F496399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2104 | 564 | 4208 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100361556|Ga0070671_1003615562 |
| Length | 97 |
| Sequence | MPVIKAIATTPTWRQFMAEKTIEEKVKDIIVEQLGVNPEQVTPTASFIEDLGADSLDTVELVMAFEEEFSVEVPDEDAEKLQSVGDVIKYIEEKTSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 105 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 136 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 137 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 153 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 157 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 158 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 161 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 162 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 164 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 248 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 255 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 269 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 287 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 309 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 314 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 315 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 316 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 317 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 318 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 319 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 325 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 328 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 329 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 330 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 331 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 332 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 333 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 334 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 335 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 336 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 337 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 338 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 339 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 340 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 341 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 342 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 343 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 344 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 345 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 346 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 347 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 348 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 349 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 350 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 351 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 352 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 353 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 354 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 355 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 356 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 357 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 358 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 359 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 360 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 361 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 420 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 421 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 422 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 423 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 424 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 425 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 428 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 429 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 430 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 431 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 432 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 433 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 434 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 435 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 436 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 438 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 439 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 440 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 441 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 442 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 470 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 471 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 472 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 473 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 474 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 475 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 476 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 477 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 478 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 479 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 480 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 481 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 482 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 483 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 484 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 485 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 486 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 487 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 488 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 489 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 490 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 491 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 492 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 493 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 494 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 496 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 499 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 500 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 501 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 502 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 503 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 504 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 505 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 506 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 507 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 508 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 513 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 514 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 515 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 516 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 517 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 518 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 519 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 523 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 524 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 533 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 534 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 535 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 536 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 537 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 538 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 539 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 541 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 542 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 543 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 544 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 546 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 547 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 548 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 564 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 1.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0 |
| Rhizoplane | 4.8 |
| Rhizosphere | 91.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100361556 | 3300005355 | Bacteria | 1239 |
| 2 | CNXas_1000097 | 3300000545 | Bacteria | 16032 |
| 3 | JGI24737J22298_10175400 | 3300001990 | Unclassified | 633 |
| 4 | JGI24743J22301_10000004 | 3300001991 | Bacteria | 25840 |
| 5 | JGI24743J22301_10047673 | 3300001991 | Unclassified | 869 |
| 6 | JGI24743J22301_10050578 | 3300001991 | Bacteria | 846 |
| 7 | JGI24745J21846_1024228 | 3300002073 | Bacteria | 719 |
| 8 | JGI24738J21930_10135760 | 3300002075 | Unclassified | 541 |
| 9 | JGI24744J21845_10113277 | 3300002077 | Bacteria | 504 |
| 10 | JGI24035J26624_1002575 | 3300002126 | Unclassified | 1695 |
| 11 | JGI24035J26624_1018071 | 3300002126 | Bacteria | 733 |
| 12 | JGI24035J26624_1029495 | 3300002126 | Bacteria | 595 |
| 13 | JGI24035J26624_1034669 | 3300002126 | Unclassified | 556 |
| 14 | JGI24033J26618_1000030 | 3300002155 | Bacteria | 21924 |
| 15 | JGI25406J46586_10026149 | 3300003203 | Bacteria | 2255 |
| 16 | rootH2_10064825 | 3300003320 | Bacteria | 1327 |
| 17 | rootH2_10178873 | 3300003320 | Bacteria | 5063 |
| 18 | rootH2_10318002 | 3300003320 | Bacteria | 1103 |
| 19 | rootL2_10115884 | 3300003322 | Bacteria | 4993 |
| 20 | rootH1_10060333 | 3300003323 | Bacteria | 6523 |
| 21 | rootH1_10354418 | 3300003323 | Bacteria | 2271 |
| 22 | Ga0055530_10006290 | 3300003791 | Bacteria | 5340 |
| 23 | JGI25405J52794_10002120 | 3300003911 | Bacteria | 3374 |
| 24 | JGI25405J52794_10004418 | 3300003911 | Bacteria | 2511 |
| 25 | JGI25405J52794_10057353 | 3300003911 | Bacteria | 839 |
| 26 | Ga0058860_11794193 | 3300004801 | Bacteria | 548 |
| 27 | Ga0058860_12144407 | 3300004801 | Bacteria | 776 |
| 28 | Ga0065714_10123883 | 3300005288 | Bacteria | 1317 |
| 29 | Ga0065714_10392326 | 3300005288 | Bacteria | 597 |
| 30 | Ga0065704_10005779 | 3300005289 | Bacteria | 3125 |
| 31 | Ga0065704_10079762 | 3300005289 | Bacteria | 4083 |
| 32 | Ga0065704_10300815 | 3300005289 | Bacteria | 886 |
| 33 | Ga0065704_10420928 | 3300005289 | Bacteria | 732 |
| 34 | Ga0065712_10004344 | 3300005290 | Bacteria | 3727 |
| 35 | Ga0065712_10009419 | 3300005290 | Bacteria | 2488 |
| 36 | Ga0065712_10011361 | 3300005290 | Bacteria | 2602 |
| 37 | Ga0065712_10036450 | 3300005290 | Bacteria | 876 |
| 38 | Ga0065712_10083662 | 3300005290 | Bacteria | 2820 |
| 39 | Ga0065712_10207868 | 3300005290 | Unclassified | 1083 |
| 40 | Ga0065712_10350488 | 3300005290 | Bacteria | 788 |
| 41 | Ga0065712_10469388 | 3300005290 | Bacteria | 671 |
| 42 | Ga0065712_10801227 | 3300005290 | Unclassified | 511 |
| 43 | Ga0065715_10000435 | 3300005293 | Bacteria | 17914 |
| 44 | Ga0065715_10000511 | 3300005293 | Bacteria | 10778 |
| 45 | Ga0065715_10016299 | 3300005293 | Bacteria | 1708 |
| 46 | Ga0065715_10148112 | 3300005293 | Bacteria | 1763 |
| 47 | Ga0065715_10302955 | 3300005293 | Bacteria | 1037 |
| 48 | Ga0065715_10546255 | 3300005293 | Bacteria | 744 |
| 49 | Ga0065715_10566813 | 3300005293 | Bacteria | 730 |
| 50 | Ga0065715_10658722 | 3300005293 | Bacteria | 674 |
| 51 | Ga0065715_10779185 | 3300005293 | Bacteria | 618 |
| 52 | Ga0065715_11021000 | 3300005293 | Bacteria | 540 |
| 53 | Ga0065715_11071634 | 3300005293 | Bacteria | 527 |
| 54 | Ga0065707_10009007 | 3300005295 | Bacteria | 2086 |
| 55 | Ga0065707_10039953 | 3300005295 | Bacteria | 2193 |
| 56 | Ga0065707_10040381 | 3300005295 | Bacteria | 1212 |
| 57 | Ga0065707_10115183 | 3300005295 | Bacteria | 2274 |
| 58 | Ga0065707_10184410 | 3300005295 | Bacteria | 1393 |
| 59 | Ga0065707_10334528 | 3300005295 | Bacteria | 944 |
| 60 | Ga0065707_10532512 | 3300005295 | Bacteria | 734 |
| 61 | Ga0070658_10027394 | 3300005327 | Bacteria | 4573 |
| 62 | Ga0070658_10082408 | 3300005327 | Bacteria | 2643 |
| 63 | Ga0070658_10105984 | 3300005327 | Bacteria | 2325 |
| 64 | Ga0070658_10324139 | 3300005327 | Bacteria | 1316 |
| 65 | Ga0070658_10404713 | 3300005327 | Unclassified | 1172 |
| 66 | Ga0070676_10002928 | 3300005328 | Bacteria | 8815 |
| 67 | Ga0070676_10008825 | 3300005328 | Bacteria | 5443 |
| 68 | Ga0070676_10015823 | 3300005328 | Bacteria | 4161 |
| 69 | Ga0070676_10266829 | 3300005328 | Bacteria | 1148 |
| 70 | Ga0070676_11371497 | 3300005328 | Bacteria | 542 |
| 71 | Ga0070683_100006421 | 3300005329 | Bacteria | 9859 |
| 72 | Ga0070683_100171520 | 3300005329 | Bacteria | 2059 |
| 73 | Ga0070683_100301098 | 3300005329 | Bacteria | 1525 |
| 74 | Ga0070683_101042187 | 3300005329 | Bacteria | 785 |
| 75 | Ga0070690_100655786 | 3300005330 | Bacteria | 802 |
| 76 | Ga0070690_100805465 | 3300005330 | Bacteria | 729 |
| 77 | Ga0070670_100002396 | 3300005331 | Bacteria | 15444 |
| 78 | Ga0070670_100057637 | 3300005331 | Bacteria | 3334 |
| 79 | Ga0070670_100098101 | 3300005331 | Bacteria | 2521 |
| 80 | Ga0070670_100145325 | 3300005331 | Bacteria | 2051 |
| 81 | Ga0070670_100169713 | 3300005331 | Bacteria | 1892 |
| 82 | Ga0070670_100431617 | 3300005331 | Bacteria | 1166 |
| 83 | Ga0070670_100526867 | 3300005331 | Bacteria | 1052 |
| 84 | Ga0070670_100965747 | 3300005331 | Bacteria | 774 |
| 85 | Ga0070670_101585835 | 3300005331 | Unclassified | 602 |
| 86 | Ga0070670_101918050 | 3300005331 | Bacteria | 546 |
| 87 | Ga0070677_10041740 | 3300005333 | Bacteria | 1813 |
| 88 | Ga0070677_10391946 | 3300005333 | Bacteria | 730 |
| 89 | Ga0070677_10394513 | 3300005333 | Bacteria | 728 |
| 90 | Ga0070677_10503049 | 3300005333 | Unclassified | 657 |
| 91 | Ga0070677_10703707 | 3300005333 | Bacteria | 569 |
| 92 | Ga0068869_100242289 | 3300005334 | Bacteria | 1437 |
| 93 | Ga0068869_101985410 | 3300005334 | Bacteria | 522 |
| 94 | Ga0070666_10008100 | 3300005335 | Bacteria | 6509 |
| 95 | Ga0070666_10038827 | 3300005335 | Bacteria | 3170 |
| 96 | Ga0070666_10112608 | 3300005335 | Bacteria | 1882 |
| 97 | Ga0070666_10121590 | 3300005335 | Bacteria | 1811 |
| 98 | Ga0070666_10318307 | 3300005335 | Bacteria | 1109 |
| 99 | Ga0070666_10667718 | 3300005335 | Bacteria | 761 |
| 100 | Ga0070666_11021421 | 3300005335 | Bacteria | 614 |
| 101 | Ga0070682_100121403 | 3300005337 | Bacteria | 1755 |
| 102 | Ga0068868_100037116 | 3300005338 | Bacteria | 3775 |
| 103 | Ga0068868_100112028 | 3300005338 | Bacteria | 2218 |
| 104 | Ga0068868_100146715 | 3300005338 | Bacteria | 1941 |
| 105 | Ga0068868_100300230 | 3300005338 | Bacteria | 1364 |
| 106 | Ga0068868_100430719 | 3300005338 | Bacteria | 1144 |
| 107 | Ga0068868_100474906 | 3300005338 | Bacteria | 1091 |
| 108 | Ga0068868_101133316 | 3300005338 | Bacteria | 721 |
| 109 | Ga0068868_101804567 | 3300005338 | Bacteria | 578 |
| 110 | Ga0068868_102022130 | 3300005338 | Bacteria | 547 |
| 111 | Ga0068868_102299889 | 3300005338 | Unclassified | 514 |
| 112 | Ga0070660_100051082 | 3300005339 | Bacteria | 3183 |
| 113 | Ga0070660_100061750 | 3300005339 | Unclassified | 2910 |
| 114 | Ga0070660_100130839 | 3300005339 | Bacteria | 2008 |
| 115 | Ga0070660_100337027 | 3300005339 | Bacteria | 1241 |
| 116 | Ga0070660_100704475 | 3300005339 | Unclassified | 847 |
| 117 | Ga0070689_100051504 | 3300005340 | Bacteria | 3183 |
| 118 | Ga0070689_100069162 | 3300005340 | Bacteria | 2754 |
| 119 | Ga0070689_100086924 | 3300005340 | Bacteria | 2459 |
| 120 | Ga0070689_100268375 | 3300005340 | Bacteria | 1412 |
| 121 | Ga0070689_100276416 | 3300005340 | Bacteria | 1392 |
| 122 | Ga0070689_100449076 | 3300005340 | Bacteria | 1097 |
| 123 | Ga0070689_100588364 | 3300005340 | Bacteria | 963 |
| 124 | Ga0070689_100895735 | 3300005340 | Bacteria | 785 |
| 125 | Ga0070689_101035171 | 3300005340 | Bacteria | 732 |
| 126 | Ga0070689_101064701 | 3300005340 | Bacteria | 722 |
| 127 | Ga0070689_101226925 | 3300005340 | Unclassified | 674 |
| 128 | Ga0070689_101868970 | 3300005340 | Unclassified | 548 |
| 129 | Ga0070691_10176381 | 3300005341 | Bacteria | 1110 |
| 130 | Ga0070691_10526231 | 3300005341 | Bacteria | 687 |
| 131 | Ga0070687_100012288 | 3300005343 | Bacteria | 3776 |
| 132 | Ga0070687_100105366 | 3300005343 | Bacteria | 1587 |
| 133 | Ga0070687_100296824 | 3300005343 | Unclassified | 1023 |
| 134 | Ga0070687_100515038 | 3300005343 | Bacteria | 808 |
| 135 | Ga0070661_100002856 | 3300005344 | Bacteria | 11872 |
| 136 | Ga0070661_100018988 | 3300005344 | Bacteria | 4895 |
| 137 | Ga0070661_100145965 | 3300005344 | Bacteria | 1786 |
| 138 | Ga0070661_100292369 | 3300005344 | Bacteria | 1266 |
| 139 | Ga0070661_100383199 | 3300005344 | Bacteria | 1109 |
| 140 | Ga0070661_101233180 | 3300005344 | Bacteria | 626 |
| 141 | Ga0070692_10507142 | 3300005345 | Bacteria | 783 |
| 142 | Ga0070668_100018320 | 3300005347 | Bacteria | 5256 |
| 143 | Ga0070668_100095080 | 3300005347 | Bacteria | 2353 |
| 144 | Ga0070668_100141529 | 3300005347 | Bacteria | 1939 |
| 145 | Ga0070668_100219341 | 3300005347 | Bacteria | 1568 |
| 146 | Ga0070668_100227551 | 3300005347 | Bacteria | 1540 |
| 147 | Ga0070668_100735778 | 3300005347 | Bacteria | 872 |
| 148 | Ga0070668_100749964 | 3300005347 | Bacteria | 864 |
| 149 | Ga0070669_100004678 | 3300005353 | Bacteria | 9880 |
| 150 | Ga0070669_100016990 | 3300005353 | Bacteria | 5195 |
| 151 | Ga0070669_100143776 | 3300005353 | Bacteria | 1841 |
| 152 | Ga0070669_100173924 | 3300005353 | Bacteria | 1680 |
| 153 | Ga0070669_100233314 | 3300005353 | Bacteria | 1459 |
| 154 | Ga0070669_100484431 | 3300005353 | Bacteria | 1024 |
| 155 | Ga0070669_100492425 | 3300005353 | Bacteria | 1016 |
| 156 | Ga0070669_101033379 | 3300005353 | Bacteria | 706 |
