacteria	1712
177	Ga0070659_100000301	3300005366	Bacteria	38549
178	Ga0070659_100192351	3300005366	Bacteria	1677
179	Ga0070667_100000766	3300005367	Bacteria	30566
180	Ga0070667_100002286	3300005367	Bacteria	16863
181	Ga0070667_100014751	3300005367	Bacteria	6456
182	Ga0070667_100023448	3300005367	Bacteria	5120
183	Ga0070667_100092689	3300005367	Bacteria	2600
184	Ga0070667_100463547	3300005367	Bacteria	1159
185	Ga0070700_100118158	3300005441	Bacteria	1773
186	Ga0070708_100028937	3300005445	Bacteria	4772
187	Ga0070663_100007362	3300005455	Bacteria	6696
188	Ga0070663_100009853	3300005455	Bacteria	5936
189	Ga0070663_100082324	3300005455	Bacteria	2368
190	Ga0070678_100359251	3300005456	Bacteria	1254
191	Ga0070678_100387540	3300005456	Bacteria	1211
192	Ga0070662_100000397	3300005457	Bacteria	25941
193	Ga0070662_100051504	3300005457	Bacteria	2974
194	Ga0070662_100085560	3300005457	Bacteria	2356
195	Ga0068867_100008567	3300005459	Bacteria	7217
196	Ga0068867_100043145	3300005459	Bacteria	3301
197	Ga0068867_100061802	3300005459	Bacteria	2782
198	Ga0068867_100497003	3300005459	Bacteria	1048
199	Ga0070706_100198732	3300005467	Bacteria	1873
200	Ga0070707_100023575	3300005468	Bacteria	5820
201	Ga0070707_100055321	3300005468	Bacteria	3804
202	Ga0070698_100066586	3300005471	Bacteria	3625
203	Ga0068853_100031387	3300005539	Bacteria	4495
204	Ga0068853_100100434	3300005539	Bacteria	2558
205	Ga0070672_100064410	3300005543	Bacteria	2896
206	Ga0070696_100344846	3300005546	Bacteria	1152
207	Ga0070665_100017684	3300005548	Bacteria	7159
208	Ga0070665_100183134	3300005548	Bacteria	2095
209	Ga0070665_100311557	3300005548	Bacteria	1578
210	Ga0070704_100073205	3300005549	Bacteria	2495
211	Ga0068855_100000072	3300005563	Bacteria	121486
212	Ga0068855_100093853	3300005563	Bacteria	3460
213	Ga0070664_100000028	3300005564	Bacteria	90414
214	Ga0070664_100013940	3300005564	Bacteria	6553
215	Ga0070664_100193857	3300005564	Bacteria	1811
216	Ga0068857_100010156	3300005577	Bacteria	8184
217	Ga0068854_100008147	3300005578	Bacteria	6723
218	Ga0068856_100001902	3300005614	Bacteria	21771
219	Ga0068852_100023154	3300005616	Bacteria	4994
220	Ga0068852_100030306	3300005616	Bacteria	4452
221	Ga0068859_100000133	3300005617	Bacteria	70133
222	Ga0068859_100129740	3300005617	Bacteria	2592
223	Ga0068864_100000237	3300005618	Bacteria	49297
224	Ga0068864_100011272	3300005618	Bacteria	7385
225	Ga0068866_10018142	3300005718	Bacteria	3177
226	Ga0068866_10021927	3300005718	Bacteria	2948
227	Ga0068866_10074766	3300005718	Bacteria	1802
228	Ga0068861_100058791	3300005719	Bacteria	2941
229	Ga0068861_100102728	3300005719	Bacteria	2276
230	Ga0068861_100299739	3300005719	Bacteria	1392
231	Ga0068851_10046515	3300005834	Bacteria	2195
232	Ga0068870_10005466	3300005840	Bacteria	5554
233	Ga0068863_100012293	3300005841	Bacteria	8264
234	Ga0068863_100041879	3300005841	Bacteria	4353
235	Ga0068863_100145706	3300005841	Bacteria	2265
236	Ga0068858_100000395	3300005842	Bacteria	45718
237	Ga0068860_100010571	3300005843	Bacteria	9117
238	Ga0068860_100028902	3300005843	Bacteria	5334
239	Ga0068860_100191918	3300005843	Bacteria	1977
240	Ga0068860_100237393	3300005843	Bacteria	1773
241	Ga0068862_100029304	3300005844	Bacteria	4637
242	Ga0068862_100063333	3300005844	Bacteria	3182
243	Ga0068862_100178864	3300005844	Bacteria	1903
244	Ga0081538_10013957	3300005981	Bacteria	6325
245	Ga0081539_10046320	3300005985	Bacteria	2493
246	Ga0075365_10070985	3300006038	Bacteria	2344
247	Ga0075365_10220676	3300006038	Bacteria	1330
248	Ga0075368_10022622	3300006042	Bacteria	2394
249	Ga0075363_100004309	3300006048	Bacteria	6195
250	Ga0075363_100026381	3300006048	Bacteria	2972
251	Ga0075363_100052420	3300006048	Bacteria	2178
252	Ga0075364_10019678	3300006051	Bacteria	4239
253	Ga0075364_10175901	3300006051	Bacteria	1447
254	Ga0075432_10012659	3300006058	Bacteria	2865
255	Ga0075362_10001418	3300006177	Bacteria	7640
256	Ga0075362_10007113	3300006177	Bacteria	4214
257	Ga0075362_10081788	3300006177	Bacteria	1489
258	Ga0075362_10094546	3300006177	Bacteria	1391
259	Ga0075367_10017422	3300006178	Bacteria	3944
260	Ga0075367_10072504	3300006178	Bacteria	2073
261	Ga0075367_10112015	3300006178	Bacteria	1676
262	Ga0075367_10194685	3300006178	Bacteria	1266
263	Ga0075369_10036447	3300006186	Bacteria	2093
264	Ga0075366_10007756	3300006195	Bacteria	5943
265	Ga0075366_10008684	3300006195	Bacteria	5657
266	Ga0075366_10014549	3300006195	Bacteria	4494
267	Ga0075366_10014990	3300006195	Bacteria	4432
268	Ga0075366_10034827	3300006195	Bacteria	2967
269	Ga0075366_10042458	3300006195	Bacteria	2692
270	Ga0075366_10056181	3300006195	Bacteria	2338
271	Ga0097621_100010287	3300006237	Bacteria	6836
272	Ga0075370_10000530	3300006353	Bacteria	14595
273	Ga0075370_10000771	3300006353	Bacteria	12845
274	Ga0075370_10001010	3300006353	Bacteria	11647
275	Ga0075370_10001315	3300006353	Bacteria	10640
276	Ga0075370_10002624	3300006353	Bacteria	8388
277	Ga0075370_10004846	3300006353	Bacteria	6598
278	Ga0075370_10021595	3300006353	Bacteria	3527
279	Ga0075370_10066320	3300006353	Bacteria	2059
280	Ga0068871_100035803	3300006358	Bacteria	3947
281	Ga0075428_100028272	3300006844	Bacteria	6201
282	Ga0075428_100045564	3300006844	Bacteria	4818
283	Ga0075428_100260691	3300006844	Bacteria	1866
284	Ga0075428_100469069	3300006844	Bacteria	1348
285	Ga0075430_100017062	3300006846	Bacteria	6185
286	Ga0075430_100035450	3300006846	Bacteria	4232
287	Ga0075430_100138333	3300006846	Bacteria	2028
288	Ga0075431_100011196	3300006847	Bacteria	9034
289	Ga0075431_100051693	3300006847	Bacteria	4237
290	Ga0075431_100096418	3300006847	Bacteria	3053
291	Ga0075431_100123021	3300006847	Bacteria	2677
292	Ga0075434_100105017	3300006871	Bacteria	2835
293	Ga0075429_100131326	3300006880	Bacteria	2191
294	Ga0068865_100026576	3300006881	Bacteria	3818
295	Ga0068865_100187814	3300006881	Bacteria	1596
296	Ga0068865_100239465	3300006881	Bacteria	1427
297	Ga0075436_100014627	3300006914	Bacteria	5379
298	Ga0097620_100000133	3300006931	Bacteria	70133
299	Ga0097620_100129736	3300006931	Bacteria	2592
300	Ga0099823_1000244	3300006944	Bacteria	31611
301	Ga0079104_1000145	3300006946	Bacteria	100111
302	Ga0079104_1000908	3300006946	Bacteria	24002
303	Ga0079104_1001974	3300006946	Bacteria	12055
304	Ga0079104_1031975	3300006946	Bacteria	1301
305	Ga0099826_10005078	3300006948	Bacteria	9357
306	Ga0099826_10072892	3300006948	Bacteria	2172
307	Ga0105251_10000061	3300009011	Bacteria	102789
308	Ga0105251_10000092	3300009011	Bacteria	86905
309	Ga0105251_10000602	3300009011	Bacteria	32992
310	Ga0105251_10000704	3300009011	Bacteria	30863
311	Ga0105251_10002688	3300009011	Bacteria	13665
312	Ga0105251_10003050	3300009011	Bacteria	12475
313	Ga0105251_10003224	3300009011	Bacteria	12022
314	Ga0105251_10019154	3300009011	Bacteria	3622
315	Ga0105251_10032066	3300009011	Bacteria	2622
316	Ga0105251_10042354	3300009011	Bacteria	2211
317	Ga0105244_10002171	3300009036	Bacteria	15043
318	Ga0105244_10002522	3300009036	Bacteria	13767
319	Ga0105244_10010806	3300009036	Bacteria	5512
320	Ga0105244_10013426	3300009036	Bacteria	4790
321	Ga0105244_10024200	3300009036	Bacteria	3317
322	Ga0105244_10051436	3300009036	Bacteria	2099
323	Ga0105244_10074244	3300009036	Bacteria	1692
324	Ga0105250_10000056	3300009092	Bacteria	114085
325	Ga0105250_10000180	3300009092	Bacteria	54634
326	Ga0105250_10014724	3300009092	Bacteria	3208
327	Ga0105240_10007736	3300009093	Bacteria	15545
328	Ga0105240_10015910	3300009093	Bacteria	10205
329	Ga0105240_10065528	3300009093	Bacteria	4509
330	Ga0105240_10109505	3300009093	Bacteria	3345
331	Ga0105240_10169087	3300009093	Bacteria	2590
332	Ga0105240_10224905	3300009093	Bacteria	2184
333	Ga0105240_10238624	3300009093	Bacteria	2109
334	Ga0105240_10489938	3300009093	Bacteria	1369
335	Ga0111539_10000128	3300009094	Bacteria	85958
336	Ga0111539_10163825	3300009094	Bacteria	2600
337	Ga0111539_10206166	3300009094	Bacteria	2291
338	Ga0105245_10034802	3300009098	Bacteria	4469
339	Ga0105245_10090180	3300009098	Bacteria	2819
340	Ga0105245_10118897	3300009098	Bacteria	2466
341	Ga0105245_10156415	3300009098	Bacteria	2159
342	Ga0105243_10000313	3300009148	Bacteria	53525
343	Ga0105243_10001425	3300009148	Bacteria	21068
344	Ga0105243_10015708	3300009148	Bacteria	5726
345	Ga0105243_10025093	3300009148	Bacteria	4552
346	Ga0105243_10068334	3300009148	Bacteria	2864
347	Ga0105243_10217195	3300009148	Bacteria	1688
348	Ga0105243_10220406	3300009148	Bacteria	1676
349	Ga0105243_10250588	3300009148	Bacteria	1581
350	Ga0105242_10000024	3300009176	Bacteria	111115
351	Ga0105242_10002462	3300009176	Bacteria	14531
352	Ga0105242_10067093	3300009176	Bacteria	2965
353	Ga0105242_10271652	3300009176	Bacteria	1536
354	Ga0105248_10002604	3300009177	Bacteria	20066
355	Ga0105248_10014194	3300009177	Bacteria	8770
356	Ga0105248_10151494	3300009177	Bacteria	2616
357	Ga0105237_10001086	3300009545	Bacteria	36387
358	Ga0105237_10008395	3300009545	Bacteria	11193
359	Ga0105237_10008765	3300009545	Bacteria	10913
360	Ga0105237_10097154	3300009545	Bacteria	2936
361	Ga0105237_10176908	3300009545	Bacteria	2134
362	Ga0105237_10307162	3300009545	Bacteria	1589
363	Ga0105238_10001437	3300009551	Bacteria	23916
364	Ga0105238_10005146	3300009551	Bacteria	12930
365	Ga0105238_10023215	3300009551	Bacteria	6323
366	Ga0105238_10594771	3300009551	Bacteria	1114
367	Ga0105249_10005689	3300009553	Bacteria	10779
368	Ga0105249_10011734	3300009553	Bacteria	7703
369	Ga0105239_10000248	3300010375	Bacteria	80738
370	Ga0105239_10024202	3300010375	Bacteria	6687
371	Ga0105239_10084112	3300010375	Bacteria	3504
372	Ga0105239_10331468	3300010375	Bacteria	1717
373	Ga0105246_10001214	3300011119	Bacteria	15096
374	Ga0105246_10001286	3300011119	Bacteria	14714
375	Ga0157373_10006570	3300013100	Bacteria	8674
376	Ga0157373_10070354	3300013100	Bacteria	2472
377	Ga0157373_10187930	3300013100	Bacteria	1455
378	Ga0157371_10002649	3300013102	Bacteria	16954
379	Ga0157370_10000490	3300013104	Bacteria	49239
380	Ga0157370_10318060	3300013104	Bacteria	1436
381	Ga0157369_10004506	3300013105	Bacteria	16407
382	Ga0157369_10020605	3300013105	Bacteria	7372
383	Ga0157369_10111968	3300013105	Bacteria	2900
384	Ga0157369_10274442	3300013105	Bacteria	1756
385	Ga0157369_10639463	3300013105	Bacteria	1097
386	Ga0157378_10011082	3300013297	Bacteria	7890
387	Ga0157378_10019760	3300013297	Bacteria	5924
388	Ga0157378_10198711	3300013297	Bacteria	1895
389	Ga0163162_10002443	3300013306	Bacteria	17524
390	Ga0163162_10050323	3300013306	Bacteria	4178
391	Ga0163162_10124774	3300013306	Bacteria	2680
392	Ga0157375_10057385	3300013308	Bacteria	3848
393	Ga0157375_10065379	3300013308	Bacteria	3626
394	Ga0157375_10111663	3300013308	Bacteria	2833
395	Ga0163163_10004911	3300014325	Bacteria	11498
396	Ga0163163_10767449	3300014325	Bacteria	1027
397	Ga0157380_10041555	3300014326	Bacteria	3589
398	Ga0157380_10047419	3300014326	Bacteria	3379
399	Ga0157380_10387890	3300014326	Bacteria	1321
400	Ga0182008_10019099	3300014497	Bacteria	3542
401	Ga0182008_10094920	3300014497	Bacteria	1471
402	Ga0157377_10130733	3300014745	Bacteria	1533
403	Ga0157379_10005267	3300014968	Bacteria	11105
404	Ga0157379_10086499	3300014968	Bacteria	2811
405	Ga0157376_10064084	3300014969	Bacteria	3098
406	Ga0157376_10225633	3300014969	Bacteria	1738
407	Ga0182006_1001318	3300015261	Bacteria	15230
408	Ga0182006_1002393	3300015261	Bacteria	10281
409	Ga0182006_1006784	3300015261	Bacteria	5285
410	Ga0182006_1023537	3300015261	Bacteria	2549
411	Ga0182007_10001406	3300015262	Bacteria	12958
412	Ga0182007_10001432	3300015262	Bacteria	12788
413	Ga0182007_10024440	3300015262	Bacteria	2114
414	Ga0182007_10048256	3300015262	Bacteria	1407
415	Ga0182005_1000312	3300015265	Bacteria	29387
416	Ga0182005_1025325	3300015265	Bacteria	1619
417	Ga0183363_1190	3300015690	Bacteria	12990
418	Ga0183361_10009	3300016635	Bacteria	205218
419	Ga0163161_10000696	3300017792	Bacteria	26770
420	Ga0163161_10043216	3300017792	Bacteria	3244
421	Ga0163161_10052855	3300017792	Bacteria	2945
422	Ga0163161_10142155	3300017792	Bacteria	1818
423	Ga0213872_10000133	3300021361	Bacteria	67595
424	Ga0213872_10011625	3300021361	Bacteria	4162
425	Ga0213872_10012284	3300021361	Bacteria	4031
426	Ga0213872_10033642	3300021361	Bacteria	2349
427	Ga0213872_10038248	3300021361	Bacteria	2190
428	Ga0213876_10107715	3300021384	Bacteria	1479
429	Ga0213875_10046465	3300021388	Bacteria	2037
430	Ga0209435_100104	3300025206	Bacteria	33801
431	Ga0209435_100285	3300025206	Bacteria	12252
432	Ga0209435_108578	3300025206	Bacteria	1123
433	Ga0209760_100022	3300025207	Bacteria	159218
434	Ga0209760_100184	3300025207	Bacteria	32884
435	Ga0209436_100705	3300025208	Bacteria	13989
436	Ga0209436_101698	3300025208	Bacteria	7254
437	Ga0209436_105832	3300025208	Bacteria	2772
438	Ga0209784_100002	3300025224	Bacteria	1753105
439	Ga0209784_100017	3300025224	Bacteria	472003
440	Ga0209784_100036	3300025224	Bacteria	263689
441	Ga0209566_100003	3300025225	Bacteria	1753105
442	Ga0209566_100014	3300025225	Bacteria	472003
443	Ga0209566_100044	3300025225	Bacteria	263689
444	Ga0209566_100331	3300025225	Bacteria	42302
445	Ga0209566_100507	3300025225	Bacteria	27001
446	Ga0209674_100004	3300025226	Bacteria	1753105
447	Ga0209674_100005	3300025226	Bacteria	1708125
448	Ga0209674_100028	3300025226	Bacteria	472003
449	Ga0209674_100065	3300025226	Bacteria	263689
450	Ga0209674_100110	3300025226	Bacteria	149245
451	Ga0209674_100148	3300025226	Bacteria	98100
452	Ga0209674_100640	3300025226	Bacteria	12724
453	Ga0209672_100001	3300025228	Bacteria	2828210
454	Ga0209672_100012	3300025228	Bacteria	795742
455	Ga0209672_100020	3300025228	Bacteria	429003
456	Ga0209672_100045	3300025228	Bacteria	264926
457	Ga0209672_100100	3300025228	Bacteria	108785
458	Ga0209672_100337	3300025228	Bacteria	30210
459	Ga0209147_100001	3300025229	Bacteria	2384371
460	Ga0209147_100007	3300025229	Bacteria	795684
461	Ga0209147_100024	3300025229	Bacteria	429003
462	Ga0209147_100038	3300025229	Bacteria	314497
463	Ga0209147_100149	3300025229	Bacteria	102676
464	Ga0209147_100713	3300025229	Bacteria	16928
465	Ga0209147_101540	3300025229	Bacteria	7959
466	Ga0209563_100006	3300025230	Bacteria	1753105
467	Ga0209563_100032	3300025230	Bacteria	472003
468	Ga0209563_100063	3300025230	Bacteria	263689
469	Ga0209563_100193	3300025230	Bacteria	33884
470	Ga0209563_100673	3300025230	Bacteria	10818
471	Ga0207427_100001	3300025231	Bacteria	1410763
472	Ga0207427_100047	3300025231	Bacteria	240409
473	Ga0207427_100139	3300025231	Bacteria	84807
474	Ga0207427_102819	3300025231	Bacteria	4219
475	Ga0207427_103026	3300025231	Bacteria	3876
476	Ga0209437_100003	3300025233	Bacteria	1517827
477	Ga0209437_100009	3300025233	Bacteria	915954
478	Ga0209437_100082	3300025233	Bacteria	263689
479	Ga0209437_100351	3300025233	Bacteria	52792
480	Ga0209437_100372	3300025233	Bacteria	45954
481	Ga0209258_100001	3300025242	Bacteria	2384269
482	Ga0209258_100014	3300025242	Bacteria	720132
483	Ga0209258_100024	3300025242	Bacteria	542096
484	Ga0209258_100084	3300025242	Bacteria	244783
485	Ga0209258_100197	3300025242	Bacteria	124028
486	Ga0209258_100200	3300025242	Bacteria	123379
487	Ga0209258_100587	3300025242	Bacteria	30186
488	Ga0207425_1000735	3300025245	Bacteria	17222
489	Ga0207425_1001198	3300025245	Bacteria	11495
490	Ga0207425_1004967	3300025245	Bacteria	3875
491	Ga0209646_1000108	3300025246	Bacteria	158853
492	Ga0209646_1000171	3300025246	Bacteria	84951
493	Ga0209646_1000545	3300025246	Bacteria	16125
494	Ga0209026_1000074	3300025250	Bacteria	203820
495	Ga0209026_1001305	3300025250	Bacteria	11263
496	Ga0209026_1002818	3300025250	Bacteria	6159
497	Ga0209677_100003	3300025253	Bacteria	1753105
498	Ga0209677_100018	3300025253	Bacteria	472003
499	Ga0209677_100038	3300025253	Bacteria	263689
500	Ga0209677_102971	3300025253	Bacteria	5895
501	Ga0209148_1000003	3300025254	Bacteria	2384288
502	Ga0209148_1000009	3300025254	Bacteria	1395625
503	Ga0209148_1000045	3300025254	Bacteria	448076
504	Ga0209148_1000434	3300025254	Bacteria	46127
505	Ga0209148_1000737	3300025254	Bacteria	25451
506	Ga0209148_1001237	3300025254	Bacteria	14282
507	Ga0209148_1002535	3300025254	Bacteria	6114
508	Ga0209759_1000033	3300025256	Bacteria	276117
509	Ga0209759_1000110	3300025256	Bacteria	144917
510	Ga0209759_1000116	3300025256	Bacteria	141810
511	Ga0209759_1000294	3300025256	Bacteria	69209
512	Ga0209759_1000411	3300025256	Bacteria	52806
513	Ga0209759_1000624	3300025256	Bacteria	33674
514	Ga0209759_1009794	3300025256	Bacteria	2867
515	Ga0209759_1018342	3300025256	Bacteria	1692
516	Ga0209129_1000030	3300025258	Bacteria	391958
517	Ga0209129_1000292	3300025258	Bacteria	47620
518	Ga0209129_1003254	3300025258	Bacteria	7207
519	Ga0209233_1000007	3300025261	Bacteria	1411234
520	Ga0209233_1000016	3300025261	Bacteria	907830
521	Ga0209233_1000032	3300025261	Bacteria	623596
522	Ga0209233_1000047	3300025261	Bacteria	459614
523	Ga0209233_1000109	3300025261	Bacteria	263689
524	Ga0209233_1000251	3300025261	Bacteria	84807
525	Ga0209565_1000019	3300025263	Bacteria	438920
526	Ga0209565_1000088	3300025263	Bacteria	151644
527	Ga0209565_1006334	3300025263	Bacteria	3328
528	Ga0209455_1000001	3300025272	Bacteria	2384278
529	Ga0209455_1000029	3300025272	Bacteria	542096
530	Ga0209455_1000035	3300025272	Bacteria	479071
531	Ga0209455_1000485	3300025272	Bacteria	29388
532	Ga0209455_1000551	3300025272	Bacteria	25451
533	Ga0209455_1000585	3300025272	Bacteria	23683
534	Ga0209455_1000621	3300025272	Bacteria	22132
535	Ga0209673_1000057	3300025273	Bacteria	270150
536	Ga0209673_1000064	3300025273	Bacteria	254712