| 157 | Ga0070669_101446723 | 3300005353 | Bacteria | 597 |
| 158 | Ga0070675_100006094 | 3300005354 | Bacteria | 9245 |
| 159 | Ga0070675_100012173 | 3300005354 | Bacteria | 6745 |
| 160 | Ga0070675_100013338 | 3300005354 | Bacteria | 6457 |
| 161 | Ga0070675_100042482 | 3300005354 | Bacteria | 3714 |
| 162 | Ga0070675_100059069 | 3300005354 | Bacteria | 3163 |
| 163 | Ga0070675_100072844 | 3300005354 | Bacteria | 2852 |
| 164 | Ga0070675_100079112 | 3300005354 | Bacteria | 2739 |
| 165 | Ga0070675_100195839 | 3300005354 | Bacteria | 1752 |
| 166 | Ga0070675_100217305 | 3300005354 | Bacteria | 1663 |
| 167 | Ga0070675_100222726 | 3300005354 | Unclassified | 1643 |
| 168 | Ga0070675_100336398 | 3300005354 | Bacteria | 1336 |
| 169 | Ga0070675_100671398 | 3300005354 | Bacteria | 943 |
| 170 | Ga0070675_101327967 | 3300005354 | Bacteria | 663 |
| 171 | Ga0070675_101493650 | 3300005354 | Bacteria | 623 |
| 172 | Ga0070675_101726670 | 3300005354 | Bacteria | 578 |
| 173 | Ga0070675_101905038 | 3300005354 | Bacteria | 548 |
| 174 | Ga0070671_100005243 | 3300005355 | Bacteria | 10330 |
| 175 | Ga0070671_100012027 | 3300005355 | Bacteria | 6962 |
| 176 | Ga0070671_100020120 | 3300005355 | Bacteria | 5439 |
| 177 | Ga0070671_100030436 | 3300005355 | Bacteria | 4454 |
| 178 | Ga0070671_100096950 | 3300005355 | Bacteria | 2473 |
| 179 | Ga0070671_100097548 | 3300005355 | Bacteria | 2465 |
| 180 | Ga0070671_100493802 | 3300005355 | Bacteria | 1052 |
| 181 | Ga0070671_100606729 | 3300005355 | Bacteria | 946 |
| 182 | Ga0070671_100997212 | 3300005355 | Bacteria | 734 |
| 183 | Ga0070674_100020612 | 3300005356 | Bacteria | 4217 |
| 184 | Ga0070674_100112621 | 3300005356 | Unclassified | 2000 |
| 185 | Ga0070674_100747418 | 3300005356 | Bacteria | 840 |
| 186 | Ga0070674_101283254 | 3300005356 | Bacteria | 652 |
| 187 | Ga0070674_101999688 | 3300005356 | Bacteria | 528 |
| 188 | Ga0070674_102222729 | 3300005356 | Bacteria | 501 |
| 189 | Ga0070673_100004636 | 3300005364 | Bacteria | 8719 |
| 190 | Ga0070673_100007080 | 3300005364 | Bacteria | 7363 |
| 191 | Ga0070673_100185191 | 3300005364 | Bacteria | 1784 |
| 192 | Ga0070673_100471018 | 3300005364 | Bacteria | 1132 |
| 193 | Ga0070673_100810366 | 3300005364 | Bacteria | 865 |
| 194 | Ga0070673_100945156 | 3300005364 | Bacteria | 801 |
| 195 | Ga0070673_101154408 | 3300005364 | Bacteria | 725 |
| 196 | Ga0070673_102143077 | 3300005364 | Bacteria | 531 |
| 197 | Ga0070688_100014902 | 3300005365 | Bacteria | 4412 |
| 198 | Ga0070688_100051469 | 3300005365 | Bacteria | 2569 |
| 199 | Ga0070688_100117718 | 3300005365 | Bacteria | 1775 |
| 200 | Ga0070688_100353336 | 3300005365 | Bacteria | 1076 |
| 201 | Ga0070688_100394796 | 3300005365 | Bacteria | 1023 |
| 202 | Ga0070688_100867497 | 3300005365 | Bacteria | 710 |
| 203 | Ga0070688_101437557 | 3300005365 | Bacteria | 560 |
| 204 | Ga0070659_100014400 | 3300005366 | Bacteria | 5911 |
| 205 | Ga0070659_100086754 | 3300005366 | Bacteria | 2505 |
| 206 | Ga0070659_100102468 | 3300005366 | Bacteria | 2304 |
| 207 | Ga0070659_100403801 | 3300005366 | Bacteria | 1154 |
| 208 | Ga0070659_101074952 | 3300005366 | Bacteria | 708 |
| 209 | Ga0070659_101583937 | 3300005366 | Bacteria | 585 |
| 210 | Ga0070667_100015061 | 3300005367 | Bacteria | 6388 |
| 211 | Ga0070667_100044677 | 3300005367 | Bacteria | 3722 |
| 212 | Ga0070667_100130538 | 3300005367 | Bacteria | 2192 |
| 213 | Ga0070667_100131297 | 3300005367 | Bacteria | 2186 |
| 214 | Ga0070667_100147773 | 3300005367 | Bacteria | 2062 |
| 215 | Ga0070667_100166491 | 3300005367 | Bacteria | 1944 |
| 216 | Ga0070667_100283551 | 3300005367 | Bacteria | 1488 |
| 217 | Ga0070667_100345310 | 3300005367 | Bacteria | 1346 |
| 218 | Ga0070667_100609222 | 3300005367 | Bacteria | 1006 |
| 219 | Ga0070709_10150585 | 3300005434 | Bacteria | 1607 |
| 220 | Ga0070709_11166690 | 3300005434 | Unclassified | 618 |
| 221 | Ga0070709_11510710 | 3300005434 | Bacteria | 545 |
| 222 | Ga0070714_100088834 | 3300005435 | Bacteria | 2704 |
| 223 | Ga0070714_100609579 | 3300005435 | Unclassified | 1049 |
| 224 | Ga0070714_100691372 | 3300005435 | Bacteria | 984 |
| 225 | Ga0070714_100963202 | 3300005435 | Bacteria | 830 |
| 226 | Ga0070714_101336704 | 3300005435 | Bacteria | 700 |
| 227 | Ga0070713_100057257 | 3300005436 | Bacteria | 3244 |
| 228 | Ga0070713_100127332 | 3300005436 | Bacteria | 2242 |
| 229 | Ga0070713_100155469 | 3300005436 | Bacteria | 2038 |
| 230 | Ga0070713_100206390 | 3300005436 | Unclassified | 1777 |
| 231 | Ga0070713_100712154 | 3300005436 | Unclassified | 959 |
| 232 | Ga0070713_101532770 | 3300005436 | Bacteria | 647 |
| 233 | Ga0070713_102108127 | 3300005436 | Bacteria | 547 |
| 234 | Ga0070713_102152223 | 3300005436 | Bacteria | 540 |
| 235 | Ga0070713_102249063 | 3300005436 | Unclassified | 528 |
| 236 | Ga0070713_102259172 | 3300005436 | Bacteria | 527 |
| 237 | Ga0070710_10027829 | 3300005437 | Unclassified | 3018 |
| 238 | Ga0070710_10060473 | 3300005437 | Bacteria | 2155 |
| 239 | Ga0070710_10538722 | 3300005437 | Unclassified | 805 |
| 240 | Ga0070710_10775723 | 3300005437 | Bacteria | 683 |
| 241 | Ga0070701_10013627 | 3300005438 | Bacteria | 3704 |
| 242 | Ga0070701_10864354 | 3300005438 | Bacteria | 622 |
| 243 | Ga0070711_100002516 | 3300005439 | Bacteria | 10472 |
| 244 | Ga0070711_100023705 | 3300005439 | Bacteria | 3995 |
| 245 | Ga0070711_100195614 | 3300005439 | Bacteria | 1557 |
| 246 | Ga0070711_100423751 | 3300005439 | Unclassified | 1085 |
| 247 | Ga0070711_100579932 | 3300005439 | Bacteria | 933 |
| 248 | Ga0070711_100680854 | 3300005439 | Bacteria | 864 |
| 249 | Ga0070711_100788670 | 3300005439 | Bacteria | 805 |
| 250 | Ga0070711_100939489 | 3300005439 | Bacteria | 740 |
| 251 | Ga0070711_101362511 | 3300005439 | Bacteria | 617 |
| 252 | Ga0070711_101497880 | 3300005439 | Unclassified | 588 |
| 253 | Ga0070705_100037482 | 3300005440 | Bacteria | 2735 |
| 254 | Ga0070705_100071004 | 3300005440 | Unclassified | 2104 |
| 255 | Ga0070705_100112251 | 3300005440 | Bacteria | 1744 |
| 256 | Ga0070705_100187518 | 3300005440 | Bacteria | 1406 |
| 257 | Ga0070705_100392457 | 3300005440 | Bacteria | 1025 |
| 258 | Ga0070705_100537339 | 3300005440 | Bacteria | 894 |
| 259 | Ga0070705_100579563 | 3300005440 | Bacteria | 865 |
| 260 | Ga0070705_100867902 | 3300005440 | Bacteria | 723 |
| 261 | Ga0070700_101061962 | 3300005441 | Bacteria | 669 |
| 262 | Ga0070700_101300241 | 3300005441 | Bacteria | 611 |
| 263 | Ga0070694_100007686 | 3300005444 | Bacteria | 6581 |
| 264 | Ga0070694_100039775 | 3300005444 | Bacteria | 3133 |
| 265 | Ga0070708_100003720 | 3300005445 | Bacteria | 11964 |
| 266 | Ga0070708_100026177 | 3300005445 | Unclassified | 4991 |
| 267 | Ga0070708_100029039 | 3300005445 | Bacteria | 4766 |
| 268 | Ga0070708_100180315 | 3300005445 | Unclassified | 1974 |
| 269 | Ga0070708_100386475 | 3300005445 | Bacteria | 1320 |
| 270 | Ga0070708_101316997 | 3300005445 | Bacteria | 675 |
| 271 | Ga0070708_102113767 | 3300005445 | Bacteria | 521 |
| 272 | Ga0070708_102166664 | 3300005445 | Bacteria | 514 |
| 273 | Ga0070663_100178428 | 3300005455 | Bacteria | 1646 |
| 274 | Ga0070663_100289384 | 3300005455 | Bacteria | 1308 |
| 275 | Ga0070663_101155862 | 3300005455 | Bacteria | 679 |
| 276 | Ga0070663_101328405 | 3300005455 | Bacteria | 635 |
| 277 | Ga0070663_101465067 | 3300005455 | Bacteria | 606 |
| 278 | Ga0070678_100056961 | 3300005456 | Bacteria | 2861 |
| 279 | Ga0070678_100063338 | 3300005456 | Bacteria | 2735 |
| 280 | Ga0070678_100237630 | 3300005456 | Bacteria | 1522 |
| 281 | Ga0070678_100302016 | 3300005456 | Bacteria | 1361 |
| 282 | Ga0070678_100569572 | 3300005456 | Bacteria | 1008 |
| 283 | Ga0070678_100818481 | 3300005456 | Bacteria | 847 |
| 284 | Ga0070678_101989151 | 3300005456 | Bacteria | 550 |
| 285 | Ga0070678_102210954 | 3300005456 | Bacteria | 522 |
| 286 | Ga0070678_102254842 | 3300005456 | Bacteria | 517 |
| 287 | Ga0070662_100001580 | 3300005457 | Bacteria | 14070 |
| 288 | Ga0070662_100032771 | 3300005457 | Bacteria | 3653 |
| 289 | Ga0070662_100103381 | 3300005457 | Bacteria | 2160 |
| 290 | Ga0070662_100377860 | 3300005457 | Bacteria | 1166 |
| 291 | Ga0070662_100539848 | 3300005457 | Bacteria | 976 |
| 292 | Ga0070662_101168801 | 3300005457 | Bacteria | 661 |
| 293 | Ga0070662_101433963 | 3300005457 | Bacteria | 595 |
| 294 | Ga0070681_10057225 | 3300005458 | Bacteria | 3879 |
| 295 | Ga0068867_100047794 | 3300005459 | Unclassified | 3147 |
| 296 | Ga0068867_101970692 | 3300005459 | Bacteria | 552 |
| 297 | Ga0070685_10043123 | 3300005466 | Bacteria | 2578 |
| 298 | Ga0070685_10157957 | 3300005466 | Bacteria | 1443 |
| 299 | Ga0070685_11177935 | 3300005466 | Bacteria | 581 |
| 300 | Ga0070706_100001219 | 3300005467 | Bacteria | 27538 |
| 301 | Ga0070706_100030253 | 3300005467 | Unclassified | 4988 |
| 302 | Ga0070706_100030575 | 3300005467 | Bacteria | 4963 |
| 303 | Ga0070706_100037742 | 3300005467 | Unclassified | 4461 |
| 304 | Ga0070706_100054114 | 3300005467 | Bacteria | 3704 |
| 305 | Ga0070706_100189339 | 3300005467 | Bacteria | 1923 |
| 306 | Ga0070706_100202577 | 3300005467 | Bacteria | 1854 |
| 307 | Ga0070706_100249380 | 3300005467 | Bacteria | 1657 |
| 308 | Ga0070706_100314078 | 3300005467 | Bacteria | 1462 |
| 309 | Ga0070706_100582147 | 3300005467 | Bacteria | 1040 |
| 310 | Ga0070706_100734927 | 3300005467 | Bacteria | 915 |
| 311 | Ga0070706_101622026 | 3300005467 | Bacteria | 590 |
| 312 | Ga0070706_101628943 | 3300005467 | Bacteria | 589 |
| 313 | Ga0070706_101935015 | 3300005467 | Bacteria | 535 |
| 314 | Ga0070707_100029247 | 3300005468 | Bacteria | 5247 |
| 315 | Ga0070707_100031437 | 3300005468 | Bacteria | 5057 |
| 316 | Ga0070707_100038062 | 3300005468 | Unclassified | 4593 |
| 317 | Ga0070707_100040090 | 3300005468 | Bacteria | 4479 |
| 318 | Ga0070707_100087284 | 3300005468 | Unclassified | 3017 |
| 319 | Ga0070707_100484228 | 3300005468 | Bacteria | 1199 |
| 320 | Ga0070707_100519529 | 3300005468 | Bacteria | 1153 |
| 321 | Ga0070707_100976501 | 3300005468 | Bacteria | 812 |
| 322 | Ga0070707_101245561 | 3300005468 | Bacteria | 710 |
| 323 | Ga0070707_101545180 | 3300005468 | Bacteria | 630 |
| 324 | Ga0070707_101781870 | 3300005468 | Unclassified | 583 |
| 325 | Ga0070698_100001369 | 3300005471 | Bacteria | 27100 |
| 326 | Ga0070698_100010266 | 3300005471 | Bacteria | 10002 |
| 327 | Ga0070698_100035064 | 3300005471 | Bacteria | 5189 |
| 328 | Ga0070698_101534189 | 3300005471 | Bacteria | 618 |
| 329 | Ga0070699_100008480 | 3300005518 | Bacteria | 8904 |
| 330 | Ga0070699_100009142 | 3300005518 | Bacteria | 8592 |
| 331 | Ga0070699_100205700 | 3300005518 | Unclassified | 1751 |
| 332 | Ga0070699_100496355 | 3300005518 | Bacteria | 1109 |
| 333 | Ga0070699_100543596 | 3300005518 | Bacteria | 1057 |
| 334 | Ga0070699_100633210 | 3300005518 | Unclassified | 976 |
| 335 | Ga0070699_101892348 | 3300005518 | Bacteria | 546 |
| 336 | Ga0070679_100077538 | 3300005530 | Bacteria | 3312 |
| 337 | Ga0070679_100270687 | 3300005530 | Bacteria | 1653 |
| 338 | Ga0070684_100007280 | 3300005535 | Bacteria | 8602 |
| 339 | Ga0070684_100086281 | 3300005535 | Bacteria | 2785 |
| 340 | Ga0070684_100173420 | 3300005535 | Bacteria | 1959 |
| 341 | Ga0070684_100500451 | 3300005535 | Bacteria | 1125 |
| 342 | Ga0070684_100637593 | 3300005535 | Bacteria | 991 |
| 343 | Ga0070697_100000699 | 3300005536 | Bacteria | 25148 |
| 344 | Ga0070697_100005432 | 3300005536 | Bacteria | 9821 |
| 345 | Ga0070697_100007588 | 3300005536 | Bacteria | 8442 |
| 346 | Ga0070697_100009771 | 3300005536 | Bacteria | 7484 |
| 347 | Ga0070697_100019645 | 3300005536 | Bacteria | 5337 |
| 348 | Ga0070697_100021093 | 3300005536 | Bacteria | 5159 |
| 349 | Ga0070697_100034246 | 3300005536 | Unclassified | 4094 |
| 350 | Ga0070697_100093744 | 3300005536 | Bacteria | 2486 |
| 351 | Ga0070697_100131293 | 3300005536 | Bacteria | 2101 |
| 352 | Ga0070697_100177335 | 3300005536 | Bacteria | 1805 |
| 353 | Ga0070697_100341249 | 3300005536 | Unclassified | 1293 |
| 354 | Ga0068853_100000043 | 3300005539 | Bacteria | 102800 |
| 355 | Ga0068853_101177274 | 3300005539 | Unclassified | 740 |
| 356 | Ga0068853_101268952 | 3300005539 | Bacteria | 712 |
| 357 | Ga0068853_101311143 | 3300005539 | Bacteria | 700 |
| 358 | Ga0070672_100019710 | 3300005543 | Bacteria | 4902 |
| 359 | Ga0070672_100081912 | 3300005543 | Bacteria | 2588 |
| 360 | Ga0070672_100089212 | 3300005543 | Bacteria | 2484 |
| 361 | Ga0070672_100133307 | 3300005543 | Bacteria | 2044 |
| 362 | Ga0070672_100146694 | 3300005543 | Bacteria | 1950 |
| 363 | Ga0070672_100422890 | 3300005543 | Bacteria | 1144 |
| 364 | Ga0070672_100824807 | 3300005543 | Bacteria | 817 |
| 365 | Ga0070672_100898655 | 3300005543 | Bacteria | 782 |
| 366 | Ga0070672_101203446 | 3300005543 | Bacteria | 675 |
| 367 | Ga0070686_100001412 | 3300005544 | Bacteria | 13554 |
| 368 | Ga0070686_100003806 | 3300005544 | Bacteria | 8301 |
| 369 | Ga0070686_100007629 | 3300005544 | Bacteria | 6044 |
| 370 | Ga0070695_100178743 | 3300005545 | Bacteria | 1502 |
| 371 | Ga0070695_100575156 | 3300005545 | Unclassified | 881 |
| 372 | Ga0070696_100174468 | 3300005546 | Bacteria | 1591 |
| 373 | Ga0070696_100728147 | 3300005546 | Bacteria | 811 |
| 374 | Ga0070696_101132882 | 3300005546 | Bacteria | 659 |
| 375 | Ga0070696_101545555 | 3300005546 | Unclassified | 569 |
| 376 | Ga0070693_100428880 | 3300005547 | Bacteria | 923 |
| 377 | Ga0070693_100603426 | 3300005547 | Bacteria | 793 |
| 378 | Ga0070693_100734407 | 3300005547 | Unclassified | 726 |
| 379 | Ga0070665_100000030 | 3300005548 | Bacteria | 335245 |
| 380 | Ga0070665_100020293 | 3300005548 | Bacteria | 6673 |
| 381 | Ga0070665_100023029 | 3300005548 | Bacteria | 6273 |
| 382 | Ga0070665_100047396 | 3300005548 | Bacteria | 4313 |
| 383 | Ga0070665_100188017 | 3300005548 | Bacteria | 2066 |
| 384 | Ga0070665_100202980 | 3300005548 | Bacteria | 1983 |
| 385 | Ga0070665_100259845 | 3300005548 | Bacteria | 1738 |
| 386 | Ga0070665_100295021 | 3300005548 | Bacteria | 1624 |
| 387 | Ga0070665_100418587 | 3300005548 | Bacteria | 1348 |
| 388 | Ga0070665_101282639 | 3300005548 | Bacteria | 743 |
| 389 | Ga0070704_100441085 | 3300005549 | Bacteria | 1119 |
| 390 | Ga0070704_101555425 | 3300005549 | Bacteria | 609 |
| 391 | Ga0070704_101921635 | 3300005549 | Bacteria | 549 |
| 392 | Ga0068855_100003050 | 3300005563 | Bacteria | 20519 |
| 393 | Ga0068855_100046518 | 3300005563 | Bacteria | 5129 |
| 394 | Ga0068855_100337136 | 3300005563 | Bacteria | 1663 |
| 395 | Ga0068855_100471299 | 3300005563 | Bacteria | 1368 |
| 396 | Ga0068855_100620911 | 3300005563 | Bacteria | 1164 |
| 397 | Ga0068855_101370013 | 3300005563 | Bacteria | 730 |
| 398 | Ga0068855_102428536 | 3300005563 | Bacteria | 523 |
| 399 | Ga0070664_100290513 | 3300005564 | Bacteria | 1476 |
| 400 | Ga0070664_100487905 | 3300005564 | Unclassified | 1134 |
| 401 | Ga0070664_102379281 | 3300005564 | Unclassified | 502 |
| 402 | Ga0068857_100652343 | 3300005577 | Bacteria | 997 |
| 403 | Ga0068857_100866608 | 3300005577 | Bacteria | 865 |
| 404 | Ga0068854_100907259 | 3300005578 | Bacteria | 775 |
| 405 | Ga0068856_100000532 | 3300005614 | Bacteria | 41990 |
| 406 | Ga0068856_100001701 | 3300005614 | Bacteria | 22983 |
| 407 | Ga0068856_100041874 | 3300005614 | Bacteria | 4503 |
| 408 | Ga0068856_100157128 | 3300005614 | Bacteria | 2284 |
| 409 | Ga0068856_100375898 | 3300005614 | Bacteria | 1440 |
| 410 | Ga0068856_100808368 | 3300005614 | Unclassified | 957 |
| 411 | Ga0068856_100818154 | 3300005614 | Bacteria | 951 |
| 412 | Ga0070702_101804068 | 3300005615 | Bacteria | 511 |
| 413 | Ga0068852_100079670 | 3300005616 | Unclassified | 2902 |
| 414 | Ga0068852_100133986 | 3300005616 | Bacteria | 2285 |
| 415 | Ga0068852_100536582 | 3300005616 | Bacteria | 1169 |
| 416 | Ga0068859_100022627 | 3300005617 | Bacteria | 6302 |
| 417 | Ga0068859_100659587 | 3300005617 | Unclassified | 1138 |
| 418 | Ga0068859_100664414 | 3300005617 | Bacteria | 1134 |
| 419 | Ga0068859_101030488 | 3300005617 | Bacteria | 904 |
| 420 | Ga0068859_101623114 | 3300005617 | Bacteria | 714 |
| 421 | Ga0068859_101842049 | 3300005617 | Bacteria | 668 |
| 422 | Ga0068864_100213123 | 3300005618 | Bacteria | 1779 |
| 423 | Ga0068864_100480744 | 3300005618 | Bacteria | 1192 |
| 424 | Ga0068864_100582093 | 3300005618 | Bacteria | 1085 |
| 425 | Ga0068864_100694210 | 3300005618 | Bacteria | 994 |
| 426 | Ga0068864_100804509 | 3300005618 | Bacteria | 924 |
| 427 | Ga0068864_100896029 | 3300005618 | Bacteria | 876 |
| 428 | Ga0068864_100907765 | 3300005618 | Bacteria | 870 |
| 429 | Ga0068864_101479358 | 3300005618 | Bacteria | 682 |
| 430 | Ga0068866_10553231 | 3300005718 | Bacteria | 770 |
| 431 | Ga0068861_100818166 | 3300005719 | Bacteria | 876 |
| 432 | Ga0068861_101284250 | 3300005719 | Unclassified | 711 |
| 433 | Ga0068870_10924066 | 3300005840 | Bacteria | 618 |
| 434 | Ga0068863_100026665 | 3300005841 | Bacteria | 5510 |
| 435 | Ga0068863_100041792 | 3300005841 | Bacteria | 4358 |
| 436 | Ga0068863_100046621 | 3300005841 | Bacteria | 4114 |
| 437 | Ga0068863_100481109 | 3300005841 | Bacteria | 1221 |
| 438 | Ga0068863_100630874 | 3300005841 | Bacteria | 1062 |
| 439 | Ga0068863_100990025 | 3300005841 | Bacteria | 843 |
| 440 | Ga0068858_100009520 | 3300005842 | Bacteria | 9270 |
| 441 | Ga0068858_100018605 | 3300005842 | Bacteria | 6504 |
| 442 | Ga0068858_100031411 | 3300005842 | Bacteria | 4933 |
| 443 | Ga0068858_100107171 | 3300005842 | Bacteria | 2608 |
| 444 | Ga0068858_100538712 | 3300005842 | Bacteria | 1130 |
| 445 | Ga0068858_100810790 | 3300005842 | Unclassified | 913 |
| 446 | Ga0068858_100884762 | 3300005842 | Bacteria | 873 |
| 447 | Ga0068858_101223216 | 3300005842 | Bacteria | 738 |
| 448 | Ga0068858_101573175 | 3300005842 | Bacteria | 649 |
| 449 | Ga0068858_102155940 | 3300005842 | Unclassified | 551 |
| 450 | Ga0068858_102492096 | 3300005842 | Bacteria | 511 |
| 451 | Ga0068860_100000335 | 3300005843 | Bacteria | 63785 |
| 452 | Ga0068860_100109821 | 3300005843 | Bacteria | 2636 |
| 453 | Ga0068860_100796962 | 3300005843 | Bacteria | 958 |
| 454 | Ga0068860_100797344 | 3300005843 | Bacteria | 958 |
| 455 | Ga0068860_100876847 | 3300005843 | Bacteria | 913 |
| 456 | Ga0068860_100939343 | 3300005843 | Bacteria | 882 |
| 457 | Ga0068860_101178464 | 3300005843 | Bacteria | 786 |
| 458 | Ga0068860_102625806 | 3300005843 | Bacteria | 523 |
| 459 | Ga0068862_100011084 | 3300005844 | Bacteria | 7448 |
| 460 | Ga0068862_100119819 | 3300005844 | Bacteria | 2319 |
| 461 | Ga0068862_100686367 | 3300005844 | Bacteria | 991 |
| 462 | Ga0068862_101086220 | 3300005844 | Bacteria | 795 |
| 463 | Ga0068862_101263012 | 3300005844 | Bacteria | 739 |
| 464 | Ga0068862_101484002 | 3300005844 | Bacteria | 683 |
| 465 | Ga0081455_10001899 | 3300005937 | Bacteria | 25143 |
| 466 | Ga0081455_10003193 | 3300005937 | Bacteria | 19003 |
| 467 | Ga0081455_10012109 | 3300005937 | Bacteria | 8622 |
| 468 | Ga0081455_10023526 | 3300005937 | Bacteria | 5731 |
| 469 | Ga0081455_10032602 | 3300005937 | Bacteria | 4692 |
| 470 | Ga0081455_10035518 | 3300005937 | Bacteria | 4452 |
| 471 | Ga0081455_10041741 | 3300005937 | Bacteria | 4031 |
| 472 | Ga0081455_10045480 | 3300005937 | Bacteria | 3819 |
| 473 | Ga0081455_10085610 | 3300005937 | Bacteria | 2570 |
| 474 | Ga0081538_10002489 | 3300005981 | Bacteria | 17967 |
| 475 | Ga0081538_10020354 | 3300005981 | Bacteria | 4887 |
| 476 | Ga0081538_10027511 | 3300005981 | Bacteria | 3940 |
| 477 | Ga0081538_10096720 | 3300005981 | Bacteria | 1503 |
| 478 | Ga0081538_10219365 | 3300005981 | Bacteria | 756 |
| 479 | Ga0081540_1012961 | 3300005983 | Bacteria | 5447 |
| 480 | Ga0081540_1023742 | 3300005983 | Bacteria | 3576 |
| 481 | Ga0081540_1151815 | 3300005983 | Bacteria | 913 |
| 482 | Ga0081540_1295909 | 3300005983 | Bacteria | 557 |
| 483 | Ga0081539_10006707 | 3300005985 | Bacteria | 10855 |
| 484 | Ga0081539_10044293 | 3300005985 | Unclassified | 2570 |
| 485 | Ga0070717_10006113 | 3300006028 | Bacteria | 8843 |
| 486 | Ga0070717_10096911 | 3300006028 | Bacteria | 2499 |
| 487 | Ga0070717_10193286 | 3300006028 | Archaea | 1779 |
| 488 | Ga0070717_10465390 | 3300006028 | Bacteria | 1141 |
| 489 | Ga0070717_10475872 | 3300006028 | Bacteria | 1127 |
| 490 | Ga0070717_10539626 | 3300006028 | Bacteria | 1056 |
| 491 | Ga0070717_10641813 | 3300006028 | Bacteria | 964 |
| 492 | Ga0070717_10962249 | 3300006028 | Bacteria | 777 |
| 493 | Ga0070717_11031178 | 3300006028 | Bacteria | 749 |
| 494 | Ga0070717_11214571 | 3300006028 | Unclassified | 686 |
| 495 | Ga0070717_11711667 | 3300006028 | Unclassified | 569 |
| 496 | Ga0070717_11763010 | 3300006028 | Bacteria | 560 |
| 497 | Ga0075365_10822943 | 3300006038 | Bacteria | 655 |
| 498 | Ga0070715_10025081 | 3300006163 | Bacteria | 2357 |
| 499 | Ga0070715_10373778 | 3300006163 | Bacteria | 785 |
| 500 | Ga0070715_10952455 | 3300006163 | Bacteria | 532 |
| 501 | Ga0070716_100089578 | 3300006173 | Unclassified | 1859 |
| 502 | Ga0070716_100097232 | 3300006173 | Bacteria | 1796 |
| 503 | Ga0070716_100110496 | 3300006173 | Bacteria | 1703 |
| 504 | Ga0070716_100344226 | 3300006173 | Bacteria | 1053 |
| 505 | Ga0070716_100379037 | 3300006173 | Bacteria | 1010 |
| 506 | Ga0070716_101787988 | 3300006173 | Bacteria | 509 |
| 507 | Ga0070712_100004918 | 3300006175 | Bacteria | 8264 |
| 508 | Ga0070712_100042146 | 3300006175 | Bacteria | 3138 |
| 509 | Ga0070712_100104160 | 3300006175 | Unclassified | 2105 |
| 510 | Ga0070712_100223872 | 3300006175 | Bacteria | 1490 |
| 511 | Ga0070712_100225110 | 3300006175 | Bacteria | 1487 |
| 512 | Ga0070712_100234621 | 3300006175 | Bacteria | 1458 |
| 513 | Ga0070712_100426835 | 3300006175 | Unclassified | 1100 |
| 514 | Ga0070712_100636948 | 3300006175 | Unclassified | 905 |
| 515 | Ga0070712_100729252 | 3300006175 | Bacteria | 847 |
| 516 | Ga0070712_100861417 | 3300006175 | Bacteria | 780 |
| 517 | Ga0070712_101367278 | 3300006175 | Bacteria | 617 |
| 518 | Ga0070712_101663103 | 3300006175 | Bacteria | 559 |
| 519 | Ga0075362_10126919 | 3300006177 | Bacteria | 1211 |
| 520 | Ga0075362_10321528 | 3300006177 | Bacteria | 771 |
| 521 | Ga0075367_10656963 | 3300006178 | Bacteria | 667 |
| 522 | Ga0075366_10061709 | 3300006195 | Bacteria | 2228 |
| 523 | Ga0075366_10396428 | 3300006195 | Bacteria | 849 |
| 524 | Ga0097621_100018151 | 3300006237 | Bacteria | 5366 |
| 525 | Ga0097621_100218165 | 3300006237 | Bacteria | 1661 |
| 526 | Ga0097621_100292569 | 3300006237 | Bacteria | 1436 |
| 527 | Ga0097621_100537455 | 3300006237 | Bacteria | 1063 |
| 528 | Ga0097621_100576960 | 3300006237 | Bacteria | 1026 |
| 529 | Ga0097621_100676038 | 3300006237 | Bacteria | 949 |
| 530 | Ga0097621_101192036 | 3300006237 | Bacteria | 717 |
| 531 | Ga0097621_101805307 | 3300006237 | Bacteria | 583 |
| 532 | Ga0097621_102042424 | 3300006237 | Bacteria | 548 |
| 533 | Ga0075370_10130487 | 3300006353 | Unclassified | 1466 |
| 534 | Ga0075370_10593246 | 3300006353 | Bacteria | 671 |
| 535 | Ga0068871_100013279 | 3300006358 | Bacteria | 6110 |
| 536 | Ga0068871_100032502 | 3300006358 | Bacteria | 4124 |
| 537 | Ga0068871_100105360 | 3300006358 | Bacteria | 2366 |
| 538 | Ga0068871_100281501 | 3300006358 | Bacteria | 1455 |
| 539 | Ga0068871_100455649 | 3300006358 | Bacteria | 1147 |
| 540 | Ga0068871_100514049 | 3300006358 | Bacteria | 1081 |
| 541 | Ga0068871_100546498 | 3300006358 | Bacteria | 1049 |
| 542 | Ga0068871_100661912 | 3300006358 | Bacteria | 954 |
| 543 | Ga0068871_101920405 | 3300006358 | Bacteria | 563 |
| 544 | Ga0075428_100160071 | 3300006844 | Bacteria | 2444 |
| 545 | Ga0075428_100618121 | 3300006844 | Bacteria | 1157 |
| 546 | Ga0075428_101113763 | 3300006844 | Bacteria | 834 |
| 547 | Ga0075428_101397677 | 3300006844 | Bacteria | 735 |
| 548 | Ga0075431_100562344 | 3300006847 | Bacteria | 1127 |
| 549 | Ga0075433_10590744 | 3300006852 | Bacteria | 975 |
| 550 | Ga0075434_100158787 | 3300006871 | Bacteria | 2281 |
| 551 | Ga0075434_100308816 | 3300006871 | Bacteria | 1602 |
| 552 | Ga0075434_100509841 | 3300006871 | Bacteria | 1223 |
| 553 | Ga0075434_100690173 | 3300006871 | Bacteria | 1039 |
| 554 | Ga0075434_100982034 | 3300006871 | Bacteria | 858 |
| 555 | Ga0075434_101047127 | 3300006871 | Bacteria | 830 |
| 556 | Ga0075434_101969807 | 3300006871 | Bacteria | 590 |
| 557 | Ga0075429_101439166 | 3300006880 | Unclassified | 600 |
| 558 | Ga0075429_101858807 | 3300006880 | Bacteria | 522 |
| 559 | Ga0068865_100059182 | 3300006881 | Bacteria | 2679 |
| 560 | Ga0068865_100103672 | 3300006881 | Bacteria | 2087 |
| 561 | Ga0068865_100123582 | 3300006881 | Bacteria | 1928 |
| 562 | Ga0068865_100161898 | 3300006881 | Bacteria | 1708 |
| 563 | Ga0068865_100465901 | 3300006881 | Bacteria | 1047 |
| 564 | Ga0068865_100914587 | 3300006881 | Bacteria | 764 |
| 565 | Ga0068865_102096862 | 3300006881 | Bacteria | 514 |
| 566 | Ga0075436_100047012 | 3300006914 | Bacteria | 2977 |
| 567 | Ga0075436_100201381 | 3300006914 | Bacteria | 1410 |
| 568 | Ga0075436_101055670 | 3300006914 | Bacteria | 611 |
| 569 | Ga0097620_100022627 | 3300006931 | Bacteria | 6302 |
| 570 | Ga0097620_100659594 | 3300006931 | Unclassified | 1138 |
| 571 | Ga0097620_100664388 | 3300006931 | Bacteria | 1134 |
| 572 | Ga0097620_101030498 | 3300006931 | Bacteria | 904 |
| 573 | Ga0097620_101622782 | 3300006931 | Bacteria | 714 |
| 574 | Ga0097620_101842973 | 3300006931 | Bacteria | 668 |
| 575 | Ga0075435_100001139 | 3300007076 | Bacteria | 16951 |
| 576 | Ga0099795_10278224 | 3300007788 | Bacteria | 730 |
| 577 | Ga0099795_10359734 | 3300007788 | Bacteria | 653 |
| 578 | Ga0105244_10396862 | 3300009036 | Bacteria | 635 |
| 579 | Ga0105244_10447724 | 3300009036 | Bacteria | 594 |
| 580 | Ga0105250_10126745 | 3300009092 | Bacteria | 1052 |
| 581 | Ga0105250_10432844 | 3300009092 | Bacteria | 588 |
| 582 | Ga0105240_10000021 | 3300009093 | Bacteria | 394304 |
| 583 | Ga0105240_10010683 | 3300009093 | Bacteria | 12884 |
| 584 | Ga0105240_10083852 | 3300009093 | Bacteria | 3909 |
| 585 | Ga0105240_10091613 | 3300009093 | Bacteria | 3713 |
| 586 | Ga0105240_10171193 | 3300009093 | Unclassified | 2572 |
| 587 | Ga0105240_10511883 | 3300009093 | Bacteria | 1333 |
| 588 | Ga0105240_10628531 | 3300009093 | Bacteria | 1179 |
| 589 | Ga0111539_10032619 | 3300009094 | Bacteria | 6324 |
| 590 | Ga0111539_10055404 | 3300009094 | Bacteria | 4713 |
| 591 | Ga0111539_10217710 | 3300009094 | Unclassified | 2224 |
| 592 | Ga0111539_10262359 | 3300009094 | Bacteria | 2011 |
| 593 | Ga0111539_10401361 | 3300009094 | Bacteria | 1597 |
| 594 | Ga0111539_10493864 | 3300009094 | Bacteria | 1425 |
| 595 | Ga0111539_10500932 | 3300009094 | Bacteria | 1415 |
| 596 | Ga0111539_10528962 | 3300009094 | Bacteria | 1374 |
| 597 | Ga0111539_10777218 | 3300009094 | Bacteria | 1114 |
| 598 | Ga0111539_11112917 | 3300009094 | Unclassified | 918 |
| 599 | Ga0111539_13371530 | 3300009094 | Bacteria | 514 |
| 600 | Ga0105245_10102481 | 3300009098 | Bacteria | 2651 |
| 601 | Ga0105245_10143622 | 3300009098 | Bacteria | 2250 |
| 602 | Ga0105245_10413129 | 3300009098 | Bacteria | 1351 |
| 603 | Ga0105245_10592530 | 3300009098 | Bacteria | 1134 |
| 604 | Ga0105245_11005655 | 3300009098 | Bacteria | 878 |
| 605 | Ga0105245_11337224 | 3300009098 | Bacteria | 766 |
| 606 | Ga0105245_11784438 | 3300009098 | Bacteria | 668 |
| 607 | Ga0105245_12131565 | 3300009098 | Bacteria | 614 |
| 608 | Ga0105245_12626424 | 3300009098 | Bacteria | 557 |
| 609 | Ga0105245_12997164 | 3300009098 | Bacteria | 523 |
| 610 | Ga0105247_10227186 | 3300009101 | Bacteria | 1266 |
| 611 | Ga0105247_10511784 | 3300009101 | Bacteria | 876 |
| 612 | Ga0114129_10002693 | 3300009147 | Bacteria | 24721 |
| 613 | Ga0114129_10405374 | 3300009147 | Bacteria | 1796 |
| 614 | Ga0114129_12073999 | 3300009147 | Bacteria | 686 |
| 615 | Ga0105243_10002066 | 3300009148 | Bacteria | 17026 |
| 616 | Ga0105243_11802948 | 3300009148 | Unclassified | 643 |
| 617 | Ga0105241_10313704 | 3300009174 | Bacteria | 1350 |
| 618 | Ga0105241_12472556 | 3300009174 | Bacteria | 520 |
| 619 | Ga0105241_12677455 | 3300009174 | Unclassified | 502 |
| 620 | Ga0105242_10004325 | 3300009176 | Bacteria | 11061 |
| 621 | Ga0105242_10445570 | 3300009176 | Bacteria | 1219 |
| 622 | Ga0105242_11956742 | 3300009176 | Bacteria | 628 |
| 623 | Ga0105242_12334617 | 3300009176 | Bacteria | 582 |
| 624 | Ga0105242_13002620 | 3300009176 | Bacteria | 522 |
| 625 | Ga0105248_12138994 | 3300009177 | Bacteria | 636 |
| 626 | Ga0105237_10003664 | 3300009545 | Bacteria | 18113 |
| 627 | Ga0105237_10004830 | 3300009545 | Bacteria | 15484 |
| 628 | Ga0105237_10113997 | 3300009545 | Bacteria | 2696 |
| 629 | Ga0105237_10479798 | 3300009545 | Bacteria | 1250 |
| 630 | Ga0105237_10575334 | 3300009545 | Bacteria | 1133 |
| 631 | Ga0105237_10634223 | 3300009545 | Bacteria | 1075 |
| 632 | Ga0105237_10728534 | 3300009545 | Bacteria | 998 |
| 633 | Ga0105237_11727674 | 3300009545 | Bacteria | 633 |
| 634 | Ga0105237_12473903 | 3300009545 | Bacteria | 530 |
| 635 | Ga0105238_10012283 | 3300009551 | Bacteria | 8637 |
| 636 | Ga0105238_10012559 | 3300009551 | Bacteria | 8549 |
| 637 | Ga0105238_10047992 | 3300009551 | Bacteria | 4304 |
| 638 | Ga0105238_10083256 | 3300009551 | Bacteria | 3188 |
| 639 | Ga0105238_10753779 | 3300009551 | Bacteria | 987 |
| 640 | Ga0105238_11799451 | 3300009551 | Bacteria | 644 |
| 641 | Ga0105238_11956851 | 3300009551 | Bacteria | 619 |
| 642 | Ga0105238_12255789 | 3300009551 | Unclassified | 579 |
| 643 | Ga0105238_12404816 | 3300009551 | Bacteria | 562 |
| 644 | Ga0105249_10005644 | 3300009553 | Bacteria | 10828 |
| 645 | Ga0105249_10018608 | 3300009553 | Bacteria | 6186 |
| 646 | Ga0105249_10102576 | 3300009553 | Bacteria | 2693 |
| 647 | Ga0105249_10188210 | 3300009553 | Bacteria | 2013 |
| 648 | Ga0105249_10192478 | 3300009553 | Bacteria | 1991 |
| 649 | Ga0105249_10488724 | 3300009553 | Bacteria | 1275 |
| 650 | Ga0105249_10611148 | 3300009553 | Bacteria | 1145 |
| 651 | Ga0105249_10916162 | 3300009553 | Bacteria | 944 |
| 652 | Ga0105249_11763975 | 3300009553 | Bacteria | 691 |
| 653 | Ga0105249_12285623 | 3300009553 | Bacteria | 613 |
| 654 | Ga0105249_12328180 | 3300009553 | Bacteria | 608 |
| 655 | Ga0099796_10431658 | 3300010159 | Bacteria | 583 |
| 656 | Ga0105239_10020017 | 3300010375 | Bacteria | 7384 |
| 657 | Ga0105239_10170410 | 3300010375 | Bacteria | 2434 |
| 658 | Ga0105239_10255355 | 3300010375 | Bacteria | 1969 |
| 659 | Ga0105239_10475571 | 3300010375 | Bacteria | 1419 |
| 660 | Ga0105239_10697421 | 3300010375 | Bacteria | 1161 |
| 661 | Ga0105239_11339011 | 3300010375 | Unclassified | 826 |
| 662 | Ga0105239_11413218 | 3300010375 | Bacteria | 803 |
| 663 | Ga0105239_12093503 | 3300010375 | Bacteria | 657 |
| 664 | Ga0105239_13054564 | 3300010375 | Bacteria | 545 |
| 665 | Ga0105246_10026336 | 3300011119 | Bacteria | 3798 |
| 666 | Ga0105246_10128603 | 3300011119 | Unclassified | 1888 |
| 667 | Ga0105246_10422781 | 3300011119 | Bacteria | 1113 |
| 668 | Ga0105246_10622570 | 3300011119 | Bacteria | 936 |
| 669 | Ga0105246_11316824 | 3300011119 | Bacteria | 670 |
| 670 | Ga0157324_1057153 | 3300012506 | Bacteria | 524 |
| 671 | Ga0157324_1065394 | 3300012506 | Bacteria | 507 |
| 672 | Ga0157342_1009614 | 3300012507 | Bacteria | 975 |
| 673 | Ga0157327_1077038 | 3300012512 | Bacteria | 529 |
| 674 | Ga0157373_10464273 | 3300013100 | Bacteria | 912 |
| 675 | Ga0157373_11203774 | 3300013100 | Unclassified | 571 |
| 676 | Ga0157371_10008630 | 3300013102 | Bacteria | 8096 |
| 677 | Ga0157369_10121539 | 3300013105 | Bacteria | 2771 |
| 678 | Ga0157369_11618021 | 3300013105 | Bacteria | 658 |
| 679 | Ga0157369_12533073 | 3300013105 | Bacteria | 519 |
| 680 | Ga0157374_10012398 | 3300013296 | Bacteria | 7416 |
| 681 | Ga0157374_10016525 | 3300013296 | Bacteria | 6488 |
| 682 | Ga0157374_10056139 | 3300013296 | Bacteria | 3676 |
| 683 | Ga0157374_10074319 | 3300013296 | Bacteria | 3210 |
| 684 | Ga0157374_10129870 | 3300013296 | Bacteria | 2438 |
| 685 | Ga0157374_10156550 | 3300013296 | Bacteria | 2218 |
| 686 | Ga0157374_10254291 | 3300013296 | Bacteria | 1729 |
| 687 | Ga0157374_10270216 | 3300013296 | Bacteria | 1676 |
| 688 | Ga0157374_10856309 | 3300013296 | Bacteria | 926 |
| 689 | Ga0157374_10866332 | 3300013296 | Bacteria | 920 |
| 690 | Ga0157374_10882366 | 3300013296 | Unclassified | 912 |
| 691 | Ga0157374_10975885 | 3300013296 | Bacteria | 866 |
| 692 | Ga0157378_10004018 | 3300013297 | Bacteria | 12987 |
| 693 | Ga0157378_10005168 | 3300013297 | Bacteria | 11458 |
| 694 | Ga0157378_10027051 | 3300013297 | Bacteria | 5060 |
| 695 | Ga0157378_10036652 | 3300013297 | Unclassified | 4340 |
| 696 | Ga0157378_10072741 | 3300013297 | Bacteria | 3090 |
| 697 | Ga0157378_10093354 | 3300013297 | Bacteria | 2739 |
| 698 | Ga0157378_10124846 | 3300013297 | Bacteria | 2377 |
| 699 | Ga0157378_10148704 | 3300013297 | Bacteria | 2181 |
| 700 | Ga0157378_10245551 | 3300013297 | Unclassified | 1712 |
| 701 | Ga0157378_10352872 | 3300013297 | Bacteria | 1437 |
| 702 | Ga0157378_10402399 | 3300013297 | Bacteria | 1349 |
| 703 | Ga0157378_10433292 | 3300013297 | Unclassified | 1301 |
| 704 | Ga0157378_10554062 | 3300013297 | Unclassified | 1155 |
| 705 | Ga0157378_10974932 | 3300013297 | Bacteria | 881 |
| 706 | Ga0157378_11121831 | 3300013297 | Bacteria | 824 |
| 707 | Ga0157378_11413397 | 3300013297 | Bacteria | 739 |
| 708 | Ga0157378_11571794 | 3300013297 | Bacteria | 703 |
| 709 | Ga0157378_12035313 | 3300013297 | Bacteria | 624 |
| 710 | Ga0157378_13186095 | 3300013297 | Bacteria | 510 |
| 711 | Ga0163162_10012601 | 3300013306 | Bacteria | 8258 |
| 712 | Ga0163162_10027417 | 3300013306 | Bacteria | 5633 |
| 713 | Ga0163162_10047319 | 3300013306 | Bacteria | 4311 |
| 714 | Ga0163162_10158835 | 3300013306 | Bacteria | 2382 |
| 715 | Ga0163162_10201949 | 3300013306 | Bacteria | 2117 |
| 716 | Ga0163162_10365762 | 3300013306 | Bacteria | 1575 |
| 717 | Ga0163162_10401006 | 3300013306 | Bacteria | 1504 |
| 718 | Ga0163162_10510573 | 3300013306 | Bacteria | 1332 |
| 719 | Ga0163162_10742020 | 3300013306 | Bacteria | 1102 |
| 720 | Ga0163162_11030998 | 3300013306 | Bacteria | 931 |
| 721 | Ga0163162_11616497 | 3300013306 | Bacteria | 739 |
| 722 | Ga0163162_12216823 | 3300013306 | Bacteria | 631 |
| 723 | Ga0163162_13251090 | 3300013306 | Bacteria | 521 |
| 724 | Ga0163162_13321546 | 3300013306 | Bacteria | 515 |
| 725 | Ga0157372_10671132 | 3300013307 | Bacteria | 1207 |
| 726 | Ga0157375_10007506 | 3300013308 | Bacteria | 9533 |
| 727 | Ga0157375_10010785 | 3300013308 | Bacteria | 8050 |
| 728 | Ga0157375_10014362 | 3300013308 | Bacteria | 7061 |
| 729 | Ga0157375_10044447 | 3300013308 | Bacteria | 4316 |
| 730 | Ga0157375_10046780 | 3300013308 | Bacteria | 4221 |
| 731 | Ga0157375_10103089 | 3300013308 | Bacteria | 2940 |
| 732 | Ga0157375_10151701 | 3300013308 | Bacteria | 2453 |
| 733 | Ga0157375_10165999 | 3300013308 | Bacteria | 2352 |
| 734 | Ga0157375_10546491 | 3300013308 | Bacteria | 1320 |
| 735 | Ga0157375_10692500 | 3300013308 | Bacteria | 1173 |
| 736 | Ga0157375_10934585 | 3300013308 | Bacteria | 1010 |
| 737 | Ga0157375_11531971 | 3300013308 | Bacteria | 787 |
| 738 | Ga0157375_11556369 | 3300013308 | Bacteria | 781 |
| 739 | Ga0157375_11960293 | 3300013308 | Bacteria | 696 |