537	Ga0209673_1000095	3300025273	Bacteria	197466
538	Ga0209673_1001209	3300025273	Bacteria	27471
539	Ga0209673_1001728	3300025273	Bacteria	18356
540	Ga0209673_1010294	3300025273	Bacteria	3950
541	Ga0209130_1000011	3300025284	Bacteria	431723
542	Ga0209130_1000033	3300025284	Bacteria	316064
543	Ga0209130_1002417	3300025284	Bacteria	9404
544	Ga0209130_1016006	3300025284	Bacteria	1829
545	Ga0209675_1000036	3300025291	Bacteria	254712
546	Ga0209675_1000073	3300025291	Bacteria	163009
547	Ga0209675_1011664	3300025291	Bacteria	2898
548	Ga0209676_1000016	3300025292	Bacteria	655561
549	Ga0209676_1000021	3300025292	Bacteria	609534
550	Ga0209676_1000033	3300025292	Bacteria	463236
551	Ga0209676_1000088	3300025292	Bacteria	263010
552	Ga0209676_1000458	3300025292	Bacteria	68762
553	Ga0209676_1001131	3300025292	Bacteria	29266
554	Ga0209676_1002585	3300025292	Bacteria	12474
555	Ga0209676_1012150	3300025292	Bacteria	3412
556	Ga0209676_1016344	3300025292	Bacteria	2684
557	Ga0209025_1000032	3300025294	Bacteria	416141
558	Ga0209025_1000157	3300025294	Bacteria	168790
559	Ga0209025_1000493	3300025294	Bacteria	75884
560	Ga0209025_1000494	3300025294	Bacteria	75744
561	Ga0209025_1015178	3300025294	Bacteria	4669
562	Ga0209025_1035346	3300025294	Bacteria	2259
563	Ga0209564_1000029	3300025295	Bacteria	505995
564	Ga0209564_1000056	3300025295	Bacteria	340873
565	Ga0209564_1000079	3300025295	Bacteria	266525
566	Ga0209564_1000103	3300025295	Bacteria	221166
567	Ga0209564_1006426	3300025295	Bacteria	6340
568	Ga0209758_1000037	3300025297	Bacteria	439101
569	Ga0209758_1000059	3300025297	Bacteria	328458
570	Ga0209758_1000096	3300025297	Bacteria	231496
571	Ga0209758_1000273	3300025297	Bacteria	102784
572	Ga0209758_1010815	3300025297	Bacteria	5394
573	Ga0209050_1000009	3300025298	Bacteria	1047265
574	Ga0209050_1000036	3300025298	Bacteria	423070
575	Ga0209050_1000107	3300025298	Bacteria	223303
576	Ga0209050_1000110	3300025298	Bacteria	216664
577	Ga0209050_1000593	3300025298	Bacteria	57753
578	Ga0209050_1001442	3300025298	Bacteria	25546
579	Ga0209050_1002197	3300025298	Bacteria	17587
580	Ga0209050_1004722	3300025298	Bacteria	9025
581	Ga0209050_1006696	3300025298	Bacteria	6739
582	Ga0209050_1019312	3300025298	Bacteria	2594
583	Ga0209050_1029224	3300025298	Bacteria	1769
584	Ga0209256_1000043	3300025299	Bacteria	340873
585	Ga0209256_1000064	3300025299	Bacteria	250853
586	Ga0209256_1000065	3300025299	Bacteria	248104
587	Ga0209256_1002048	3300025299	Bacteria	17889
588	Ga0207426_1000029	3300025302	Bacteria	473835
589	Ga0207426_1000078	3300025302	Bacteria	316064
590	Ga0207426_1000124	3300025302	Bacteria	218145
591	Ga0207426_1000326	3300025302	Bacteria	91021
592	Ga0207426_1001828	3300025302	Bacteria	15739
593	Ga0209051_1000043	3300025303	Bacteria	305473
594	Ga0209051_1000053	3300025303	Bacteria	281564
595	Ga0209051_1000069	3300025303	Bacteria	219208
596	Ga0209051_1000090	3300025303	Bacteria	173748
597	Ga0209051_1000921	3300025303	Bacteria	29186
598	Ga0209051_1001655	3300025303	Bacteria	17996
599	Ga0209051_1002771	3300025303	Bacteria	12097
600	Ga0209051_1008395	3300025303	Bacteria	5471
601	Ga0209051_1013349	3300025303	Bacteria	3915
602	Ga0209051_1027441	3300025303	Bacteria	2269
603	Ga0209257_1000093	3300025304	Bacteria	263088
604	Ga0209257_1000098	3300025304	Bacteria	256390
605	Ga0209257_1000997	3300025304	Bacteria	38352
606	Ga0209257_1002425	3300025304	Bacteria	18609
607	Ga0209257_1004164	3300025304	Bacteria	11486
608	Ga0209257_1007244	3300025304	Bacteria	6782
609	Ga0209257_1012719	3300025304	Bacteria	3848
610	Ga0209257_1013089	3300025304	Bacteria	3738
611	Ga0209257_1018666	3300025304	Bacteria	2653
612	Ga0209257_1021400	3300025304	Bacteria	2350
613	Ga0207697_10026541	3300025315	Bacteria	2368
614	Ga0207656_10000213	3300025321	Bacteria	20743
615	Ga0207696_1000010	3300025711	Bacteria	534681
616	Ga0207696_1000034	3300025711	Bacteria	350426
617	Ga0207696_1000043	3300025711	Bacteria	307112
618	Ga0207696_1000158	3300025711	Bacteria	112178
619	Ga0207696_1001606	3300025711	Bacteria	11961
620	Ga0207696_1012778	3300025711	Bacteria	2955
621	Ga0207655_1000019	3300025728	Bacteria	536324
622	Ga0207655_1000095	3300025728	Bacteria	195899
623	Ga0207655_1000175	3300025728	Bacteria	115631
624	Ga0207655_1000558	3300025728	Bacteria	46519
625	Ga0207655_1007882	3300025728	Bacteria	6843
626	Ga0207655_1007917	3300025728	Bacteria	6823
627	Ga0207713_1000014	3300025735	Bacteria	432450
628	Ga0207713_1000074	3300025735	Bacteria	181376
629	Ga0207713_1000372	3300025735	Bacteria	48799
630	Ga0207713_1000449	3300025735	Bacteria	43122
631	Ga0207713_1000623	3300025735	Bacteria	34739
632	Ga0207713_1000846	3300025735	Bacteria	28111
633	Ga0207713_1001459	3300025735	Bacteria	18816
634	Ga0207713_1002427	3300025735	Bacteria	13594
635	Ga0207713_1010467	3300025735	Bacteria	5128
636	Ga0207713_1017527	3300025735	Bacteria	3585
637	Ga0207713_1038629	3300025735	Bacteria	2023
638	Ga0207682_10025362	3300025893	Bacteria	2351
639	Ga0207642_10065717	3300025899	Bacteria	1705
640	Ga0207680_10001739	3300025903	Bacteria	10269
641	Ga0207680_10095736	3300025903	Bacteria	1898
642	Ga0207647_10005786	3300025904	Bacteria	9018
643	Ga0207647_10007274	3300025904	Bacteria	8010
644	Ga0207647_10037383	3300025904	Bacteria	3079
645	Ga0207647_10057888	3300025904	Bacteria	2375
646	Ga0207645_10015113	3300025907	Bacteria	5141
647	Ga0207645_10017804	3300025907	Bacteria	4684
648	Ga0207645_10042218	3300025907	Bacteria	2918
649	Ga0207643_10063101	3300025908	Bacteria	2118
650	Ga0207643_10078630	3300025908	Bacteria	1908
651	Ga0207643_10124819	3300025908	Bacteria	1528
652	Ga0207643_10148331	3300025908	Bacteria	1405
653	Ga0207684_10078429	3300025910	Bacteria	2809
654	Ga0207695_10014296	3300025913	Bacteria	9413
655	Ga0207695_10110627	3300025913	Bacteria	2727
656	Ga0207671_10000035	3300025914	Bacteria	237603
657	Ga0207671_10009819	3300025914	Bacteria	7963
658	Ga0207671_10082764	3300025914	Bacteria	2409
659	Ga0207657_10000003	3300025919	Bacteria	263148
660	Ga0207657_10055369	3300025919	Bacteria	3426
661	Ga0207657_10195253	3300025919	Bacteria	1631
662	Ga0207649_10000017	3300025920	Bacteria	225193
663	Ga0207646_10196147	3300025922	Bacteria	1823
664	Ga0207681_10005056	3300025923	Bacteria	8108
665	Ga0207681_10006303	3300025923	Bacteria	7281
666	Ga0207681_10022988	3300025923	Bacteria	3981
667	Ga0207681_10025122	3300025923	Bacteria	3829
668	Ga0207681_10159519	3300025923	Bacteria	1698
669	Ga0207694_10274212	3300025924	Bacteria	1384
670	Ga0207650_10000212	3300025925	Bacteria	66326
671	Ga0207650_10000523	3300025925	Bacteria	31492
672	Ga0207650_10317921	3300025925	Bacteria	1274
673	Ga0207659_10001481	3300025926	Bacteria	13992
674	Ga0207659_10012532	3300025926	Bacteria	5397
675	Ga0207659_10460641	3300025926	Bacteria	1072
676	Ga0207687_10020325	3300025927	Bacteria	4404
677	Ga0207687_10287623	3300025927	Bacteria	1320
678	Ga0207644_10023011	3300025931	Bacteria	4262
679	Ga0207644_10037410	3300025931	Bacteria	3414
680	Ga0207690_10000007	3300025932	Bacteria	388533
681	Ga0207706_10000170	3300025933	Bacteria	72208
682	Ga0207706_10004682	3300025933	Bacteria	12825
683	Ga0207706_10008668	3300025933	Bacteria	9370
684	Ga0207706_10017214	3300025933	Bacteria	6516
685	Ga0207706_10061843	3300025933	Bacteria	3298
686	Ga0207706_10263442	3300025933	Bacteria	1504
687	Ga0207686_10003698	3300025934	Bacteria	8201
688	Ga0207686_10123571	3300025934	Bacteria	1765
689	Ga0207709_10000036	3300025935	Bacteria	292568
690	Ga0207709_10000502	3300025935	Bacteria	34963
691	Ga0207709_10033520	3300025935	Bacteria	3017
692	Ga0207709_10042744	3300025935	Bacteria	2728
693	Ga0207709_10060754	3300025935	Bacteria	2358
694	Ga0207709_10105392	3300025935	Bacteria	1873
695	Ga0207709_10249948	3300025935	Bacteria	1294
696	Ga0207709_10259487	3300025935	Bacteria	1273
697	Ga0207669_10007673	3300025937	Bacteria	5012
698	Ga0207669_10045906	3300025937	Bacteria	2578
699	Ga0207669_10068621	3300025937	Bacteria	2215
700	Ga0207704_10027692	3300025938	Bacteria	3132
701	Ga0207704_10236842	3300025938	Bacteria	1361
702	Ga0207704_10247946	3300025938	Bacteria	1335
703	Ga0207691_10008211	3300025940	Bacteria	10029
704	Ga0207691_10013323	3300025940	Bacteria	7876
705	Ga0207691_10145805	3300025940	Unclassified	2084
706	Ga0207711_10002914	3300025941	Bacteria	15001
707	Ga0207711_10054438	3300025941	Bacteria	3434
708	Ga0207689_10027013	3300025942	Bacteria	4805
709	Ga0207689_10031214	3300025942	Bacteria	4438
710	Ga0207689_10132326	3300025942	Bacteria	2053
711	Ga0207679_10000005	3300025945	Bacteria	525011
712	Ga0207667_10000055	3300025949	Bacteria	223770
713	Ga0207667_10297354	3300025949	Bacteria	1649
714	Ga0207651_10000537	3300025960	Bacteria	15920
715	Ga0207651_10052303	3300025960	Bacteria	2784
716	Ga0207651_10081015	3300025960	Bacteria	2339
717	Ga0207651_10129699	3300025960	Bacteria	1928
718	Ga0207712_10018924	3300025961	Bacteria	4493
719	Ga0207668_10056511	3300025972	Bacteria	2733
720	Ga0207668_10273872	3300025972	Bacteria	1381
721	Ga0207668_10401778	3300025972	Bacteria	1159
722	Ga0207668_10407187	3300025972	Bacteria	1151
723	Ga0207640_10010712	3300025981	Bacteria	5170
724	Ga0207640_10095663	3300025981	Bacteria	2069
725	Ga0207640_10293945	3300025981	Bacteria	1282
726	Ga0207658_10000319	3300025986	Bacteria	48401
727	Ga0207658_10000720	3300025986	Bacteria	28611
728	Ga0207658_10021764	3300025986	Bacteria	4456
729	Ga0207658_10096325	3300025986	Bacteria	2307
730	Ga0207658_10185056	3300025986	Bacteria	1727
731	Ga0207658_10202651	3300025986	Bacteria	1658
732	Ga0207658_10220374	3300025986	Bacteria	1596
733	Ga0207677_10005784	3300026023	Bacteria	6725
734	Ga0207677_10005900	3300026023	Bacteria	6666
735	Ga0207677_10074578	3300026023	Bacteria	2408
736	Ga0207703_10000787	3300026035	Bacteria	31183
737	Ga0207639_10071507	3300026041	Bacteria	2714
738	Ga0207678_10002921	3300026067	Bacteria	15496
739	Ga0207678_10019668	3300026067	Bacteria	5937
740	Ga0207678_10028502	3300026067	Bacteria	4874
741	Ga0207678_10075602	3300026067	Bacteria	2885
742	Ga0207678_10086125	3300026067	Bacteria	2685
743	Ga0207708_10061730	3300026075	Bacteria	2862
744	Ga0207702_10006184	3300026078	Bacteria	10356
745	Ga0207702_10124621	3300026078	Bacteria	2311
746	Ga0207641_10034515	3300026088	Bacteria	4209
747	Ga0207648_10008161	3300026089	Bacteria	10180
748	Ga0207648_10014892	3300026089	Bacteria	7169
749	Ga0207648_10015990	3300026089	Bacteria	6876
750	Ga0207648_10042949	3300026089	Bacteria	3970
751	Ga0207648_10354903	3300026089	Bacteria	1322
752	Ga0207676_10000485	3300026095	Bacteria	33413
753	Ga0207676_10103033	3300026095	Bacteria	2371
754	Ga0207674_10008268	3300026116	Bacteria	12052
755	Ga0207674_10031934	3300026116	Bacteria	5527
756	Ga0207675_100038899	3300026118	Bacteria	4439
757	Ga0207675_100055401	3300026118	Bacteria	3699
758	Ga0207683_10002119	3300026121	Bacteria	17431
759	Ga0207683_10116784	3300026121	Bacteria	2392
760	Ga0207683_10270203	3300026121	Bacteria	1553
761	Ga0207683_10325958	3300026121	Bacteria	1407
762	Ga0207698_10136208	3300026142	Bacteria	2107
763	Ga0209281_1000018	3300027111	Bacteria	579091
764	Ga0209281_1000271	3300027111	Bacteria	100141
765	Ga0209281_1014736	3300027111	Bacteria	1647
766	Ga0209281_1018215	3300027111	Bacteria	1409
767	Ga0209389_1000063	3300027296	Bacteria	102403
768	Ga0209371_1000702	3300027312	Bacteria	28356
769	Ga0209371_1001162	3300027312	Bacteria	19262
770	Ga0209282_1000348	3300027666	Bacteria	22795
771	Ga0209282_1033875	3300027666	Bacteria	3109
772	Ga0209813_10037778	3300027866	Bacteria	1456
773	Ga0207428_10000078	3300027907	Bacteria	136571
774	Ga0207428_10204394	3300027907	Bacteria	1486
775	Ga0268266_10303654	3300028379	Bacteria	1490
776	Ga0268266_10310052	3300028379	Bacteria	1474
777	Ga0268266_10511515	3300028379	Bacteria	1147
778	Ga0268265_10003523	3300028380	Bacteria	11198
779	Ga0268265_10005792	3300028380	Bacteria	8430
780	Ga0268265_10203852	3300028380	Bacteria	1718
781	Ga0268264_10211702	3300028381	Bacteria	1780
782	Ga0307517_10001636	3300028786	Bacteria	37073
783	Ga0307517_10022200	3300028786	Bacteria	7965
784	Ga0307515_10000063	3300028794	Bacteria	245504
785	Ga0307515_10000131	3300028794	Bacteria	178919
786	Ga0307515_10000571	3300028794	Bacteria	86938
787	Ga0307515_10002612	3300028794	Bacteria	38796
788	Ga0307515_10003642	3300028794	Bacteria	32380
789	Ga0307515_10050976	3300028794	Bacteria	6184
790	Ga0307515_10056385	3300028794	Bacteria	5711
791	Ga0307515_10061224	3300028794	Bacteria	5346
792	Ga0307515_10152064	3300028794	Bacteria	2413
793	Ga0268256_1000556	3300030500	Bacteria	30238
794	Ga0268256_1000994	3300030500	Bacteria	19262
795	Ga0307511_10130206	3300030521	Bacteria	1519
796	Ga0307511_10144757	3300030521	Bacteria	1384
797	Ga0307512_10015675	3300030522	Bacteria	7015
798	Ga0314311_1121003	3300030733	Bacteria	3122
799	Ga0316178_1165952	3300030735	Bacteria	6031
800	Ga0316183_1068607	3300030742	Bacteria	2105
801	Ga0316181_1153552	3300030744	Bacteria	1500
802	Ga0316181_1164795	3300030744	Bacteria	2768
803	Ga0316181_1182049	3300030744	Bacteria	1925
804	Ga0265332_10000003	3300031238	Bacteria	482849
805	Ga0265328_10063012	3300031239	Bacteria	1361
806	Ga0265328_10091666	3300031239	Bacteria	1123
807	Ga0265331_10001261	3300031250	Bacteria	18968
808	Ga0265327_10036252	3300031251	Bacteria	2714
809	Ga0265316_10036438	3300031344	Bacteria	3978
810	Ga0307513_10008962	3300031456	Bacteria	12693
811	Ga0307513_10063632	3300031456	Bacteria	3892
812	Ga0307513_10174766	3300031456	Bacteria	2020
813	Ga0307513_10188955	3300031456	Bacteria	1914
814	Ga0307509_10000063	3300031507	Bacteria	143708
815	Ga0307509_10021582	3300031507	Bacteria	7276
816	Ga0307509_10119178	3300031507	Bacteria	2621
817	Ga0307509_10213796	3300031507	Bacteria	1750
818	Ga0307408_100000097	3300031548	Bacteria	96726
819	Ga0307408_100001348	3300031548	Bacteria	18399
820	Ga0307408_100003252	3300031548	Bacteria	11169
821	Ga0307408_100025350	3300031548	Bacteria	4061
822	Ga0265313_10000298	3300031595	Bacteria	53738
823	Ga0307508_10000004	3300031616	Bacteria	287547
824	Ga0307508_10003415	3300031616	Bacteria	16068
825	Ga0307508_10032149	3300031616	Bacteria	4741
826	Ga0307508_10091395	3300031616	Bacteria	2632
827	Ga0307508_10117185	3300031616	Bacteria	2264
828	Ga0307508_10157991	3300031616	Bacteria	1870
829	Ga0307508_10218890	3300031616	Bacteria	1504
830	Ga0307514_10000708	3300031649	Bacteria	57806
831	Ga0307514_10011676	3300031649	Bacteria	7305
832	Ga0307514_10042395	3300031649	Bacteria	3579
833	Ga0307514_10135016	3300031649	Bacteria	1690
834	Ga0307514_10216270	3300031649	Bacteria	1182
835	Ga0316579_10029402	3300031691	Bacteria	2508
836	Ga0316579_10100588	3300031691	Bacteria	1384
837	Ga0265314_10038986	3300031711	Bacteria	3427
838	Ga0265342_10101339	3300031712	Bacteria	1640
839	Ga0307516_10001976	3300031730	Bacteria	28078
840	Ga0307410_10075149	3300031852	Bacteria	2355
841	Ga0307410_10362628	3300031852	Bacteria	1161
842	Ga0307406_10202611	3300031901	Bacteria	1462
843	Ga0307412_10000005	3300031911	Bacteria	526194
844	Ga0307412_10014370	3300031911	Bacteria	4667
845	Ga0307412_10172723	3300031911	Bacteria	1617
846	Ga0307412_10270453	3300031911	Bacteria	1329
847	Ga0307412_10442538	3300031911	Bacteria	1068
848	Ga0307409_100102899	3300031995	Bacteria	2374
849	Ga0307416_100004376	3300032002	Bacteria	8507
850	Ga0307414_10040188	3300032004	Bacteria	3157
851	Ga0307411_10093285	3300032005	Bacteria	2107
852	Ga0307411_10337503	3300032005	Bacteria	1223
853	Ga0307507_10029203	3300033179	Bacteria	5853
854	Ga0307510_10032584	3300033180	Bacteria	5868
855	Ga0307510_10040540	3300033180	Bacteria	5110
856	Ga0307510_10133690	3300033180	Bacteria	2145
857	Ga0307510_10172987	3300033180	Bacteria	1735
858	Ga0316574_0008875	3300035398	Bacteria	5608
859	Ga0373924_0016442	3300035410	Bacteria	2824
860	Ga0373931_0002028	3300035691	Bacteria	8917
861	Ga0373931_0025830	3300035691	Bacteria	2984
862	Ga0373935_0043879	3300035692	Bacteria	2816
863	Ga0373927_0000147	3300035695	Bacteria	55399
864	Ga0373927_0160069	3300035695	Bacteria	1475
865	Ga0373937_0199651	3300036401	Bacteria	1880
866	Ga0373937_0243522	3300036401	Bacteria	1694
867	Ga0373937_0439907	3300036401	Bacteria	1238
868	Ga0316582_0077312	3300036647	Bacteria	2166
869	Ga0373925_0011078	3300037068	Bacteria	6549
870	Ga0373925_0061993	3300037068	Bacteria	2811
871	Ga0373925_0197610	3300037068	Bacteria	1598
872	Ga0395899_0069036	3300037312	Bacteria	2589
873	Ga0395900_0038014	3300037418	Bacteria	4963
874	Ga0395900_0059055	3300037418	Bacteria	3948
875	Ga0395898_0009730	3300037466	Bacteria	10081
876	Ga0395905_0000059	3300037471	Bacteria	198101
877	Ga0395905_0000249	3300037471	Bacteria	80584
878	Ga0395905_0002979	3300037471	Bacteria	18377
879	Ga0395905_0017642	3300037471	Bacteria	6775
880	Ga0395905_0038134	3300037471	Bacteria	4508
881	Ga0395905_0093216	3300037471	Bacteria	2824
882	Ga0395905_0136277	3300037471	Bacteria	2309
883	Ga0395905_0204596	3300037471	Bacteria	1850
884	Ga0436364_0007287	3300037853	Bacteria	16077
885	Ga0237819_02139	3300038705	Bacteria	4249
886	Ga0400485_13367	3300038735	Bacteria	1684
887	Ga0400483_072274	3300039062	Bacteria	5621
888	Ga0400483_213022	3300039062	Bacteria	7596
889	Ga0400483_217782	3300039062	Bacteria	2947
890	Ga0436365_0185891	3300039437	Bacteria	3038
891	Ga0436365_1723405	3300039437	Bacteria	2592
892	Ga0436361_0084387	3300039447	Bacteria	1429
893	Ga0436361_0089016	3300039447	Bacteria	1161
894	Ga0436361_0220501	3300039447	Bacteria	36098
895	Ga0436361_0509869	3300039447	Bacteria	7068
896	Ga0436361_0942191	3300039447	Bacteria	17343
897	Ga0436361_1204257	3300039447	Bacteria	1681