| 740 | Ga0157375_13080755 | 3300013308 | Bacteria | 556 |
| 741 | Ga0157375_13781017 | 3300013308 | Bacteria | 503 |
| 742 | Ga0163163_10103428 | 3300014325 | Bacteria | 2873 |
| 743 | Ga0163163_10511774 | 3300014325 | Bacteria | 1262 |
| 744 | Ga0163163_10619591 | 3300014325 | Bacteria | 1145 |
| 745 | Ga0163163_11065491 | 3300014325 | Bacteria | 871 |
| 746 | Ga0163163_11167478 | 3300014325 | Bacteria | 833 |
| 747 | Ga0157380_10094673 | 3300014326 | Bacteria | 2473 |
| 748 | Ga0157380_10183437 | 3300014326 | Bacteria | 1841 |
| 749 | Ga0157380_11044407 | 3300014326 | Bacteria | 853 |
| 750 | Ga0157380_12173601 | 3300014326 | Bacteria | 618 |
| 751 | Ga0182008_10021914 | 3300014497 | Bacteria | 3277 |
| 752 | Ga0157377_10068102 | 3300014745 | Bacteria | 2051 |
| 753 | Ga0157377_10458336 | 3300014745 | Bacteria | 882 |
| 754 | Ga0157379_10004631 | 3300014968 | Bacteria | 11804 |
| 755 | Ga0157379_10953954 | 3300014968 | Bacteria | 816 |
| 756 | Ga0157379_11676150 | 3300014968 | Bacteria | 622 |
| 757 | Ga0157379_12264049 | 3300014968 | Bacteria | 541 |
| 758 | Ga0157376_10001227 | 3300014969 | Bacteria | 16886 |
| 759 | Ga0157376_10020873 | 3300014969 | Bacteria | 5077 |
| 760 | Ga0157376_10041051 | 3300014969 | Bacteria | 3786 |
| 761 | Ga0157376_10083550 | 3300014969 | Bacteria | 2747 |
| 762 | Ga0157376_10154311 | 3300014969 | Bacteria | 2074 |
| 763 | Ga0157376_10430454 | 3300014969 | Bacteria | 1282 |
| 764 | Ga0157376_10529104 | 3300014969 | Bacteria | 1163 |
| 765 | Ga0157376_10939618 | 3300014969 | Bacteria | 885 |
| 766 | Ga0157376_11178938 | 3300014969 | Bacteria | 794 |
| 767 | Ga0157376_11654515 | 3300014969 | Bacteria | 675 |
| 768 | Ga0157376_12055981 | 3300014969 | Bacteria | 609 |
| 769 | Ga0157376_12113010 | 3300014969 | Bacteria | 601 |
| 770 | Ga0157376_12518328 | 3300014969 | Bacteria | 554 |
| 771 | Ga0182007_10117656 | 3300015262 | Unclassified | 888 |
| 772 | Ga0182007_10238889 | 3300015262 | Bacteria | 648 |
| 773 | Ga0182007_10264437 | 3300015262 | Unclassified | 621 |
| 774 | Ga0182005_1118238 | 3300015265 | Bacteria | 753 |
| 775 | Ga0163161_10036397 | 3300017792 | Bacteria | 3525 |
| 776 | Ga0163161_10104703 | 3300017792 | Unclassified | 2109 |
| 777 | Ga0163161_10275084 | 3300017792 | Bacteria | 1319 |
| 778 | Ga0163161_10380623 | 3300017792 | Bacteria | 1128 |
| 779 | Ga0163161_10777273 | 3300017792 | Bacteria | 803 |
| 780 | Ga0163161_11039188 | 3300017792 | Bacteria | 701 |
| 781 | Ga0163161_11489141 | 3300017792 | Bacteria | 594 |
| 782 | Ga0163161_11691730 | 3300017792 | Bacteria | 560 |
| 783 | Ga0163161_11785325 | 3300017792 | Bacteria | 546 |
| 784 | Ga0206356_11167105 | 3300020070 | Bacteria | 588 |
| 785 | Ga0213873_10065272 | 3300021358 | Bacteria | 993 |
| 786 | Ga0213873_10239200 | 3300021358 | Bacteria | 573 |
| 787 | Ga0213872_10002717 | 3300021361 | Bacteria | 10182 |
| 788 | Ga0213872_10020372 | 3300021361 | Bacteria | 3056 |
| 789 | Ga0213872_10030861 | 3300021361 | Bacteria | 2456 |
| 790 | Ga0213872_10060081 | 3300021361 | Bacteria | 1719 |
| 791 | Ga0213872_10106654 | 3300021361 | Bacteria | 1246 |
| 792 | Ga0213872_10129238 | 3300021361 | Bacteria | 1113 |
| 793 | Ga0213874_10010920 | 3300021377 | Bacteria | 2287 |
| 794 | Ga0213874_10017223 | 3300021377 | Bacteria | 1935 |
| 795 | Ga0213876_10003351 | 3300021384 | Bacteria | 9167 |
| 796 | Ga0213876_10025981 | 3300021384 | Bacteria | 3088 |
| 797 | Ga0213876_10148606 | 3300021384 | Bacteria | 1246 |
| 798 | Ga0213876_10195731 | 3300021384 | Bacteria | 1074 |
| 799 | Ga0213876_10515126 | 3300021384 | Bacteria | 637 |
| 800 | Ga0213876_10656165 | 3300021384 | Bacteria | 558 |
| 801 | Ga0213875_10146532 | 3300021388 | Bacteria | 1106 |
| 802 | Ga0213875_10290432 | 3300021388 | Bacteria | 773 |
| 803 | Ga0213875_10664909 | 3300021388 | Unclassified | 505 |
| 804 | Ga0213871_10006967 | 3300021441 | Bacteria | 2420 |
| 805 | Ga0213871_10070427 | 3300021441 | Bacteria | 987 |
| 806 | Ga0224712_10241735 | 3300022467 | Bacteria | 832 |
| 807 | Ga0224572_1060923 | 3300024225 | Bacteria | 699 |
| 808 | Ga0207666_1000173 | 3300025271 | Bacteria | 9878 |
| 809 | Ga0207666_1031112 | 3300025271 | Bacteria | 817 |
| 810 | Ga0207673_1002648 | 3300025290 | Bacteria | 2056 |
| 811 | Ga0207673_1017938 | 3300025290 | Bacteria | 947 |
| 812 | Ga0207673_1036913 | 3300025290 | Bacteria | 683 |
| 813 | Ga0209050_1000597 | 3300025298 | Bacteria | 57550 |
| 814 | Ga0207697_10000708 | 3300025315 | Bacteria | 18998 |
| 815 | Ga0207697_10001975 | 3300025315 | Bacteria | 10866 |
| 816 | Ga0207697_10008102 | 3300025315 | Bacteria | 4631 |
| 817 | Ga0207697_10019530 | 3300025315 | Bacteria | 2776 |
| 818 | Ga0207697_10112148 | 3300025315 | Bacteria | 1168 |
| 819 | Ga0207697_10208433 | 3300025315 | Bacteria | 861 |
| 820 | Ga0207697_10228776 | 3300025315 | Bacteria | 821 |
| 821 | Ga0207697_10269005 | 3300025315 | Bacteria | 755 |
| 822 | Ga0207697_10298120 | 3300025315 | Bacteria | 715 |
| 823 | Ga0207697_10357473 | 3300025315 | Bacteria | 648 |
| 824 | Ga0207697_10524147 | 3300025315 | Bacteria | 522 |
| 825 | Ga0207656_10220102 | 3300025321 | Unclassified | 922 |
| 826 | Ga0207653_10058385 | 3300025885 | Bacteria | 1297 |
| 827 | Ga0207653_10178608 | 3300025885 | Bacteria | 793 |
| 828 | Ga0207653_10253636 | 3300025885 | Bacteria | 675 |
| 829 | Ga0207653_10348386 | 3300025885 | Bacteria | 578 |
| 830 | Ga0207653_10374256 | 3300025885 | Bacteria | 558 |
| 831 | Ga0207682_10033191 | 3300025893 | Bacteria | 2077 |
| 832 | Ga0207682_10320017 | 3300025893 | Bacteria | 728 |
| 833 | Ga0207682_10360016 | 3300025893 | Bacteria | 686 |
| 834 | Ga0207692_10098835 | 3300025898 | Bacteria | 1598 |
| 835 | Ga0207692_10104716 | 3300025898 | Bacteria | 1560 |
| 836 | Ga0207692_10205220 | 3300025898 | Bacteria | 1161 |
| 837 | Ga0207692_10421403 | 3300025898 | Bacteria | 836 |
| 838 | Ga0207642_10002474 | 3300025899 | Bacteria | 5744 |
| 839 | Ga0207642_10324034 | 3300025899 | Bacteria | 901 |
| 840 | Ga0207642_10714072 | 3300025899 | Bacteria | 632 |
| 841 | Ga0207642_11001219 | 3300025899 | Bacteria | 538 |
| 842 | Ga0207710_10262033 | 3300025900 | Bacteria | 866 |
| 843 | Ga0207688_10006693 | 3300025901 | Bacteria | 6272 |
| 844 | Ga0207688_10023264 | 3300025901 | Bacteria | 3392 |
| 845 | Ga0207688_10044048 | 3300025901 | Bacteria | 2487 |
| 846 | Ga0207688_10089078 | 3300025901 | Bacteria | 1770 |
| 847 | Ga0207688_10505652 | 3300025901 | Bacteria | 757 |
| 848 | Ga0207688_10656618 | 3300025901 | Bacteria | 662 |
| 849 | Ga0207688_10720435 | 3300025901 | Bacteria | 631 |
| 850 | Ga0207680_10021316 | 3300025903 | Bacteria | 3504 |
| 851 | Ga0207680_10073182 | 3300025903 | Bacteria | 2130 |
| 852 | Ga0207680_10079338 | 3300025903 | Bacteria | 2058 |
| 853 | Ga0207680_10302795 | 3300025903 | Bacteria | 1115 |
| 854 | Ga0207680_10814542 | 3300025903 | Bacteria | 669 |
| 855 | Ga0207680_10848186 | 3300025903 | Bacteria | 655 |
| 856 | Ga0207647_10180287 | 3300025904 | Bacteria | 1227 |
| 857 | Ga0207647_10617726 | 3300025904 | Bacteria | 597 |
| 858 | Ga0207685_10023234 | 3300025905 | Bacteria | 2108 |
| 859 | Ga0207685_10114633 | 3300025905 | Bacteria | 1174 |
| 860 | Ga0207685_10142578 | 3300025905 | Bacteria | 1076 |
| 861 | Ga0207685_10724984 | 3300025905 | Unclassified | 543 |
| 862 | Ga0207699_10120190 | 3300025906 | Unclassified | 1698 |
| 863 | Ga0207699_10186453 | 3300025906 | Bacteria | 1398 |
| 864 | Ga0207699_10400193 | 3300025906 | Bacteria | 978 |
| 865 | Ga0207699_10653315 | 3300025906 | Unclassified | 768 |
| 866 | Ga0207699_11010850 | 3300025906 | Bacteria | 615 |
| 867 | Ga0207699_11360087 | 3300025906 | Bacteria | 525 |
| 868 | Ga0207645_10001061 | 3300025907 | Bacteria | 22746 |
| 869 | Ga0207645_10002307 | 3300025907 | Bacteria | 15073 |
| 870 | Ga0207645_10003112 | 3300025907 | Bacteria | 12718 |
| 871 | Ga0207645_10021393 | 3300025907 | Bacteria | 4218 |
| 872 | Ga0207645_10184136 | 3300025907 | Bacteria | 1371 |
| 873 | Ga0207645_10260550 | 3300025907 | Bacteria | 1148 |
| 874 | Ga0207643_10109221 | 3300025908 | Bacteria | 1628 |
| 875 | Ga0207643_10306214 | 3300025908 | Bacteria | 990 |
| 876 | Ga0207643_10781739 | 3300025908 | Bacteria | 618 |
| 877 | Ga0207705_10011248 | 3300025909 | Bacteria | 6487 |
| 878 | Ga0207705_10058614 | 3300025909 | Bacteria | 2778 |
| 879 | Ga0207705_10399338 | 3300025909 | Bacteria | 1063 |
| 880 | Ga0207705_10539864 | 3300025909 | Bacteria | 906 |
| 881 | Ga0207705_10806092 | 3300025909 | Bacteria | 729 |
| 882 | Ga0207705_11029367 | 3300025909 | Bacteria | 636 |
| 883 | Ga0207684_10004166 | 3300025910 | Bacteria | 13742 |
| 884 | Ga0207684_10006584 | 3300025910 | Bacteria | 10569 |
| 885 | Ga0207684_10027724 | 3300025910 | Unclassified | 4824 |
| 886 | Ga0207684_10269571 | 3300025910 | Bacteria | 1469 |
| 887 | Ga0207684_10363473 | 3300025910 | Bacteria | 1245 |
| 888 | Ga0207684_10477640 | 3300025910 | Unclassified | 1069 |
| 889 | Ga0207684_10638434 | 3300025910 | Bacteria | 908 |
| 890 | Ga0207684_10640349 | 3300025910 | Unclassified | 906 |
| 891 | Ga0207684_11004756 | 3300025910 | Bacteria | 698 |
| 892 | Ga0207654_10358633 | 3300025911 | Bacteria | 1005 |
| 893 | Ga0207654_10692529 | 3300025911 | Bacteria | 732 |
| 894 | Ga0207654_11245367 | 3300025911 | Bacteria | 542 |
| 895 | Ga0207707_10082901 | 3300025912 | Bacteria | 2800 |
| 896 | Ga0207707_10587926 | 3300025912 | Bacteria | 943 |
| 897 | Ga0207695_10008487 | 3300025913 | Bacteria | 12846 |
| 898 | Ga0207695_10180201 | 3300025913 | Unclassified | 2033 |
| 899 | Ga0207695_10359602 | 3300025913 | Bacteria | 1342 |
| 900 | Ga0207695_10821108 | 3300025913 | Bacteria | 810 |
| 901 | Ga0207695_11246602 | 3300025913 | Unclassified | 624 |
| 902 | Ga0207671_10008359 | 3300025914 | Bacteria | 8788 |
| 903 | Ga0207671_10077451 | 3300025914 | Bacteria | 2489 |
| 904 | Ga0207671_10270884 | 3300025914 | Bacteria | 1338 |
| 905 | Ga0207671_10427384 | 3300025914 | Unclassified | 1054 |
| 906 | Ga0207671_10550964 | 3300025914 | Bacteria | 919 |
| 907 | Ga0207671_10776678 | 3300025914 | Bacteria | 760 |
| 908 | Ga0207693_10005851 | 3300025915 | Bacteria | 10204 |
| 909 | Ga0207693_10008150 | 3300025915 | Bacteria | 8587 |
| 910 | Ga0207693_10057969 | 3300025915 | Bacteria | 3034 |
| 911 | Ga0207693_10079292 | 3300025915 | Bacteria | 2569 |
| 912 | Ga0207693_10134757 | 3300025915 | Bacteria | 1942 |
| 913 | Ga0207693_10164776 | 3300025915 | Bacteria | 1745 |
| 914 | Ga0207693_10544067 | 3300025915 | Bacteria | 906 |
| 915 | Ga0207693_10567022 | 3300025915 | Bacteria | 885 |
| 916 | Ga0207693_10631323 | 3300025915 | Bacteria | 833 |
| 917 | Ga0207693_10704082 | 3300025915 | Bacteria | 782 |
| 918 | Ga0207693_10916282 | 3300025915 | Bacteria | 672 |
| 919 | Ga0207663_10032433 | 3300025916 | Bacteria | 3101 |
| 920 | Ga0207663_10076086 | 3300025916 | Bacteria | 2180 |
| 921 | Ga0207663_10160649 | 3300025916 | Bacteria | 1586 |
| 922 | Ga0207663_10249089 | 3300025916 | Bacteria | 1306 |
| 923 | Ga0207663_10267563 | 3300025916 | Bacteria | 1265 |
| 924 | Ga0207663_10305675 | 3300025916 | Bacteria | 1190 |
| 925 | Ga0207663_10329742 | 3300025916 | Unclassified | 1149 |
| 926 | Ga0207663_10433696 | 3300025916 | Bacteria | 1011 |
| 927 | Ga0207663_10746280 | 3300025916 | Bacteria | 777 |
| 928 | Ga0207660_10261545 | 3300025917 | Bacteria | 1368 |
| 929 | Ga0207660_11034482 | 3300025917 | Bacteria | 670 |
| 930 | Ga0207660_11687088 | 3300025917 | Bacteria | 510 |
| 931 | Ga0207662_10002029 | 3300025918 | Bacteria | 10020 |
| 932 | Ga0207662_10219987 | 3300025918 | Bacteria | 1236 |
| 933 | Ga0207662_10314592 | 3300025918 | Unclassified | 1044 |
| 934 | Ga0207662_11174464 | 3300025918 | Bacteria | 546 |
| 935 | Ga0207657_10076450 | 3300025919 | Bacteria | 2824 |
| 936 | Ga0207657_10157502 | 3300025919 | Bacteria | 1846 |
| 937 | Ga0207657_10196731 | 3300025919 | Unclassified | 1624 |
| 938 | Ga0207657_10656393 | 3300025919 | Unclassified | 816 |
| 939 | Ga0207657_10842684 | 3300025919 | Bacteria | 708 |
| 940 | Ga0207649_10001369 | 3300025920 | Bacteria | 14472 |
| 941 | Ga0207649_10009962 | 3300025920 | Bacteria | 5208 |
| 942 | Ga0207649_10348131 | 3300025920 | Bacteria | 1096 |
| 943 | Ga0207649_10461741 | 3300025920 | Bacteria | 960 |
| 944 | Ga0207652_10046754 | 3300025921 | Bacteria | 3694 |
| 945 | Ga0207646_10026329 | 3300025922 | Bacteria | 5309 |
| 946 | Ga0207646_10037463 | 3300025922 | Bacteria | 4372 |
| 947 | Ga0207646_10043842 | 3300025922 | Unclassified | 4015 |
| 948 | Ga0207646_10051531 | 3300025922 | Unclassified | 3683 |
| 949 | Ga0207646_10058770 | 3300025922 | Bacteria | 3434 |
| 950 | Ga0207646_10103473 | 3300025922 | Bacteria | 2553 |
| 951 | Ga0207646_10202351 | 3300025922 | Bacteria | 1794 |
| 952 | Ga0207646_10214886 | 3300025922 | Archaea | 1737 |
| 953 | Ga0207646_10234370 | 3300025922 | Bacteria | 1658 |
| 954 | Ga0207646_10535830 | 3300025922 | Bacteria | 1053 |
| 955 | Ga0207646_10696943 | 3300025922 | Bacteria | 908 |
| 956 | Ga0207646_10970037 | 3300025922 | Bacteria | 752 |
| 957 | Ga0207646_11412598 | 3300025922 | Bacteria | 605 |
| 958 | Ga0207646_11666288 | 3300025922 | Bacteria | 549 |
| 959 | Ga0207681_10011144 | 3300025923 | Bacteria | 5521 |
| 960 | Ga0207681_10033022 | 3300025923 | Bacteria | 3391 |
| 961 | Ga0207681_10052822 | 3300025923 | Bacteria | 2757 |
| 962 | Ga0207681_10062385 | 3300025923 | Bacteria | 2566 |
| 963 | Ga0207681_10332145 | 3300025923 | Bacteria | 1212 |
| 964 | Ga0207681_10378213 | 3300025923 | Bacteria | 1139 |
| 965 | Ga0207681_10879291 | 3300025923 | Bacteria | 750 |
| 966 | Ga0207681_10991541 | 3300025923 | Bacteria | 705 |
| 967 | Ga0207681_11037637 | 3300025923 | Bacteria | 688 |
| 968 | Ga0207681_11106208 | 3300025923 | Bacteria | 665 |
| 969 | Ga0207681_11386174 | 3300025923 | Bacteria | 590 |
| 970 | Ga0207694_10126770 | 3300025924 | Bacteria | 2043 |
| 971 | Ga0207694_10179043 | 3300025924 | Bacteria | 1719 |
| 972 | Ga0207694_10303739 | 3300025924 | Bacteria | 1314 |
| 973 | Ga0207694_10700915 | 3300025924 | Bacteria | 854 |
| 974 | Ga0207694_10983487 | 3300025924 | Bacteria | 714 |
| 975 | Ga0207694_11196310 | 3300025924 | Bacteria | 643 |
| 976 | Ga0207694_11787738 | 3300025924 | Bacteria | 517 |
| 977 | Ga0207650_10016550 | 3300025925 | Bacteria | 5157 |
| 978 | Ga0207650_10067678 | 3300025925 | Bacteria | 2680 |
| 979 | Ga0207650_10070019 | 3300025925 | Bacteria | 2636 |
| 980 | Ga0207650_10106265 | 3300025925 | Bacteria | 2168 |
| 981 | Ga0207650_10150292 | 3300025925 | Bacteria | 1838 |
| 982 | Ga0207650_10566369 | 3300025925 | Bacteria | 953 |
| 983 | Ga0207650_10601367 | 3300025925 | Bacteria | 925 |
| 984 | Ga0207650_10973539 | 3300025925 | Bacteria | 721 |
| 985 | Ga0207650_11515092 | 3300025925 | Bacteria | 570 |
| 986 | Ga0207650_11601333 | 3300025925 | Bacteria | 553 |
| 987 | Ga0207659_10012375 | 3300025926 | Bacteria | 5426 |
| 988 | Ga0207659_10013549 | 3300025926 | Bacteria | 5227 |
| 989 | Ga0207659_10021808 | 3300025926 | Bacteria | 4259 |
| 990 | Ga0207659_10044527 | 3300025926 | Bacteria | 3123 |
| 991 | Ga0207659_10044673 | 3300025926 | Bacteria | 3118 |
| 992 | Ga0207659_10084453 | 3300025926 | Bacteria | 2356 |
| 993 | Ga0207659_10101212 | 3300025926 | Bacteria | 2173 |
| 994 | Ga0207659_10209359 | 3300025926 | Bacteria | 1562 |
| 995 | Ga0207659_10541733 | 3300025926 | Bacteria | 989 |
| 996 | Ga0207659_10652807 | 3300025926 | Bacteria | 899 |
| 997 | Ga0207659_10678256 | 3300025926 | Bacteria | 882 |
| 998 | Ga0207659_11123819 | 3300025926 | Bacteria | 676 |
| 999 | Ga0207687_10286759 | 3300025927 | Unclassified | 1322 |
| 1000 | Ga0207687_10485712 | 3300025927 | Bacteria | 1029 |
| 1001 | Ga0207687_10572072 | 3300025927 | Bacteria | 950 |
| 1002 | Ga0207687_10592272 | 3300025927 | Bacteria | 934 |
| 1003 | Ga0207687_10677020 | 3300025927 | Bacteria | 874 |
| 1004 | Ga0207700_10165824 | 3300025928 | Bacteria | 1838 |
| 1005 | Ga0207700_10183223 | 3300025928 | Bacteria | 1755 |
| 1006 | Ga0207700_10434368 | 3300025928 | Bacteria | 1155 |
| 1007 | Ga0207700_10470353 | 3300025928 | Unclassified | 1110 |
| 1008 | Ga0207700_11054937 | 3300025928 | Bacteria | 727 |
| 1009 | Ga0207700_11625833 | 3300025928 | Bacteria | 571 |
| 1010 | Ga0207700_11729164 | 3300025928 | Bacteria | 551 |
| 1011 | Ga0207700_11771464 | 3300025928 | Bacteria | 543 |
| 1012 | Ga0207664_10958836 | 3300025929 | Bacteria | 767 |
| 1013 | Ga0207664_11283320 | 3300025929 | Bacteria | 652 |
| 1014 | Ga0207664_11839213 | 3300025929 | Bacteria | 528 |
| 1015 | Ga0207644_10073252 | 3300025931 | Bacteria | 2511 |
| 1016 | Ga0207644_10095915 | 3300025931 | Bacteria | 2219 |
| 1017 | Ga0207644_10097127 | 3300025931 | Bacteria | 2206 |
| 1018 | Ga0207644_10158315 | 3300025931 | Bacteria | 1758 |
| 1019 | Ga0207644_10267575 | 3300025931 | Bacteria | 1368 |
| 1020 | Ga0207644_10350023 | 3300025931 | Bacteria | 1199 |
| 1021 | Ga0207644_10488368 | 3300025931 | Unclassified | 1015 |
| 1022 | Ga0207644_10618165 | 3300025931 | Bacteria | 900 |
| 1023 | Ga0207690_10009051 | 3300025932 | Bacteria | 5911 |
| 1024 | Ga0207690_10068248 | 3300025932 | Bacteria | 2442 |
| 1025 | Ga0207690_10073094 | 3300025932 | Bacteria | 2370 |
| 1026 | Ga0207690_10109769 | 3300025932 | Bacteria | 1985 |
| 1027 | Ga0207690_10276882 | 3300025932 | Bacteria | 1306 |
| 1028 | Ga0207690_11200390 | 3300025932 | Bacteria | 633 |
| 1029 | Ga0207706_10000683 | 3300025933 | Bacteria | 35576 |
| 1030 | Ga0207706_10001838 | 3300025933 | Bacteria | 20815 |
| 1031 | Ga0207706_10026901 | 3300025933 | Bacteria | 5148 |
| 1032 | Ga0207706_10113505 | 3300025933 | Bacteria | 2383 |
| 1033 | Ga0207706_10191585 | 3300025933 | Bacteria | 1795 |
| 1034 | Ga0207706_10248354 | 3300025933 | Bacteria | 1555 |
| 1035 | Ga0207706_10326975 | 3300025933 | Bacteria | 1334 |
| 1036 | Ga0207706_10341722 | 3300025933 | Bacteria | 1302 |
| 1037 | Ga0207706_11269430 | 3300025933 | Bacteria | 610 |
| 1038 | Ga0207686_10000067 | 3300025934 | Bacteria | 94339 |
| 1039 | Ga0207686_10104433 | 3300025934 | Bacteria | 1898 |
| 1040 | Ga0207686_10123554 | 3300025934 | Bacteria | 1765 |
| 1041 | Ga0207686_11013572 | 3300025934 | Bacteria | 674 |
| 1042 | Ga0207686_11107494 | 3300025934 | Bacteria | 646 |
| 1043 | Ga0207709_10001490 | 3300025935 | Bacteria | 16174 |
| 1044 | Ga0207709_10008591 | 3300025935 | Bacteria | 5640 |
| 1045 | Ga0207709_10462738 | 3300025935 | Bacteria | 982 |
| 1046 | Ga0207670_10015302 | 3300025936 | Bacteria | 4581 |
| 1047 | Ga0207670_10055090 | 3300025936 | Bacteria | 2686 |
| 1048 | Ga0207670_10094855 | 3300025936 | Bacteria | 2118 |
| 1049 | Ga0207670_10189207 | 3300025936 | Bacteria | 1556 |
| 1050 | Ga0207670_10190777 | 3300025936 | Bacteria | 1551 |
| 1051 | Ga0207670_10431835 | 3300025936 | Bacteria | 1059 |
| 1052 | Ga0207670_10712104 | 3300025936 | Bacteria | 832 |
| 1053 | Ga0207670_10859199 | 3300025936 | Bacteria | 758 |
| 1054 | Ga0207670_10971494 | 3300025936 | Bacteria | 714 |
| 1055 | Ga0207670_11075425 | 3300025936 | Bacteria | 678 |
| 1056 | Ga0207670_11103500 | 3300025936 | Bacteria | 670 |
| 1057 | Ga0207670_11339890 | 3300025936 | Bacteria | 607 |
| 1058 | Ga0207670_11343549 | 3300025936 | Bacteria | 606 |
| 1059 | Ga0207669_10000496 | 3300025937 | Bacteria | 17234 |
| 1060 | Ga0207669_10011752 | 3300025937 | Bacteria | 4275 |
| 1061 | Ga0207669_10535098 | 3300025937 | Bacteria | 943 |
| 1062 | Ga0207669_10556434 | 3300025937 | Bacteria | 926 |
| 1063 | Ga0207669_10676574 | 3300025937 | Bacteria | 846 |
| 1064 | Ga0207669_10693034 | 3300025937 | Unclassified | 837 |
| 1065 | Ga0207669_10829594 | 3300025937 | Unclassified | 768 |
| 1066 | Ga0207669_11135931 | 3300025937 | Bacteria | 660 |
| 1067 | Ga0207669_11215857 | 3300025937 | Bacteria | 639 |
| 1068 | Ga0207669_11399667 | 3300025937 | Bacteria | 595 |
| 1069 | Ga0207704_10000383 | 3300025938 | Bacteria | 20322 |
| 1070 | Ga0207704_10049497 | 3300025938 | Bacteria | 2529 |
| 1071 | Ga0207704_10412826 | 3300025938 | Bacteria | 1068 |
| 1072 | Ga0207704_10446999 | 3300025938 | Bacteria | 1031 |
| 1073 | Ga0207704_10649450 | 3300025938 | Bacteria | 869 |
| 1074 | Ga0207704_10948975 | 3300025938 | Bacteria | 725 |
| 1075 | Ga0207704_11288427 | 3300025938 | Bacteria | 625 |
| 1076 | Ga0207704_11763891 | 3300025938 | Bacteria | 532 |
| 1077 | Ga0207665_10027602 | 3300025939 | Bacteria | 3750 |
| 1078 | Ga0207665_10058893 | 3300025939 | Bacteria | 2598 |
| 1079 | Ga0207665_10099264 | 3300025939 | Unclassified | 2030 |
| 1080 | Ga0207665_10164742 | 3300025939 | Bacteria | 1597 |
| 1081 | Ga0207665_10313542 | 3300025939 | Bacteria | 1175 |
| 1082 | Ga0207665_10386188 | 3300025939 | Unclassified | 1063 |
| 1083 | Ga0207665_10423106 | 3300025939 | Bacteria | 1018 |
| 1084 | Ga0207665_10439113 | 3300025939 | Bacteria | 1000 |
| 1085 | Ga0207665_10490786 | 3300025939 | Bacteria | 948 |
| 1086 | Ga0207665_10516809 | 3300025939 | Bacteria | 924 |
| 1087 | Ga0207665_10585357 | 3300025939 | Bacteria | 870 |
| 1088 | Ga0207665_11486791 | 3300025939 | Bacteria | 538 |
| 1089 | Ga0207691_10002751 | 3300025940 | Bacteria | 17148 |
| 1090 | Ga0207691_10084055 | 3300025940 | Bacteria | 2857 |
| 1091 | Ga0207691_10131884 | 3300025940 | Bacteria | 2206 |
| 1092 | Ga0207691_10147194 | 3300025940 | Bacteria | 2072 |
| 1093 | Ga0207691_10167102 | 3300025940 | Bacteria | 1928 |
| 1094 | Ga0207691_10315499 | 3300025940 | Bacteria | 1341 |
| 1095 | Ga0207691_10464137 | 3300025940 | Bacteria | 1077 |
| 1096 | Ga0207691_10487387 | 3300025940 | Bacteria | 1047 |
| 1097 | Ga0207691_10770813 | 3300025940 | Unclassified | 809 |
| 1098 | Ga0207691_11291529 | 3300025940 | Bacteria | 603 |
| 1099 | Ga0207711_10000687 | 3300025941 | Bacteria | 33408 |
| 1100 | Ga0207711_10253917 | 3300025941 | Bacteria | 1615 |
| 1101 | Ga0207711_11240986 | 3300025941 | Bacteria | 687 |
| 1102 | Ga0207711_11263259 | 3300025941 | Bacteria | 680 |
| 1103 | Ga0207689_11720161 | 3300025942 | Bacteria | 519 |
| 1104 | Ga0207661_10023175 | 3300025944 | Bacteria | 4688 |
| 1105 | Ga0207661_10193619 | 3300025944 | Bacteria | 1784 |
| 1106 | Ga0207661_10409892 | 3300025944 | Bacteria | 1230 |
| 1107 | Ga0207661_10961742 | 3300025944 | Bacteria | 787 |
| 1108 | Ga0207661_10997321 | 3300025944 | Bacteria | 771 |
| 1109 | Ga0207679_10043113 | 3300025945 | Bacteria | 3246 |
| 1110 | Ga0207679_10218420 | 3300025945 | Bacteria | 1603 |
| 1111 | Ga0207679_10304436 | 3300025945 | Bacteria | 1375 |
| 1112 | Ga0207679_10325647 | 3300025945 | Bacteria | 1332 |
| 1113 | Ga0207679_10331811 | 3300025945 | Bacteria | 1320 |
| 1114 | Ga0207679_11174963 | 3300025945 | Bacteria | 704 |
| 1115 | Ga0207679_11244339 | 3300025945 | Bacteria | 683 |
| 1116 | Ga0207667_10005991 | 3300025949 | Bacteria | 14791 |
| 1117 | Ga0207667_10146074 | 3300025949 | Bacteria | 2434 |
| 1118 | Ga0207667_10221355 | 3300025949 | Bacteria | 1939 |
| 1119 | Ga0207667_10399735 | 3300025949 | Bacteria | 1399 |
| 1120 | Ga0207667_10437437 | 3300025949 | Bacteria | 1330 |
| 1121 | Ga0207667_10746278 | 3300025949 | Bacteria | 978 |
| 1122 | Ga0207667_10772788 | 3300025949 | Bacteria | 959 |
| 1123 | Ga0207667_11269944 | 3300025949 | Bacteria | 714 |
| 1124 | Ga0207667_12156072 | 3300025949 | Bacteria | 515 |
| 1125 | Ga0207651_10012729 | 3300025960 | Bacteria | 4776 |
| 1126 | Ga0207651_10056846 | 3300025960 | Bacteria | 2695 |
| 1127 | Ga0207651_10161242 | 3300025960 | Bacteria | 1758 |
| 1128 | Ga0207651_10603549 | 3300025960 | Unclassified | 960 |
| 1129 | Ga0207651_10610231 | 3300025960 | Bacteria | 954 |
| 1130 | Ga0207651_10613050 | 3300025960 | Bacteria | 952 |
| 1131 | Ga0207651_10690545 | 3300025960 | Bacteria | 898 |
| 1132 | Ga0207651_10823037 | 3300025960 | Bacteria | 824 |
| 1133 | Ga0207651_11156749 | 3300025960 | Bacteria | 694 |
| 1134 | Ga0207651_11238491 | 3300025960 | Bacteria | 670 |
| 1135 | Ga0207651_11351382 | 3300025960 | Bacteria | 641 |
| 1136 | Ga0207712_10000422 | 3300025961 | Bacteria | 36283 |
| 1137 | Ga0207712_10115324 | 3300025961 | Bacteria | 2022 |
| 1138 | Ga0207712_10189804 | 3300025961 | Bacteria | 1621 |
| 1139 | Ga0207712_10195145 | 3300025961 | Bacteria | 1601 |
| 1140 | Ga0207712_10338429 | 3300025961 | Bacteria | 1247 |
| 1141 | Ga0207712_10667183 | 3300025961 | Bacteria | 905 |
| 1142 | Ga0207712_11069587 | 3300025961 | Bacteria | 717 |
| 1143 | Ga0207712_11090498 | 3300025961 | Bacteria | 710 |
| 1144 | Ga0207712_11607063 | 3300025961 | Bacteria | 583 |
| 1145 | Ga0207712_12118196 | 3300025961 | Bacteria | 503 |
| 1146 | Ga0207668_10008111 | 3300025972 | Bacteria | 6252 |
| 1147 | Ga0207668_10029829 | 3300025972 | Bacteria | 3579 |
| 1148 | Ga0207668_10089985 | 3300025972 | Bacteria | 2251 |
| 1149 | Ga0207668_10109810 | 3300025972 | Bacteria | 2067 |
| 1150 | Ga0207668_10833667 | 3300025972 | Bacteria | 818 |
| 1151 | Ga0207668_10881402 | 3300025972 | Bacteria | 796 |
| 1152 | Ga0207668_11290713 | 3300025972 | Bacteria | 657 |
| 1153 | Ga0207668_11734783 | 3300025972 | Bacteria | 564 |
| 1154 | Ga0207668_11780447 | 3300025972 | Bacteria | 556 |
| 1155 | Ga0207640_10001771 | 3300025981 | Bacteria | 11596 |
| 1156 | Ga0207640_10371902 | 3300025981 | Bacteria | 1155 |
| 1157 | Ga0207640_10628406 | 3300025981 | Bacteria | 912 |
| 1158 | Ga0207640_11188970 | 3300025981 | Bacteria | 677 |
| 1159 | Ga0207658_10005779 | 3300025986 | Bacteria | 8464 |
| 1160 | Ga0207658_10152106 | 3300025986 | Bacteria | 1886 |
| 1161 | Ga0207658_10170219 | 3300025986 | Bacteria | 1794 |
| 1162 | Ga0207658_10442317 | 3300025986 | Bacteria | 1149 |
| 1163 | Ga0207658_10657076 | 3300025986 | Bacteria | 945 |
| 1164 | Ga0207658_10832849 | 3300025986 | Bacteria | 838 |
| 1165 | Ga0207658_10980291 | 3300025986 | Bacteria | 771 |
| 1166 | Ga0207658_11153898 | 3300025986 | Bacteria | 708 |
| 1167 | Ga0207658_11469160 | 3300025986 | Bacteria | 623 |
| 1168 | Ga0207658_11999587 | 3300025986 | Bacteria | 527 |
| 1169 | Ga0207658_12173926 | 3300025986 | Bacteria | 504 |
| 1170 | Ga0207677_10055174 | 3300026023 | Bacteria | 2716 |
| 1171 | Ga0207677_10081818 | 3300026023 | Bacteria | 2319 |
| 1172 | Ga0207677_10102621 | 3300026023 | Bacteria | 2109 |
| 1173 | Ga0207677_10148454 | 3300026023 | Bacteria | 1805 |
| 1174 | Ga0207677_10585261 | 3300026023 | Bacteria | 977 |
| 1175 | Ga0207677_10753603 | 3300026023 | Bacteria | 868 |
| 1176 | Ga0207677_11389288 | 3300026023 | Unclassified | 646 |
| 1177 | Ga0207703_10007776 | 3300026035 | Bacteria | 8484 |
| 1178 | Ga0207703_10018959 | 3300026035 | Bacteria | 5374 |
| 1179 | Ga0207703_10053903 | 3300026035 | Bacteria | 3269 |
| 1180 | Ga0207703_10133057 | 3300026035 | Bacteria | 2150 |
| 1181 | Ga0207703_10609806 | 3300026035 | Bacteria | 1033 |
| 1182 | Ga0207703_10655802 | 3300026035 | Bacteria | 996 |
| 1183 | Ga0207703_11086685 | 3300026035 | Bacteria | 768 |
| 1184 | Ga0207639_10000002 | 3300026041 | Bacteria | 903066 |
| 1185 | Ga0207639_10205773 | 3300026041 | Bacteria | 1691 |
| 1186 | Ga0207639_10654560 | 3300026041 | Bacteria | 972 |
| 1187 | Ga0207678_10076735 | 3300026067 | Bacteria | 2862 |
| 1188 | Ga0207678_10095292 | 3300026067 | Bacteria | 2543 |
| 1189 | Ga0207678_10266782 | 3300026067 | Bacteria | 1468 |
| 1190 | Ga0207678_10521838 | 3300026067 | Bacteria | 1037 |
| 1191 | Ga0207678_10550534 | 3300026067 | Bacteria | 1009 |
| 1192 | Ga0207678_11454139 | 3300026067 | Bacteria | 605 |
| 1193 | Ga0207708_10006632 | 3300026075 | Bacteria | 8569 |
| 1194 | Ga0207708_10097558 | 3300026075 | Bacteria | 2271 |
| 1195 | Ga0207708_10257878 | 3300026075 | Bacteria | 1407 |
| 1196 | Ga0207708_10375537 | 3300026075 | Bacteria | 1171 |
| 1197 | Ga0207702_10001504 | 3300026078 | Bacteria | 23046 |
| 1198 | Ga0207702_10002467 | 3300026078 | Bacteria | 17513 |
| 1199 | Ga0207702_10049604 | 3300026078 | Bacteria | 3542 |
| 1200 | Ga0207702_10228340 | 3300026078 | Bacteria | 1738 |
| 1201 | Ga0207702_10646637 | 3300026078 | Bacteria | 1040 |
| 1202 | Ga0207702_11497995 | 3300026078 | Bacteria | 668 |
| 1203 | Ga0207641_10032948 | 3300026088 | Bacteria | 4304 |
| 1204 | Ga0207641_10036408 | 3300026088 | Bacteria | 4108 |
| 1205 | Ga0207641_10060341 | 3300026088 | Bacteria | 3233 |
| 1206 | Ga0207641_10128608 | 3300026088 | Bacteria | 2271 |
| 1207 | Ga0207641_10362709 | 3300026088 | Bacteria | 1384 |
| 1208 | Ga0207641_10618282 | 3300026088 | Bacteria | 1062 |
| 1209 | Ga0207641_11043400 | 3300026088 | Bacteria | 815 |
| 1210 | Ga0207641_11306106 | 3300026088 | Bacteria | 726 |
| 1211 | Ga0207641_11381735 | 3300026088 | Bacteria | 705 |
| 1212 | Ga0207641_11480833 | 3300026088 | Bacteria | 680 |
| 1213 | Ga0207648_10000612 | 3300026089 | Bacteria | 40038 |
| 1214 | Ga0207648_10064653 | 3300026089 | Unclassified | 3188 |
| 1215 | Ga0207648_10653012 | 3300026089 | Bacteria | 972 |
| 1216 | Ga0207648_10875495 | 3300026089 | Bacteria | 838 |
| 1217 | Ga0207648_11129022 | 3300026089 | Bacteria | 735 |
| 1218 | Ga0207676_10012822 | 3300026095 | Bacteria | 6016 |
| 1219 | Ga0207676_10044354 | 3300026095 | Bacteria | 3430 |
| 1220 | Ga0207676_10187659 | 3300026095 | Bacteria | 1816 |
| 1221 | Ga0207676_10194360 | 3300026095 | Bacteria | 1788 |
| 1222 | Ga0207676_10402926 | 3300026095 | Bacteria | 1279 |
| 1223 | Ga0207676_10899002 | 3300026095 | Bacteria | 868 |
| 1224 | Ga0207676_10972788 | 3300026095 | Bacteria | 835 |
| 1225 | Ga0207676_11876748 | 3300026095 | Bacteria | 598 |
| 1226 | Ga0207676_12267316 | 3300026095 | Bacteria | 541 |
| 1227 | Ga0207676_12277330 | 3300026095 | Unclassified | 539 |
| 1228 | Ga0207674_10013415 | 3300026116 | Bacteria | 9095 |
| 1229 | Ga0207674_10135214 | 3300026116 | Bacteria | 2427 |
| 1230 | Ga0207674_10335803 | 3300026116 | Bacteria | 1461 |
| 1231 | Ga0207674_11609942 | 3300026116 | Bacteria | 618 |
| 1232 | Ga0207675_100020388 | 3300026118 | Bacteria | 6179 |
| 1233 | Ga0207675_100353104 | 3300026118 | Bacteria | 1441 |
| 1234 | Ga0207675_100519711 | 3300026118 | Bacteria | 1187 |
| 1235 | Ga0207675_100524426 | 3300026118 | Bacteria | 1181 |
| 1236 | Ga0207675_100572425 | 3300026118 | Bacteria | 1130 |
| 1237 | Ga0207675_100587627 | 3300026118 | Bacteria | 1115 |
| 1238 | Ga0207675_101003326 | 3300026118 | Bacteria | 853 |
| 1239 | Ga0207675_102687646 | 3300026118 | Bacteria | 506 |
| 1240 | Ga0207683_10009358 | 3300026121 | Bacteria | 8345 |
| 1241 | Ga0207683_10036687 | 3300026121 | Bacteria | 4270 |
| 1242 | Ga0207683_10080355 | 3300026121 | Bacteria | 2892 |
| 1243 | Ga0207683_10125371 | 3300026121 | Bacteria | 2307 |
| 1244 | Ga0207683_10246548 | 3300026121 | Bacteria | 1630 |
| 1245 | Ga0207683_10371229 | 3300026121 | Unclassified | 1314 |
| 1246 | Ga0207683_10562634 | 3300026121 | Bacteria | 1054 |
| 1247 | Ga0207683_11745733 | 3300026121 | Bacteria | 572 |
| 1248 | Ga0207683_12130165 | 3300026121 | Unclassified | 509 |
| 1249 | Ga0207698_10117274 | 3300026142 | Unclassified | 2245 |
| 1250 | Ga0207698_10620146 | 3300026142 | Bacteria | 1068 |
| 1251 | Ga0207698_10801523 | 3300026142 | Bacteria | 944 |
| 1252 | Ga0207698_11472055 | 3300026142 | Bacteria | 696 |
| 1253 | Ga0207698_12029469 | 3300026142 | Bacteria | 589 |
| 1254 | Ga0209969_1075083 | 3300027360 | Bacteria | 539 |
| 1255 | Ga0209179_1038669 | 3300027512 | Bacteria | 999 |
| 1256 | Ga0209968_1104973 | 3300027526 | Bacteria | 516 |
| 1257 | Ga0210002_1029966 | 3300027617 | Bacteria | 902 |
| 1258 | Ga0209998_10200725 | 3300027717 | Bacteria | 521 |
| 1259 | Ga0209974_10112043 | 3300027876 | Bacteria | 961 |
| 1260 | Ga0209974_10147754 | 3300027876 | Unclassified | 847 |
| 1261 | Ga0209974_10171331 | 3300027876 | Bacteria | 791 |
| 1262 | Ga0209974_10273834 | 3300027876 | Bacteria | 640 |
| 1263 | Ga0207428_10126902 | 3300027907 | Bacteria | 1953 |
| 1264 | Ga0207428_10140317 | 3300027907 | Bacteria | 1845 |
| 1265 | Ga0207428_10184025 | 3300027907 | Bacteria | 1577 |
| 1266 | Ga0207428_10394927 | 3300027907 | Bacteria | 1013 |
| 1267 | Ga0268266_10000031 | 3300028379 | Bacteria | 406292 |
| 1268 | Ga0268266_10002821 | 3300028379 | Bacteria | 18126 |
| 1269 | Ga0268266_10047522 | 3300028379 | Bacteria | 3677 |
| 1270 | Ga0268266_10141881 | 3300028379 | Bacteria | 2156 |
| 1271 | Ga0268266_10147762 | 3300028379 | Bacteria | 2115 |
| 1272 | Ga0268266_10156877 | 3300028379 | Bacteria | 2056 |
| 1273 | Ga0268266_10514334 | 3300028379 | Bacteria | 1144 |
| 1274 | Ga0268266_10706271 | 3300028379 | Bacteria | 972 |
| 1275 | Ga0268266_10744803 | 3300028379 | Bacteria | 945 |
| 1276 | Ga0268266_10915275 | 3300028379 | Bacteria | 848 |
| 1277 | Ga0268266_11383296 | 3300028379 | Bacteria | 679 |
| 1278 | Ga0268266_11466802 | 3300028379 | Bacteria | 658 |
| 1279 | Ga0268265_10143675 | 3300028380 | Bacteria | 2001 |
| 1280 | Ga0268265_10336624 | 3300028380 | Bacteria | 1373 |
| 1281 | Ga0268265_10390961 | 3300028380 | Bacteria | 1282 |
| 1282 | Ga0268265_10588176 | 3300028380 | Bacteria | 1062 |
| 1283 | Ga0268265_11007178 | 3300028380 | Bacteria | 823 |
| 1284 | Ga0268265_12637424 | 3300028380 | Bacteria | 508 |
| 1285 | Ga0268264_10000490 | 3300028381 | Bacteria | 52433 |
| 1286 | Ga0268264_10010376 | 3300028381 | Bacteria | 7702 |
| 1287 | Ga0268264_10040759 | 3300028381 | Bacteria | 3837 |
| 1288 | Ga0268264_10152610 | 3300028381 | Bacteria | 2073 |
| 1289 | Ga0268264_10263862 | 3300028381 | Bacteria | 1606 |
| 1290 | Ga0268264_10843530 | 3300028381 | Bacteria | 917 |
| 1291 | Ga0268264_10975788 | 3300028381 | Bacteria | 853 |
| 1292 | Ga0268264_11065684 | 3300028381 | Bacteria | 816 |
| 1293 | Ga0268264_11102274 | 3300028381 | Unclassified | 802 |
| 1294 | Ga0268264_11735586 | 3300028381 | Bacteria | 635 |
| 1295 | Ga0265337_1011579 | 3300028556 | Bacteria | 3032 |
| 1296 | Ga0265326_10004921 | 3300028558 | Bacteria | 4232 |
| 1297 | Ga0265319_1090682 | 3300028563 | Bacteria | 965 |
| 1298 | Ga0265323_10004821 | 3300028653 | Bacteria | 5779 |
| 1299 | Ga0265338_10042182 | 3300028800 | Bacteria | 4254 |
| 1300 | Ga0265338_10055943 | 3300028800 | Bacteria | 3504 |
| 1301 | Ga0265338_10057989 | 3300028800 | Bacteria | 3421 |
| 1302 | Ga0265338_10078952 | 3300028800 | Bacteria | 2772 |
| 1303 | Ga0265338_10120162 | 3300028800 | Bacteria | 2096 |
| 1304 | Ga0265338_10185306 | 3300028800 | Bacteria | 1583 |
| 1305 | Ga0265338_10234227 | 3300028800 | Bacteria | 1364 |
| 1306 | Ga0265338_10392461 | 3300028800 | Bacteria | 991 |
| 1307 | Ga0265324_10000744 | 3300029957 | Bacteria | 21661 |
| 1308 | Ga0265324_10005663 | 3300029957 | Bacteria | 5339 |
| 1309 | Ga0265324_10056285 | 3300029957 | Bacteria | 1347 |
| 1310 | Ga0265324_10205455 | 3300029957 | Bacteria | 669 |
| 1311 | Ga0265324_10260613 | 3300029957 | Unclassified | 589 |
| 1312 | Ga0307511_10000356 | 3300030521 | Bacteria | 48468 |
| 1313 | Ga0265325_10092814 | 3300031241 | Bacteria | 1486 |
| 1314 | Ga0265325_10432668 | 3300031241 | Bacteria | 574 |
| 1315 | Ga0265340_10004729 | 3300031247 | Bacteria | 7568 |
| 1316 | Ga0265327_10000981 | 3300031251 | Bacteria | 40636 |
| 1317 | Ga0265327_10001732 | 3300031251 | Bacteria | 25842 |
| 1318 | Ga0265327_10506298 | 3300031251 | Bacteria | 520 |
| 1319 | Ga0265327_10515495 | 3300031251 | Bacteria | 515 |
| 1320 | Ga0265316_10065020 | 3300031344 | Bacteria | 2825 |
| 1321 | Ga0307513_10024894 | 3300031456 | Bacteria | 6954 |
| 1322 | Ga0307408_100071641 | 3300031548 | Bacteria | 2563 |
| 1323 | Ga0307408_100093208 | 3300031548 | Bacteria | 2278 |
| 1324 | Ga0307408_100425310 | 3300031548 | Bacteria | 1146 |
| 1325 | Ga0307408_100849871 | 3300031548 | Bacteria | 832 |