898	Ga0436361_1216391	3300039447	Bacteria	23695
899	Ga0439436_0000379	3300041404	Bacteria	11057
900	Ga0439438_023302	3300041405	Bacteria	1708
901	Ga0439438_034515	3300041405	Bacteria	1332
902	Ga0439447_003115	3300041407	Bacteria	5915
903	Ga0439447_004011	3300041407	Bacteria	5149
904	Ga0439447_006156	3300041407	Bacteria	3917
905	Ga0439447_010237	3300041407	Bacteria	2793
906	Ga0439447_019088	3300041407	Bacteria	1833
907	Ga0439466_0000709	3300041411	Bacteria	12580
908	Ga0439466_0000811	3300041411	Bacteria	11888
909	Ga0439466_0008675	3300041411	Bacteria	3830
910	Ga0439466_0013881	3300041411	Bacteria	2943
911	Ga0439466_0042803	3300041411	Bacteria	1506
912	Ga0439465_0050317	3300041413	Bacteria	1363
913	Ga0439465_0077282	3300041413	Bacteria	1123
914	Ga0451793_0219815	3300041452	Bacteria	1387
915	Ga0451804_0076240	3300041463	Bacteria	1336
916	Ga0451853_2791224	3300041512	Bacteria	1942
917	Ga0451853_3614585	3300041512	Bacteria	1730
918	Ga0439442_009796	3300042002	Bacteria	1938
919	Ga0439432_007416	3300042006	Bacteria	3888
920	Ga0439432_010965	3300042006	Bacteria	3126
921	Ga0439449_0023176	3300042007	Bacteria	2323
922	Ga0439451_010261	3300042009	Bacteria	1888
923	Ga0439451_010569	3300042009	Bacteria	1860
924	Ga0439451_020483	3300042009	Bacteria	1333
925	Ga0439452_000228	3300042010	Bacteria	39646
926	Ga0439452_022566	3300042010	Bacteria	1627
927	Ga0439452_033413	3300042010	Bacteria	1249
928	Ga0439456_000326	3300042013	Bacteria	10887
929	Ga0439456_024032	3300042013	Bacteria	1292
930	Ga0439463_000167	3300042016	Bacteria	17152
931	Ga0439463_016590	3300042016	Bacteria	1821
932	Ga0450923_004147	3300042125	Bacteria	2255
933	Ga0450890_006910	3300042127	Bacteria	1447
934	Ga0450904_000045	3300042139	Bacteria	27768
935	Ga0450906_002438	3300042145	Bacteria	4064
936	Ga0450906_008729	3300042145	Bacteria	1950
937	Ga0450907_000056	3300042146	Bacteria	44042
938	Ga0450907_003657	3300042146	Bacteria	2717
939	Ga0450910_013449	3300042147	Bacteria	1191
940	Ga0439446_0000087	3300042156	Bacteria	15432
941	Ga0439458_0019192	3300042157	Bacteria	1572
942	Ga0450908_005412	3300042184	Bacteria	2447
943	Ga0450909_013021	3300042185	Bacteria	1221
944	Ga0439460_0006798	3300042461	Bacteria	2846
945	Ga0450893_0023357	3300042532	Bacteria	1075
946	Ga0451577_0000068	3300042876	Bacteria	241923
947	Ga0451577_0004102	3300042876	Bacteria	15626
948	Ga0451577_0220059	3300042876	Bacteria	1716
949	Ga0439440_0003218	3300042993	Bacteria	3133
950	Ga0466969_0072845	3300044656	Bacteria	1649
951	Ga0466972_0011791	3300044658	Bacteria	4390
952	Ga0466978_0008643	3300044671	Bacteria	5420
953	Ga0466965_0009640	3300044683	Bacteria	4490
954	Ga0466965_0010921	3300044683	Bacteria	4247
955	Ga0466966_0266764	3300044684	Bacteria	1030
956	Ga0466961_0000187	3300044693	Bacteria	41670
957	Ga0466961_0000728	3300044693	Bacteria	20670
958	Ga0466961_0001099	3300044693	Bacteria	16615
959	Ga0466961_0010060	3300044693	Bacteria	6025
960	Ga0466961_0066408	3300044693	Bacteria	2291
961	Ga0466964_0013345	3300044706	Bacteria	3116
962	Ga0466964_0113655	3300044706	Bacteria	1211
963	Ga0453684_0000279	3300044712	Bacteria	220016
964	Ga0453684_0037004	3300044712	Bacteria	6708
965	Ga0453684_0143822	3300044712	Bacteria	2843
966	Ga0466971_0004905	3300044719	Bacteria	5786
967	Ga0466970_0001856	3300044765	Bacteria	10207
968	Ga0466970_0003617	3300044765	Bacteria	7536
969	Ga0466970_0006458	3300044765	Bacteria	5864
970	Ga0466970_0039891	3300044765	Bacteria	2492
971	Ga0466957_0084042	3300044842	Bacteria	1986
972	Ga0466959_0008736	3300045049	Bacteria	7173
973	Ga0466959_0013483	3300045049	Bacteria	5923
974	Ga0466959_0013619	3300045049	Bacteria	5898
975	Ga0466959_0043062	3300045049	Bacteria	3329
976	Ga0451576_0020743	3300045051	Bacteria	7152
977	Ga0451576_0057070	3300045051	Bacteria	4081
978	Ga0451576_0120107	3300045051	Bacteria	2736
979	Ga0451576_0242166	3300045051	Bacteria	1884
980	Ga0466958_0008779	3300045836	Bacteria	5613
981	Ga0466958_0022740	3300045836	Bacteria	3676
982	Ga0466958_0036011	3300045836	Bacteria	2960
983	Ga0466958_0069194	3300045836	Bacteria	2158
984	Ga0466967_0030232	3300045976	Bacteria	4543
985	Ga0495617_000307	3300046452	Bacteria	27630
986	Ga0495617_010311	3300046452	Bacteria	3199
987	Ga0495627_000130	3300046453	Bacteria	91090
988	Ga0495627_004801	3300046453	Bacteria	5584
989	Ga0495627_007559	3300046453	Bacteria	4155
990	Ga0495592_0013664	3300046454	Bacteria	6175
991	Ga0495592_0083803	3300046454	Bacteria	2301
992	Ga0495603_0000533	3300046455	Bacteria	21129
993	Ga0495603_0001445	3300046455	Bacteria	13824
994	Ga0495603_0007398	3300046455	Bacteria	6602
995	Ga0495603_0020266	3300046455	Bacteria	4031
996	Ga0495590_0007714	3300046457	Bacteria	4135
997	Ga0495590_0007748	3300046457	Bacteria	4125
998	Ga0495590_0009324	3300046457	Bacteria	3723
999	Ga0495590_0011614	3300046457	Bacteria	3289
1000	Ga0495590_0026088	3300046457	Bacteria	2052
1001	Ga0495591_000119	3300046458	Bacteria	87324
1002	Ga0495591_000264	3300046458	Bacteria	49787
1003	Ga0495591_000756	3300046458	Bacteria	23358
1004	Ga0495591_004015	3300046458	Bacteria	7363
1005	Ga0495591_006268	3300046458	Bacteria	5298
1006	Ga0495591_015514	3300046458	Bacteria	2688
1007	Ga0495591_028532	3300046458	Bacteria	1705
1008	Ga0495629_0000410	3300046459	Bacteria	35913
1009	Ga0495629_0000476	3300046459	Bacteria	33606
1010	Ga0495629_0000839	3300046459	Bacteria	24957
1011	Ga0495629_0003131	3300046459	Bacteria	12543
1012	Ga0495629_0005441	3300046459	Bacteria	9494
1013	Ga0495629_0032513	3300046459	Bacteria	3693
1014	Ga0495629_0051032	3300046459	Bacteria	2895
1015	Ga0495629_0054153	3300046459	Bacteria	2806
1016	Ga0495638_0007783	3300046460	Bacteria	7652
1017	Ga0495638_0009261	3300046460	Bacteria	6925
1018	Ga0495638_0015054	3300046460	Bacteria	5206
1019	Ga0495638_0015870	3300046460	Bacteria	5047
1020	Ga0495638_0043139	3300046460	Bacteria	2847
1021	Ga0495638_0085106	3300046460	Bacteria	1912
1022	Ga0495638_0110136	3300046460	Bacteria	1636
1023	Ga0495638_0120842	3300046460	Bacteria	1548
1024	Ga0495638_0165722	3300046460	Bacteria	1271
1025	Ga0495641_0040440	3300046461	Bacteria	2168
1026	Ga0495651_0002299	3300046462	Bacteria	14742
1027	Ga0495651_0032113	3300046462	Bacteria	4096
1028	Ga0495651_0050997	3300046462	Bacteria	3192
1029	Ga0495651_0070548	3300046462	Bacteria	2658
1030	Ga0495653_0003728	3300046463	Bacteria	12328
1031	Ga0495653_0004370	3300046463	Bacteria	11426
1032	Ga0495653_0005110	3300046463	Bacteria	10650
1033	Ga0495653_0009595	3300046463	Bacteria	7916
1034	Ga0495653_0011922	3300046463	Bacteria	7101
1035	Ga0495653_0069614	3300046463	Bacteria	2635
1036	Ga0495650_0000936	3300046471	Bacteria	33895
1037	Ga0495650_0001333	3300046471	Bacteria	24676
1038	Ga0495650_0001434	3300046471	Bacteria	23059
1039	Ga0495650_0014157	3300046471	Bacteria	4169
1040	Ga0495650_0018455	3300046471	Bacteria	3465
1041	Ga0495650_0034357	3300046471	Bacteria	2245
1042	Ga0495650_0035273	3300046471	Bacteria	2203
1043	Ga0495580_0000385	3300046472	Bacteria	36254
1044	Ga0495580_0001332	3300046472	Bacteria	21777
1045	Ga0495580_0001735	3300046472	Bacteria	19158
1046	Ga0495580_0002124	3300046472	Bacteria	17383
1047	Ga0495580_0002424	3300046472	Bacteria	16292
1048	Ga0495580_0014401	3300046472	Bacteria	5998
1049	Ga0495580_0021597	3300046472	Bacteria	4746
1050	Ga0495580_0112442	3300046472	Bacteria	1891
1051	Ga0495580_0160950	3300046472	Bacteria	1553
1052	Ga0495582_0003164	3300046473	Bacteria	9243
1053	Ga0495582_0013461	3300046473	Bacteria	4503
1054	Ga0495605_0000125	3300046474	Bacteria	101414
1055	Ga0495605_0000149	3300046474	Bacteria	90748
1056	Ga0495605_0000429	3300046474	Bacteria	38029
1057	Ga0495605_0004289	3300046474	Bacteria	8400
1058	Ga0495605_0005452	3300046474	Bacteria	7411
1059	Ga0495605_0005967	3300046474	Bacteria	7046
1060	Ga0495605_0012996	3300046474	Bacteria	4602
1061	Ga0495605_0041646	3300046474	Bacteria	2287
1062	Ga0495605_0091735	3300046474	Bacteria	1407
1063	Ga0495639_0005923	3300046475	Bacteria	5261
1064	Ga0495639_0046603	3300046475	Bacteria	1963
1065	Ga0495662_0028506	3300046476	Bacteria	2695
1066	Ga0495664_0001516	3300046477	Bacteria	12281
1067	Ga0495664_0015349	3300046477	Bacteria	4354
1068	Ga0495664_0018031	3300046477	Bacteria	4037
1069	Ga0495664_0021060	3300046477	Bacteria	3765
1070	Ga0495584_0001014	3300046491	Bacteria	17540
1071	Ga0495584_0004437	3300046491	Bacteria	7550
1072	Ga0495584_0008986	3300046491	Bacteria	5163
1073	Ga0495584_0046652	3300046491	Bacteria	2185
1074	Ga0495585_0000896	3300046492	Bacteria	25237
1075	Ga0495594_0000232	3300046499	Bacteria	27005
1076	Ga0495594_0044363	3300046499	Bacteria	2438
1077	Ga0495596_0000004	3300046500	Bacteria	163832
1078	Ga0495596_0002583	3300046500	Bacteria	9619
1079	Ga0495607_0000312	3300046501	Bacteria	50602
1080	Ga0495607_0000379	3300046501	Bacteria	45776
1081	Ga0495607_0000455	3300046501	Bacteria	40967
1082	Ga0495607_0000464	3300046501	Bacteria	40712
1083	Ga0495607_0000881	3300046501	Bacteria	27990
1084	Ga0495607_0001650	3300046501	Bacteria	19320
1085	Ga0495607_0004316	3300046501	Bacteria	10490
1086	Ga0495607_0004448	3300046501	Bacteria	10300
1087	Ga0495607_0009393	3300046501	Bacteria	6621
1088	Ga0495607_0016086	3300046501	Bacteria	4832
1089	Ga0495607_0031983	3300046501	Bacteria	3217
1090	Ga0495607_0054923	3300046501	Bacteria	2293
1091	Ga0495607_0101246	3300046501	Bacteria	1542
1092	Ga0495607_0127099	3300046501	Bacteria	1331
1093	Ga0495583_0000196	3300046506	Bacteria	101268
1094	Ga0495583_0000400	3300046506	Bacteria	65891
1095	Ga0495583_0000990	3300046506	Bacteria	32535
1096	Ga0495583_0001481	3300046506	Bacteria	23485
1097	Ga0495583_0002285	3300046506	Bacteria	16764
1098	Ga0495583_0002749	3300046506	Bacteria	14546
1099	Ga0495583_0003079	3300046506	Bacteria	13207
1100	Ga0495583_0005581	3300046506	Bacteria	8490
1101	Ga0495583_0006038	3300046506	Bacteria	8025
1102	Ga0495583_0010231	3300046506	Bacteria	5499
1103	Ga0495583_0010765	3300046506	Bacteria	5302
1104	Ga0495583_0020302	3300046506	Bacteria	3446
1105	Ga0495606_0000169	3300046507	Bacteria	115434
1106	Ga0495606_0000255	3300046507	Bacteria	93984
1107	Ga0495606_0000712	3300046507	Bacteria	51489
1108	Ga0495606_0001681	3300046507	Bacteria	28559
1109	Ga0495606_0005043	3300046507	Bacteria	12852
1110	Ga0495606_0035777	3300046507	Bacteria	3390
1111	Ga0495606_0038069	3300046507	Bacteria	3257
1112	Ga0495606_0043008	3300046507	Bacteria	3017
1113	Ga0495606_0057651	3300046507	Bacteria	2500
1114	Ga0495606_0103139	3300046507	Bacteria	1733
1115	Ga0495606_0140510	3300046507	Bacteria	1427
1116	Ga0495608_0001569	3300046511	Bacteria	16329
1117	Ga0495610_0002041	3300046512	Bacteria	17239
1118	Ga0495610_0021553	3300046512	Bacteria	3540
1119	Ga0495610_0025146	3300046512	Bacteria	3202
1120	Ga0495610_0025674	3300046512	Bacteria	3157
1121	Ga0495616_0012710	3300046513	Bacteria	4767
1122	Ga0495616_0017798	3300046513	Bacteria	3915
1123	Ga0495616_0019669	3300046513	Bacteria	3682
1124	Ga0495616_0028167	3300046513	Bacteria	2975
1125	Ga0495616_0104353	3300046513	Bacteria	1325
1126	Ga0495616_0129504	3300046513	Bacteria	1158
1127	Ga0495616_0129527	3300046513	Bacteria	1157
1128	Ga0495618_0002524	3300046514	Bacteria	11732
1129	Ga0495618_0009039	3300046514	Bacteria	6013
1130	Ga0495620_0000002	3300046515	Bacteria	373737
1131	Ga0495620_0000055	3300046515	Bacteria	99544
1132	Ga0495620_0001154	3300046515	Bacteria	16178
1133	Ga0495620_0001652	3300046515	Bacteria	13191
1134	Ga0495620_0002930	3300046515	Bacteria	9811
1135	Ga0495620_0022464	3300046515	Bacteria	3036
1136	Ga0495620_0087047	3300046515	Bacteria	1257
1137	Ga0495620_0127861	3300046515	Bacteria	998
1138	Ga0495628_0003520	3300046516	Bacteria	14012
1139	Ga0495628_0004273	3300046516	Bacteria	12702
1140	Ga0495628_0004598	3300046516	Bacteria	12200
1141	Ga0495628_0008836	3300046516	Bacteria	8620
1142	Ga0495628_0015011	3300046516	Bacteria	6472
1143	Ga0495628_0036103	3300046516	Bacteria	3969
1144	Ga0495630_0008991	3300046517	Bacteria	7174
1145	Ga0495630_0019995	3300046517	Bacteria	4930
1146	Ga0495630_0039481	3300046517	Bacteria	3528
1147	Ga0495630_0077636	3300046517	Bacteria	2503
1148	Ga0495631_0008485	3300046518	Bacteria	5179
1149	Ga0495632_0000807	3300046519	Bacteria	27730
1150	Ga0495632_0010531	3300046519	Bacteria	5464
1151	Ga0495632_0019607	3300046519	Bacteria	3679
1152	Ga0495632_0042859	3300046519	Bacteria	2266
1153	Ga0495637_0000162	3300046520	Bacteria	50983
1154	Ga0495637_0000231	3300046520	Bacteria	43247
1155	Ga0495637_0006414	3300046520	Bacteria	5904
1156	Ga0495637_0008558	3300046520	Bacteria	5022
1157	Ga0495637_0010082	3300046520	Bacteria	4584
1158	Ga0495637_0043337	3300046520	Bacteria	1921
1159	Ga0495643_0000975	3300046522	Bacteria	29344
1160	Ga0495643_0021268	3300046522	Bacteria	3724
1161	Ga0495643_0039452	3300046522	Bacteria	2582
1162	Ga0495643_0058275	3300046522	Bacteria	2055
1163	Ga0495643_0070690	3300046522	Bacteria	1832
1164	Ga0495644_0000341	3300046523	Bacteria	21235
1165	Ga0495644_0071082	3300046523	Bacteria	1308
1166	Ga0495648_0000984	3300046524	Bacteria	29405
1167	Ga0495648_0002651	3300046524	Bacteria	16219
1168	Ga0495648_0006586	3300046524	Bacteria	9443
1169	Ga0495648_0012701	3300046524	Bacteria	6262
1170	Ga0495648_0012970	3300046524	Bacteria	6186
1171	Ga0495648_0018479	3300046524	Bacteria	4931
1172	Ga0495648_0019219	3300046524	Bacteria	4812
1173	Ga0495648_0034451	3300046524	Bacteria	3294
1174	Ga0495648_0044874	3300046524	Bacteria	2755
1175	Ga0495648_0091083	3300046524	Bacteria	1707
1176	Ga0495648_0144532	3300046524	Bacteria	1248
1177	Ga0495666_0000170	3300046526	Bacteria	27460
1178	Ga0495666_0010921	3300046526	Bacteria	4528
1179	Ga0495666_0014864	3300046526	Bacteria	3873
1180	Ga0495666_0040353	3300046526	Bacteria	2263
1181	Ga0495642_0000027	3300046528	Bacteria	89620
1182	Ga0495642_0000055	3300046528	Bacteria	69106
1183	Ga0495642_0000139	3300046528	Bacteria	41862
1184	Ga0495642_0019048	3300046528	Bacteria	2688
1185	Ga0495652_0001431	3300046529	Bacteria	26455
1186	Ga0495652_0003179	3300046529	Bacteria	16373
1187	Ga0495652_0011308	3300046529	Bacteria	8075
1188	Ga0495652_0011555	3300046529	Bacteria	7979
1189	Ga0495652_0056488	3300046529	Bacteria	3333
1190	Ga0495652_0080568	3300046529	Bacteria	2688
1191	Ga0495652_0117053	3300046529	Bacteria	2132
1192	Ga0495654_0001596	3300046530	Bacteria	15374
1193	Ga0495654_0008893	3300046530	Bacteria	5522
1194	Ga0495654_0009508	3300046530	Bacteria	5328
1195	Ga0495654_0021695	3300046530	Bacteria	3340
1196	Ga0495654_0028385	3300046530	Bacteria	2861
1197	Ga0495665_0000432	3300046531	Bacteria	21347
1198	Ga0495665_0001567	3300046531	Bacteria	12211
1199	Ga0495665_0005206	3300046531	Bacteria	7009
1200	Ga0495665_0008500	3300046531	Bacteria	5573
1201	Ga0495665_0017601	3300046531	Bacteria	3843
1202	Ga0495640_0014649	3300046533	Bacteria	5923
1203	Ga0495640_0028142	3300046533	Bacteria	4048
1204	Ga0495586_0001425	3300046535	Bacteria	13229
1205	Ga0495586_0001656	3300046535	Bacteria	12231
1206	Ga0495587_0010421	3300046536	Bacteria	5917
1207	Ga0495587_0015992	3300046536	Bacteria	4669
1208	Ga0495609_0000087	3300046538	Bacteria	110204
1209	Ga0495609_0000174	3300046538	Bacteria	65959
1210	Ga0495609_0000213	3300046538	Bacteria	57790
1211	Ga0495609_0000307	3300046538	Bacteria	44197
1212	Ga0495609_0015073	3300046538	Bacteria	3622
1213	Ga0495609_0015687	3300046538	Bacteria	3542
1214	Ga0495609_0083384	3300046538	Bacteria	1395
1215	Ga0495621_0035077	3300046539	Bacteria	1736
1216	Ga0495597_0000097	3300046542	Bacteria	78347
1217	Ga0495597_0011814	3300046542	Bacteria	4227
1218	Ga0495597_0027163	3300046542	Bacteria	2625
1219	Ga0495597_0039085	3300046542	Bacteria	2125
1220	Ga0495597_0052622	3300046542	Bacteria	1792
1221	Ga0495597_0059175	3300046542	Bacteria	1673
1222	Ga0495645_0005409	3300046543	Bacteria	8757
1223	Ga0495645_0035211	3300046543	Bacteria	3650
1224	Ga0495645_0228103	3300046543	Bacteria	1249
1225	Ga0495622_0000302	3300046557	Bacteria	37049
1226	Ga0495622_0000485	3300046557	Bacteria	25046
1227	Ga0495622_0018033	3300046557	Bacteria	3287
1228	Ga0495622_0024340	3300046557	Bacteria	2827
1229	Ga0495622_0048571	3300046557	Bacteria	1971
1230	Ga0495622_0070369	3300046557	Bacteria	1615
1231	Ga0495633_0000134	3300046558	Bacteria	98658
1232	Ga0495633_0039832	3300046558	Bacteria	2241
1233	Ga0495633_0045478	3300046558	Bacteria	2078
1234	Ga0495667_0047962	3300046559	Bacteria	2821
1235	Ga0495656_0004367	3300046615	Bacteria	4836
1236	Ga0495668_0000135	3300046616	Bacteria	111827
1237	Ga0495668_0000940	3300046616	Bacteria	32529
1238	Ga0495668_0003531	3300046616	Bacteria	11645
1239	Ga0495668_0024043	3300046616	Bacteria	3467
1240	Ga0495668_0043840	3300046616	Bacteria	2486
1241	Ga0495668_0051226	3300046616	Bacteria	2286
1242	Ga0495668_0087225	3300046616	Bacteria	1711
1243	Ga0495634_0003130	3300046642	Bacteria	13432
1244	Ga0495634_0005291	3300046642	Bacteria	9965
1245	Ga0495634_0009676	3300046642	Bacteria	7095
1246	Ga0495634_0013241	3300046642	Bacteria	5963
1247	Ga0495634_0013785	3300046642	Bacteria	5837
1248	Ga0495611_0000256	3300046648	Bacteria	36807
1249	Ga0495611_0001001	3300046648	Bacteria	15022
1250	Ga0495611_0015343	3300046648	Bacteria	3275
1251	Ga0495611_0063371	3300046648	Bacteria	1682
1252	Ga0495625_0000145	3300046660	Bacteria	108480
1253	Ga0495625_0000292	3300046660	Bacteria	77369
1254	Ga0495625_0010212	3300046660	Bacteria	7789
1255	Ga0495625_0048247	3300046660	Bacteria	3067
1256	Ga0495625_0068649	3300046660	Bacteria	2491
1257	Ga0495625_0212010	3300046660	Bacteria	1273
1258	Ga0495635_0007554	3300046663	Bacteria	7584
1259	Ga0495635_0038525	3300046663	Bacteria	3309
1260	Ga0495635_0073019	3300046663	Bacteria	2350