| 1326 | Ga0307408_100906181 | 3300031548 | Bacteria | 807 |
| 1327 | Ga0307408_101947599 | 3300031548 | Bacteria | 564 |
| 1328 | Ga0265314_10103220 | 3300031711 | Bacteria | 1828 |
| 1329 | Ga0265314_10378101 | 3300031711 | Bacteria | 772 |
| 1330 | Ga0265342_10068536 | 3300031712 | Bacteria | 2073 |
| 1331 | Ga0307405_10063523 | 3300031731 | Bacteria | 2342 |
| 1332 | Ga0307405_10095620 | 3300031731 | Bacteria | 1979 |
| 1333 | Ga0307405_10231625 | 3300031731 | Bacteria | 1362 |
| 1334 | Ga0307405_10408954 | 3300031731 | Bacteria | 1064 |
| 1335 | Ga0307405_10679078 | 3300031731 | Bacteria | 850 |
| 1336 | Ga0307405_10992433 | 3300031731 | Bacteria | 716 |
| 1337 | Ga0307413_10010373 | 3300031824 | Bacteria | 4515 |
| 1338 | Ga0307413_10015554 | 3300031824 | Bacteria | 3903 |
| 1339 | Ga0307413_10051152 | 3300031824 | Bacteria | 2488 |
| 1340 | Ga0307413_10099797 | 3300031824 | Bacteria | 1915 |
| 1341 | Ga0307413_10150839 | 3300031824 | Bacteria | 1619 |
| 1342 | Ga0307413_10201561 | 3300031824 | Bacteria | 1437 |
| 1343 | Ga0307413_10320086 | 3300031824 | Bacteria | 1184 |
| 1344 | Ga0307410_10006805 | 3300031852 | Bacteria | 6205 |
| 1345 | Ga0307410_10008590 | 3300031852 | Bacteria | 5675 |
| 1346 | Ga0307410_10020165 | 3300031852 | Bacteria | 4072 |
| 1347 | Ga0307410_10041478 | 3300031852 | Bacteria | 3036 |
| 1348 | Ga0307410_10057779 | 3300031852 | Bacteria | 2643 |
| 1349 | Ga0307410_10346664 | 3300031852 | Bacteria | 1185 |
| 1350 | Ga0307410_10475971 | 3300031852 | Bacteria | 1023 |
| 1351 | Ga0307410_11334514 | 3300031852 | Bacteria | 628 |
| 1352 | Ga0307410_11711602 | 3300031852 | Bacteria | 557 |
| 1353 | Ga0307410_12092265 | 3300031852 | Bacteria | 506 |
| 1354 | Ga0307406_10008452 | 3300031901 | Bacteria | 5744 |
| 1355 | Ga0307406_10044210 | 3300031901 | Bacteria | 2791 |
| 1356 | Ga0307406_10148028 | 3300031901 | Bacteria | 1671 |
| 1357 | Ga0307406_10179223 | 3300031901 | Bacteria | 1541 |
| 1358 | Ga0307406_11642959 | 3300031901 | Bacteria | 568 |
| 1359 | Ga0307406_12087218 | 3300031901 | Bacteria | 508 |
| 1360 | Ga0307407_10005095 | 3300031903 | Bacteria | 5663 |
| 1361 | Ga0307407_10039348 | 3300031903 | Bacteria | 2629 |
| 1362 | Ga0307407_10090773 | 3300031903 | Bacteria | 1872 |
| 1363 | Ga0307407_10454268 | 3300031903 | Bacteria | 930 |
| 1364 | Ga0307407_10762030 | 3300031903 | Bacteria | 734 |
| 1365 | Ga0307407_10766904 | 3300031903 | Bacteria | 731 |
| 1366 | Ga0307412_10042584 | 3300031911 | Bacteria | 2952 |
| 1367 | Ga0307412_10514252 | 3300031911 | Bacteria | 999 |
| 1368 | Ga0307412_10894624 | 3300031911 | Bacteria | 778 |
| 1369 | Ga0307409_100003004 | 3300031995 | Bacteria | 9000 |
| 1370 | Ga0307409_100014634 | 3300031995 | Bacteria | 5113 |
| 1371 | Ga0307409_100023493 | 3300031995 | Bacteria | 4274 |
| 1372 | Ga0307409_100042998 | 3300031995 | Bacteria | 3388 |
| 1373 | Ga0307409_100045105 | 3300031995 | Bacteria | 3326 |
| 1374 | Ga0307409_100083572 | 3300031995 | Bacteria | 2589 |
| 1375 | Ga0307409_100286353 | 3300031995 | Bacteria | 1526 |
| 1376 | Ga0307409_100356146 | 3300031995 | Bacteria | 1383 |
| 1377 | Ga0307409_100619445 | 3300031995 | Bacteria | 1072 |
| 1378 | Ga0307409_102470349 | 3300031995 | Bacteria | 548 |
| 1379 | Ga0307416_100009633 | 3300032002 | Bacteria | 6336 |
| 1380 | Ga0307416_100027570 | 3300032002 | Bacteria | 4209 |
| 1381 | Ga0307416_100045957 | 3300032002 | Bacteria | 3442 |
| 1382 | Ga0307416_100053571 | 3300032002 | Bacteria | 3237 |
| 1383 | Ga0307416_100058553 | 3300032002 | Bacteria | 3125 |
| 1384 | Ga0307416_100076924 | 3300032002 | Bacteria | 2800 |
| 1385 | Ga0307416_100236469 | 3300032002 | Bacteria | 1766 |
| 1386 | Ga0307416_100246682 | 3300032002 | Bacteria | 1735 |
| 1387 | Ga0307416_100441448 | 3300032002 | Bacteria | 1351 |
| 1388 | Ga0307416_100652717 | 3300032002 | Bacteria | 1137 |
| 1389 | Ga0307416_100984322 | 3300032002 | Bacteria | 946 |
| 1390 | Ga0307416_101664852 | 3300032002 | Bacteria | 743 |
| 1391 | Ga0307416_103046012 | 3300032002 | Bacteria | 561 |
| 1392 | Ga0307414_10018396 | 3300032004 | Bacteria | 4301 |
| 1393 | Ga0307414_10046014 | 3300032004 | Bacteria | 2992 |
| 1394 | Ga0307414_10067533 | 3300032004 | Bacteria | 2562 |
| 1395 | Ga0307414_10179811 | 3300032004 | Bacteria | 1700 |
| 1396 | Ga0307414_10190725 | 3300032004 | Bacteria | 1658 |
| 1397 | Ga0307414_10317095 | 3300032004 | Bacteria | 1325 |
| 1398 | Ga0307414_10449004 | 3300032004 | Bacteria | 1130 |
| 1399 | Ga0307414_11337357 | 3300032004 | Bacteria | 665 |
| 1400 | Ga0307411_10003099 | 3300032005 | Bacteria | 7609 |
| 1401 | Ga0307411_10005029 | 3300032005 | Bacteria | 6431 |
| 1402 | Ga0307411_10024400 | 3300032005 | Bacteria | 3605 |
| 1403 | Ga0307411_10055315 | 3300032005 | Bacteria | 2610 |
| 1404 | Ga0307411_10095416 | 3300032005 | Bacteria | 2088 |
| 1405 | Ga0307411_10298164 | 3300032005 | Bacteria | 1291 |
| 1406 | Ga0307411_10611506 | 3300032005 | Bacteria | 938 |
| 1407 | Ga0307411_10698205 | 3300032005 | Bacteria | 883 |
| 1408 | Ga0307411_11780090 | 3300032005 | Bacteria | 571 |
| 1409 | Ga0307415_100000666 | 3300032126 | Bacteria | 15183 |
| 1410 | Ga0307415_100077683 | 3300032126 | Bacteria | 2358 |
| 1411 | Ga0307415_100148040 | 3300032126 | Bacteria | 1803 |
| 1412 | Ga0307415_100174589 | 3300032126 | Bacteria | 1679 |
| 1413 | Ga0307415_100608123 | 3300032126 | Bacteria | 974 |
| 1414 | Ga0307415_100711555 | 3300032126 | Bacteria | 907 |
| 1415 | Ga0307415_101584614 | 3300032126 | Bacteria | 629 |
| 1416 | Ga0373948_0090104 | 3300034817 | Bacteria | 711 |
| 1417 | Ga0373959_0048516 | 3300034820 | Bacteria | 911 |
| 1418 | Ga0373959_0141689 | 3300034820 | Bacteria | 602 |
| 1419 | Ga0373938_0024118 | 3300034957 | Bacteria | 1256 |
| 1420 | Ga0373934_0261097 | 3300035086 | Bacteria | 717 |
| 1421 | Ga0373940_0103172 | 3300035088 | Bacteria | 868 |
| 1422 | Ga0373940_0221816 | 3300035088 | Unclassified | 628 |
| 1423 | Ga0373944_0098620 | 3300035089 | Bacteria | 985 |
| 1424 | Ga0373944_0376766 | 3300035089 | Bacteria | 544 |
| 1425 | Ga0373949_0124666 | 3300035090 | Bacteria | 726 |
| 1426 | Ga0373923_0325355 | 3300035111 | Bacteria | 731 |
| 1427 | Ga0373932_0221417 | 3300035112 | Bacteria | 680 |
| 1428 | Ga0373939_0193889 | 3300035114 | Bacteria | 765 |
| 1429 | Ga0373939_0253374 | 3300035114 | Bacteria | 686 |
| 1430 | Ga0373939_0321875 | 3300035114 | Bacteria | 622 |
| 1431 | Ga0373941_0058935 | 3300035115 | Bacteria | 1244 |
| 1432 | Ga0373941_0281300 | 3300035115 | Bacteria | 658 |
| 1433 | Ga0373945_0176235 | 3300035116 | Bacteria | 878 |
| 1434 | Ga0373953_0024734 | 3300035117 | Bacteria | 2286 |
| 1435 | Ga0373953_0202213 | 3300035117 | Bacteria | 859 |
| 1436 | Ga0373953_0234936 | 3300035117 | Bacteria | 795 |
| 1437 | Ga0373954_0021839 | 3300035118 | Bacteria | 2900 |
| 1438 | Ga0373954_0152775 | 3300035118 | Bacteria | 1128 |
| 1439 | Ga0373956_0492958 | 3300035119 | Bacteria | 585 |
| 1440 | Ga0373957_0145856 | 3300035120 | Bacteria | 970 |
| 1441 | Ga0373957_0313091 | 3300035120 | Bacteria | 667 |
| 1442 | Ga0373960_0147520 | 3300035121 | Bacteria | 801 |
| 1443 | Ga0373943_0219330 | 3300035170 | Bacteria | 1059 |
| 1444 | Ga0373943_0299460 | 3300035170 | Bacteria | 913 |
| 1445 | Ga0373943_0304300 | 3300035170 | Bacteria | 906 |
| 1446 | Ga0373943_0444201 | 3300035170 | Bacteria | 753 |
| 1447 | Ga0373943_0936307 | 3300035170 | Bacteria | 518 |
| 1448 | Ga0373946_0328342 | 3300035171 | Bacteria | 761 |
| 1449 | Ga0373955_0115760 | 3300035172 | Bacteria | 1554 |
| 1450 | Ga0373955_0446899 | 3300035172 | Bacteria | 788 |
| 1451 | Ga0373955_0595079 | 3300035172 | Bacteria | 677 |
| 1452 | Ga0373961_0025608 | 3300035241 | Bacteria | 1605 |
| 1453 | Ga0373961_0225914 | 3300035241 | Bacteria | 669 |
| 1454 | Ga0373962_0086686 | 3300035242 | Bacteria | 959 |
| 1455 | Ga0316574_0528705 | 3300035398 | Bacteria | 733 |
| 1456 | Ga0373924_0049684 | 3300035410 | Unclassified | 1736 |
| 1457 | Ga0373931_0040722 | 3300035691 | Bacteria | 2439 |
| 1458 | Ga0373931_0089040 | 3300035691 | Bacteria | 1717 |
| 1459 | Ga0373931_0090386 | 3300035691 | Bacteria | 1705 |
| 1460 | Ga0373931_0124824 | 3300035691 | Bacteria | 1475 |
| 1461 | Ga0373931_0204509 | 3300035691 | Bacteria | 1181 |
| 1462 | Ga0373931_1025801 | 3300035691 | Bacteria | 559 |
| 1463 | Ga0373935_0012815 | 3300035692 | Bacteria | 5050 |
| 1464 | Ga0373935_0688124 | 3300035692 | Bacteria | 752 |
| 1465 | Ga0373927_0001027 | 3300035695 | Bacteria | 21256 |
| 1466 | Ga0373927_0240924 | 3300035695 | Bacteria | 1189 |
| 1467 | Ga0373927_1092565 | 3300035695 | Bacteria | 526 |
| 1468 | Ga0373927_1199743 | 3300035695 | Bacteria | 500 |
| 1469 | Ga0373933_0682409 | 3300035724 | Bacteria | 675 |
| 1470 | Ga0373947_0006561 | 3300035725 | Bacteria | 6748 |
| 1471 | Ga0373947_0045704 | 3300035725 | Unclassified | 2621 |
| 1472 | Ga0373947_0064308 | 3300035725 | Bacteria | 2237 |
| 1473 | Ga0373937_0017356 | 3300036401 | Bacteria | 6411 |
| 1474 | Ga0373937_0177494 | 3300036401 | Bacteria | 2000 |
| 1475 | Ga0373937_0319398 | 3300036401 | Bacteria | 1469 |
| 1476 | Ga0373937_1633811 | 3300036401 | Bacteria | 591 |
| 1477 | Ga0373925_0034723 | 3300037068 | Bacteria | 3718 |
| 1478 | Ga0373925_0098578 | 3300037068 | Unclassified | 2243 |
| 1479 | Ga0373925_0188911 | 3300037068 | Unclassified | 1634 |
| 1480 | Ga0373925_0643059 | 3300037068 | Bacteria | 874 |
| 1481 | Ga0373925_0682257 | 3300037068 | Bacteria | 847 |
| 1482 | Ga0395899_0000020 | 3300037312 | Bacteria | 404354 |
| 1483 | Ga0395899_0147628 | 3300037312 | Bacteria | 1669 |
| 1484 | Ga0395899_0977859 | 3300037312 | Bacteria | 512 |
| 1485 | Ga0395900_0025758 | 3300037418 | Bacteria | 6020 |
| 1486 | Ga0395900_0204403 | 3300037418 | Bacteria | 1997 |
| 1487 | Ga0395900_0563951 | 3300037418 | Bacteria | 1082 |
| 1488 | Ga0395900_1568402 | 3300037418 | Bacteria | 570 |
| 1489 | Ga0395898_0000005 | 3300037466 | Bacteria | 621247 |
| 1490 | Ga0395898_0346400 | 3300037466 | Bacteria | 1417 |
| 1491 | Ga0395898_0417235 | 3300037466 | Bacteria | 1279 |
| 1492 | Ga0395898_0612638 | 3300037466 | Bacteria | 1031 |
| 1493 | Ga0395905_0010612 | 3300037471 | Bacteria | 8943 |
| 1494 | Ga0395905_0150611 | 3300037471 | Bacteria | 2189 |
| 1495 | Ga0395905_0308654 | 3300037471 | Bacteria | 1470 |
| 1496 | Ga0395905_0716654 | 3300037471 | Bacteria | 903 |
| 1497 | Ga0395905_0881465 | 3300037471 | Bacteria | 798 |
| 1498 | Ga0436364_0505772 | 3300037853 | Bacteria | 1768 |
| 1499 | Ga0436364_0823930 | 3300037853 | Bacteria | 2413 |
| 1500 | Ga0436364_1396628 | 3300037853 | Unclassified | 679 |
| 1501 | Ga0436364_1512261 | 3300037853 | Bacteria | 7242 |
| 1502 | Ga0395901_0035274 | 3300038443 | Bacteria | 5168 |
| 1503 | Ga0395901_0346224 | 3300038443 | Bacteria | 1534 |
| 1504 | Ga0395901_0363995 | 3300038443 | Bacteria | 1491 |
| 1505 | Ga0395901_0379938 | 3300038443 | Bacteria | 1454 |
| 1506 | Ga0395901_0387784 | 3300038443 | Bacteria | 1437 |
| 1507 | Ga0395901_0911573 | 3300038443 | Bacteria | 860 |
| 1508 | Ga0242420_049142 | 3300038996 | Bacteria | 821 |
| 1509 | Ga0242420_070842 | 3300038996 | Bacteria | 708 |
| 1510 | Ga0400487_17689 | 3300039110 | Bacteria | 1324 |
| 1511 | Ga0436365_0124390 | 3300039437 | Bacteria | 1624 |
| 1512 | Ga0436365_0373930 | 3300039437 | Bacteria | 1898 |
| 1513 | Ga0436365_0449926 | 3300039437 | Bacteria | 19026 |
| 1514 | Ga0436365_0568727 | 3300039437 | Bacteria | 519 |
| 1515 | Ga0436365_1024521 | 3300039437 | Bacteria | 1396 |
| 1516 | Ga0436365_1112867 | 3300039437 | Bacteria | 50005 |
| 1517 | Ga0436365_1621097 | 3300039437 | Bacteria | 6312 |
| 1518 | Ga0436360_0633339 | 3300039438 | Bacteria | 3931 |
| 1519 | Ga0436360_0691807 | 3300039438 | Unclassified | 1809 |
| 1520 | Ga0436360_1033638 | 3300039438 | Bacteria | 2395 |
| 1521 | Ga0436360_1107696 | 3300039438 | Unclassified | 4066 |
| 1522 | Ga0436361_0045124 | 3300039447 | Unclassified | 2328 |
| 1523 | Ga0436361_0147811 | 3300039447 | Bacteria | 1639 |
| 1524 | Ga0436361_0155125 | 3300039447 | Bacteria | 10559 |
| 1525 | Ga0436361_0169046 | 3300039447 | Bacteria | 26611 |
| 1526 | Ga0436361_0344738 | 3300039447 | Bacteria | 2200 |
| 1527 | Ga0436361_0405526 | 3300039447 | Bacteria | 11056 |
| 1528 | Ga0436361_0626659 | 3300039447 | Bacteria | 4353 |
| 1529 | Ga0436361_0917304 | 3300039447 | Bacteria | 39295 |
| 1530 | Ga0436361_0981451 | 3300039447 | Bacteria | 557 |
| 1531 | Ga0436363_0803061 | 3300039450 | Bacteria | 15961 |
| 1532 | Ga0436363_0848729 | 3300039450 | Bacteria | 11384 |
| 1533 | Ga0436363_1578574 | 3300039450 | Unclassified | 795 |
| 1534 | Ga0436362_0213225 | 3300039453 | Bacteria | 644 |
| 1535 | Ga0436362_0310560 | 3300039453 | Bacteria | 959 |
| 1536 | Ga0436362_0336515 | 3300039453 | Bacteria | 1036 |
| 1537 | Ga0436362_0616189 | 3300039453 | Bacteria | 2199 |
| 1538 | Ga0436362_0955727 | 3300039453 | Bacteria | 1856 |
| 1539 | Ga0436362_1222664 | 3300039453 | Bacteria | 543 |
| 1540 | Ga0439436_0142735 | 3300041404 | Bacteria | 674 |
| 1541 | Ga0439461_0082667 | 3300041410 | Bacteria | 760 |
| 1542 | Ga0439461_0115238 | 3300041410 | Bacteria | 667 |
| 1543 | Ga0439466_0146094 | 3300041411 | Bacteria | 725 |
| 1544 | Ga0439465_0120502 | 3300041413 | Bacteria | 920 |
| 1545 | Ga0439465_0222847 | 3300041413 | Bacteria | 692 |
| 1546 | Ga0451789_0209120 | 3300041443 | Bacteria | 722 |
| 1547 | Ga0451793_1292636 | 3300041452 | Bacteria | 1423 |
| 1548 | Ga0451798_0000265 | 3300041458 | Bacteria | 692 |
| 1549 | Ga0451798_0249200 | 3300041458 | Bacteria | 546 |
| 1550 | Ga0451798_0656924 | 3300041458 | Bacteria | 768 |
| 1551 | Ga0451798_1034082 | 3300041458 | Bacteria | 663 |
| 1552 | Ga0451800_0130657 | 3300041459 | Bacteria | 1005 |
| 1553 | Ga0451802_0846379 | 3300041460 | Unclassified | 582 |
| 1554 | Ga0451805_049017 | 3300041461 | Bacteria | 637 |
| 1555 | Ga0451804_0729216 | 3300041463 | Bacteria | 613 |
| 1556 | Ga0451807_0449875 | 3300041486 | Bacteria | 679 |
| 1557 | Ga0451807_0559256 | 3300041486 | Bacteria | 722 |
| 1558 | Ga0451807_0937083 | 3300041486 | Bacteria | 565 |
| 1559 | Ga0451807_0937796 | 3300041486 | Bacteria | 602 |
| 1560 | Ga0451807_1346229 | 3300041486 | Bacteria | 1020 |
| 1561 | Ga0451835_0845796 | 3300041492 | Unclassified | 648 |
| 1562 | Ga0451839_1339201 | 3300041496 | Bacteria | 656 |
| 1563 | Ga0451839_1548798 | 3300041496 | Bacteria | 944 |
| 1564 | Ga0451845_0752156 | 3300041501 | Bacteria | 746 |
| 1565 | Ga0451849_0485370 | 3300041505 | Bacteria | 1245 |
| 1566 | Ga0451849_1349095 | 3300041505 | Bacteria | 552 |
| 1567 | Ga0451851_0507346 | 3300041507 | Bacteria | 584 |
| 1568 | Ga0451853_3595515 | 3300041512 | Bacteria | 1467 |
| 1569 | Ga0439431_0251742 | 3300041997 | Bacteria | 524 |
| 1570 | Ga0439437_030251 | 3300042000 | Bacteria | 679 |
| 1571 | Ga0439443_073159 | 3300042003 | Bacteria | 628 |
| 1572 | Ga0439448_0008572 | 3300042005 | Bacteria | 2996 |
| 1573 | Ga0439448_0158797 | 3300042005 | Bacteria | 786 |
| 1574 | Ga0439451_013570 | 3300042009 | Bacteria | 1647 |
| 1575 | Ga0439454_037404 | 3300042011 | Bacteria | 783 |
| 1576 | Ga0439455_0003989 | 3300042012 | Bacteria | 2880 |
| 1577 | Ga0439446_0011270 | 3300042156 | Bacteria | 2425 |
| 1578 | Ga0439446_0127685 | 3300042156 | Bacteria | 823 |
| 1579 | Ga0439458_0146728 | 3300042157 | Bacteria | 631 |
| 1580 | Ga0439435_0059806 | 3300042436 | Bacteria | 1108 |
| 1581 | Ga0439459_0018953 | 3300042438 | Bacteria | 1299 |
| 1582 | Ga0439464_0115806 | 3300042439 | Bacteria | 823 |
| 1583 | Ga0439460_0025430 | 3300042461 | Bacteria | 1649 |
| 1584 | Ga0439460_0333553 | 3300042461 | Bacteria | 533 |
| 1585 | Ga0450893_0089392 | 3300042532 | Bacteria | 617 |
| 1586 | Ga0451577_0007985 | 3300042876 | Bacteria | 10333 |
| 1587 | Ga0451577_0012394 | 3300042876 | Bacteria | 8007 |
| 1588 | Ga0451577_0118766 | 3300042876 | Bacteria | 2368 |
| 1589 | Ga0439440_0159075 | 3300042993 | Bacteria | 651 |
| 1590 | Ga0439440_0252031 | 3300042993 | Bacteria | 538 |
| 1591 | Ga0466969_0395508 | 3300044656 | Bacteria | 627 |
| 1592 | Ga0453683_0316127 | 3300044673 | Bacteria | 1000 |
| 1593 | Ga0466965_0005363 | 3300044683 | Bacteria | 5773 |
| 1594 | Ga0466966_0335277 | 3300044684 | Unclassified | 909 |
| 1595 | Ga0466963_0575770 | 3300044694 | Bacteria | 795 |
| 1596 | Ga0466964_0009690 | 3300044706 | Bacteria | 3629 |
| 1597 | Ga0453684_0263704 | 3300044712 | Bacteria | 1972 |
| 1598 | Ga0466971_0000058 | 3300044719 | Bacteria | 43131 |
| 1599 | Ga0466957_0046058 | 3300044842 | Bacteria | 2646 |
| 1600 | Ga0466957_0768439 | 3300044842 | Bacteria | 683 |
| 1601 | Ga0466960_0149466 | 3300044901 | Bacteria | 1247 |
| 1602 | Ga0466960_0436220 | 3300044901 | Bacteria | 759 |
| 1603 | Ga0466960_0827205 | 3300044901 | Bacteria | 562 |
| 1604 | Ga0451576_0072646 | 3300045051 | Bacteria | 3580 |
| 1605 | Ga0451576_0084931 | 3300045051 | Bacteria | 3292 |
| 1606 | Ga0451576_0131093 | 3300045051 | Bacteria | 2613 |
| 1607 | Ga0451576_0383999 | 3300045051 | Bacteria | 1472 |
| 1608 | Ga0451576_0958705 | 3300045051 | Bacteria | 897 |
| 1609 | Ga0451576_1516917 | 3300045051 | Bacteria | 696 |
| 1610 | Ga0451576_1830484 | 3300045051 | Bacteria | 627 |
| 1611 | Ga0466967_0015079 | 3300045976 | Bacteria | 6047 |
| 1612 | Ga0466967_0354280 | 3300045976 | Bacteria | 1421 |
| 1613 | Ga0466967_0580955 | 3300045976 | Bacteria | 1105 |
| 1614 | Ga0466967_0789694 | 3300045976 | Bacteria | 942 |
| 1615 | Ga0495592_0000006 | 3300046454 | Bacteria | 192981 |
| 1616 | Ga0495592_0069715 | 3300046454 | Bacteria | 2563 |
| 1617 | Ga0495592_0146039 | 3300046454 | Bacteria | 1640 |
| 1618 | Ga0495603_0015630 | 3300046455 | Bacteria | 4593 |
| 1619 | Ga0495603_0248231 | 3300046455 | Bacteria | 1025 |