1261	Ga0495635_0114713	3300046663	Bacteria	1839
1262	Ga0495659_0024666	3300046664	Bacteria	2052
1263	Ga0495661_0000127	3300046665	Bacteria	92684
1264	Ga0495661_0000193	3300046665	Bacteria	70300
1265	Ga0495661_0000306	3300046665	Bacteria	55899
1266	Ga0495661_0000608	3300046665	Bacteria	36516
1267	Ga0495661_0001372	3300046665	Bacteria	20563
1268	Ga0495661_0003433	3300046665	Bacteria	11694
1269	Ga0495661_0012242	3300046665	Bacteria	5794
1270	Ga0495661_0015559	3300046665	Bacteria	5076
1271	Ga0495661_0027752	3300046665	Bacteria	3630
1272	Ga0495661_0052899	3300046665	Bacteria	2444
1273	Ga0495657_0049442	3300046675	Bacteria	2832
1274	Ga0495599_0004015	3300046678	Bacteria	8666
1275	Ga0495599_0076000	3300046678	Bacteria	2097
1276	Ga0495623_0011656	3300046679	Bacteria	5695
1277	Ga0495623_0012575	3300046679	Bacteria	5477
1278	Ga0495623_0017335	3300046679	Bacteria	4653
1279	Ga0495623_0045997	3300046679	Bacteria	2770
1280	Ga0495623_0200357	3300046679	Bacteria	1148
1281	Ga0495646_0000533	3300046680	Bacteria	20404
1282	Ga0495646_0001277	3300046680	Bacteria	14817
1283	Ga0495646_0006647	3300046680	Bacteria	7332
1284	Ga0495646_0010111	3300046680	Bacteria	5999
1285	Ga0495646_0031218	3300046680	Bacteria	3321
1286	Ga0495646_0031952	3300046680	Bacteria	3278
1287	Ga0495646_0057643	3300046680	Bacteria	2324
1288	Ga0495647_0006114	3300046681	Bacteria	3970
1289	Ga0495658_0025447	3300046683	Bacteria	3163
1290	Ga0495658_0030636	3300046683	Bacteria	2923
1291	Ga0495669_0000670	3300046684	Bacteria	14894
1292	Ga0495613_0001037	3300046689	Bacteria	21189
1293	Ga0495613_0002040	3300046689	Bacteria	15344
1294	Ga0495624_0000466	3300046690	Bacteria	31707
1295	Ga0495624_0002908	3300046690	Bacteria	12810
1296	Ga0495624_0006386	3300046690	Bacteria	8366
1297	Ga0495624_0009023	3300046690	Bacteria	6930
1298	Ga0495624_0018455	3300046690	Bacteria	4666
1299	Ga0495624_0022361	3300046690	Bacteria	4182
1300	Ga0495624_0041736	3300046690	Bacteria	2933
1301	Ga0495624_0048787	3300046690	Bacteria	2685
1302	Ga0495624_0231651	3300046690	Bacteria	1119
1303	Ga0495670_0002630	3300046691	Bacteria	8864
1304	Ga0495670_0003687	3300046691	Bacteria	7528
1305	Ga0495670_0006261	3300046691	Bacteria	5839
1306	Ga0495670_0120826	3300046691	Bacteria	1360
1307	Ga0495671_0000569	3300046692	Bacteria	27538
1308	Ga0495671_0001596	3300046692	Bacteria	14973
1309	Ga0495671_0002517	3300046692	Bacteria	11534
1310	Ga0495671_0004348	3300046692	Bacteria	8502
1311	Ga0495671_0008415	3300046692	Bacteria	5806
1312	Ga0495671_0014785	3300046692	Bacteria	4193
1313	Ga0495671_0034235	3300046692	Bacteria	2584
1314	Ga0495671_0063190	3300046692	Bacteria	1823
1315	Ga0495649_0000288	3300046694	Bacteria	44617
1316	Ga0495649_0002121	3300046694	Bacteria	14221
1317	Ga0495649_0031290	3300046694	Bacteria	2935
1318	Ga0495649_0035367	3300046694	Bacteria	2747
1319	Ga0495649_0046869	3300046694	Bacteria	2352
1320	Ga0495649_0057580	3300046694	Bacteria	2095
1321	Ga0495589_0000720	3300046794	Bacteria	21405
1322	Ga0495589_0000913	3300046794	Bacteria	18138
1323	Ga0495589_0002553	3300046794	Bacteria	10128
1324	Ga0495589_0010749	3300046794	Bacteria	4757
1325	Ga0495589_0088261	3300046794	Bacteria	1506
1326	Ga0495600_0002213	3300046809	Bacteria	11056
1327	Ga0495600_0021694	3300046809	Bacteria	4117
1328	Ga0495660_0001305	3300046810	Bacteria	17241
1329	Ga0495660_0003345	3300046810	Bacteria	9947
1330	Ga0495660_0004982	3300046810	Bacteria	7994
1331	Ga0495660_0009735	3300046810	Bacteria	5600
1332	Ga0495660_0010224	3300046810	Bacteria	5456
1333	Ga0495660_0022443	3300046810	Bacteria	3604
1334	Ga0495660_0026284	3300046810	Bacteria	3300
1335	Ga0495660_0033540	3300046810	Bacteria	2878
1336	Ga0495581_0001458	3300047315	Bacteria	13153
1337	Ga0495581_0009182	3300047315	Bacteria	5720
1338	Ga0495581_0066673	3300047315	Bacteria	2081
1339	Ga0495604_0015642	3300047317	Bacteria	6056
1340	Ga0495604_0087504	3300047317	Bacteria	2320
1341	Ga0495636_0004287	3300047318	Bacteria	5598
1342	Ga0495674_0005364	3300047319	Bacteria	12304
1343	Ga0495674_0009410	3300047319	Bacteria	9283
1344	Ga0495674_0010002	3300047319	Bacteria	8987
1345	Ga0495674_0029218	3300047319	Bacteria	5022
1346	Ga0495674_0050249	3300047319	Bacteria	3680
1347	Ga0495674_0085795	3300047319	Bacteria	2696
1348	Ga0495674_0319735	3300047319	Bacteria	1264
1349	Ga0495672_0013200	3300047320	Bacteria	5711
1350	Ga0495672_0020399	3300047320	Bacteria	4346
1351	Ga0495672_0024349	3300047320	Bacteria	3901
1352	Ga0495672_0032506	3300047320	Bacteria	3245
1353	Ga0495672_0111481	3300047320	Bacteria	1467
1354	Ga0495676_0000119	3300047321	Bacteria	60424
1355	Ga0495676_0002532	3300047321	Bacteria	16256
1356	Ga0495676_0021549	3300047321	Bacteria	5624
1357	Ga0495676_0037186	3300047321	Bacteria	4055
1358	Ga0495676_0049955	3300047321	Bacteria	3358
1359	Ga0495676_0089004	3300047321	Bacteria	2313
1360	Ga0495680_0002385	3300047322	Bacteria	19258
1361	Ga0495680_0002420	3300047322	Bacteria	19092
1362	Ga0495680_0003442	3300047322	Bacteria	15610
1363	Ga0495680_0009746	3300047322	Bacteria	8617
1364	Ga0495680_0049542	3300047322	Bacteria	3290
1365	Ga0495680_0069442	3300047322	Bacteria	2688
1366	Ga0495683_0000018	3300047323	Bacteria	185871
1367	Ga0495683_0000095	3300047323	Bacteria	89824
1368	Ga0495683_0000217	3300047323	Bacteria	54243
1369	Ga0495683_0000754	3300047323	Bacteria	23376
1370	Ga0495683_0004031	3300047323	Bacteria	8433
1371	Ga0495683_0005383	3300047323	Bacteria	7104
1372	Ga0495683_0023404	3300047323	Bacteria	3175
1373	Ga0495683_0042536	3300047323	Bacteria	2290
1374	Ga0495683_0073094	3300047323	Bacteria	1682
1375	Ga0495683_0099618	3300047323	Bacteria	1398
1376	Ga0495683_0121111	3300047323	Bacteria	1241
1377	Ga0495683_0149693	3300047323	Bacteria	1087
1378	Ga0495687_000131	3300047443	Bacteria	114820
1379	Ga0495687_000594	3300047443	Bacteria	42250
1380	Ga0495687_006178	3300047443	Bacteria	7403
1381	Ga0495687_021706	3300047443	Bacteria	3099
1382	Ga0495687_022198	3300047443	Bacteria	3052
1383	Ga0495687_024981	3300047443	Bacteria	2831
1384	Ga0495687_061358	3300047443	Bacteria	1546
1385	Ga0495687_098664	3300047443	Bacteria	1101
1386	Ga0495675_0003888	3300047444	Bacteria	9057
1387	Ga0495675_0005599	3300047444	Bacteria	7668
1388	Ga0495675_0009915	3300047444	Bacteria	5938
1389	Ga0495675_0025559	3300047444	Bacteria	3764
1390	Ga0495677_0016913	3300047445	Bacteria	2645
1391	Ga0495679_000050	3300047446	Bacteria	125325
1392	Ga0495679_000267	3300047446	Bacteria	43569
1393	Ga0495679_000379	3300047446	Bacteria	34084
1394	Ga0495679_000683	3300047446	Bacteria	22224
1395	Ga0495679_000723	3300047446	Bacteria	21247
1396	Ga0495679_009879	3300047446	Bacteria	3785
1397	Ga0495679_012191	3300047446	Bacteria	3281
1398	Ga0495673_0001123	3300047469	Bacteria	22938
1399	Ga0495673_0001165	3300047469	Bacteria	22250
1400	Ga0495673_0001214	3300047469	Bacteria	21441
1401	Ga0495673_0004618	3300047469	Bacteria	8571
1402	Ga0495673_0006889	3300047469	Bacteria	6623
1403	Ga0495673_0008791	3300047469	Bacteria	5640
1404	Ga0495673_0012788	3300047469	Bacteria	4431
1405	Ga0495673_0052869	3300047469	Bacteria	1773
1406	Ga0495681_0000961	3300047470	Bacteria	22061
1407	Ga0495681_0001069	3300047470	Bacteria	20882
1408	Ga0495681_0004354	3300047470	Bacteria	9684
1409	Ga0495681_0014766	3300047470	Bacteria	4457
1410	Ga0495681_0025087	3300047470	Bacteria	3124
1411	Ga0495684_0070278	3300047471	Bacteria	2662
1412	Ga0495686_0000021	3300047472	Bacteria	426560
1413	Ga0495686_0010831	3300047472	Bacteria	6463
1414	Ga0495686_0025907	3300047472	Bacteria	3840
1415	Ga0495593_0000534	3300047673	Bacteria	21558
1416	Ga0495593_0003089	3300047673	Bacteria	10013
1417	Ga0495593_0007015	3300047673	Bacteria	6606
1418	Ga0495593_0023507	3300047673	Bacteria	3426
1419	Ga0495593_0040854	3300047673	Bacteria	2496
1420	Ga0495593_0062199	3300047673	Bacteria	1951
1421	Ga0495602_0001009	3300048088	Bacteria	27355
1422	Ga0495602_0008243	3300048088	Bacteria	10882
1423	Ga0495602_0012477	3300048088	Bacteria	8731
1424	Ga0495602_0024476	3300048088	Bacteria	5856
1425	Ga0495602_0080537	3300048088	Bacteria	2742
1426	Ga0495614_0000824	3300048089	Bacteria	13094
1427	Ga0495614_0025861	3300048089	Bacteria	2530
1428	Ga0495614_0028745	3300048089	Bacteria	2393
1429	Ga0495626_0000172	3300048091	Bacteria	79971
1430	Ga0495626_0000259	3300048091	Bacteria	60592
1431	Ga0495626_0000263	3300048091	Bacteria	59779
1432	Ga0495626_0002323	3300048091	Bacteria	13435
1433	Ga0495626_0003152	3300048091	Bacteria	10775
1434	Ga0495626_0008706	3300048091	Bacteria	5530
1435	Ga0495626_0031725	3300048091	Bacteria	2541
1436	Ga0495626_0032200	3300048091	Bacteria	2519
1437	Ga0495626_0039942	3300048091	Bacteria	2218
1438	Ga0495626_0051941	3300048091	Bacteria	1890
1439	Ga0496100_0168208	3300048903	Bacteria	1576
1440	Ga0496101_0001774	3300048904	Bacteria	12961
1441	Ga0496101_0012857	3300048904	Bacteria	5599
1442	Ga0496101_0017591	3300048904	Bacteria	4849
1443	Ga0496102_0007255	3300048905	Bacteria	9462
1444	Ga0496102_0013301	3300048905	Bacteria	7127
1445	Ga0496102_0027150	3300048905	Bacteria	5113
1446	Ga0496102_0260184	3300048905	Bacteria	1636
1447	Ga0496103_0014669	3300048906	Bacteria	4656
1448	Ga0496103_0128637	3300048906	Bacteria	1616
1449	Ga0496104_0059811	3300048907	Bacteria	3608
1450	Ga0496104_0069291	3300048907	Bacteria	3352
1451	Ga0496105_0007454	3300048908	Bacteria	8470
1452	Ga0496105_0007469	3300048908	Bacteria	8462
1453	Ga0496105_0032353	3300048908	Bacteria	4291
1454	Ga0496105_0086944	3300048908	Bacteria	2583
1455	Ga0496105_0123894	3300048908	Bacteria	2130
1456	Ga0496106_0011680	3300048909	Bacteria	6487
1457	Ga0496106_0138058	3300048909	Bacteria	1916
1458	Ga0496106_0254621	3300048909	Bacteria	1404
1459	Ga0496107_0027107	3300048910	Bacteria	4068
1460	Ga0496107_0032918	3300048910	Bacteria	3707
1461	Ga0496107_0034705	3300048910	Bacteria	3614
1462	Ga0496107_0063271	3300048910	Bacteria	2681
1463	Ga0496107_0136846	3300048910	Bacteria	1810
1464	Ga0496107_0215006	3300048910	Bacteria	1430
1465	Ga0496108_0050158	3300048911	Bacteria	3493
1466	Ga0496108_0109992	3300048911	Bacteria	2356
1467	Ga0496110_0002740	3300048913	Bacteria	13305
1468	Ga0496110_0029211	3300048913	Bacteria	4742
1469	Ga0496110_0164469	3300048913	Bacteria	2012
1470	Ga0496110_0241380	3300048913	Bacteria	1644
1471	Ga0496111_0045142	3300048914	Bacteria	3170
1472	Ga0496112_0002167	3300048915	Bacteria	15599
1473	Ga0496112_0013918	3300048915	Bacteria	7442
1474	Ga0496112_0018750	3300048915	Bacteria	6521
1475	Ga0496113_0015300	3300048916	Bacteria	5269
1476	Ga0496114_0004974	3300048917	Bacteria	10369
1477	Ga0496114_0005954	3300048917	Bacteria	9588
1478	Ga0496114_0024018	3300048917	Bacteria	4974
1479	Ga0496114_0472926	3300048917	Bacteria	1109
1480	Ga0496115_0260938	3300048918	Bacteria	1425
1481	Ga0496116_0000085	3300048919	Bacteria	219553
1482	Ga0496116_0190590	3300048919	Bacteria	1086
1483	Ga0496117_0000332	3300048920	Bacteria	83405
1484	Ga0496117_0004030	3300048920	Bacteria	16547
1485	Ga0496117_0004751	3300048920	Bacteria	14749
1486	Ga0496117_0017724	3300048920	Bacteria	5938
1487	Ga0496117_0022270	3300048920	Bacteria	5087
1488	Ga0496118_0001261	3300048921	Bacteria	38807
1489	Ga0496118_0006078	3300048921	Bacteria	13436
1490	Ga0496118_0020229	3300048921	Bacteria	5910
1491	Ga0496118_0034178	3300048921	Bacteria	4154
1492	Ga0496118_0035949	3300048921	Bacteria	4013
1493	Ga0496118_0044026	3300048921	Bacteria	3499
1494	Ga0496118_0084974	3300048921	Bacteria	2206
1495	Ga0496118_0129642	3300048921	Bacteria	1623
1496	Ga0496118_0144815	3300048921	Bacteria	1498
1497	Ga0496118_0159288	3300048921	Bacteria	1399
1498	Ga0496119_0001099	3300048922	Bacteria	34061
1499	Ga0496119_0001480	3300048922	Bacteria	28141
1500	Ga0496119_0047980	3300048922	Bacteria	2652
1501	Ga0496120_0000052	3300048923	Bacteria	186071
1502	Ga0496120_0000137	3300048923	Bacteria	123518
1503	Ga0496120_0068678	3300048923	Bacteria	1954
1504	Ga0496121_0000102	3300048924	Bacteria	195341
1505	Ga0496121_0000179	3300048924	Bacteria	141214
1506	Ga0496121_0000858	3300048924	Bacteria	55007
1507	Ga0496121_0003434	3300048924	Bacteria	22636
1508	Ga0496121_0004169	3300048924	Bacteria	19761
1509	Ga0496121_0007246	3300048924	Bacteria	13425
1510	Ga0496121_0009096	3300048924	Bacteria	11496
1511	Ga0496121_0012751	3300048924	Bacteria	9107
1512	Ga0496121_0016995	3300048924	Bacteria	7468
1513	Ga0496121_0020733	3300048924	Bacteria	6482
1514	Ga0496121_0036214	3300048924	Bacteria	4401
1515	Ga0496121_0181314	3300048924	Bacteria	1519
1516	Ga0496121_0181489	3300048924	Bacteria	1518
1517	Ga0496122_0000324	3300048925	Bacteria	104220
1518	Ga0496122_0003009	3300048925	Bacteria	22888
1519	Ga0496122_0003551	3300048925	Bacteria	20396
1520	Ga0496122_0012647	3300048925	Bacteria	8369
1521	Ga0496122_0058150	3300048925	Bacteria	2865
1522	Ga0496122_0080037	3300048925	Bacteria	2280
1523	Ga0496123_0000550	3300048926	Bacteria	64267
1524	Ga0496123_0008278	3300048926	Bacteria	9579
1525	Ga0496123_0013187	3300048926	Bacteria	6966
1526	Ga0496123_0016377	3300048926	Bacteria	6024
1527	Ga0496123_0018139	3300048926	Bacteria	5619
1528	Ga0496123_0065502	3300048926	Bacteria	2309
1529	Ga0496124_0000017	3300048927	Bacteria	444389
1530	Ga0496124_0000355	3300048927	Bacteria	83748
1531	Ga0496124_0000772	3300048927	Bacteria	52180
1532	Ga0496124_0007064	3300048927	Bacteria	12028
1533	Ga0496124_0018474	3300048927	Bacteria	6528
1534	Ga0496124_0022061	3300048927	Bacteria	5848
1535	Ga0496124_0032733	3300048927	Bacteria	4585
1536	Ga0496124_0112314	3300048927	Bacteria	2191
1537	Ga0496124_0167730	3300048927	Bacteria	1704
1538	Ga0496124_0237029	3300048927	Bacteria	1359
1539	Ga0496124_0242636	3300048927	Bacteria	1339
1540	Ga0496124_0247335	3300048927	Bacteria	1321
1541	Ga0496125_0001171	3300048928	Bacteria	39699
1542	Ga0496125_0015408	3300048928	Bacteria	7398
1543	Ga0496125_0020562	3300048928	Bacteria	6193
1544	Ga0496125_0022409	3300048928	Bacteria	5867
1545	Ga0496125_0024444	3300048928	Bacteria	5556
1546	Ga0496125_0036147	3300048928	Bacteria	4318
1547	Ga0496125_0045699	3300048928	Bacteria	3681
1548	Ga0496125_0051308	3300048928	Bacteria	3403
1549	Ga0496125_0131881	3300048928	Bacteria	1757
1550	Ga0496126_0000400	3300048929	Bacteria	88670
1551	Ga0496126_0001236	3300048929	Bacteria	41467
1552	Ga0496126_0007689	3300048929	Bacteria	11765
1553	Ga0496126_0257462	3300048929	Bacteria	1452
1554	Ga0495678_000108	3300049459	Bacteria	99839
1555	Ga0495678_000338	3300049459	Bacteria	49205
1556	Ga0495678_002574	3300049459	Bacteria	12142
1557	Ga0495678_005524	3300049459	Bacteria	6954
1558	Ga0495678_052195	3300049459	Bacteria	1575
1559	Ga0495678_064808	3300049459	Bacteria	1359
1560	Ga0495682_0000050	3300049460	Bacteria	110280
1561	Ga0495682_0000170	3300049460	Bacteria	55005
1562	Ga0495682_0035408	3300049460	Bacteria	1839
1563	Ga0495682_0041268	3300049460	Bacteria	1691
1564	Ga0501031_0162388	3300049568	Bacteria	1460
1565	Ga0501032_0040856	3300049569	Bacteria	3151
1566	Ga0501033_0028046	3300049570	Bacteria	4231
1567	Ga0501034_0000041	3300049571	Bacteria	229264
1568	Ga0501034_0056941	3300049571	Bacteria	3931
1569	Ga0501034_0172972	3300049571	Bacteria	2126
1570	Ga0501034_0314736	3300049571	Bacteria	1499
1571	Ga0501036_0005769	3300049572	Bacteria	10036
1572	Ga0501036_0176508	3300049572	Bacteria	1799
1573	Ga0501038_0005617	3300049574	Bacteria	11639
1574	Ga0501038_0193281	3300049574	Bacteria	1636
1575	Ga0501043_0000072	3300049579	Bacteria	89021
1576	Ga0501043_0025772	3300049579	Bacteria	4612
1577	Ga0501046_0000112	3300049580	Bacteria	86313
1578	Ga0501046_0004385	3300049580	Bacteria	12826
1579	Ga0501046_0070855	3300049580	Bacteria	2710
1580	Ga0501047_0000138	3300049581	Bacteria	89028
1581	Ga0501048_0001412	3300049582	Bacteria	18171
1582	Ga0501048_0105898	3300049582	Bacteria	1985
1583	Ga0501067_0065009	3300049583	Bacteria	2019
1584	Ga0501070_0020731	3300049586	Bacteria	5513
1585	Ga0501070_0155986	3300049586	Bacteria	1882
1586	Ga0501070_0183962	3300049586	Bacteria	1719
1587	Ga0501072_0018052	3300049588	Bacteria	5425
1588	Ga0501072_0356181	3300049588	Bacteria	1162
1589	Ga0501073_0029261	3300049589	Bacteria	3936
1590	Ga0501073_0033119	3300049589	Bacteria	3681
1591	Ga0501074_0013567	3300049590	Bacteria	5923
1592	Ga0501077_0139209	3300049593	Bacteria	1539
1593	Ga0501080_0007238	3300049742	Bacteria	10016
1594	Ga0501080_0072221	3300049742	Bacteria	3211
1595	Ga0501081_0014703	3300049743	Bacteria	5163
1596	Ga0501083_0005249	3300049744	Bacteria	9161
1597	Ga0501083_0027219	3300049744	Bacteria	3946
1598	Ga0501083_0227142	3300049744	Bacteria	1216
1599	Ga0501241_024843	3300049758	Bacteria	1114
1600	Ga0501262_000009	3300049759	Bacteria	32874
1601	Ga0501035_0055675	3300049822	Bacteria	3530
1602	Ga0501035_0348896	3300049822	Bacteria	1239
1603	Ga0501044_0001940	3300049823	Bacteria	23930
1604	Ga0501044_0018348	3300049823	Bacteria	7498
1605	Ga0501044_0073114	3300049823	Bacteria	3485
1606	Ga0501044_0080171	3300049823	Bacteria	3307
1607	Ga0501044_0134060	3300049823	Bacteria	2469
1608	Ga0501045_0008786	3300049824	Bacteria	7052
1609	nmdc:mga03683_10444_c1	3300050489	Bacteria	3330
1610	nmdc:mga03683_110631_c1	3300050489	Bacteria	1214
1611	nmdc:mga03683_1938_c1	3300050489	Bacteria	6330
1612	nmdc:mga03683_5647_c1	3300050489	Bacteria	4236
1613	nmdc:mga03n38_120272_c1	3300050490	Bacteria	1290
1614	nmdc:mga03n38_16956_c1	3300050490	Bacteria	2844
1615	nmdc:mga00v17_189982_c1	3300050491	Bacteria	1326
1616	nmdc:mga00v17_90108_c1	3300050491	Bacteria	1925
1617	nmdc:mga0k408_2639_c1	3300050493	Bacteria	5869
1618	nmdc:mga0k408_39408_c1	3300050493	Bacteria	2715
1619	nmdc:mga0k408_426_c2	3300050493	Bacteria	9284
1620	nmdc:mga0k408_45758_c1	3300050493	Bacteria	2526
1621	nmdc:mga0k408_460_c1	3300050493	Bacteria	22325
1622	nmdc:mga0k408_5960_c1	3300050493	Bacteria	6505
1623	nmdc:mga0k408_79184_c1	3300050493	Bacteria	1923
1624	nmdc:mga0k408_8135_c1	3300050493	Bacteria	5620
1625	nmdc:mga0k408_9093_c1	3300050493	Bacteria	5349
1626	nmdc:mga06z11_14628_c1	3300050494	Bacteria	3481
1627	nmdc:mga06z11_43890_c1	3300050494	Bacteria	2252
1628	nmdc:mga07m45_171_c2	3300050496	Bacteria	24206
1629	nmdc:mga07m45_18310_c1	3300050496	Bacteria	3778
1630	nmdc:mga07m45_204_c1	3300050496	Bacteria	23423
1631	nmdc:mga07m45_23682_c1	3300050496	Bacteria	3358
1632	nmdc:mga07m45_5769_c1	3300050496	Bacteria	6199
1633	nmdc:mga05p37_361848_c1	3300050507	Bacteria	1705
1634	nmdc:mga09592_254022_c1	3300050508	Bacteria	1524
1635	nmdc:mga0qj67_213447_c1	3300050509	Bacteria	1567
1636	nmdc:mga0qj67_56324_c1	3300050509	Bacteria	3116
1637	nmdc:mga06r32_10081_c1	3300050510	Bacteria	8532
1638	nmdc:mga06r32_253151_c1	3300050510	Bacteria	1749
1639	nmdc:mga08y16_283_c1	3300050511	Bacteria	46126
1640	nmdc:mga08y16_317862_c1	3300050511	Bacteria	1603
1641	nmdc:mga0sz30_2070_c1	3300050516	Bacteria	6869
1642	nmdc:mga0sz30_91813_c1	3300050516	Bacteria	1321
1643	Ga0495612_0055479	3300053078	Bacteria	1634
1644	Ga0500610_0002019	3300053079	Bacteria	7265
1645	Ga0500610_0002652	3300053079	Bacteria	6656
1646	Ga0500578_0000719	3300053086	Bacteria	39279
1647	Ga0500651_0003767	3300053093	Bacteria	8359
1648	Ga0500651_0157477	3300053093	Bacteria	1360
1649	Ga0500641_0101829	3300053096	Bacteria	1232
1650	Ga0500571_003409	3300053110	Bacteria	8152
1651	Ga0500593_006856	3300053117	Bacteria	4588
1652	Ga0500594_0009443	3300053118	Bacteria	2246
1653	Ga0500594_0026071	3300053118	Bacteria	1503
1654	Ga0500595_000045	3300053119	Bacteria	90834
1655	Ga0500595_000392	3300053119	Bacteria	28126
1656	Ga0500607_000040	3300053121	Bacteria	85325
1657	Ga0500618_007176	3300053125	Bacteria	3203
1658	Ga0500626_049160	3300053128	Bacteria	1900
1659	Ga0500642_0000487	3300053130	Bacteria	12233
1660	Ga0500652_000362	3300053131	Bacteria	16330
1661	Ga0500655_005931	3300053133	Bacteria	2200
1662	Ga0500658_0000179	3300053134	Bacteria	30449
1663	Ga0500658_0005813	3300053134	Bacteria	4595
1664	Ga0500658_0056682	3300053134	Bacteria	1617
1665	Ga0500659_0000462	3300053135	Bacteria	26341
1666	Ga0500559_0000407	3300053136	Bacteria	30942
1667	Ga0500559_0004199	3300053136	Bacteria	6904
1668	Ga0500559_0014084	3300053136	Bacteria	3381
1669	Ga0500568_0001521	3300053139	Bacteria	14782
1670	Ga0500568_0009247	3300053139	Bacteria	4697
1671	Ga0500568_0020026	3300053139	Bacteria	2901
1672	Ga0500568_0024164	3300053139	Bacteria	2576
1673	Ga0500568_0043597	3300053139	Bacteria	1792
1674	Ga0500574_001145	3300053141	Bacteria	3799
1675	Ga0500604_0004857	3300053151	Bacteria	3563
1676	Ga0500604_0033766	3300053151	Bacteria	1514
1677	Ga0500616_0002061	3300053153	Bacteria	17612
1678	Ga0500622_0000262	3300053156	Bacteria	53796
1679	Ga0500622_0003164	3300053156	Bacteria	11262
1680	Ga0500627_0010431	3300053158	Bacteria	3389
1681	Ga0500634_0020089	3300053161	Bacteria	3607
1682	Ga0500634_0083769	3300053161	Bacteria	1636
1683	Ga0500638_020068	3300053162	Bacteria	3141
1684	Ga0501084_0012515	3300054114	Bacteria	7027
1685	Ga0590071_001548	3300059421	Bacteria	6016
1686	Ga0501082_0007663	3300060353	Bacteria	9317
1687	Ga0501082_0058056	3300060353	Bacteria	3334
1688	Ga0501082_0184430	3300060353	Bacteria	1815
1689	Ga0501082_0211555	3300060353	Bacteria	1687
1690	Ga0466962_0001386	3300061719	Bacteria	11251
1691	Ga0466962_0008339	3300061719	Bacteria	4966
1692	2501072335	2501025501	Bacteria	7768574
1693	2501079962	2501025502	Bacteria	9641094
1694	2501083628	2501025502	Bacteria	9641094
1695	2501412345	2501025504	Bacteria	8008976
1696	2509127562	2508501125	Bacteria	7208311
1697	2510284978	2510065053	Bacteria	5005518
1698	2510294190	2510065055	Bacteria	5037935
1699	2510313217	2510065058	Bacteria	5005894
1700	2511087541	2510917013	Bacteria	9951648
1701	2511087849	2510917013	Bacteria	9951648
1702	2511101519	2510917014	Bacteria	8296963
1703	2511107878	2510917015	Bacteria	7950052
1704	2511247557	2511231003	Bacteria	5606035
1705	2511257210	2511231004	Bacteria	6669789
1706	2511263038	2511231006	Bacteria	6794709
1707	2511274853	2511231007	Bacteria	6306603
1708	2511277973	2511231008	Bacteria	6624100
1709	2511291089	2511231010	Bacteria	6373152
1710	2511294526	2511231011	Bacteria	6149768
1711	2511300499	2511231012	Bacteria	6738011
1712	2511312986	2511231014	Bacteria	6462302
1713	2511323096	2511231015	Bacteria	6598026
1714	2511328577	2511231016	Bacteria	6704427
1715	2511332068	2511231017	Bacteria	6503007
1716	2511336124	2511231018	Bacteria	6436256
1717	2511341006	2511231018	Bacteria	6436256
1718	2511345071	2511231019	Bacteria	6520662
1719	2511348530	2511231020	Bacteria	6115223
1720	2511356974	2511231021	Bacteria	7302637
1721	2511362210	2511231022	Bacteria	6719296
1722	2511371450	2511231023	Bacteria	6808468
1723	2511373459	2511231024	Bacteria	5835885
1724	2511385367	2511231026	Bacteria	5225445
1725	2511823493	2511231156	Bacteria	6845832
1726	2512325015	2512047018	Bacteria	6663241
1727	2513226491	2513020051	Bacteria	6053213
1728	2513552987	2513237082	Bacteria	8640282
1729	2513559838	2513237083	Bacteria	8410967
1730	2513960362	2513237151	Bacteria	6309801
1731	2514053975	2513237166	Bacteria	10373764
1732	2515690003	2515154123	Bacteria	6387382
1733	2516018156	2515154189	Bacteria	9629850
1734	2516022850	2515154189	Bacteria	9629850
1735	2527076931	2526164713	Bacteria	6780608
1736	2547374546	2547132103	Bacteria	5115736
1737	2553002784	2551306416	Bacteria	6152985
1738	2554816312	2554235132	Bacteria	6772433
1739	2555246132	2554235231	Bacteria	5215788
1740	2555668552	2554235341	Bacteria	6867980
1741	2563059420	2562617112	Bacteria	10918404
1742	2583791139	2582580891	Bacteria	6800976
1743	2585295702	2582581311	Bacteria	6763856
1744	2587733102	2585428058	Bacteria	6853932
1745	2597856716	2597489887	Bacteria	6666321
1746	2597865202	2597489888	Bacteria	6179543
1747	2597871062	2597489889	Bacteria	6297495
1748	2599356924	2599185160	Bacteria	6844013
1749	2599362289	2599185161	Bacteria	6960462
1750	2599368609	2599185162	Bacteria	6957254
1751	2599375398	2599185163	Bacteria	6995158
1752	2599382029	2599185164	Bacteria	6841688
1753	2599388476	2599185165	Bacteria	6843250
1754	2599394256	2599185166	Bacteria	6959206
1755	2599400334	2599185167	Bacteria	6353609
1756	2599406021	2599185168	Bacteria	6997636
1757	2599451335	2599185179	Bacteria	6611171
1758	2599464571	2599185181	Bacteria	6844519
1759	2599468895	2599185182	Bacteria	6883168
1760	2599483739	2599185185	Bacteria	6652270
1761	2599493594	2599185186	Bacteria	6831633
1762	2599503982	2599185188	Bacteria	6164180
1763	2599508650	2599185189	Bacteria	5862825
1764	2599512509	2599185190	Bacteria	6285678
1765	2599519858	2599185191	Bacteria	6297582
1766	2599616383	2599185212	Bacteria	6765997
1767	2599626138	2599185214	Bacteria	8209958
1768	2599675777	2599185226	Bacteria	8233575
1769	2599682339	2599185227	Bacteria	8246414
1770	2599695990	2599185229	Bacteria	8216126
1771	2599736024	2599185239	Bacteria	8686614
1772	2599740677	2599185239	Bacteria	8686614
1773	2599748316	2599185240	Bacteria	7968121
1774	2599772689	2599185248	Bacteria	6696816
1775	2599801385	2599185257	Bacteria	6492581
1776	2599878541	2599185288	Bacteria	6666191
1777	2599887721	2599185289	Bacteria	6778765
1778	2599891185	2599185290	Bacteria	6289611
1779	2599901981	2599185291	Bacteria	6775623
1780	2599931944	2599185300	Bacteria	6062622
1781	2599946369	2599185302	Bacteria	5954930
1782	2599947744	2599185303	Bacteria	6512725
1783	2599957637	2599185304	Bacteria	5951361
1784	2599963766	2599185305	Bacteria	6748700
1785	2599965286	2599185306	Bacteria	6637356
1786	2599972839	2599185307	Bacteria	6194719
1787	2599978832	2599185308	Bacteria	6621546
1788	2599986870	2599185309	Bacteria	5969593
1789	2599992267	2599185310	Bacteria	6014457
1790	2599997966	2599185311	Bacteria	6354990
1791	2600003252	2599185312	Bacteria	5912071
1792	2600006931	2599185313	Bacteria	6658188
1793	2600010518	2599185314	Bacteria	6621749
1794	2600021478	2599185315	Bacteria	6771107
1795	2600027043	2599185316	Bacteria	6320029
1796	2600030295	2599185317	Bacteria	6435722
1797	2600036275	2599185318	Bacteria	6961590
1798	2600045222	2599185319	Bacteria	6637840
1799	2600050644	2599185320	Bacteria	5963263
1800	2600056562	2599185321	Bacteria	6764560
1801	2600061374	2599185322	Bacteria	6763055
1802	2600065029	2599185323	Bacteria	6688755
1803	2600070349	2599185324	Bacteria	6590677
1804	2600078877	2599185325	Bacteria	6324919
1805	2600210228	2599185355	Bacteria	7968906
1806	2600216848	2599185356	Bacteria	6843884
1807	2600362245	2600254930	Bacteria	6431253
1808	2600365685	2600254931	Bacteria	6734225
1809	2600445529	2600254954	Bacteria	5100516
1810	2600815216	2600255067	Bacteria	6795583
1811	2601625479	2600255283	Bacteria	6061572
1812	2601689541	2600255296	Bacteria	5784754
1813	2601776555	2600255313	Bacteria	6842543
1814	2601800011	2600255318	Bacteria	6383414
1815	2602009938	2600255389	Bacteria	5275336
1816	2606074190	2603880185	Bacteria	6379190
1817	2606127052	2603880199	Bacteria	6377649
1818	2608380285	2606217733	Bacteria	6360972
1819	2621298243	2619619299	Bacteria	6649820
1820	2624479298	2623620443	Bacteria	6427864
1821	2624493705	2623620446	Bacteria	6500345
1822	2643804562	2643221557	Bacteria	7184309
1823	2643841876	2643221565	Bacteria	6216018
1824	2643869316	2643221571	Bacteria	6228673
1825	2643936357	2643221585	Bacteria	5812563
1826	2643952440	2643221589	Bacteria	6250934
1827	2643969813	2643221592	Bacteria	6608788
1828	2644022204	2643221602	Bacteria	6249926
1829	2644065479	2643221610	Bacteria	7480339
1830	2644141934	2643221625	Bacteria	6512927
1831	2644162101	2643221628	Bacteria	5745828
1832	2644187626	2643221633	Bacteria	6733554
1833	2644273312	2643221648	Bacteria	6521465
1834	2644281806	2643221650	Bacteria	7029547
1835	2644304196	2643221654	Bacteria	5273570
1836	2644317002	2643221656	Bacteria	5809961
1837	2644326764	2643221658	Bacteria	6064537
1838	2644375531	2643221668	Bacteria	7306521
1839	2644399980	2643221672	Bacteria	6322190
1840	2644417081	2643221675	Bacteria	7473456
1841	2644448167	2643221680	Bacteria	7473610
1842	2644622035	2643221713	Bacteria	6554480
1843	2644651276	2643221718	Bacteria	5345506
1844	2644677618	2643221723	Bacteria	7095460
1845	2644686680	2643221726	Bacteria	7455827
1846	2652548781	2651869719	Bacteria	6047974
1847	2671090381	2667528170	Bacteria	6786960
1848	2671098928	2667528171	Bacteria	6900659
1849	2671125821	2667528176	Bacteria	6724917
1850	2671768334	2671180172	Bacteria	6495783
1851	2676745718	2675903129	Bacteria	7964495
1852	2677899985	2675903420	Bacteria	6247433
1853	2678262428	2675903515	Bacteria	6580491
1854	2687581140	2687453129	Bacteria	4387428
1855	2713479640	2711768613	Bacteria	11048459
1856	2715751826	2713897148	Bacteria	5883533
1857	2715759593	2713897149	Bacteria	6506249
1858	2718633147	2718217725	Bacteria	5758958
1859	2723249956	2721755607	Bacteria	5841722
1860	2738671373	2738541265	Bacteria	6594665
1861	2738689128	2738541271	Bacteria	5657310
1862	2738749767	2738541282	Bacteria	6593925
1863	2738808374	2738541294	Bacteria	6925949
1864	2738819822	2738541296	Bacteria	7285013
1865	2738832302	2738541298	Bacteria	7286732
1866	2738858807	2738541303	Bacteria	6591772
1867	2738873829	2738541306	Bacteria	7284992
1868	2738895734	2738541309	Bacteria	6926455
1869	2739185459	2738543002	Bacteria	7284546
1870	2739200725	2738543004	Bacteria	6381073
1871	2739220427	2738543008	Bacteria	7282815
1872	2739256432	2738543015	Bacteria	6750701
1873	2739264515	2738543016	Bacteria	5657564
1874	2739285034	2738543020	Bacteria	5718238
1875	2739290348	2738543021	Bacteria	5718241
1876	2739314243	2738543025	Bacteria	6600348
1877	2743736144	2740892503	Bacteria	6855563
1878	2745008772	2744054620	Bacteria	6551379
1879	2746092016	2744054900	Bacteria	8399525
1880	2746099879	2744054901	Bacteria	8397047
1881	2753571302	2751185846	Bacteria	7242164
1882	2765582630	2765235841	Bacteria	6137024
1883	2772438172	2772190666	Bacteria	5117644
1884	2774123832	2773857670	Bacteria	6407454
1885	2774138469	2773857673	Bacteria	6513460
1886	2784259944	2784132063	Bacteria	6262788
1887	2784317684	2784132072	Bacteria	6596533
1888	2792838658	2791355137	Bacteria	9654227
1889	2794596221	2791355520	Bacteria	5948615
1890	2807409599	2806310737	Bacteria	5751088
1891	2807457901	2806310745	Bacteria	5742165
1892	2808856033	2808606361	Bacteria	6136259
1893	2808923500	2808606376	Bacteria	6248667
1894	2808929936	2808606377	Bacteria	6646337
1895	2808936217	2808606378	Bacteria	6177535
1896	2808941825	2808606379	Bacteria	5022697
1897	2808945738	2808606380	Bacteria	6248705
1898	2808951988	2808606381	Bacteria	6646461
1899	2808957554	2808606382	Bacteria	6841132
1900	2808964538	2808606383	Bacteria	6138645
1901	2808973163	2808606384	Bacteria	8474373
1902	2808977908	2808606385	Bacteria	6711065
1903	2808993388	2808606388	Bacteria	6706662
1904	2808999426	2808606389	Bacteria	6138126
1905	2809008009	2808606390	Bacteria	8476311
1906	2809014812	2808606391	Bacteria	8308166
1907	2809216248	2808606445	Bacteria	6057339
1908	2812365788	2811994881	Bacteria	6298475
1909	2817257762	2816332253	Bacteria	6764532
1910	2817281840	2816332256	Bacteria	6891714
1911	2817451419	2816332286	Bacteria	6853759
1912	2817492614	2816332298	Bacteria	6852809
1913	2819545081	2818991436	Bacteria	5376622
1914	2819622043	2818991450	Bacteria	6962147
1915	2819629927	2818991452	Bacteria	8442785
1916	2819636902	2818991452	Bacteria	8442785
1917	2819654463	2818991456	Bacteria	6123676
1918	2819704049	2818991464	Bacteria	6907494
1919	2825653222	2825651385	Bacteria	6715909
1920	2831272320	2831265667	Bacteria	7184833
1921	2834031795	2834028612	Bacteria	6354979
1922	2838059480	2838054893	Bacteria	7451788
1923	2840883680	2840878972	Bacteria	5483153
1924	2842330197	2842324504	Bacteria	9364110
1925	2842356760	2842348783	Bacteria	9002918
1926	2842457781	2842454564	Bacteria	8730687
1927	2842488572	2842482326	Bacteria	7212537
1928	2842679483	2842677519	Bacteria	5615038
1929	2842810160	2842805378	Bacteria	5385175
1930	2842827572	2842826826	Bacteria	5974129
1931	2842832826	2842832357	Bacteria	5959113
1932	2842841320	2842837860	Bacteria	6066181
1933	2842848494	2842843487	Bacteria	6004777
1934	2842859024	2842854478	Bacteria	6143501
1935	2843692066	2843690924	Bacteria	5169057
1936	2844534452	2844533157	Bacteria	7517899
1937	2844669050	2844665904	Bacteria	6817974
1938	2852613020	2852612431	Bacteria	6885235
1939	2852658763	2852657418	Bacteria	6472974
1940	2852669245	2852667396	Bacteria	6885555
1941	2856287974	2856287931	Bacteria	7223934
1942	2857358403	2857357740	Bacteria	9937880
1943	2857361407	2857357740	Bacteria	9937880
1944	2857542933	2857542790	Bacteria	5326616
1945	2860340157	2860339153	Bacteria	6846989
1946	2860871706	2860867994	Bacteria	5645326
1947	2863427088	2863421361	Bacteria	7300805
1948	2870073723	2870068957	Bacteria	8925310
1949	2878031307	2878029506	Bacteria	6418441
1950	2880232157	2880230671	Bacteria	6140320
1951	2881846739	2881845957	Bacteria	6611900
1952	2883089672	2883087390	Bacteria	9532701
1953	2883090439	2883087390	Bacteria	9532701
1954	2883294984	2883291878	Bacteria	5894118
1955	2883356540	2883354860	Bacteria	5865246
1956	2885202681	2885198086	Bacteria	7212419
1957	2885216334	2885211737	Bacteria	7212420
1958	2885279164	2885270888	Bacteria	9831543
1959	2888352440	2888350351	Bacteria	7372807
1960	2888368188	2888366609	Bacteria	5155009
1961	2898795547	2898795034	Bacteria	4294459
1962	2900578264	2900577576	Bacteria	5438534
1963	2900635878	2900634093	Bacteria	10263517
1964	2904484251	2904483920	Bacteria	7545285
1965	2904522318	2904518522	Bacteria	6068986
1966	2904555652	2904550169	Bacteria	6221258
1967	2904571070	2904564687	Bacteria	7609577
1968	2904578218	2904571731	Bacteria	7608790
1969	2904618166	2904615490	Bacteria	10047340
1970	2908451115	2908446538	Bacteria	6829095
1971	2912965200	2912963787	Bacteria	5646108
1972	2913038400	2913036834	Bacteria	6704877
1973	2917072323	2917070673	Bacteria	6868303
1974	2917835566	2917832318	Bacteria	5346010
1975	2919064223	2919063839	Bacteria	6302690
1976	2919129670	2919125081	Bacteria	5385106
1977	2919386269	2919385768	Bacteria	5897293
1978	2919461899	2919456309	Bacteria	6586567
1979	2919462542	2919462493	Bacteria	5817112
1980	2919481666	2919481497	Bacteria	6907839
1981	2919491452	2919487758	Bacteria	5929766
1982	2919503950	2919501602	Bacteria	5286340
1983	2919530194	2919527303	Bacteria	7718827
1984	2919683220	2919679072	Bacteria	4629602
1985	2919703636	2919697872	Bacteria	6553725
1986	2919704431	2919704043	Bacteria	5560311
1987	2920826924	2920822456	Bacteria	6897201
1988	2921649880	2921643360	Bacteria	11448031
1989	2922134961	2922130491	Bacteria	7173936
1990	2923155158	2923153595	Bacteria	6870622
1991	2923510870	2923510766	Bacteria	5926163
1992	2923525756	2923519811	Bacteria	6298479
1993	2923587479	2923586266	Bacteria	6565975
1994	2926065477	2926063275	Bacteria	5285848
1995	2928061908	2928058823	Bacteria	5520022
1996	2928075614	2928070936	Bacteria	8062541
1997	2928089533	2928084124	Bacteria	7159212
1998	2928109949	2928108538	Bacteria	7360024
1999	2928135167	2928130867	Bacteria	5467269
2000	2928136596	2928135762	Bacteria	7259641
2001	2928158210	2928157003	Bacteria	7522202
2002	2928167569	2928163908	Bacteria	7561269
2003	2928174104	2928170801	Bacteria	8785406
2004	2928177890	2928170801	Bacteria	8785406
2005	2928509023	2928503688	Bacteria	7268108
2006	2928542852	2928536128	Bacteria	7657547
2007	2929145843	2929144301	Bacteria	6622272