| 1620 | Ga0495590_0230280 | 3300046457 | Bacteria | 686 |
| 1621 | Ga0495629_0496486 | 3300046459 | Bacteria | 823 |
| 1622 | Ga0495641_0023473 | 3300046461 | Bacteria | 3063 |
| 1623 | Ga0495651_0030156 | 3300046462 | Bacteria | 4229 |
| 1624 | Ga0495651_0733126 | 3300046462 | Bacteria | 614 |
| 1625 | Ga0495653_0267718 | 3300046463 | Bacteria | 1127 |
| 1626 | Ga0495580_0292722 | 3300046472 | Bacteria | 1110 |
| 1627 | Ga0495580_0867852 | 3300046472 | Bacteria | 582 |
| 1628 | Ga0495582_0004514 | 3300046473 | Bacteria | 7825 |
| 1629 | Ga0495582_0167005 | 3300046473 | Bacteria | 1252 |
| 1630 | Ga0495605_0449914 | 3300046474 | Bacteria | 531 |
| 1631 | Ga0495639_0062925 | 3300046475 | Bacteria | 1703 |
| 1632 | Ga0495639_0233681 | 3300046475 | Bacteria | 906 |
| 1633 | Ga0495662_0016393 | 3300046476 | Bacteria | 3589 |
| 1634 | Ga0495662_0040643 | 3300046476 | Bacteria | 2246 |
| 1635 | Ga0495585_0630480 | 3300046492 | Bacteria | 503 |
| 1636 | Ga0495594_0009810 | 3300046499 | Bacteria | 4959 |
| 1637 | Ga0495594_0034317 | 3300046499 | Bacteria | 2760 |
| 1638 | Ga0495594_0125728 | 3300046499 | Bacteria | 1451 |
| 1639 | Ga0495608_0263156 | 3300046511 | Bacteria | 1073 |
| 1640 | Ga0495618_0015859 | 3300046514 | Bacteria | 4599 |
| 1641 | Ga0495618_0069098 | 3300046514 | Bacteria | 2246 |
| 1642 | Ga0495618_0111345 | 3300046514 | Bacteria | 1753 |
| 1643 | Ga0495628_0000138 | 3300046516 | Bacteria | 62238 |
| 1644 | Ga0495628_0054183 | 3300046516 | Unclassified | 3162 |
| 1645 | Ga0495628_0504838 | 3300046516 | Bacteria | 873 |
| 1646 | Ga0495628_0702890 | 3300046516 | Bacteria | 714 |
| 1647 | Ga0495630_0001362 | 3300046517 | Bacteria | 16804 |
| 1648 | Ga0495630_0041633 | 3300046517 | Unclassified | 3431 |
| 1649 | Ga0495630_0278163 | 3300046517 | Bacteria | 1279 |
| 1650 | Ga0495630_0380399 | 3300046517 | Bacteria | 1081 |
| 1651 | Ga0495630_0603123 | 3300046517 | Bacteria | 842 |
| 1652 | Ga0495643_0000820 | 3300046522 | Bacteria | 33927 |
| 1653 | Ga0495666_0000412 | 3300046526 | Bacteria | 18941 |
| 1654 | Ga0495666_0016355 | 3300046526 | Bacteria | 3695 |
| 1655 | Ga0495666_0185182 | 3300046526 | Bacteria | 961 |
| 1656 | Ga0495652_0011918 | 3300046529 | Bacteria | 7861 |
| 1657 | Ga0495652_0021022 | 3300046529 | Bacteria | 5801 |
| 1658 | Ga0495652_0495464 | 3300046529 | Bacteria | 848 |
| 1659 | Ga0495652_0930270 | 3300046529 | Bacteria | 572 |
| 1660 | Ga0495665_0082900 | 3300046531 | Bacteria | 1686 |
| 1661 | Ga0495640_0051905 | 3300046533 | Unclassified | 2817 |
| 1662 | Ga0495640_0059807 | 3300046533 | Bacteria | 2593 |
| 1663 | Ga0495640_0070443 | 3300046533 | Bacteria | 2349 |
| 1664 | Ga0495640_0626695 | 3300046533 | Bacteria | 648 |
| 1665 | Ga0495586_0007175 | 3300046535 | Bacteria | 5942 |
| 1666 | Ga0495586_0080014 | 3300046535 | Bacteria | 1794 |
| 1667 | Ga0495586_0300278 | 3300046535 | Bacteria | 920 |
| 1668 | Ga0495587_0543044 | 3300046536 | Bacteria | 642 |
| 1669 | Ga0495598_0068478 | 3300046537 | Bacteria | 1112 |
| 1670 | Ga0495598_0069336 | 3300046537 | Bacteria | 1107 |
| 1671 | Ga0495598_0178890 | 3300046537 | Bacteria | 756 |
| 1672 | Ga0495621_0109494 | 3300046539 | Bacteria | 1058 |
| 1673 | Ga0495645_0000530 | 3300046543 | Bacteria | 26207 |
| 1674 | Ga0495645_0236083 | 3300046543 | Bacteria | 1222 |
| 1675 | Ga0495645_0426986 | 3300046543 | Bacteria | 840 |
| 1676 | Ga0495622_0108379 | 3300046557 | Bacteria | 1272 |
| 1677 | Ga0495633_0175650 | 3300046558 | Bacteria | 987 |
| 1678 | Ga0495667_0103225 | 3300046559 | Unclassified | 1844 |
| 1679 | Ga0495667_0212469 | 3300046559 | Bacteria | 1236 |
| 1680 | Ga0495656_0322171 | 3300046615 | Bacteria | 796 |
| 1681 | Ga0495656_0490469 | 3300046615 | Bacteria | 651 |
| 1682 | Ga0495634_0027622 | 3300046642 | Bacteria | 3947 |
| 1683 | Ga0495611_0328004 | 3300046648 | Bacteria | 704 |
| 1684 | Ga0495611_0537065 | 3300046648 | Bacteria | 530 |
| 1685 | Ga0495635_0187952 | 3300046663 | Bacteria | 1403 |
| 1686 | Ga0495659_0035560 | 3300046664 | Bacteria | 1756 |
| 1687 | Ga0495659_0439624 | 3300046664 | Bacteria | 567 |
| 1688 | Ga0495588_0028500 | 3300046674 | Bacteria | 2795 |
| 1689 | Ga0495599_0014142 | 3300046678 | Bacteria | 4939 |
| 1690 | Ga0495599_0039473 | 3300046678 | Bacteria | 2966 |
| 1691 | Ga0495599_0076713 | 3300046678 | Unclassified | 2087 |
| 1692 | Ga0495623_0401985 | 3300046679 | Bacteria | 737 |
| 1693 | Ga0495623_0501902 | 3300046679 | Bacteria | 640 |
| 1694 | Ga0495646_0046577 | 3300046680 | Unclassified | 2643 |
| 1695 | Ga0495647_0009796 | 3300046681 | Bacteria | 3254 |
| 1696 | Ga0495647_0540985 | 3300046681 | Bacteria | 544 |
| 1697 | Ga0495658_0003313 | 3300046683 | Bacteria | 7995 |
| 1698 | Ga0495658_0082489 | 3300046683 | Bacteria | 1889 |
| 1699 | Ga0495658_0610881 | 3300046683 | Bacteria | 699 |
| 1700 | Ga0495658_0647435 | 3300046683 | Unclassified | 677 |
| 1701 | Ga0495658_0981682 | 3300046683 | Bacteria | 539 |
| 1702 | Ga0495669_0017769 | 3300046684 | Bacteria | 3054 |
| 1703 | Ga0495669_0081814 | 3300046684 | Bacteria | 1483 |
| 1704 | Ga0495669_0094927 | 3300046684 | Bacteria | 1381 |
| 1705 | Ga0495613_0028431 | 3300046689 | Bacteria | 4158 |
| 1706 | Ga0495624_0829280 | 3300046690 | Bacteria | 546 |
| 1707 | Ga0495600_0222407 | 3300046809 | Bacteria | 1207 |
| 1708 | Ga0495600_0337033 | 3300046809 | Bacteria | 946 |
| 1709 | Ga0495581_0075383 | 3300047315 | Bacteria | 1952 |
| 1710 | Ga0495636_0630205 | 3300047318 | Bacteria | 526 |
| 1711 | Ga0495674_0020816 | 3300047319 | Bacteria | 6073 |
| 1712 | Ga0495674_0029534 | 3300047319 | Bacteria | 4991 |
| 1713 | Ga0495674_0056074 | 3300047319 | Bacteria | 3453 |
| 1714 | Ga0495674_0104815 | 3300047319 | Unclassified | 2404 |
| 1715 | Ga0495674_1080123 | 3300047319 | Bacteria | 612 |
| 1716 | Ga0495676_0285364 | 3300047321 | Bacteria | 1117 |
| 1717 | Ga0495680_0004984 | 3300047322 | Bacteria | 12553 |
| 1718 | Ga0495680_0214010 | 3300047322 | Bacteria | 1378 |
| 1719 | Ga0495680_0233196 | 3300047322 | Bacteria | 1310 |
| 1720 | Ga0495675_0355540 | 3300047444 | Bacteria | 861 |
| 1721 | Ga0495684_0012158 | 3300047471 | Bacteria | 6639 |
| 1722 | Ga0495684_0201224 | 3300047471 | Bacteria | 1468 |
| 1723 | Ga0495684_0948808 | 3300047471 | Bacteria | 550 |
| 1724 | Ga0495684_1061214 | 3300047471 | Bacteria | 511 |
| 1725 | Ga0495593_0634469 | 3300047673 | Bacteria | 536 |
| 1726 | Ga0495602_0192709 | 3300048088 | Bacteria | 1561 |
| 1727 | Ga0495602_0730402 | 3300048088 | Bacteria | 670 |
| 1728 | Ga0495602_0740979 | 3300048088 | Bacteria | 664 |
| 1729 | Ga0495614_0207287 | 3300048089 | Bacteria | 888 |
| 1730 | Ga0496100_0172922 | 3300048903 | Bacteria | 1557 |
| 1731 | Ga0496100_0280389 | 3300048903 | Unclassified | 1242 |
| 1732 | Ga0496100_0603781 | 3300048903 | Bacteria | 852 |
| 1733 | Ga0496100_1198301 | 3300048903 | Bacteria | 599 |
| 1734 | Ga0496100_1523895 | 3300048903 | Bacteria | 528 |
| 1735 | Ga0496100_1688245 | 3300048903 | Bacteria | 501 |
| 1736 | Ga0496101_0048241 | 3300048904 | Bacteria | 3060 |
| 1737 | Ga0496101_0074470 | 3300048904 | Bacteria | 2497 |
| 1738 | Ga0496101_0118421 | 3300048904 | Bacteria | 2000 |
| 1739 | Ga0496101_0640258 | 3300048904 | Bacteria | 840 |
| 1740 | Ga0496101_1090128 | 3300048904 | Bacteria | 627 |
| 1741 | Ga0496101_1189898 | 3300048904 | Bacteria | 597 |
| 1742 | Ga0496102_0007849 | 3300048905 | Bacteria | 9118 |
| 1743 | Ga0496102_0078030 | 3300048905 | Bacteria | 3049 |
| 1744 | Ga0496102_0086480 | 3300048905 | Bacteria | 2895 |
| 1745 | Ga0496102_0127536 | 3300048905 | Bacteria | 2379 |
| 1746 | Ga0496102_0150845 | 3300048905 | Bacteria | 2184 |
| 1747 | Ga0496102_0905632 | 3300048905 | Bacteria | 804 |
| 1748 | Ga0496102_1110744 | 3300048905 | Bacteria | 710 |
| 1749 | Ga0496103_0020270 | 3300048906 | Bacteria | 3994 |
| 1750 | Ga0496103_0069235 | 3300048906 | Bacteria | 2206 |
| 1751 | Ga0496103_0602123 | 3300048906 | Bacteria | 700 |
| 1752 | Ga0496103_0982504 | 3300048906 | Bacteria | 526 |
| 1753 | Ga0496104_0011908 | 3300048907 | Bacteria | 7803 |
| 1754 | Ga0496104_0031019 | 3300048907 | Bacteria | 4969 |
| 1755 | Ga0496104_0031930 | 3300048907 | Bacteria | 4900 |
| 1756 | Ga0496104_0768535 | 3300048907 | Unclassified | 870 |
| 1757 | Ga0496104_0826109 | 3300048907 | Bacteria | 832 |
| 1758 | Ga0496105_0036763 | 3300048908 | Bacteria | 4035 |
| 1759 | Ga0496105_0039455 | 3300048908 | Bacteria | 3892 |
| 1760 | Ga0496105_0184169 | 3300048908 | Unclassified | 1709 |
| 1761 | Ga0496105_0495071 | 3300048908 | Bacteria | 960 |
| 1762 | Ga0496106_0005482 | 3300048909 | Bacteria | 9388 |
| 1763 | Ga0496106_0068421 | 3300048909 | Bacteria | 2708 |
| 1764 | Ga0496106_0343786 | 3300048909 | Bacteria | 1198 |
| 1765 | Ga0496106_0500957 | 3300048909 | Bacteria | 976 |
| 1766 | Ga0496106_0699765 | 3300048909 | Bacteria | 808 |
| 1767 | Ga0496107_0166569 | 3300048910 | Bacteria | 1634 |
| 1768 | Ga0496107_0555043 | 3300048910 | Bacteria | 851 |
| 1769 | Ga0496107_1071665 | 3300048910 | Bacteria | 583 |
| 1770 | Ga0496107_1107019 | 3300048910 | Bacteria | 572 |
| 1771 | Ga0496107_1374055 | 3300048910 | Unclassified | 503 |
| 1772 | Ga0496108_0006558 | 3300048911 | Bacteria | 9442 |
| 1773 | Ga0496108_0123529 | 3300048911 | Bacteria | 2221 |
| 1774 | Ga0496108_0541551 | 3300048911 | Bacteria | 1016 |
| 1775 | Ga0496108_0773275 | 3300048911 | Bacteria | 829 |
| 1776 | Ga0496108_0972326 | 3300048911 | Bacteria | 726 |
| 1777 | Ga0496108_1334947 | 3300048911 | Bacteria | 602 |
| 1778 | Ga0496109_0002800 | 3300048912 | Bacteria | 14601 |
| 1779 | Ga0496109_0015170 | 3300048912 | Bacteria | 6707 |
| 1780 | Ga0496109_0069389 | 3300048912 | Bacteria | 3232 |
| 1781 | Ga0496109_0088911 | 3300048912 | Unclassified | 2855 |
| 1782 | Ga0496109_0738515 | 3300048912 | Bacteria | 922 |
| 1783 | Ga0496109_1546157 | 3300048912 | Unclassified | 598 |
| 1784 | Ga0496109_1618180 | 3300048912 | Bacteria | 582 |
| 1785 | Ga0496109_1626732 | 3300048912 | Unclassified | 580 |
| 1786 | Ga0496109_1932102 | 3300048912 | Bacteria | 522 |
| 1787 | Ga0496110_0009675 | 3300048913 | Bacteria | 7807 |
| 1788 | Ga0496110_0012160 | 3300048913 | Bacteria | 7071 |
| 1789 | Ga0496110_0302004 | 3300048913 | Bacteria | 1458 |
| 1790 | Ga0496110_0397376 | 3300048913 | Bacteria | 1257 |
| 1791 | Ga0496111_0075485 | 3300048914 | Bacteria | 2456 |
| 1792 | Ga0496111_0170029 | 3300048914 | Bacteria | 1619 |
| 1793 | Ga0496111_0206796 | 3300048914 | Bacteria | 1459 |
| 1794 | Ga0496112_0006373 | 3300048915 | Bacteria | 10357 |
| 1795 | Ga0496112_0022700 | 3300048915 | Bacteria | 5985 |
| 1796 | Ga0496112_0104761 | 3300048915 | Bacteria | 2799 |
| 1797 | Ga0496112_0129284 | 3300048915 | Bacteria | 2497 |
| 1798 | Ga0496112_0179616 | 3300048915 | Bacteria | 2080 |
| 1799 | Ga0496112_0286398 | 3300048915 | Bacteria | 1594 |
| 1800 | Ga0496112_0529452 | 3300048915 | Unclassified | 1113 |
| 1801 | Ga0496112_1518690 | 3300048915 | Unclassified | 583 |
| 1802 | Ga0496113_0004859 | 3300048916 | Bacteria | 8321 |
| 1803 | Ga0496113_0013512 | 3300048916 | Bacteria | 5536 |
| 1804 | Ga0496113_0424943 | 3300048916 | Bacteria | 1067 |
| 1805 | Ga0496113_0662430 | 3300048916 | Bacteria | 834 |
| 1806 | Ga0496113_0757873 | 3300048916 | Bacteria | 773 |
| 1807 | Ga0496113_1506768 | 3300048916 | Unclassified | 519 |
| 1808 | Ga0496113_1606987 | 3300048916 | Bacteria | 500 |
| 1809 | Ga0496114_0018469 | 3300048917 | Bacteria | 5638 |
| 1810 | Ga0496114_0040825 | 3300048917 | Bacteria | 3843 |
| 1811 | Ga0496114_1528654 | 3300048917 | Bacteria | 555 |
| 1812 | Ga0496115_0001343 | 3300048918 | Bacteria | 17541 |
| 1813 | Ga0496115_0002505 | 3300048918 | Bacteria | 13201 |
| 1814 | Ga0496115_1220364 | 3300048918 | Bacteria | 564 |
| 1815 | Ga0496115_1372819 | 3300048918 | Bacteria | 523 |
| 1816 | Ga0496121_0506800 | 3300048924 | Bacteria | 765 |
| 1817 | Ga0496124_0420591 | 3300048927 | Bacteria | 921 |
| 1818 | Ga0496125_0000832 | 3300048928 | Bacteria | 49783 |
| 1819 | Ga0501305_073781 | 3300049161 | Bacteria | 604 |
| 1820 | Ga0501291_062011 | 3300049514 | Bacteria | 706 |
| 1821 | Ga0501291_122024 | 3300049514 | Bacteria | 566 |
| 1822 | Ga0501294_008815 | 3300049517 | Bacteria | 986 |
| 1823 | Ga0501298_070428 | 3300049521 | Bacteria | 754 |
| 1824 | Ga0501299_103058 | 3300049522 | Bacteria | 665 |
| 1825 | Ga0501299_228561 | 3300049522 | Bacteria | 505 |
| 1826 | Ga0501303_034026 | 3300049526 | Bacteria | 608 |
| 1827 | Ga0501336_028030 | 3300049552 | Bacteria | 542 |
| 1828 | Ga0501031_0000638 | 3300049568 | Bacteria | 20752 |
| 1829 | Ga0501031_0019681 | 3300049568 | Bacteria | 4397 |
| 1830 | Ga0501031_0059313 | 3300049568 | Bacteria | 2494 |
| 1831 | Ga0501031_0064858 | 3300049568 | Bacteria | 2379 |
| 1832 | Ga0501032_0015768 | 3300049569 | Bacteria | 5329 |
| 1833 | Ga0501032_0056199 | 3300049569 | Bacteria | 2646 |
| 1834 | Ga0501032_0067166 | 3300049569 | Bacteria | 2396 |
| 1835 | Ga0501032_0374219 | 3300049569 | Bacteria | 916 |
| 1836 | Ga0501033_0000020 | 3300049570 | Bacteria | 192214 |
| 1837 | Ga0501033_0004029 | 3300049570 | Bacteria | 11864 |
| 1838 | Ga0501033_0051628 | 3300049570 | Bacteria | 3048 |
| 1839 | Ga0501033_0122327 | 3300049570 | Bacteria | 1888 |
| 1840 | Ga0501034_0189620 | 3300049571 | Bacteria | 2019 |
| 1841 | Ga0501036_0011557 | 3300049572 | Bacteria | 7316 |
| 1842 | Ga0501036_0462012 | 3300049572 | Bacteria | 1057 |
| 1843 | Ga0501036_0535761 | 3300049572 | Bacteria | 973 |
| 1844 | Ga0501036_0672000 | 3300049572 | Bacteria | 857 |
| 1845 | Ga0501037_0000022 | 3300049573 | Bacteria | 147056 |
| 1846 | Ga0501037_0104183 | 3300049573 | Bacteria | 2046 |
| 1847 | Ga0501037_0142320 | 3300049573 | Bacteria | 1716 |
| 1848 | Ga0501037_0312123 | 3300049573 | Bacteria | 1090 |
| 1849 | Ga0501038_0000194 | 3300049574 | Bacteria | 52581 |
| 1850 | Ga0501038_0002823 | 3300049574 | Bacteria | 16165 |
| 1851 | Ga0501038_0029243 | 3300049574 | Bacteria | 4886 |
| 1852 | Ga0501039_0224793 | 3300049575 | Bacteria | 1475 |
| 1853 | Ga0501039_0642511 | 3300049575 | Bacteria | 831 |
| 1854 | Ga0501039_0835447 | 3300049575 | Bacteria | 718 |
| 1855 | Ga0501039_1043354 | 3300049575 | Bacteria | 634 |
| 1856 | Ga0501039_1399420 | 3300049575 | Bacteria | 538 |
| 1857 | Ga0501040_0224812 | 3300049576 | Bacteria | 1336 |
| 1858 | Ga0501040_0325871 | 3300049576 | Bacteria | 1099 |
| 1859 | Ga0501040_0523563 | 3300049576 | Bacteria | 855 |
| 1860 | Ga0501041_0013861 | 3300049577 | Bacteria | 4778 |
| 1861 | Ga0501041_0197319 | 3300049577 | Bacteria | 1261 |
| 1862 | Ga0501041_0283737 | 3300049577 | Bacteria | 1042 |
| 1863 | Ga0501041_0362990 | 3300049577 | Bacteria | 916 |
| 1864 | Ga0501042_0014238 | 3300049578 | Bacteria | 5426 |
| 1865 | Ga0501042_0023610 | 3300049578 | Bacteria | 4305 |
| 1866 | Ga0501042_1323978 | 3300049578 | Bacteria | 525 |
| 1867 | Ga0501043_0248688 | 3300049579 | Bacteria | 1370 |
| 1868 | Ga0501043_0364029 | 3300049579 | Bacteria | 1097 |
| 1869 | Ga0501043_0366021 | 3300049579 | Bacteria | 1093 |
| 1870 | Ga0501043_0405146 | 3300049579 | Bacteria | 1030 |
| 1871 | Ga0501046_0050662 | 3300049580 | Bacteria | 3279 |
| 1872 | Ga0501046_0179628 | 3300049580 | Bacteria | 1583 |
| 1873 | Ga0501047_0010776 | 3300049581 | Bacteria | 8642 |
| 1874 | Ga0501047_0498503 | 3300049581 | Bacteria | 1044 |
| 1875 | Ga0501048_0017270 | 3300049582 | Bacteria | 5317 |
| 1876 | Ga0501048_0664849 | 3300049582 | Bacteria | 748 |
| 1877 | Ga0501048_0719627 | 3300049582 | Bacteria | 717 |
| 1878 | Ga0501067_0008076 | 3300049583 | Bacteria | 5848 |
| 1879 | Ga0501067_0028695 | 3300049583 | Bacteria | 3083 |
| 1880 | Ga0501067_0401888 | 3300049583 | Bacteria | 764 |
| 1881 | Ga0501068_0035332 | 3300049584 | Bacteria | 2982 |
| 1882 | Ga0501069_0080801 | 3300049585 | Bacteria | 1831 |
| 1883 | Ga0501069_0383334 | 3300049585 | Bacteria | 830 |
| 1884 | Ga0501070_0286107 | 3300049586 | Bacteria | 1344 |
| 1885 | Ga0501071_0418529 | 3300049587 | Bacteria | 1024 |
| 1886 | Ga0501071_0425077 | 3300049587 | Bacteria | 1015 |
| 1887 | Ga0501071_0498616 | 3300049587 | Bacteria | 934 |
| 1888 | Ga0501072_0561209 | 3300049588 | Bacteria | 901 |
| 1889 | Ga0501072_0577338 | 3300049588 | Bacteria | 887 |
| 1890 | Ga0501072_0615454 | 3300049588 | Bacteria | 856 |
| 1891 | Ga0501072_0667020 | 3300049588 | Bacteria | 818 |
| 1892 | Ga0501072_1042757 | 3300049588 | Bacteria | 637 |
| 1893 | Ga0501073_0229342 | 3300049589 | Bacteria | 1283 |
| 1894 | Ga0501074_0365701 | 3300049590 | Bacteria | 1023 |
| 1895 | Ga0501074_0380994 | 3300049590 | Bacteria | 1001 |
| 1896 | Ga0501075_0166364 | 3300049591 | Bacteria | 1682 |
| 1897 | Ga0501075_0168266 | 3300049591 | Bacteria | 1672 |
| 1898 | Ga0501075_0281800 | 3300049591 | Bacteria | 1266 |
| 1899 | Ga0501075_0320372 | 3300049591 | Bacteria | 1181 |
| 1900 | Ga0501075_0543274 | 3300049591 | Bacteria | 887 |
| 1901 | Ga0501075_0708031 | 3300049591 | Bacteria | 767 |
| 1902 | Ga0501076_0011287 | 3300049592 | Bacteria | 6648 |
| 1903 | Ga0501076_0180929 | 3300049592 | Bacteria | 1719 |
| 1904 | Ga0501076_0515766 | 3300049592 | Bacteria | 985 |
| 1905 | Ga0501076_0756095 | 3300049592 | Bacteria | 802 |
| 1906 | Ga0501076_1425902 | 3300049592 | Bacteria | 569 |
| 1907 | Ga0501077_0000313 | 3300049593 | Bacteria | 28906 |
| 1908 | Ga0501077_0020354 | 3300049593 | Bacteria | 4199 |
| 1909 | Ga0501077_0047849 | 3300049593 | Bacteria | 2717 |
| 1910 | Ga0501199_014038 | 3300049650 | Bacteria | 887 |
| 1911 | Ga0501201_056199 | 3300049651 | Bacteria | 501 |
| 1912 | Ga0501208_133923 | 3300049655 | Bacteria | 555 |
| 1913 | Ga0501214_031081 | 3300049659 | Bacteria | 733 |
| 1914 | Ga0501217_040783 | 3300049661 | Bacteria | 1181 |
| 1915 | Ga0501224_059530 | 3300049664 | Bacteria | 594 |