2008	2929193746	2929189879	Bacteria	5930554
2009	2929525763	2929520902	Bacteria	6765052
2010	2931370810	2931369376	Bacteria	6847892
2011	2931395072	2931390751	Bacteria	6273349
2012	2931399950	2931396565	Bacteria	7251677
2013	2935354487	2935353572	Unclassified	6955622
2014	2937969912	2937967321	Bacteria	5094075
2015	2939642496	2939636861	Bacteria	6297853
2016	2939653573	2939651529	Bacteria	5895393
2017	2945909550	2945909444	Bacteria	7065066
2018	2945932239	2945928738	Bacteria	6053221
2019	2945935817	2945934425	Bacteria	7444609
2020	2945949667	2945945610	Bacteria	5951079
2021	2945961860	2945961074	Bacteria	7342064
2022	2945975328	2945972063	Bacteria	6086495
2023	2945988471	2945984333	Bacteria	7358892
2024	2946008428	2946006987	Bacteria	6705746
2025	2946032211	2946027586	Bacteria	6049274
2026	2947239041	2947233263	Bacteria	6439278
2027	2952253607	2952252522	Bacteria	4171745
2028	2967998979	2967996073	Bacteria	6787468
2029	2968002672	2967996073	Bacteria	6787468
2030	2969306075	2969304461	Bacteria	6601805
2031	2974292264	2974289157	Bacteria	6080362
2032	2974299761	2974298342	Bacteria	4840922
2033	2977976069	2977971508	Bacteria	7472917
2034	2977991092	2977986579	Bacteria	6581278
2035	2979747977	2979742915	Bacteria	7301278
2036	2981996601	2981990288	Bacteria	7590678
2037	2984290880	2984286254	Bacteria	6702062
2038	2984504354	2984504281	Bacteria	5262371
2039	2984569115	2984568884	Bacteria	3884413
2040	2988733375	2988728565	Bacteria	6124362
2041	2990710272	2990703756	Bacteria	7715990
2042	2996337344	2996336353	Bacteria	5511628
2043	2998141481	2998139840	Bacteria	6073514
2044	3007400697	3007395558	Bacteria	6755444
2045	3007421166	3007419365	Bacteria	7026924
2046	3007512880	3007511990	Bacteria	6481491
2047	3007615922	3007614139	Bacteria	6053559
2048	3007623947	3007619802	Bacteria	6411688
2049	3007720017	3007718800	Bacteria	5971527
2050	3007806901	3007803356	Bacteria	5931491
2051	3007856078	3007855910	Bacteria	5637581
2052	3007863287	3007861166	Bacteria	6045338
2053	3007868020	3007866637	Bacteria	5899198
2054	3007874615	3007872151	Bacteria	5268868
2055	642422795	641736151	Bacteria	7477263
2056	642417097	641736154	Bacteria	7689995
2057	642592402	642555112	Bacteria	8676562
2058	642620602	642555113	Bacteria	8214658
2059	8003956316	8003955200	Bacteria	8601927
2060	8005488203	8005484373	Bacteria	6297373
2061	8011356715	8011350971	Bacteria	6158957
2062	8015397706	8015394850	Bacteria	5064660
2063	8015689377	8015687852	Bacteria	6613826
2064	8018848605	8018845410	Bacteria	8933938
2065	8018852283	8018845410	Bacteria	8933938
2066	8019771092	8019769354	Bacteria	6924660
2067	8019781167	8019775933	Bacteria	6858656
2068	8020808274	8020807995	Bacteria	6801506
2069	8020943826	8020938398	Bacteria	7472757
2070	8020952825	8020945358	Bacteria	8467355
2071	8020954648	8020953355	Bacteria	7439080
2072	8021123688	8021120328	Bacteria	8782274
2073	8021126358	8021120328	Bacteria	8782274
2074	8029999269	8029995093	Bacteria	5990776
2075	8034965748	8034962539	Bacteria	4884839
2076	8039103129	8039098773	Bacteria	6602928
2077	8039104398	8039098773	Bacteria	6602928
2078	8040172331	8040167225	Bacteria	6542727
2079	8040179000	8040173305	Bacteria	6827067
2080	8052498598	8052494512	Bacteria	5765634
2081	8054289800	8054285046	Bacteria	6919322
2082	8054350672	8054347763	Bacteria	5901107
2083	8054507573	8054503363	Bacteria	6101651
2084	8054933840	8054929484	Bacteria	5599761
2085	8055304946	8055301274	Bacteria	8587385
2086	8055772512	8055770955	Bacteria	6827675
2087	8055822515	8055817908	Bacteria	6609162
2088	8055879419	8055878733	Bacteria	5907058
2089	8056119904	8056115690	Bacteria	5527654
2090	8056122228	8056120720	Bacteria	5758328
2091	8056130317	8056125926	Bacteria	6228218
2092	8056135971	8056131705	Bacteria	6107031
2093	8056141539	8056137416	Bacteria	6147080
2094	8056147441	8056143049	Bacteria	6307666
2095	8056150294	8056148874	Bacteria	6479865
2096	8056155250	8056155041	Bacteria	6486948
2097	8056162183	8056161164	Bacteria	6106669
2098	8056175690	8056172158	Bacteria	6133900
2099	8056181019	8056177738	Bacteria	6748268
2100	8056570148	8056569372	Bacteria	5997322
2101	8057803840	8057798959	Bacteria	6713499
2102	Ga0395900_0391945
2103	MRS2a_Contig_76
2104	MRS2a_Contig_923
2105	JGI24740J21852_10000408
2106	JGI24740J21852_10005990
2107	JGI24739J22299_10001939
2108	JGI24739J22299_10002298
2109	JGI24739J22299_10015272
2110	JGI24739J22299_10027161
2111	JGI24737J22298_10010148
2112	JGI24735J21928_10001688
2113	JGI24735J21928_10013207
2114	JGI24738J21930_10013961
2115	JGI25156J39149_1000694
2116	JGI25156J39149_1000808
2117	JGI25156J39149_1001250
2118	JGI25156J39149_1003923
2119	JGI25162J39368_1000037
2120	JGI25162J39368_1000087
2121	JGI25162J39368_1000157
2122	JGI25162J39368_1000396
2123	JGI25154J39366_1000262
2124	JGI25157J39369_1000172
2125	JGI25157J39369_1000865
2126	JGI25163J39215_1000066
2127	JGI25163J39215_1000110
2128	JGI25163J39215_1002113
2129	JGI25164J39214_1000020
2130	JGI25164J39214_1000065
2131	JGI25164J39214_1000263
2132	JGI25152J39213_1000928
2133	JGI25152J39213_1001845
2134	JGI25152J39213_1004924
2135	JGI25150J39212_1000601
2136	JGI25150J39212_1004403
2137	JGI25159J45721_1000475
2138	JGI25151J46595_10000909
2139	JGI25151J46595_10001696
2140	JGI25151J46595_10021628
2141	JGI25165J46597_1000020
2142	JGI25165J46597_1000045
2143	JGI25165J46597_1000077
2144	JGI25165J46597_1000091
2145	JGI25165J46597_1000473
2146	JGI25153J46596_10000012
2147	JGI25153J46596_10001260
2148	JGI25153J46596_10001655
2149	JGI25153J46596_10002628
2150	rootH2_10118054
2151	JGI25160J50197_1000899
2152	JGI25161J50226_1002821
2153	Ga0006562J51391_1041821
2154	Ga0006562J51391_1041822
2155	Ga0006562J51391_1064349
2156	Ga0006562J51391_1151119
2157	Ga0055538_1000022
2158	Ga0055538_1000027
2159	Ga0055539_1000028
2160	Ga0055539_1000036
2161	Ga0055539_1000064
2162	Ga0055539_1001064
2163	Ga0055533_1000036
2164	Ga0055533_1000046
2165	Ga0055533_1000074
2166	Ga0055533_1000750
2167	Ga0055533_1001582
2168	Ga0055532_1000001
2169	Ga0055532_1000032
2170	Ga0055532_1000339
2171	Ga0055532_1000445
2172	Ga0055532_1001174
2173	Ga0055525_1000092
2174	Ga0055525_1000191
2175	Ga0055525_1000217
2176	Ga0055527_1000002
2177	Ga0055527_1000185
2178	Ga0055527_1000256
2179	Ga0055527_1000406
2180	Ga0055527_1001507
2181	Ga0055527_1003921
2182	Ga0055535_1000001
2183	Ga0055535_1000386
2184	Ga0055535_1001005
2185	Ga0055535_1001016
2186	Ga0055535_1001049
2187	Ga0055535_1001643
2188	Ga0055535_1005867
2189	Ga0055542_1000001
2190	Ga0055542_1000423
2191	Ga0055542_1000564
2192	Ga0055542_1001012
2193	Ga0055542_1001507
2194	Ga0055542_1002559
2195	Ga0055529_1000001
2196	Ga0055529_1000116
2197	Ga0055529_1000533
2198	Ga0055529_1000699
2199	Ga0055526_1001431
2200	Ga0055526_1001651
2201	Ga0055526_1001876
2202	Ga0055526_1010601
2203	Ga0055537_1000280
2204	Ga0055537_1000682
2205	Ga0055537_1005616
2206	Ga0055524_1001173
2207	Ga0055524_1005981
2208	Ga0055536_1000041
2209	Ga0055536_1000042
2210	Ga0055536_1022285
2211	Ga0055534_1000358
2212	Ga0055534_1000744
2213	Ga0055528_1000566
2214	Ga0055528_1000843
2215	Ga0055528_1001301
2216	Ga0055528_1012325
2217	Ga0055530_10000063
2218	Ga0055530_10001280
2219	Ga0055530_10004550
2220	Ga0055530_10032635
2221	Ga0055540_1000318
2222	Ga0055540_1000431
2223	Ga0055540_1000936
2224	Ga0055540_1011947
2225	Ga0055531_10000548
2226	Ga0055531_10005876
2227	Ga0055531_10010388
2228	Ga0055531_10011907
2229	Ga0055531_10012470
2230	Ga0055531_10027232
2231	Ga0055541_1000024
2232	Ga0055541_1000046
2233	Ga0055541_1000094
2234	Ga0058692_1006587
2235	Ga0055543_1003421
2236	Ga0058859_11722582
2237	Ga0065165_1000952
2238	Ga0065165_1001963
2239	Ga0065165_1004597
2240	Ga0065714_10001100
2241	Ga0065714_10003469
2242	Ga0065714_10005452
2243	Ga0065714_10007547
2244	Ga0065714_10016005
2245	Ga0065704_10005489
2246	Ga0065712_10072537
2247	Ga0065715_10009282
2248	Ga0065707_10007575
2249	Ga0070658_10022601
2250	Ga0070658_10103685
2251	Ga0070676_10021599
2252	Ga0070676_10030334
2253	Ga0070676_10089289
2254	Ga0070690_100111807
2255	Ga0070670_100096664
2256	Ga0068869_100007271
2257	Ga0070666_10003553
2258	Ga0068868_100005038
2259	Ga0068868_100010970
2260	Ga0068868_100017499
2261	Ga0068868_100078558
2262	Ga0070660_100000351
2263	Ga0070687_100044747
2264	Ga0070661_100000008
2265	Ga0070668_100017121
2266	Ga0070669_100000618
2267	Ga0070675_100004251
2268	Ga0070671_100003057
2269	Ga0070671_100048649
2270	Ga0070671_100055001
2271	Ga0070674_100003115
2272	Ga0070674_100023607
2273	Ga0070674_100029859
2274	Ga0070673_100003996
2275	Ga0070673_100004321
2276	Ga0070688_100006220
2277	Ga0070688_100127477
2278	Ga0070659_100000301
2279	Ga0070659_100192351
2280	Ga0070667_100000766
2281	Ga0070667_100002286
2282	Ga0070667_100014751
2283	Ga0070667_100023448
2284	Ga0070667_100092689
2285	Ga0070667_100463547
2286	Ga0070700_100118158
2287	Ga0070708_100028937
2288	Ga0070663_100007362
2289	Ga0070663_100009853
2290	Ga0070663_100082324
2291	Ga0070678_100359251
2292	Ga0070678_100387540
2293	Ga0070662_100000397
2294	Ga0070662_100051504
2295	Ga0070662_100085560
2296	Ga0068867_100008567
2297	Ga0068867_100043145
2298	Ga0068867_100061802
2299	Ga0068867_100497003
2300	Ga0070706_100198732
2301	Ga0070707_100023575
2302	Ga0070707_100055321
2303	Ga0070698_100066586
2304	Ga0068853_100031387
2305	Ga0068853_100100434
2306	Ga0070672_100064410
2307	Ga0070696_100344846
2308	Ga0070665_100017684
2309	Ga0070665_100183134
2310	Ga0070665_100311557
2311	Ga0070704_100073205
2312	Ga0068855_100000072
2313	Ga0068855_100093853
2314	Ga0070664_100000028
2315	Ga0070664_100013940
2316	Ga0070664_100193857
2317	Ga0068857_100010156
2318	Ga0068854_100008147
2319	Ga0068856_100001902
2320	Ga0068852_100023154
2321	Ga0068852_100030306
2322	Ga0068859_100000133
2323	Ga0068859_100129740
2324	Ga0068864_100000237
2325	Ga0068864_100011272
2326	Ga0068866_10018142
2327	Ga0068866_10021927
2328	Ga0068866_10074766
2329	Ga0068861_100058791
2330	Ga0068861_100102728
2331	Ga0068861_100299739
2332	Ga0068851_10046515
2333	Ga0068870_10005466
2334	Ga0068863_100012293
2335	Ga0068863_100041879
2336	Ga0068863_100145706
2337	Ga0068858_100000395
2338	Ga0068860_100010571
2339	Ga0068860_100028902
2340	Ga0068860_100191918
2341	Ga0068860_100237393
2342	Ga0068862_100029304
2343	Ga0068862_100063333
2344	Ga0068862_100178864
2345	Ga0081538_10013957
2346	Ga0081539_10046320
2347	Ga0075365_10070985
2348	Ga0075365_10220676
2349	Ga0075368_10022622
2350	Ga0075363_100004309
2351	Ga0075363_100026381
2352	Ga0075363_100052420
2353	Ga0075364_10019678
2354	Ga0075364_10175901
2355	Ga0075432_10012659
2356	Ga0075362_10001418
2357	Ga0075362_10007113
2358	Ga0075362_10081788
2359	Ga0075362_10094546
2360	Ga0075367_10017422
2361	Ga0075367_10072504
2362	Ga0075367_10112015
2363	Ga0075367_10194685
2364	Ga0075369_10036447
2365	Ga0075366_10007756
2366	Ga0075366_10008684
2367	Ga0075366_10014549
2368	Ga0075366_10014990
2369	Ga0075366_10034827
2370	Ga0075366_10042458
2371	Ga0075366_10056181
2372	Ga0097621_100010287
2373	Ga0075370_10000530
2374	Ga0075370_10000771
2375	Ga0075370_10001010
2376	Ga0075370_10001315
2377	Ga0075370_10002624
2378	Ga0075370_10004846
2379	Ga0075370_10021595
2380	Ga0075370_10066320
2381	Ga0068871_100035803
2382	Ga0075428_100028272
2383	Ga0075428_100045564
2384	Ga0075428_100260691
2385	Ga0075428_100469069
2386	Ga0075430_100017062
2387	Ga0075430_100035450
2388	Ga0075430_100138333
2389	Ga0075431_100011196
2390	Ga0075431_100051693
2391	Ga0075431_100096418
2392	Ga0075431_100123021
2393	Ga0075434_100105017
2394	Ga0075429_100131326
2395	Ga0068865_100026576
2396	Ga0068865_100187814
2397	Ga0068865_100239465
2398	Ga0075436_100014627
2399	Ga0097620_100000133
2400	Ga0097620_100129736
2401	Ga0099823_1000244
2402	Ga0079104_1000145
2403	Ga0079104_1000908
2404	Ga0079104_1001974
2405	Ga0079104_1031975
2406	Ga0099826_10005078
2407	Ga0099826_10072892
2408	Ga0105251_10000061
2409	Ga0105251_10000092
2410	Ga0105251_10000602
2411	Ga0105251_10000704
2412	Ga0105251_10002688
2413	Ga0105251_10003050
2414	Ga0105251_10003224
2415	Ga0105251_10019154
2416	Ga0105251_10032066
2417	Ga0105251_10042354
2418	Ga0105244_10002171
2419	Ga0105244_10002522
2420	Ga0105244_10010806
2421	Ga0105244_10013426
2422	Ga0105244_10024200
2423	Ga0105244_10051436
2424	Ga0105244_10074244
2425	Ga0105250_10000056
2426	Ga0105250_10000180
2427	Ga0105250_10014724
2428	Ga0105240_10007736
2429	Ga0105240_10015910
2430	Ga0105240_10065528
2431	Ga0105240_10109505
2432	Ga0105240_10169087
2433	Ga0105240_10224905
2434	Ga0105240_10238624
2435	Ga0105240_10489938
2436	Ga0111539_10000128
2437	Ga0111539_10163825
2438	Ga0111539_10206166
2439	Ga0105245_10034802
2440	Ga0105245_10090180
2441	Ga0105245_10118897
2442	Ga0105245_10156415
2443	Ga0105243_10000313
2444	Ga0105243_10001425
2445	Ga0105243_10015708
2446	Ga0105243_10025093
2447	Ga0105243_10068334
2448	Ga0105243_10217195
2449	Ga0105243_10220406
2450	Ga0105243_10250588
2451	Ga0105242_10000024
2452	Ga0105242_10002462
2453	Ga0105242_10067093
2454	Ga0105242_10271652
2455	Ga0105248_10002604
2456	Ga0105248_10014194
2457	Ga0105248_10151494
2458	Ga0105237_10001086
2459	Ga0105237_10008395
2460	Ga0105237_10008765
2461	Ga0105237_10097154
2462	Ga0105237_10176908
2463	Ga0105237_10307162
2464	Ga0105238_10001437
2465	Ga0105238_10005146
2466	Ga0105238_10023215
2467	Ga0105238_10594771
2468	Ga0105249_10005689
2469	Ga0105249_10011734
2470	Ga0105239_10000248
2471	Ga0105239_10024202
2472	Ga0105239_10084112
2473	Ga0105239_10331468
2474	Ga0105246_10001214
2475	Ga0105246_10001286
2476	Ga0157373_10006570
2477	Ga0157373_10070354
2478	Ga0157373_10187930
2479	Ga0157371_10002649
2480	Ga0157370_10000490
2481	Ga0157370_10318060
2482	Ga0157369_10004506
2483	Ga0157369_10020605
2484	Ga0157369_10111968
2485	Ga0157369_10274442
2486	Ga0157369_10639463
2487	Ga0157378_10011082
2488	Ga0157378_10019760
2489	Ga0157378_10198711
2490	Ga0163162_10002443
2491	Ga0163162_10050323
2492	Ga0163162_10124774
2493	Ga0157375_10057385
2494	Ga0157375_10065379
2495	Ga0157375_10111663
2496	Ga0163163_10004911
2497	Ga0163163_10767449
2498	Ga0157380_10041555
2499	Ga0157380_10047419
2500	Ga0157380_10387890
2501	Ga0182008_10019099
2502	Ga0182008_10094920
2503	Ga0157377_10130733
2504	Ga0157379_10005267
2505	Ga0157379_10086499
2506	Ga0157376_10064084
2507	Ga0157376_10225633
2508	Ga0182006_1001318
2509	Ga0182006_1002393
2510	Ga0182006_1006784
2511	Ga0182006_1023537
2512	Ga0182007_10001406
2513	Ga0182007_10001432
2514	Ga0182007_10024440
2515	Ga0182007_10048256
2516	Ga0182005_1000312
2517	Ga0182005_1025325
2518	Ga0183363_1190
2519	Ga0183361_10009
2520	Ga0163161_10000696
2521	Ga0163161_10043216
2522	Ga0163161_10052855
2523	Ga0163161_10142155
2524	Ga0213872_10000133
2525	Ga0213872_10011625
2526	Ga0213872_10012284
2527	Ga0213872_10033642
2528	Ga0213872_10038248
2529	Ga0213876_10107715
2530	Ga0213875_10046465
2531	Ga0209435_100104
2532	Ga0209435_100285
2533	Ga0209435_108578
2534	Ga0209760_100022
2535	Ga0209760_100184
2536	Ga0209436_100705
2537	Ga0209436_101698
2538	Ga0209436_105832
2539	Ga0209784_100002
2540	Ga0209784_100017
2541	Ga0209784_100036
2542	Ga0209566_100003
2543	Ga0209566_100014
2544	Ga0209566_100044
2545	Ga0209566_100331
2546	Ga0209566_100507
2547	Ga0209674_100004
2548	Ga0209674_100005
2549	Ga0209674_100028
2550	Ga0209674_100065
2551	Ga0209674_100110
2552	Ga0209674_100148
2553	Ga0209674_100640
2554	Ga0209672_100001
2555	Ga0209672_100012
2556	Ga0209672_100020
2557	Ga0209672_100045
2558	Ga0209672_100100
2559	Ga0209672_100337
2560	Ga0209147_100001
2561	Ga0209147_100007
2562	Ga0209147_100024
2563	Ga0209147_100038
2564	Ga0209147_100149
2565	Ga0209147_100713
2566	Ga0209147_101540
2567	Ga0209563_100006
2568	Ga0209563_100032
2569	Ga0209563_100063
2570	Ga0209563_100193
2571	Ga0209563_100673
2572	Ga0207427_100001
2573	Ga0207427_100047
2574	Ga0207427_100139
2575	Ga0207427_102819
2576	Ga0207427_103026
2577	Ga0209437_100003
2578	Ga0209437_100009
2579	Ga0209437_100082
2580	Ga0209437_100351
2581	Ga0209437_100372
2582	Ga0209258_100001
2583	Ga0209258_100014
2584	Ga0209258_100024
2585	Ga0209258_100084
2586	Ga0209258_100197
2587	Ga0209258_100200
2588	Ga0209258_100587
2589	Ga0207425_1000735
2590	Ga0207425_1001198
2591	Ga0207425_1004967
2592	Ga0209646_1000108
2593	Ga0209646_1000171
2594	Ga0209646_1000545
2595	Ga0209026_1000074
2596	Ga0209026_1001305
2597	Ga0209026_1002818
2598	Ga0209677_100003
2599	Ga0209677_100018
2600	Ga0209677_100038
2601	Ga0209677_102971
2602	Ga0209148_1000003
2603	Ga0209148_1000009
2604	Ga0209148_1000045
2605	Ga0209148_1000434
2606	Ga0209148_1000737
2607	Ga0209148_1001237
2608	Ga0209148_1002535
2609	Ga0209759_1000033
2610	Ga0209759_1000110
2611	Ga0209759_1000116
2612	Ga0209759_1000294
2613	Ga0209759_1000411
2614	Ga0209759_1000624
2615	Ga0209759_1009794
2616	Ga0209759_1018342
2617	Ga0209129_1000030
2618	Ga0209129_1000292
2619	Ga0209129_1003254
2620	Ga0209233_1000007
2621	Ga0209233_1000016
2622	Ga0209233_1000032
2623	Ga0209233_1000047
2624	Ga0209233_1000109
2625	Ga0209233_1000251
2626	Ga0209565_1000019
2627	Ga0209565_1000088
2628	Ga0209565_1006334
2629	Ga0209455_1000001
2630	Ga0209455_1000029
2631	Ga0209455_1000035
2632	Ga0209455_1000485
2633	Ga0209455_1000551
2634	Ga0209455_1000585
2635	Ga0209455_1000621
2636	Ga0209673_1000057
2637	Ga0209673_1000064
2638	Ga0209673_1000095
2639	Ga0209673_1001209
2640	Ga0209673_1001728
2641	Ga0209673_1010294
2642	Ga0209130_1000011
2643	Ga0209130_1000033
2644	Ga0209130_1002417
2645	Ga0209130_1016006
2646	Ga0209675_1000036
2647	Ga0209675_1000073
2648	Ga0209675_1011664
2649	Ga0209676_1000016
2650	Ga0209676_1000021
2651	Ga0209676_1000033
2652	Ga0209676_1000088
2653	Ga0209676_1000458
2654	Ga0209676_1001131
2655	Ga0209676_1002585
2656	Ga0209676_1012150
2657	Ga0209676_1016344
2658	Ga0209025_1000032
2659	Ga0209025_1000157
2660	Ga0209025_1000493
2661	Ga0209025_1000494
2662	Ga0209025_1015178
2663	Ga0209025_1035346
2664	Ga0209564_1000029
2665	Ga0209564_1000056
2666	Ga0209564_1000079
2667	Ga0209564_1000103
2668	Ga0209564_1006426
2669	Ga0209758_1000037
2670	Ga0209758_1000059
2671	Ga0209758_1000096
2672	Ga0209758_1000273
2673	Ga0209758_1010815
2674	Ga0209050_1000009
2675	Ga0209050_1000036
2676	Ga0209050_1000107
2677	Ga0209050_1000110
2678	Ga0209050_1000593
2679	Ga0209050_1001442
2680	Ga0209050_1002197
2681	Ga0209050_1004722
2682	Ga0209050_1006696
2683	Ga0209050_1019312
2684	Ga0209050_1029224
2685	Ga0209256_1000043
2686	Ga0209256_1000064
2687	Ga0209256_1000065
2688	Ga0209256_1002048
2689	Ga0207426_1000029
2690	Ga0207426_1000078
2691	Ga0207426_1000124
2692	Ga0207426_1000326
2693	Ga0207426_1001828
2694	Ga0209051_1000043
2695	Ga0209051_1000053
2696	Ga0209051_1000069
2697	Ga0209051_1000090
2698	Ga0209051_1000921
2699	Ga0209051_1001655
2700	Ga0209051_1002771
2701	Ga0209051_1008395
2702	Ga0209051_1013349
2703	Ga0209051_1027441
2704	Ga0209257_1000093
2705	Ga0209257_1000098
2706	Ga0209257_1000997
2707	Ga0209257_1002425
2708	Ga0209257_1004164
2709	Ga0209257_1007244
2710	Ga0209257_1012719
2711	Ga0209257_1013089
2712	Ga0209257_1018666
2713	Ga0209257_1021400
2714	Ga0207697_10026541
2715	Ga0207656_10000213
2716	Ga0207696_1000010
2717	Ga0207696_1000034
2718	Ga0207696_1000043
2719	Ga0207696_1000158
2720	Ga0207696_1001606
2721	Ga0207696_1012778
2722	Ga0207655_1000019
2723	Ga0207655_1000095
2724	Ga0207655_1000175
2725	Ga0207655_1000558
2726	Ga0207655_1007882
2727	Ga0207655_1007917
2728	Ga0207713_1000014
2729	Ga0207713_1000074
2730	Ga0207713_1000372
2731	Ga0207713_1000449
2732	Ga0207713_1000623
2733	Ga0207713_1000846
2734	Ga0207713_1001459
2735	Ga0207713_1002427
2736	Ga0207713_1010467
2737	Ga0207713_1017527
2738	Ga0207713_1038629
2739	Ga0207682_10025362
2740	Ga0207642_10065717
2741	Ga0207680_10001739
2742	Ga0207680_10095736
2743	Ga0207647_10005786
2744	Ga0207647_10007274
2745	Ga0207647_10037383
2746	Ga0207647_10057888
2747	Ga0207645_10015113
2748	Ga0207645_10017804
2749	Ga0207645_10042218
2750	Ga0207643_10063101
2751	Ga0207643_10078630
2752	Ga0207643_10124819
2753	Ga0207643_10148331
2754	Ga0207684_10078429
2755	Ga0207695_10014296
2756	Ga0207695_10110627
2757	Ga0207671_10000035
2758	Ga0207671_10009819
2759	Ga0207671_10082764
2760	Ga0207657_10000003
2761	Ga0207657_10055369
2762	Ga0207657_10195253
2763	Ga0207649_10000017
2764	Ga0207646_10196147
2765	Ga0207681_10005056
2766	Ga0207681_10006303
2767	Ga0207681_10022988
2768	Ga0207681_10025122
2769	Ga0207681_10159519
2770	Ga0207694_10274212
2771	Ga0207650_10000212
2772	Ga0207650_10000523
2773	Ga0207650_10317921
2774	Ga0207659_10001481
2775	Ga0207659_10012532
2776	Ga0207659_10460641
2777	Ga0207687_10020325
2778	Ga0207687_10287623
2779	Ga0207644_10023011
2780	Ga0207644_10037410
2781	Ga0207690_10000007
2782	Ga0207706_10000170
2783	Ga0207706_10004682
2784	Ga0207706_10008668
2785	Ga0207706_10017214
2786	Ga0207706_10061843
2787	Ga0207706_10263442
2788	Ga0207686_10003698
2789	Ga0207686_10123571
2790	Ga0207709_10000036
2791	Ga0207709_10000502
2792	Ga0207709_10033520
2793	Ga0207709_10042744
2794	Ga0207709_10060754
2795	Ga0207709_10105392
2796	Ga0207709_10249948
2797	Ga0207709_10259487
2798	Ga0207669_10007673
2799	Ga0207669_10045906
2800	Ga0207669_10068621
2801	Ga0207704_10027692
2802	Ga0207704_10236842
2803	Ga0207704_10247946
2804	Ga0207691_10008211
2805	Ga0207691_10013323
2806	Ga0207691_10145805
2807	Ga0207711_10002914
2808	Ga0207711_10054438
2809	Ga0207689_10027013
2810	Ga0207689_10031214
2811	Ga0207689_10132326
2812	Ga0207679_10000005
2813	Ga0207667_10000055
2814	Ga0207667_10297354
2815	Ga0207651_10000537
2816	Ga0207651_10052303
2817	Ga0207651_10081015
2818	Ga0207651_10129699
2819	Ga0207712_10018924
2820	Ga0207668_10056511
2821	Ga0207668_10273872
2822	Ga0207668_10401778
2823	Ga0207668_10407187
2824	Ga0207640_10010712
2825	Ga0207640_10095663
2826	Ga0207640_10293945
2827	Ga0207658_10000319
2828	Ga0207658_10000720
2829	Ga0207658_10021764
2830	Ga0207658_10096325
2831	Ga0207658_10185056
2832	Ga0207658_10202651
2833	Ga0207658_10220374
2834	Ga0207677_10005784
2835	Ga0207677_10005900
2836	Ga0207677_10074578
2837	Ga0207703_10000787
2838	Ga0207639_10071507
2839	Ga0207678_10002921
2840	Ga0207678_10019668
2841	Ga0207678_10028502
2842	Ga0207678_10075602
2843	Ga0207678_10086125
2844	Ga0207708_10061730
2845	Ga0207702_10006184
2846	Ga0207702_10124621
2847	Ga0207641_10034515
2848	Ga0207648_10008161
2849	Ga0207648_10014892
2850	Ga0207648_10015990
2851	Ga0207648_10042949
2852	Ga0207648_10354903
2853	Ga0207676_10000485
2854	Ga0207676_10103033
2855	Ga0207674_10008268
2856	Ga0207674_10031934
2857	Ga0207675_100038899
2858	Ga0207675_100055401
2859	Ga0207683_10002119
2860	Ga0207683_10116784
2861	Ga0207683_10270203
2862	Ga0207683_10325958
2863	Ga0207698_10136208
2864	Ga0209281_1000018
2865	Ga0209281_1000271
2866	Ga0209281_1014736
2867	Ga0209281_1018215
2868	Ga0209389_1000063
2869	Ga0209371_1000702
2870	Ga0209371_1001162
2871	Ga0209282_1000348
2872	Ga0209282_1033875
2873	Ga0209813_10037778
2874	Ga0207428_10000078
2875	Ga0207428_10204394
2876	Ga0268266_10303654
2877	Ga0268266_10310052
2878	Ga0268266_10511515
2879	Ga0268265_10003523
2880	Ga0268265_10005792
2881	Ga0268265_10203852
2882	Ga0268264_10211702
2883	Ga0307517_10001636
2884	Ga0307517_10022200
2885	Ga0307515_10000063
2886	Ga0307515_10000131
2887	Ga0307515_10000571
2888	Ga0307515_10002612
2889	Ga0307515_10003642
2890	Ga0307515_10050976
2891	Ga0307515_10056385
2892	Ga0307515_10061224
2893	Ga0307515_10152064
2894	Ga0268256_1000556
2895	Ga0268256_1000994
2896	Ga0307511_10130206
2897	Ga0307511_10144757
2898	Ga0307512_10015675
2899	Ga0314311_1121003
2900	Ga0316178_1165952
2901	Ga0316183_1068607
2902	Ga0316181_1153552
2903	Ga0316181_1164795
2904	Ga0316181_1182049
2905	Ga0265332_10000003
2906	Ga0265328_10063012
2907	Ga0265328_10091666
2908	Ga0265331_10001261
2909	Ga0265327_10036252
2910	Ga0265316_10036438
2911	Ga0307513_10008962
2912	Ga0307513_10063632
2913	Ga0307513_10174766
2914	Ga0307513_10188955
2915	Ga0307509_10000063
2916	Ga0307509_10021582
2917	Ga0307509_10119178
2918	Ga0307509_10213796
2919	Ga0307408_100000097
2920	Ga0307408_100001348
2921	Ga0307408_100003252
2922	Ga0307408_100025350
2923	Ga0265313_10000298
2924	Ga0307508_10000004
2925	Ga0307508_10003415
2926	Ga0307508_10032149
2927	Ga0307508_10091395
2928	Ga0307508_10117185
2929	Ga0307508_10157991
2930	Ga0307508_10218890
2931	Ga0307514_10000708
2932	Ga0307514_10011676
2933	Ga0307514_10042395
2934	Ga0307514_10135016
2935	Ga0307514_10216270
2936	Ga0316579_10029402
2937	Ga0316579_10100588
2938	Ga0265314_10038986
2939	Ga0265342_10101339
2940	Ga0307516_10001976
2941	Ga0307410_10075149
2942	Ga0307410_10362628
2943	Ga0307406_10202611
2944	Ga0307412_10000005
2945	Ga0307412_10014370
2946	Ga0307412_10172723
2947	Ga0307412_10270453
2948	Ga0307412_10442538
2949	Ga0307409_100102899
2950	Ga0307416_100004376
2951	Ga0307414_10040188
2952	Ga0307411_10093285
2953	Ga0307411_10337503
2954	Ga0307507_10029203
2955	Ga0307510_10032584
2956	Ga0307510_10040540
2957	Ga0307510_10133690
2958	Ga0307510_10172987
2959	Ga0316574_0008875
2960	Ga0373924_0016442
2961	Ga0373931_0002028
2962	Ga0373931_0025830
2963	Ga0373935_0043879
2964	Ga0373927_0000147
2965	Ga0373927_0160069
2966	Ga0373937_0199651
2967	Ga0373937_0243522
2968	Ga0373937_0439907
2969	Ga0316582_0077312
2970	Ga0373925_0011078
2971	Ga0373925_0061993
2972	Ga0373925_0197610
2973	Ga0395899_0069036
2974	Ga0395900_0038014
2975	Ga0395900_0059055
2976	Ga0395898_0009730
2977	Ga0395905_0000059
2978	Ga0395905_0000249
2979	Ga0395905_0002979
2980	Ga0395905_0017642
2981	Ga0395905_0038134
2982	Ga0395905_0093216
2983	Ga0395905_0136277
2984	Ga0395905_0204596
2985	Ga0436364_0007287
2986	Ga0237819_02139
2987	Ga0400485_13367
2988	Ga0400483_072274
2989	Ga0400483_213022
2990	Ga0400483_217782
2991	Ga0436365_0185891
2992	Ga0436365_1723405
2993	Ga0436361_0084387
2994	Ga0436361_0089016
2995	Ga0436361_0220501
2996	Ga0436361_0509869
2997	Ga0436361_0942191
2998	Ga0436361_1204257
2999	Ga0436361_1216391
3000	Ga0439436_0000379
3001	Ga0439438_023302
3002	Ga0439438_034515
3003	Ga0439447_003115
3004	Ga0439447_004011
3005	Ga0439447_006156
3006	Ga0439447_010237
3007	Ga0439447_019088
3008	Ga0439466_0000709
3009	Ga0439466_0000811
3010	Ga0439466_0008675
3011	Ga0439466_0013881
3012	Ga0439466_0042803
3013	Ga0439465_0050317
3014	Ga0439465_0077282
3015	Ga0451793_0219815
3016	Ga0451804_0076240
3017	Ga0451853_2791224
3018	Ga0451853_3614585
3019	Ga0439442_009796
3020	Ga0439432_007416
3021	Ga0439432_010965
3022	Ga0439449_0023176
3023	Ga0439451_010261
3024	Ga0439451_010569
3025	Ga0439451_020483
3026	Ga0439452_000228
3027	Ga0439452_022566
3028	Ga0439452_033413
3029	Ga0439456_000326
3030	Ga0439456_024032
3031	Ga0439463_000167
3032	Ga0439463_016590
3033	Ga0450923_004147
3034	Ga0450890_006910
3035	Ga0450904_000045
3036	Ga0450906_002438
3037	Ga0450906_008729
3038	Ga0450907_000056
3039	Ga0450907_003657
3040	Ga0450910_013449
3041	Ga0439446_0000087
3042	Ga0439458_0019192
3043	Ga0450908_005412
3044	Ga0450909_013021
3045	Ga0439460_0006798
3046	Ga0450893_0023357
3047	Ga0451577_0000068
3048	Ga0451577_0004102
3049	Ga0451577_0220059
3050	Ga0439440_0003218
3051	Ga0466969_0072845
3052	Ga0466972_0011791
3053	Ga0466978_0008643
3054	Ga0466965_0009640
3055	Ga0466965_0010921
3056	Ga0466966_0266764
3057	Ga0466961_0000187
3058	Ga0466961_0000728
3059	Ga0466961_0001099
3060	Ga0466961_0010060
3061	Ga0466961_0066408
3062	Ga0466964_0013345
3063	Ga0466964_0113655
3064	Ga0453684_0000279
3065	Ga0453684_0037004
3066	Ga0453684_0143822
3067	Ga0466971_0004905
3068	Ga0466970_0001856
3069	Ga0466970_0003617
3070	Ga0466970_0006458
3071	Ga0466970_0039891
3072	Ga0466957_0084042
3073	Ga0466959_0008736
3074	Ga0466959_0013483
3075	Ga0466959_0013619
3076	Ga0466959_0043062
3077	Ga0451576_0020743
3078	Ga0451576_0057070
3079	Ga0451576_0120107
3080	Ga0451576_0242166
3081	Ga0466958_0008779
3082	Ga0466958_0022740
3083	Ga0466958_0036011
3084	Ga0466958_0069194
3085	Ga0466967_0030232
3086	Ga0495617_000307
3087	Ga0495617_010311
3088	Ga0495627_000130
3089	Ga0495627_004801
3090	Ga0495627_007559
3091	Ga0495592_0013664
3092	Ga0495592_0083803
3093	Ga0495603_0000533
3094	Ga0495603_0001445
3095	Ga0495603_0007398
3096	Ga0495603_0020266
3097	Ga0495590_0007714
3098	Ga0495590_0007748
3099	Ga0495590_0009324
3100	Ga0495590_0011614
3101	Ga0495590_0026088
3102	Ga0495591_000119
3103	Ga0495591_000264
3104	Ga0495591_000756
3105	Ga0495591_004015
3106	Ga0495591_006268
3107	Ga0495591_015514
3108	Ga0495591_028532
3109	Ga0495629_0000410
3110	Ga0495629_0000476
3111	Ga0495629_0000839
3112	Ga0495629_0003131
3113	Ga0495629_0005441
3114	Ga0495629_0032513
3115	Ga0495629_0051032
3116	Ga0495629_0054153
3117	Ga0495638_0007783
3118	Ga0495638_0009261
3119	Ga0495638_0015054
3120	Ga0495638_0015870
3121	Ga0495638_0043139
3122	Ga0495638_0085106
3123	Ga0495638_0110136
3124	Ga0495638_0120842
3125	Ga0495638_0165722
3126	Ga0495641_0040440
3127	Ga0495651_0002299
3128	Ga0495651_0032113
3129	Ga0495651_0050997
3130	Ga0495651_0070548
3131	Ga0495653_0003728
3132	Ga0495653_0004370
3133	Ga0495653_0005110
3134	Ga0495653_0009595
3135	Ga0495653_0011922
3136	Ga0495653_0069614
3137	Ga0495650_0000936
3138	Ga0495650_0001333
3139	Ga0495650_0001434
3140	Ga0495650_0014157
3141	Ga0495650_0018455
3142	Ga0495650_0034357
3143	Ga0495650_0035273
3144	Ga0495580_0000385
3145	Ga0495580_0001332
3146	Ga0495580_0001735
3147	Ga0495580_0002124
3148	Ga0495580_0002424
3149	Ga0495580_0014401
3150	Ga0495580_0021597
3151	Ga0495580_0112442
3152	Ga0495580_0160950
3153	Ga0495582_0003164
3154	Ga0495582_0013461
3155	Ga0495605_0000125
3156	Ga0495605_0000149
3157	Ga0495605_0000429
3158	Ga0495605_0004289
3159	Ga0495605_0005452
3160	Ga0495605_0005967
3161	Ga0495605_0012996
3162	Ga0495605_0041646
3163	Ga0495605_0091735
3164	Ga0495639_0005923
3165	Ga0495639_0046603
3166	Ga0495662_0028506
3167	Ga0495664_0001516
3168	Ga0495664_0015349
3169	Ga0495664_0018031
3170	Ga0495664_0021060
3171	Ga0495584_0001014
3172	Ga0495584_0004437
3173	Ga0495584_0008986
3174	Ga0495584_0046652
3175	Ga0495585_0000896
3176	Ga0495594_0000232
3177	Ga0495594_0044363
3178	Ga0495596_0000004
3179	Ga0495596_0002583
3180	Ga0495607_0000312
3181	Ga0495607_0000379
3182	Ga0495607_0000455
3183	Ga0495607_0000464
3184	Ga0495607_0000881
3185	Ga0495607_0001650
3186	Ga0495607_0004316
3187	Ga0495607_0004448
3188	Ga0495607_0009393
3189	Ga0495607_0016086
3190	Ga0495607_0031983
3191	Ga0495607_0054923
3192	Ga0495607_0101246
3193	Ga0495607_0127099
3194	Ga0495583_0000196
3195	Ga0495583_0000400
3196	Ga0495583_0000990
3197	Ga0495583_0001481
3198	Ga0495583_0002285
3199	Ga0495583_0002749
3200	Ga0495583_0003079
3201	Ga0495583_0005581
3202	Ga0495583_0006038
3203	Ga0495583_0010231
3204	Ga0495583_0010765
3205	Ga0495583_0020302
3206	Ga0495606_0000169
3207	Ga0495606_0000255
3208	Ga0495606_0000712
3209	Ga0495606_0001681
3210	Ga0495606_0005043
3211	Ga0495606_0035777
3212	Ga0495606_0038069
3213	Ga0495606_0043008
3214	Ga0495606_0057651
3215	Ga0495606_0103139
3216	Ga0495606_0140510
3217	Ga0495608_0001569
3218	Ga0495610_0002041
3219	Ga0495610_0021553
3220	Ga0495610_0025146
3221	Ga0495610_0025674
3222	Ga0495616_0012710
3223	Ga0495616_0017798
3224	Ga0495616_0019669
3225	Ga0495616_0028167
3226	Ga0495616_0104353
3227	Ga0495616_0129504
3228	Ga0495616_0129527
3229	Ga0495618_0002524
3230	Ga0495618_0009039
3231	Ga0495620_0000002
3232	Ga0495620_0000055
3233	Ga0495620_0001154
3234	Ga0495620_0001652
3235	Ga0495620_0002930
3236	Ga0495620_0022464
3237	Ga0495620_0087047
3238	Ga0495620_0127861
3239	Ga0495628_0003520
3240	Ga0495628_0004273
3241	Ga0495628_0004598
3242	Ga0495628_0008836
3243	Ga0495628_0015011
3244	Ga0495628_0036103
3245	Ga0495630_0008991
3246	Ga0495630_0019995
3247	Ga0495630_0039481
3248	Ga0495630_0077636
3249	Ga0495631_0008485
3250	Ga0495632_0000807
3251	Ga0495632_0010531
3252	Ga0495632_0019607
3253	Ga0495632_0042859
3254	Ga0495637_0000162
3255	Ga0495637_0000231
3256	Ga0495637_0006414
3257	Ga0495637_0008558
3258	Ga0495637_0010082
3259	Ga0495637_0043337
3260	Ga0495643_0000975
3261	Ga0495643_0021268
3262	Ga0495643_0039452
3263	Ga0495643_0058275
3264	Ga0495643_0070690
3265	Ga0495644_0000341
3266	Ga0495644_0071082
3267	Ga0495648_0000984
3268	Ga0495648_0002651
3269	Ga0495648_0006586
3270	Ga0495648_0012701
3271	Ga0495648_0012970
3272	Ga0495648_0018479
3273	Ga0495648_0019219
3274	Ga0495648_0034451
3275	Ga0495648_0044874
3276	Ga0495648_0091083
3277	Ga0495648_0144532
3278	Ga0495666_0000170
3279	Ga0495666_0010921
3280	Ga0495666_0014864
3281	Ga0495666_0040353
3282	Ga0495642_0000027
3283	Ga0495642_0000055
3284	Ga0495642_0000139
3285	Ga0495642_0019048
3286	Ga0495652_0001431
3287	Ga0495652_0003179
3288	Ga0495652_0011308
3289	Ga0495652_0011555
3290	Ga0495652_0056488
3291	Ga0495652_0080568
3292	Ga0495652_0117053
3293	Ga0495654_0001596
3294	Ga0495654_0008893
3295	Ga0495654_0009508
3296	Ga0495654_0021695
3297	Ga0495654_0028385
3298	Ga0495665_0000432
3299	Ga0495665_0001567
3300	Ga0495665_0005206
3301	Ga0495665_0008500
3302	Ga0495665_0017601
3303	Ga0495640_0014649
3304	Ga0495640_0028142
3305	Ga0495586_0001425
3306	Ga0495586_0001656
3307	Ga0495587_0010421
3308	Ga0495587_0015992
3309	Ga0495609_0000087
3310	Ga0495609_0000174
3311	Ga0495609_0000213
3312	Ga0495609_0000307
3313	Ga0495609_0015073
3314	Ga0495609_0015687
3315	Ga0495609_0083384
3316	Ga0495621_0035077
3317	Ga0495597_0000097
3318	Ga0495597_0011814
3319	Ga0495597_0027163
3320	Ga0495597_0039085
3321	Ga0495597_0052622
3322	Ga0495597_0059175
3323	Ga0495645_0005409
3324	Ga0495645_0035211
3325	Ga0495645_0228103
3326	Ga0495622_0000302
3327	Ga0495622_0000485
3328	Ga0495622_0018033
3329	Ga0495622_0024340
3330	Ga0495622_0048571
3331	Ga0495622_0070369
3332	Ga0495633_0000134
3333	Ga0495633_0039832
3334	Ga0495633_0045478
3335	Ga0495667_0047962
3336	Ga0495656_0004367
3337	Ga0495668_0000135
3338	Ga0495668_0000940
3339	Ga0495668_0003531
3340	Ga0495668_0024043
3341	Ga0495668_0043840
3342	Ga0495668_0051226
3343	Ga0495668_0087225
3344	Ga0495634_0003130
3345	Ga0495634_0005291
3346	Ga0495634_0009676
3347	Ga0495634_0013241
3348	Ga0495634_0013785
3349	Ga0495611_0000256
3350	Ga0495611_0001001
3351	Ga0495611_0015343
3352	Ga0495611_0063371
3353	Ga0495625_0000145
3354	Ga0495625_0000292
3355	Ga0495625_0010212
3356	Ga0495625_0048247
3357	Ga0495625_0068649
3358	Ga0495625_0212010
3359	Ga0495635_0007554
3360	Ga0495635_0038525
3361	Ga0495635_0073019
3362	Ga0495635_0114713
3363	Ga0495659_0024666
3364	Ga0495661_0000127
3365	Ga0495661_0000193
3366	Ga0495661_0000306
3367	Ga0495661_0000608
3368	Ga0495661_0001372
3369	Ga0495661_0003433
3370	Ga0495661_0012242
3371	Ga0495661_0015559
3372	Ga0495661_0027752
3373	Ga0495661_0052899
3374	Ga0495657_0049442
3375	Ga0495599_0004015
3376	Ga0495599_0076000
3377	Ga0495623_0011656
3378	Ga0495623_0012575
3379	Ga0495623_0017335
3380	Ga0495623_0045997
3381	Ga0495623_0200357
3382	Ga0495646_0000533
3383	Ga0495646_0001277
3384	Ga0495646_0006647
3385	Ga0495646_0010111
3386	Ga0495646_0031218
3387	Ga0495646_0031952
3388	Ga0495646_0057643
3389	Ga0495647_0006114
3390	Ga0495658_0025447
3391	Ga0495658_0030636
3392	Ga0495669_0000670
3393	Ga0495613_0001037
3394	Ga0495613_0002040
3395	Ga0495624_0000466
3396	Ga0495624_0002908
3397	Ga0495624_0006386
3398	Ga0495624_0009023
3399	Ga0495624_0018455
3400	Ga0495624_0022361
3401	Ga0495624_0041736
3402	Ga0495624_0048787
3403	Ga0495624_0231651
3404	Ga0495670_0002630
3405	Ga0495670_0003687
3406	Ga0495670_0006261
3407	Ga0495670_0120826
3408	Ga0495671_0000569
3409	Ga0495671_0001596
3410	Ga0495671_0002517
3411	Ga0495671_0004348
3412	Ga0495671_0008415
3413	Ga0495671_0014785
3414	Ga0495671_0034235
3415	Ga0495671_0063190
3416	Ga0495649_0000288
3417	Ga0495649_0002121
3418	Ga0495649_0031290
3419	Ga0495649_0035367
3420	Ga0495649_0046869
3421	Ga0495649_0057580
3422	Ga0495589_0000720
3423	Ga0495589_0000913
3424	Ga0495589_0002553
3425	Ga0495589_0010749
3426	Ga0495589_0088261
3427	Ga0495600_0002213
3428	Ga0495600_0021694
3429	Ga0495660_0001305
3430	Ga0495660_0003345
3431	Ga0495660_0004982
3432	Ga0495660_0009735
3433	Ga0495660_0010224
3434	Ga0495660_0022443
3435	Ga0495660_0026284
3436	Ga0495660_0033540
3437	Ga0495581_0001458
3438	Ga0495581_0009182
3439	Ga0495581_0066673
3440	Ga0495604_0015642
3441	Ga0495604_0087504
3442	Ga0495636_0004287
3443	Ga0495674_0005364
3444	Ga0495674_0009410
3445	Ga0495674_0010002
3446	Ga0495674_0029218
3447	Ga0495674_0050249
3448	Ga0495674_0085795
3449	Ga0495674_0319735
3450	Ga0495672_0013200
3451	Ga0495672_0020399
3452	Ga0495672_0024349
3453	Ga0495672_0032506
3454	Ga0495672_0111481
3455	Ga0495676_0000119
3456	Ga0495676_0002532
3457	Ga0495676_0021549
3458	Ga0495676_0037186
3459	Ga0495676_0049955
3460	Ga0495676_0089004
3461	Ga0495680_0002385
3462	Ga0495680_0002420
3463	Ga0495680_0003442
3464	Ga0495680_0009746
3465	Ga0495680_0049542
3466	Ga0495680_0069442
3467	Ga0495683_0000018
3468	Ga0495683_0000095
3469	Ga0495683_0000217
3470	Ga0495683_0000754
3471	Ga0495683_0004031
3472	Ga0495683_0005383
3473	Ga0495683_0023404
3474	Ga0495683_0042536
3475	Ga0495683_0073094
3476	Ga0495683_0099618
3477	Ga0495683_0121111
3478	Ga0495683_0149693
3479	Ga0495687_000131
3480	Ga0495687_000594
3481	Ga0495687_006178
3482	Ga0495687_021706
3483	Ga0495687_022198
3484	Ga0495687_024981
3485	Ga0495687_061358
3486	Ga0495687_098664
3487	Ga0495675_0003888
3488	Ga0495675_0005599
3489	Ga0495675_0009915
3490	Ga0495675_0025559
3491	Ga0495677_0016913
3492	Ga0495679_000050
3493	Ga0495679_000267
3494	Ga0495679_000379
3495	Ga0495679_000683
3496	Ga0495679_000723
3497	Ga0495679_009879
3498	Ga0495679_012191
3499	Ga0495673_0001123
3500	Ga0495673_0001165
3501	Ga0495673_0001214
3502	Ga0495673_0004618
3503	Ga0495673_0006889
3504	Ga0495673_0008791
3505	Ga0495673_0012788
3506	Ga0495673_0052869
3507	Ga0495681_0000961
3508	Ga0495681_0001069
3509	Ga0495681_0004354
3510	Ga0495681_0014766
3511	Ga0495681_0025087
3512	Ga0495684_0070278
3513	Ga0495686_0000021
3514	Ga0495686_0010831
3515	Ga0495686_0025907
3516	Ga0495593_0000534
3517	Ga0495593_0003089
3518	Ga0495593_0007015
3519	Ga0495593_0023507
3520	Ga0495593_0040854
3521	Ga0495593_0062199
3522	Ga0495602_0001009
3523	Ga0495602_0008243
3524	Ga0495602_0012477
3525	Ga0495602_0024476
3526	Ga0495602_0080537
3527	Ga0495614_0000824
3528	Ga0495614_0025861
3529	Ga0495614_0028745
3530	Ga0495626_0000172
3531	Ga0495626_0000259
3532	Ga0495626_0000263
3533	Ga0495626_0002323
3534	Ga0495626_0003152
3535	Ga0495626_0008706
3536	Ga0495626_0031725
3537	Ga0495626_0032200
3538	Ga0495626_0039942
3539	Ga0495626_0051941
3540	Ga0496100_0168208
3541	Ga0496101_0001774
3542	Ga0496101_0012857
3543	Ga0496101_0017591
3544	Ga0496102_0007255
3545	Ga0496102_0013301
3546	Ga0496102_0027150
3547	Ga0496102_0260184
3548	Ga0496103_0014669
3549	Ga0496103_0128637
3550	Ga0496104_0059811
3551	Ga0496104_0069291
3552	Ga0496105_0007454
3553	Ga0496105_0007469
3554	Ga0496105_0032353
3555	Ga0496105_0086944
3556	Ga0496105_0123894
3557	Ga0496106_0011680
3558	Ga0496106_0138058
3559	Ga0496106_0254621
3560	Ga0496107_0027107
3561	Ga0496107_0032918
3562	Ga0496107_0034705
3563	Ga0496107_0063271
3564	Ga0496107_0136846
3565	Ga0496107_0215006
3566	Ga0496108_0050158
3567	Ga0496108_0109992
3568	Ga0496110_0002740
3569	Ga0496110_0029211
3570	Ga0496110_0164469
3571	Ga0496110_0241380
3572	Ga0496111_0045142
3573	Ga0496112_0002167
3574	Ga0496112_0013918
3575	Ga0496112_0018750
3576	Ga0496113_0015300
3577	Ga0496114_0004974
3578	Ga0496114_0005954
3579	Ga0496114_0024018
3580	Ga0496114_0472926
3581	Ga0496115_0260938
3582	Ga0496116_0000085
3583	Ga0496116_0190590
3584	Ga0496117_0000332
3585	Ga0496117_0004030
3586	Ga0496117_0004751
3587	Ga0496117_0017724
3588	Ga0496117_0022270
3589	Ga0496118_0001261
3590	Ga0496118_0006078
3591	Ga0496118_0020229
3592	Ga0496118_0034178
3593	Ga0496118_0035949
3594	Ga0496118_0044026
3595	Ga0496118_0084974
3596	Ga0496118_0129642
3597	Ga0496118_0144815
3598	Ga0496118_0159288
3599	Ga0496119_0001099
3600	Ga0496119_0001480
3601	Ga0496119_0047980
3602	Ga0496120_0000052
3603	Ga0496120_0000137
3604	Ga0496120_0068678
3605	Ga0496121_0000102
3606	Ga0496121_0000179
3607	Ga0496121_0000858
3608	Ga0496121_0003434
3609	Ga0496121_0004169
3610	Ga0496121_0007246
3611	Ga0496121_0009096
3612	Ga0496121_0012751
3613	Ga0496121_0016995
3614	Ga0496121_0020733
3615	Ga0496121_0036214
3616	Ga0496121_0181314
3617	Ga0496121_0181489
3618	Ga0496122_0000324
3619	Ga0496122_0003009
3620	Ga0496122_0003551
3621	Ga0496122_0012647
3622	Ga0496122_0058150
3623	Ga0496122_0080037
3624	Ga0496123_0000550
3625	Ga0496123_0008278
3626	Ga0496123_0013187
3627	Ga0496123_0016377
3628	Ga0496123_0018139
3629	Ga0496123_0065502
3630	Ga0496124_0000017
3631	Ga0496124_0000355
3632	Ga0496124_0000772
3633	Ga0496124_0007064
3634	Ga0496124_0018474
3635	Ga0496124_0022061
3636	Ga0496124_0032733
3637	Ga0496124_0112314
3638	Ga0496124_0167730
3639	Ga0496124_0237029
3640	Ga0496124_0242636
3641	Ga0496124_0247335
3642	Ga0496125_0001171
3643	Ga0496125_0015408
3644	Ga0496125_0020562
3645	Ga0496125_0022409
3646	Ga0496125_0024444
3647	Ga0496125_0036147
3648	Ga0496125_0045699
3649	Ga0496125_0051308
3650	Ga0496125_0131881
3651	Ga0496126_0000400
3652	Ga0496126_0001236
3653	Ga0496126_0007689
3654	Ga0496126_0257462
3655	Ga0495678_000108
3656	Ga0495678_000338
3657	Ga0495678_002574
3658	Ga0495678_005524
3659	Ga0495678_052195
3660	Ga0495678_064808
3661	Ga0495682_0000050
3662	Ga0495682_0000170
3663	Ga0495682_0035408
3664	Ga0495682_0041268
3665	Ga0501031_0162388
3666	Ga0501032_0040856
3667	Ga0501033_0028046
3668	Ga0501034_0000041
3669	Ga0501034_0056941
3670	Ga0501034_0172972
3671	Ga0501034_0314736
3672	Ga0501036_0005769
3673	Ga0501036_0176508
3674	Ga0501038_0005617
3675	Ga0501038_0193281
3676	Ga0501043_0000072
3677	Ga0501043_0025772
3678	Ga0501046_0000112
3679	Ga0501046_0004385
3680	Ga0501046_0070855
3681	Ga0501047_0000138
3682	Ga0501048_0001412
3683	Ga0501048_0105898
3684	Ga0501067_0065009
3685	Ga0501070_0020731
3686	Ga0501070_0155986
3687	Ga0501070_0183962
3688	Ga0501072_0018052
3689	Ga0501072_0356181
3690	Ga0501073_0029261
3691	Ga0501073_0033119
3692	Ga0501074_0013567
3693	Ga0501077_0139209
3694	Ga0501080_0007238
3695	Ga0501080_0072221
3696	Ga0501081_0014703
3697	Ga0501083_0005249
3698	Ga0501083_0027219
3699	Ga0501083_0227142
3700	Ga0501241_024843
3701	Ga0501262_000009
3702	Ga0501035_0055675
3703	Ga0501035_0348896
3704	Ga0501044_0001940
3705	Ga0501044_0018348
3706	Ga0501044_0073114
3707	Ga0501044_0080171
3708	Ga0501044_0134060
3709	Ga0501045_0008786
3710	nmdc:mga03683_10444_c1
3711	nmdc:mga03683_110631_c1
3712	nmdc:mga03683_1938_c1
3713	nmdc:mga03683_5647_c1
3714	nmdc:mga03n38_120272_c1
3715	nmdc:mga03n38_16956_c1
3716	nmdc:mga00v17_189982_c1
3717	nmdc:mga00v17_90108_c1
3718	nmdc:mga0k408_2639_c1
3719	nmdc:mga0k408_39408_c1
3720	nmdc:mga0k408_426_c2
3721	nmdc:mga0k408_45758_c1
3722	nmdc:mga0k408_460_c1
3723	nmdc:mga0k408_5960_c1
3724	nmdc:mga0k408_79184_c1
3725	nmdc:mga0k408_8135_c1
3726	nmdc:mga0k408_9093_c1
3727	nmdc:mga06z11_14628_c1
3728	nmdc:mga06z11_43890_c1
3729	nmdc:mga07m45_171_c2
3730	nmdc:mga07m45_18310_c1
3731	nmdc:mga07m45_204_c1
3732	nmdc:mga07m45_23682_c1
3733	nmdc:mga07m45_5769_c1
3734	nmdc:mga05p37_361848_c1
3735	nmdc:mga09592_254022_c1
3736	nmdc:mga0qj67_213447_c1
3737	nmdc:mga0qj67_56324_c1
3738	nmdc:mga06r32_10081_c1
3739	nmdc:mga06r32_253151_c1
3740	nmdc:mga08y16_283_c1
3741	nmdc:mga08y16_317862_c1
3742	nmdc:mga0sz30_2070_c1
3743	nmdc:mga0sz30_91813_c1
3744	Ga0495612_0055479
3745	Ga0500610_0002019
3746	Ga0500610_0002652
3747	Ga0500578_0000719
3748	Ga0500651_0003767
3749	Ga0500651_0157477
3750	Ga0500641_0101829
3751	Ga0500571_003409
3752	Ga0500593_006856
3753	Ga0500594_0009443
3754	Ga0500594_0026071
3755	Ga0500595_000045
3756	Ga0500595_000392
3757	Ga0500607_000040
3758	Ga0500618_007176
3759	Ga0500626_049160
3760	Ga0500642_0000487
3761	Ga0500652_000362
3762	Ga0500655_005931
3763	Ga0500658_0000179
3764	Ga0500658_0005813
3765	Ga0500658_0056682
3766	Ga0500659_0000462
3767	Ga0500559_0000407
3768	Ga0500559_0004199
3769	Ga0500559_0014084
3770	Ga0500568_0001521
3771	Ga0500568_0009247
3772	Ga0500568_0020026
3773	Ga0500568_0024164
3774	Ga0500568_0043597
3775	Ga0500574_001145
3776	Ga0500604_0004857
3777	Ga0500604_0033766
3778	Ga0500616_0002061
3779	Ga0500622_0000262
3780	Ga0500622_0003164
3781	Ga0500627_0010431
3782	Ga0500634_0020089
3783	Ga0500634_0083769
3784	Ga0500638_020068
3785	Ga0501084_0012515
3786	Ga0590071_001548
3787	Ga0501082_0007663
3788	Ga0501082_0058056
3789	Ga0501082_0184430
3790	Ga0501082_0211555
3791	Ga0466962_0001386
3792	Ga0466962_0008339
3793	2501072335
3794	2501079962
3795	2501083628
3796	2501412345
3797	2509127562
3798	2510284978
3799	2510294190
3800	2510313217
3801	2511087541
3802	2511087849
3803	2511101519
3804	2511107878
3805	2511247557
3806	2511257210
3807	2511263038
3808	2511274853
3809	2511277973
3810	2511291089
3811	2511294526
3812	2511300499
3813	2511312986
3814	2511323096
3815	2511328577
3816	2511332068
3817	2511336124
3818	2511341006
3819	2511345071
3820	2511348530
3821	2511356974
3822	2511362210
3823	2511371450
3824	2511373459
3825	2511385367
3826	2511823493
3827	2512325015
3828	2513226491
3829	2513552987
3830	2513559838
3831	2513960362
3832	2514053975
3833	2515690003
3834	2516018156
3835	2516022850
3836	2527076931
3837	2547374546
3838	2553002784
3839	2554816312
3840	2555246132
3841	2555668552
3842	2563059420
3843	2583791139
3844	2585295702
3845	2587733102
3846	2597856716
3847	2597865202
3848	2597871062
3849	2599356924
3850	2599362289
3851	2599368609
3852	2599375398
3853	2599382029
3854	2599388476
3855	2599394256
3856	2599400334
3857	2599406021
3858	2599451335
3859	2599464571
3860	2599468895
3861	2599483739
3862	2599493594
3863	2599503982
3864	2599508650
3865	2599512509
3866	2599519858
3867	2599616383
3868	2599626138
3869	2599675777
3870	2599682339
3871	2599695990
3872	2599736024
3873	2599740677
3874	2599748316
3875	2599772689
3876	2599801385
3877	2599878541
3878	2599887721
3879	2599891185
3880	2599901981
3881	2599931944
3882	2599946369
3883	2599947744
3884	2599957637
3885	2599963766
3886	2599965286
3887	2599972839
3888	2599978832
3889	2599986870
3890	2599992267
3891	2599997966
3892	2600003252
3893	2600006931
3894	2600010518
3895	2600021478
3896	2600027043
3897	2600030295
3898	2600036275
3899	2600045222
3900	2600050644
3901	2600056562
3902	2600061374
3903	2600065029
3904	2600070349
3905	2600078877
3906	2600210228
3907	2600216848
3908	2600362245
3909	2600365685
3910	2600445529
3911	2600815216
3912	2601625479
3913	2601689541
3914	2601776555
3915	2601800011
3916	2602009938
3917	2606074190
3918	2606127052
3919	2608380285
3920	2621298243
3921	2624479298
3922	2624493705
3923	2643804562
3924	2643841876
3925	2643869316
3926	2643936357
3927	2643952440
3928	2643969813
3929	2644022204
3930	2644065479
3931	2644141934
3932	2644162101
3933	2644187626
3934	2644273312
3935	2644281806
3936	2644304196
3937	2644317002
3938	2644326764
3939	2644375531
3940	2644399980
3941	2644417081
3942	2644448167
3943	2644622035
3944	2644651276
3945	2644677618
3946	2644686680
3947	2652548781
3948	2671090381
3949	2671098928
3950	2671125821
3951	2671768334
3952	2676745718
3953	2677899985
3954	2678262428
3955	2687581140
3956	2713479640
3957	2715751826
3958	2715759593
3959	2718633147
3960	2723249956
3961	2738671373
3962	2738689128
3963	2738749767
3964	2738808374
3965	2738819822
3966	2738832302
3967	2738858807
3968	2738873829
3969	2738895734
3970	2739185459
3971	2739200725
3972	2739220427
3973	2739256432
3974	2739264515
3975	2739285034
3976	2739290348
3977	2739314243
3978	2743736144
3979	2745008772
3980	2746092016
3981	2746099879
3982	2753571302
3983	2765582630
3984	2772438172
3985	2774123832
3986	2774138469
3987	2784259944
3988	2784317684
3989	2792838658
3990	2794596221
3991	2807409599
3992	2807457901
3993	2808856033
3994	2808923500
3995	2808929936
3996	2808936217
3997	2808941825
3998	2808945738
3999	2808951988
4000	2808957554
4001	2808964538
4002	2808973163
4003	2808977908
4004	2808993388
4005	2808999426
4006	2809008009
4007	2809014812
4008	2809216248
4009	2812365788
4010	2817257762
4011	2817281840
4012	2817451419
4013	2817492614
4014	2819545081
4015	2819622043
4016	2819629927
4017	2819636902
4018	2819654463
4019	2819704049
4020	2825653222
4021	2831272320
4022	2834031795
4023	2838059480
4024	2840883680
4025	2842330197
4026	2842356760
4027	2842457781
4028	2842488572
4029	2842679483
4030	2842810160
4031	2842827572
4032	2842832826
4033	2842841320
4034	2842848494
4035	2842859024
4036	2843692066
4037	2844534452
4038	2844669050
4039	2852613020
4040	2852658763
4041	2852669245
4042	2856287974
4043	2857358403
4044	2857361407
4045	2857542933
4046	2860340157
4047	2860871706
4048	2863427088
4049	2870073723
4050	2878031307
4051	2880232157
4052	2881846739
4053	2883089672
4054	2883090439
4055	2883294984
4056	2883356540
4057	2885202681
4058	2885216334
4059	2885279164
4060	2888352440
4061	2888368188
4062	2898795547
4063	2900578264
4064	2900635878
4065	2904484251
4066	2904522318
4067	2904555652
4068	2904571070
4069	2904578218
4070	2904618166
4071	2908451115
4072	2912965200
4073	2913038400
4074	2917072323
4075	2917835566
4076	2919064223
4077	2919129670
4078	2919386269
4079	2919461899
4080	2919462542
4081	2919481666
4082	2919491452
4083	2919503950
4084	2919530194
4085	2919683220
4086	2919703636
4087	2919704431
4088	2920826924
4089	2921649880
4090	2922134961
4091	2923155158
4092	2923510870
4093	2923525756
4094	2923587479
4095	2926065477
4096	2928061908
4097	2928075614
4098	2928089533
4099	2928109949
4100	2928135167
4101	2928136596
4102	2928158210
4103	2928167569
4104	2928174104
4105	2928177890
4106	2928509023
4107	2928542852
4108	2929145843
4109	2929193746
4110	2929525763
4111	2931370810
4112	2931395072
4113	2931399950
4114	2935354487
4115	2937969912
4116	2939642496
4117	2939653573
4118	2945909550
4119	2945932239
4120	2945935817
4121	2945949667
4122	2945961860
4123	2945975328
4124	2945988471
4125	2946008428
4126	2946032211
4127	2947239041
4128	2952253607
4129	2967998979
4130	2968002672
4131	2969306075
4132	2974292264
4133	2974299761
4134	2977976069
4135	2977991092
4136	2979747977
4137	2981996601
4138	2984290880
4139	2984504354
4140	2984569115
4141	2988733375
4142	2990710272
4143	2996337344
4144	2998141481
4145	3007400697
4146	3007421166
4147	3007512880
4148	3007615922
4149	3007623947
4150	3007720017
4151	3007806901
4152	3007856078
4153	3007863287
4154	3007868020
4155	3007874615
4156	642422795
4157	642417097
4158	642592402
4159	642620602
4160	8003956316
4161	8005488203
4162	8011356715
4163	8015397706
4164	8015689377
4165	8018848605
4166	8018852283
4167	8019771092
4168	8019781167
4169	8020808274
4170	8020943826
4171	8020952825
4172	8020954648
4173	8021123688
4174	8021126358
4175	8029999269
4176	8034965748
4177	8039103129
4178	8039104398
4179	8040172331
4180	8040179000
4181	8052498598
4182	8054289800
4183	8054350672
4184	8054507573
4185	8054933840
4186	8055304946
4187	8055772512
4188	8055822515
4189	8055879419
4190	8056119904
4191	8056122228
4192	8056130317
4193	8056135971
4194	8056141539
4195	8056147441
4196	8056150294
4197	8056155250
4198	8056162183
4199	8056175690
4200	8056181019
4201	8056570148
4202	8057803840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

96

369

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3nip-assembly1.cif.gz_D	crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane	0.9613	6	307
3nio-assembly1.cif.gz_D	crystal structure of pseudomonas aeruginosa guanidinobutyrase	0.9588	4	314
3nio-assembly1.cif.gz_D	crystal structure of pseudomonas aeruginosa guanidinobutyrase	0.947	4	314
1gq6-assembly1.cif.gz_B	proclavaminate amidino hydrolase from streptomyces clavuligerus	0.9415	15	307
8c0h-assembly1.cif.gz_C	error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8c0h	0.9318	9	307

ID	Description	Score	Start	End	Superfamily
1gq7A00	Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain	0.9617	15	305	3.40.800.10
3niqB00	Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain	0.9616	6	307	3.40.800.10
3nioD00	Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain	0.9421	4	314	3.40.800.10
3nioD00	Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain	0.9392	4	314	3.40.800.10
af_A0A1D8PPP3_13_348_3.40.800.10	Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain	0.936	12	308	3.40.800.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1G3DYT5-F1-model_v4	deleted	0.9878	103	314
AF-A0A127QCC5-F1-model_v4	Agmatinase	0.9868	5	314	GO:0008783 GO:0033389 GO:0046872
AF-A0A7W9U264-F1-model_v4	Guanidinobutyrase (EC 3.5.3.7)	0.9867	5	314	GO:0008783 GO:0033389 GO:0046872 GO:0047971
AF-A0A1I8AMY8-F1-model_v4	Agmatinase	0.9867	90	281	GO:0008783 GO:0033389 GO:0046872
AF-A0A158J0R4-F1-model_v4	Agmatinase	0.9865	6	314	GO:0008783 GO:0033389 GO:0046872

F496397

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00491

Arginase

Arginase family

96

369

0.97

Structural Annotation

Top 5 Hits

Map