| 1916 | Ga0501228_004781 | 3300049666 | Bacteria | 1176 |
| 1917 | Ga0501228_008776 | 3300049666 | Bacteria | 974 |
| 1918 | Ga0501230_036559 | 3300049667 | Bacteria | 937 |
| 1919 | Ga0501233_011819 | 3300049668 | Bacteria | 1743 |
| 1920 | Ga0501233_249769 | 3300049668 | Bacteria | 533 |
| 1921 | Ga0501235_030904 | 3300049669 | Bacteria | 1208 |
| 1922 | Ga0501235_043292 | 3300049669 | Bacteria | 1033 |
| 1923 | Ga0501243_006374 | 3300049675 | Bacteria | 1786 |
| 1924 | Ga0501243_049497 | 3300049675 | Bacteria | 755 |
| 1925 | Ga0501246_005560 | 3300049676 | Bacteria | 1061 |
| 1926 | Ga0501247_025754 | 3300049677 | Bacteria | 783 |
| 1927 | Ga0501248_018578 | 3300049678 | Bacteria | 699 |
| 1928 | Ga0501249_048107 | 3300049679 | Bacteria | 976 |
| 1929 | Ga0501249_062617 | 3300049679 | Unclassified | 863 |
| 1930 | Ga0501250_024265 | 3300049680 | Unclassified | 807 |
| 1931 | Ga0501250_031006 | 3300049680 | Bacteria | 743 |
| 1932 | Ga0501252_039290 | 3300049682 | Bacteria | 681 |
| 1933 | Ga0501253_050690 | 3300049683 | Bacteria | 868 |
| 1934 | Ga0501255_089336 | 3300049684 | Unclassified | 527 |
| 1935 | Ga0501257_108042 | 3300049686 | Bacteria | 735 |
| 1936 | Ga0501261_016191 | 3300049690 | Bacteria | 1033 |
| 1937 | Ga0501221_041047 | 3300049704 | Bacteria | 1009 |
| 1938 | Ga0501229_019955 | 3300049706 | Bacteria | 885 |
| 1939 | Ga0501229_061267 | 3300049706 | Bacteria | 574 |
| 1940 | Ga0501234_065863 | 3300049707 | Bacteria | 620 |
| 1941 | Ga0501245_056828 | 3300049708 | Bacteria | 706 |
| 1942 | Ga0501079_0037314 | 3300049741 | Bacteria | 3745 |
| 1943 | Ga0501079_0270749 | 3300049741 | Bacteria | 1328 |
| 1944 | Ga0501079_0303378 | 3300049741 | Bacteria | 1249 |
| 1945 | Ga0501080_0031612 | 3300049742 | Bacteria | 4933 |
| 1946 | Ga0501080_0138044 | 3300049742 | Bacteria | 2255 |
| 1947 | Ga0501080_0368987 | 3300049742 | Bacteria | 1294 |
| 1948 | Ga0501080_0374339 | 3300049742 | Bacteria | 1284 |
| 1949 | Ga0501080_0570190 | 3300049742 | Bacteria | 1007 |
| 1950 | Ga0501080_0739595 | 3300049742 | Bacteria | 866 |
| 1951 | Ga0501081_0065826 | 3300049743 | Bacteria | 2519 |
| 1952 | Ga0501081_0124166 | 3300049743 | Bacteria | 1841 |
| 1953 | Ga0501083_0026321 | 3300049744 | Bacteria | 4021 |
| 1954 | Ga0501083_0064606 | 3300049744 | Bacteria | 2439 |
| 1955 | Ga0501083_0471338 | 3300049744 | Bacteria | 817 |
| 1956 | Ga0501083_1096309 | 3300049744 | Bacteria | 518 |
| 1957 | Ga0501232_026783 | 3300049757 | Bacteria | 778 |
| 1958 | Ga0501262_010341 | 3300049759 | Bacteria | 1167 |
| 1959 | Ga0501263_035636 | 3300049760 | Unclassified | 716 |
| 1960 | Ga0501265_093333 | 3300049762 | Bacteria | 540 |
| 1961 | Ga0501266_019519 | 3300049763 | Bacteria | 918 |
| 1962 | Ga0501267_038016 | 3300049764 | Bacteria | 591 |
| 1963 | Ga0501269_057670 | 3300049766 | Bacteria | 545 |
| 1964 | Ga0501270_026374 | 3300049767 | Bacteria | 927 |
| 1965 | Ga0501270_116527 | 3300049767 | Bacteria | 576 |
| 1966 | Ga0501271_011350 | 3300049768 | Bacteria | 952 |
| 1967 | Ga0501273_003901 | 3300049770 | Bacteria | 1610 |
| 1968 | Ga0501273_029852 | 3300049770 | Bacteria | 772 |
| 1969 | Ga0501283_013090 | 3300049779 | Bacteria | 1254 |
| 1970 | Ga0501035_0000018 | 3300049822 | Bacteria | 241543 |
| 1971 | Ga0501035_0007736 | 3300049822 | Bacteria | 10037 |
| 1972 | Ga0501035_0061691 | 3300049822 | Bacteria | 3336 |
| 1973 | Ga0501035_0228806 | 3300049822 | Bacteria | 1585 |
| 1974 | Ga0501035_0440402 | 3300049822 | Bacteria | 1079 |
| 1975 | Ga0501035_0528385 | 3300049822 | Bacteria | 968 |
| 1976 | Ga0501035_0683417 | 3300049822 | Bacteria | 829 |
| 1977 | Ga0501044_0000356 | 3300049823 | Bacteria | 57280 |
| 1978 | Ga0501044_0000611 | 3300049823 | Bacteria | 43362 |
| 1979 | Ga0501044_0050422 | 3300049823 | Bacteria | 4294 |
| 1980 | Ga0501044_0262866 | 3300049823 | Bacteria | 1664 |
| 1981 | Ga0501044_0395442 | 3300049823 | Bacteria | 1295 |
| 1982 | Ga0501045_0069044 | 3300049824 | Bacteria | 2597 |
| 1983 | Ga0501045_0221429 | 3300049824 | Bacteria | 1409 |
| 1984 | Ga0501204_043361 | 3300049850 | Bacteria | 667 |
| 1985 | Ga0501212_061998 | 3300049851 | Bacteria | 649 |
| 1986 | Ga0501226_019273 | 3300049853 | Bacteria | 753 |
| 1987 | nmdc:mga03683_191095_c1 | 3300050489 | Bacteria | 937 |
| 1988 | nmdc:mga03683_257698_c1 | 3300050489 | Bacteria | 811 |
| 1989 | nmdc:mga03683_480164_c1 | 3300050489 | Bacteria | 600 |
| 1990 | nmdc:mga03n38_291639_c1 | 3300050490 | Bacteria | 874 |
| 1991 | nmdc:mga0yw44_884437_c1 | 3300050492 | Bacteria | 606 |
| 1992 | nmdc:mga0k408_422_c1 | 3300050493 | Bacteria | 23140 |
| 1993 | nmdc:mga0k408_519_c1 | 3300050493 | Bacteria | 21203 |
| 1994 | nmdc:mga0k408_758255_c1 | 3300050493 | Bacteria | 567 |
| 1995 | nmdc:mga07m45_127955_c1 | 3300050496 | Unclassified | 1469 |
| 1996 | nmdc:mga05p37_147719_c1 | 3300050507 | Bacteria | 2877 |
| 1997 | nmdc:mga05p37_1804585_c1 | 3300050507 | Bacteria | 590 |
| 1998 | nmdc:mga05p37_2139670_c1 | 3300050507 | Bacteria | 522 |
| 1999 | nmdc:mga05p37_2158795_c1 | 3300050507 | Bacteria | 519 |
| 2000 | nmdc:mga05p37_225902_c1 | 3300050507 | Bacteria | 2257 |
| 2001 | nmdc:mga05p37_226446_c1 | 3300050507 | Bacteria | 2254 |
| 2002 | nmdc:mga05p37_228803_c1 | 3300050507 | Bacteria | 2241 |
| 2003 | nmdc:mga05p37_2996_c1 | 3300050507 | Bacteria | 19604 |
| 2004 | nmdc:mga05p37_423550_c1 | 3300050507 | Bacteria | 1548 |
| 2005 | nmdc:mga05p37_508909_c1 | 3300050507 | Bacteria | 1380 |
| 2006 | nmdc:mga05p37_5420_c1 | 3300050507 | Bacteria | 14992 |
| 2007 | nmdc:mga09592_217940_c1 | 3300050508 | Bacteria | 1654 |
| 2008 | nmdc:mga09592_260903_c1 | 3300050508 | Bacteria | 1502 |
| 2009 | nmdc:mga09592_848776_c1 | 3300050508 | Unclassified | 770 |
| 2010 | nmdc:mga0qj67_18879_c1 | 3300050509 | Bacteria | 5260 |
| 2011 | nmdc:mga0qj67_434176_c1 | 3300050509 | Bacteria | 1058 |
| 2012 | nmdc:mga06r32_112696_c1 | 3300050510 | Bacteria | 2677 |
| 2013 | nmdc:mga06r32_1982616_c1 | 3300050510 | Bacteria | 516 |
| 2014 | nmdc:mga06r32_58625_c1 | 3300050510 | Bacteria | 3700 |
| 2015 | nmdc:mga08y16_105403_c1 | 3300050511 | Bacteria | 2935 |
| 2016 | nmdc:mga08y16_1517870_c1 | 3300050511 | Bacteria | 630 |
| 2017 | nmdc:mga08y16_155223_c1 | 3300050511 | Bacteria | 2379 |
| 2018 | nmdc:mga08y16_155856_c1 | 3300050511 | Bacteria | 2373 |
| 2019 | nmdc:mga08y16_166580_c1 | 3300050511 | Unclassified | 2289 |
| 2020 | nmdc:mga08y16_22076_c1 | 3300050511 | Bacteria | 6720 |
| 2021 | nmdc:mga08y16_425312_c1 | 3300050511 | Bacteria | 1357 |
| 2022 | nmdc:mga08y16_440777_c1 | 3300050511 | Bacteria | 1329 |
| 2023 | nmdc:mga08y16_604273_c1 | 3300050511 | Bacteria | 1105 |
| 2024 | nmdc:mga08y16_612479_c1 | 3300050511 | Bacteria | 1096 |
| 2025 | nmdc:mga08y16_934735_c1 | 3300050511 | Bacteria | 851 |
| 2026 | nmdc:mga0n895_1043242_c1 | 3300050512 | Bacteria | 797 |
| 2027 | nmdc:mga0n895_1179667_c1 | 3300050512 | Bacteria | 740 |
| 2028 | nmdc:mga0n895_1832291_c1 | 3300050512 | Bacteria | 567 |
| 2029 | nmdc:mga0n895_2026989_c1 | 3300050512 | Bacteria | 533 |
| 2030 | nmdc:mga0n895_256254_c1 | 3300050512 | Bacteria | 1775 |
| 2031 | nmdc:mga0n895_263767_c1 | 3300050512 | Bacteria | 1748 |
| 2032 | nmdc:mga0n895_272159_c1 | 3300050512 | Bacteria | 1718 |
| 2033 | nmdc:mga0n895_297981_c1 | 3300050512 | Bacteria | 1635 |
| 2034 | nmdc:mga0n895_383596_c1 | 3300050512 | Bacteria | 1422 |
| 2035 | nmdc:mga0n895_45713_c1 | 3300050512 | Bacteria | 4273 |
| 2036 | nmdc:mga0n895_475657_c1 | 3300050512 | Bacteria | 1260 |
| 2037 | nmdc:mga0n895_624280_c1 | 3300050512 | Bacteria | 1078 |
| 2038 | nmdc:mga0n895_810979_c1 | 3300050512 | Bacteria | 926 |
| 2039 | nmdc:mga0rr50_1086598_c1 | 3300050513 | Bacteria | 681 |
| 2040 | nmdc:mga0rr50_123189_c1 | 3300050513 | Bacteria | 2066 |
| 2041 | nmdc:mga0rr50_1273581_c1 | 3300050513 | Bacteria | 624 |
| 2042 | nmdc:mga0rr50_1434932_c1 | 3300050513 | Bacteria | 584 |
| 2043 | nmdc:mga0rr50_16705_c1 | 3300050513 | Bacteria | 4882 |
| 2044 | nmdc:mga0rr50_263162_c1 | 3300050513 | Bacteria | 1435 |
| 2045 | nmdc:mga0rr50_339624_c1 | 3300050513 | Bacteria | 1262 |
| 2046 | nmdc:mga08x19_36841_c1 | 3300050514 | Bacteria | 3100 |
| 2047 | nmdc:mga08x19_843611_c1 | 3300050514 | Bacteria | 651 |
| 2048 | nmdc:mga08x19_936947_c1 | 3300050514 | Bacteria | 615 |
| 2049 | nmdc:mga0a205_185032_c1 | 3300050515 | Bacteria | 1976 |
| 2050 | nmdc:mga0a205_23268_c1 | 3300050515 | Bacteria | 5875 |
| 2051 | nmdc:mga0a205_261998_c1 | 3300050515 | Bacteria | 1606 |
| 2052 | nmdc:mga0a205_34062_c1 | 3300050515 | Bacteria | 4886 |
| 2053 | nmdc:mga0a205_52758_c2 | 3300050515 | Bacteria | 2704 |
| 2054 | nmdc:mga0a205_643938_c1 | 3300050515 | Bacteria | 911 |
| 2055 | nmdc:mga0a205_871790_c1 | 3300050515 | Bacteria | 747 |
| 2056 | Ga0495601_0128111 | 3300053077 | Unclassified | 1652 |
| 2057 | Ga0495601_0452533 | 3300053077 | Bacteria | 830 |
| 2058 | Ga0495595_0326040 | 3300053084 | Bacteria | 773 |
| 2059 | Ga0495595_0462310 | 3300053084 | Bacteria | 645 |
| 2060 | Ga0495619_0142554 | 3300053085 | Bacteria | 1651 |
| 2061 | Ga0500651_0190029 | 3300053093 | Bacteria | 1216 |
| 2062 | Ga0500555_000378 | 3300053103 | Bacteria | 18755 |
| 2063 | Ga0500556_0000453 | 3300053104 | Bacteria | 29167 |
| 2064 | Ga0500594_0014244 | 3300053118 | Bacteria | 1902 |
| 2065 | Ga0500595_017957 | 3300053119 | Bacteria | 2598 |
| 2066 | Ga0500642_0046777 | 3300053130 | Bacteria | 1893 |
| 2067 | Ga0500655_081180 | 3300053133 | Bacteria | 667 |
| 2068 | Ga0500658_0109300 | 3300053134 | Bacteria | 1215 |
| 2069 | Ga0500568_0008069 | 3300053139 | Bacteria | 5111 |
| 2070 | Ga0500573_0425060 | 3300053140 | Bacteria | 622 |
| 2071 | Ga0500616_0005196 | 3300053153 | Bacteria | 8918 |
| 2072 | Ga0500616_0024716 | 3300053153 | Bacteria | 3335 |
| 2073 | Ga0500645_191810 | 3300053730 | Bacteria | 553 |
| 2074 | Ga0501084_0037665 | 3300054114 | Bacteria | 4041 |
| 2075 | Ga0501084_0040152 | 3300054114 | Bacteria | 3914 |
| 2076 | Ga0501084_0071596 | 3300054114 | Bacteria | 2903 |
| 2077 | Ga0501084_0250030 | 3300054114 | Bacteria | 1497 |
| 2078 | Ga0590071_005233 | 3300059421 | Bacteria | 3126 |
| 2079 | Ga0590074_003362 | 3300059423 | Bacteria | 2639 |
| 2080 | Ga0590074_006539 | 3300059423 | Bacteria | 1936 |
| 2081 | Ga0590077_066256 | 3300059426 | Bacteria | 822 |
| 2082 | Ga0587073_0243779 | 3300059492 | Bacteria | 560 |
| 2083 | Ga0587077_245141 | 3300059493 | Bacteria | 516 |
| 2084 | Ga0587080_172255 | 3300059503 | Bacteria | 514 |
| 2085 | Ga0587086_069257 | 3300059507 | Bacteria | 603 |
| 2086 | Ga0587088_015612 | 3300059508 | Bacteria | 1198 |
| 2087 | Ga0587088_145992 | 3300059508 | Bacteria | 568 |
| 2088 | Ga0587089_036292 | 3300059509 | Bacteria | 747 |
| 2089 | Ga0587091_027861 | 3300059511 | Bacteria | 1039 |
| 2090 | Ga0587094_022810 | 3300059513 | Bacteria | 922 |
| 2091 | Ga0587094_092795 | 3300059513 | Bacteria | 573 |
| 2092 | Ga0587125_051191 | 3300059607 | Bacteria | 583 |
| 2093 | Ga0587113_039157 | 3300059625 | Bacteria | 563 |
| 2094 | Ga0587067_206071 | 3300059640 | Bacteria | 525 |
| 2095 | Ga0587075_073606 | 3300059644 | Bacteria | 639 |
| 2096 | Ga0587107_153127 | 3300059652 | Bacteria | 502 |
| 2097 | Ga0587071_113982 | 3300060344 | Bacteria | 639 |
| 2098 | Ga0501082_0938735 | 3300060353 | Bacteria | 757 |
| 2099 | Ga0501082_1663186 | 3300060353 | Bacteria | 557 |
| 2100 | Ga0466962_0000021 | 3300061719 | Bacteria | 89078 |
| 2101 | Ga0530510_0067414 | 3300061734 | Bacteria | 2596 |
| 2102 | Ga0530510_0160452 | 3300061734 | Bacteria | 1663 |
| 2103 | Ga0530510_0234640 | 3300061734 | Bacteria | 1365 |
| 2104 | Ga0530510_0272885 | 3300061734 | Bacteria | 1262 |
| 2105 | Ga0070671_100361556 | |||
| 2106 | CNXas_1000097 | |||
| 2107 | JGI24737J22298_10175400 | |||
| 2108 | JGI24743J22301_10000004 | |||
| 2109 | JGI24743J22301_10047673 | |||
| 2110 | JGI24743J22301_10050578 | |||
| 2111 | JGI24745J21846_1024228 | |||
| 2112 | JGI24738J21930_10135760 | |||
| 2113 | JGI24744J21845_10113277 | |||
| 2114 | JGI24035J26624_1002575 | |||
| 2115 | JGI24035J26624_1018071 | |||
| 2116 | JGI24035J26624_1029495 | |||
| 2117 | JGI24035J26624_1034669 | |||
| 2118 | JGI24033J26618_1000030 | |||
| 2119 | JGI25406J46586_10026149 | |||
| 2120 | rootH2_10064825 | |||
| 2121 | rootH2_10178873 | |||
| 2122 | rootH2_10318002 | |||
| 2123 | rootL2_10115884 | |||
| 2124 | rootH1_10060333 | |||
| 2125 | rootH1_10354418 | |||
| 2126 | Ga0055530_10006290 | |||
| 2127 | JGI25405J52794_10002120 | |||
| 2128 | JGI25405J52794_10004418 | |||
| 2129 | JGI25405J52794_10057353 | |||
| 2130 | Ga0058860_11794193 | |||
| 2131 | Ga0058860_12144407 | |||
| 2132 | Ga0065714_10123883 | |||
| 2133 | Ga0065714_10392326 | |||
| 2134 | Ga0065704_10005779 | |||
| 2135 | Ga0065704_10079762 | |||
| 2136 | Ga0065704_10300815 | |||
| 2137 | Ga0065704_10420928 | |||
| 2138 | Ga0065712_10004344 | |||
| 2139 | Ga0065712_10009419 | |||
| 2140 | Ga0065712_10011361 | |||
| 2141 | Ga0065712_10036450 | |||
| 2142 | Ga0065712_10083662 | |||
| 2143 | Ga0065712_10207868 | |||
| 2144 | Ga0065712_10350488 | |||
| 2145 | Ga0065712_10469388 | |||
| 2146 | Ga0065712_10801227 | |||
| 2147 | Ga0065715_10000435 | |||
| 2148 | Ga0065715_10000511 | |||
| 2149 | Ga0065715_10016299 | |||
| 2150 | Ga0065715_10148112 | |||
| 2151 | Ga0065715_10302955 | |||
| 2152 | Ga0065715_10546255 | |||
| 2153 | Ga0065715_10566813 | |||
| 2154 | Ga0065715_10658722 | |||
| 2155 | Ga0065715_10779185 | |||
| 2156 | Ga0065715_11021000 | |||
| 2157 | Ga0065715_11071634 | |||
| 2158 | Ga0065707_10009007 | |||
| 2159 | Ga0065707_10039953 | |||
| 2160 | Ga0065707_10040381 | |||
| 2161 | Ga0065707_10115183 | |||
| 2162 | Ga0065707_10184410 | |||
| 2163 | Ga0065707_10334528 | |||
| 2164 | Ga0065707_10532512 | |||
| 2165 | Ga0070658_10027394 | |||
| 2166 | Ga0070658_10082408 | |||
| 2167 | Ga0070658_10105984 | |||
| 2168 | Ga0070658_10324139 | |||
| 2169 | Ga0070658_10404713 | |||
| 2170 | Ga0070676_10002928 | |||
| 2171 | Ga0070676_10008825 | |||
| 2172 | Ga0070676_10015823 | |||
| 2173 | Ga0070676_10266829 | |||
| 2174 | Ga0070676_11371497 | |||
| 2175 | Ga0070683_100006421 | |||
| 2176 | Ga0070683_100171520 | |||
| 2177 | Ga0070683_100301098 | |||
| 2178 | Ga0070683_101042187 | |||
| 2179 | Ga0070690_100655786 | |||
| 2180 | Ga0070690_100805465 | |||
| 2181 | Ga0070670_100002396 | |||
| 2182 | Ga0070670_100057637 | |||
| 2183 | Ga0070670_100098101 | |||
| 2184 | Ga0070670_100145325 | |||
| 2185 | Ga0070670_100169713 | |||
| 2186 | Ga0070670_100431617 | |||
| 2187 | Ga0070670_100526867 | |||
| 2188 | Ga0070670_100965747 | |||
| 2189 | Ga0070670_101585835 | |||
| 2190 | Ga0070670_101918050 | |||
| 2191 | Ga0070677_10041740 | |||
| 2192 | Ga0070677_10391946 | |||
| 2193 | Ga0070677_10394513 | |||
| 2194 | Ga0070677_10503049 | |||
| 2195 | Ga0070677_10703707 | |||
| 2196 | Ga0068869_100242289 | |||
| 2197 | Ga0068869_101985410 | |||
| 2198 | Ga0070666_10008100 | |||
| 2199 | Ga0070666_10038827 | |||
| 2200 | Ga0070666_10112608 | |||
| 2201 | Ga0070666_10121590 | |||
| 2202 | Ga0070666_10318307 | |||
| 2203 | Ga0070666_10667718 | |||
| 2204 | Ga0070666_11021421 | |||
| 2205 | Ga0070682_100121403 | |||
| 2206 | Ga0068868_100037116 | |||
| 2207 | Ga0068868_100112028 | |||
| 2208 | Ga0068868_100146715 | |||
| 2209 | Ga0068868_100300230 | |||
| 2210 | Ga0068868_100430719 | |||
| 2211 | Ga0068868_100474906 | |||
| 2212 | Ga0068868_101133316 | |||
| 2213 | Ga0068868_101804567 | |||
| 2214 | Ga0068868_102022130 | |||
| 2215 | Ga0068868_102299889 | |||
| 2216 | Ga0070660_100051082 | |||
| 2217 | Ga0070660_100061750 | |||
| 2218 | Ga0070660_100130839 | |||
| 2219 | Ga0070660_100337027 | |||
| 2220 | Ga0070660_100704475 | |||
| 2221 | Ga0070689_100051504 | |||
| 2222 | Ga0070689_100069162 | |||
| 2223 | Ga0070689_100086924 | |||
| 2224 | Ga0070689_100268375 | |||
| 2225 | Ga0070689_100276416 | |||
| 2226 | Ga0070689_100449076 | |||
| 2227 | Ga0070689_100588364 | |||
| 2228 | Ga0070689_100895735 | |||
| 2229 | Ga0070689_101035171 | |||
| 2230 | Ga0070689_101064701 | |||
| 2231 | Ga0070689_101226925 | |||
| 2232 | Ga0070689_101868970 | |||
| 2233 | Ga0070691_10176381 | |||
| 2234 | Ga0070691_10526231 | |||
| 2235 | Ga0070687_100012288 | |||
| 2236 | Ga0070687_100105366 | |||
| 2237 | Ga0070687_100296824 | |||
| 2238 | Ga0070687_100515038 | |||
| 2239 | Ga0070661_100002856 | |||
| 2240 | Ga0070661_100018988 | |||
| 2241 | Ga0070661_100145965 | |||
| 2242 | Ga0070661_100292369 | |||
| 2243 | Ga0070661_100383199 | |||
| 2244 | Ga0070661_101233180 | |||
| 2245 | Ga0070692_10507142 | |||
| 2246 | Ga0070668_100018320 | |||
| 2247 | Ga0070668_100095080 | |||
| 2248 | Ga0070668_100141529 | |||
| 2249 | Ga0070668_100219341 | |||
| 2250 | Ga0070668_100227551 | |||
| 2251 | Ga0070668_100735778 | |||
| 2252 | Ga0070668_100749964 | |||
| 2253 | Ga0070669_100004678 | |||
| 2254 | Ga0070669_100016990 | |||
| 2255 | Ga0070669_100143776 | |||
| 2256 | Ga0070669_100173924 | |||
| 2257 | Ga0070669_100233314 | |||
| 2258 | Ga0070669_100484431 | |||
| 2259 | Ga0070669_100492425 | |||
| 2260 | Ga0070669_101033379 | |||
| 2261 | Ga0070669_101446723 | |||
| 2262 | Ga0070675_100006094 | |||
| 2263 | Ga0070675_100012173 | |||
| 2264 | Ga0070675_100013338 | |||
| 2265 | Ga0070675_100042482 | |||
| 2266 | Ga0070675_100059069 | |||
| 2267 | Ga0070675_100072844 | |||
| 2268 | Ga0070675_100079112 | |||
| 2269 | Ga0070675_100195839 | |||
| 2270 | Ga0070675_100217305 | |||
| 2271 | Ga0070675_100222726 | |||
| 2272 | Ga0070675_100336398 | |||
| 2273 | Ga0070675_100671398 | |||
| 2274 | Ga0070675_101327967 | |||
| 2275 | Ga0070675_101493650 | |||
| 2276 | Ga0070675_101726670 | |||
| 2277 | Ga0070675_101905038 | |||
| 2278 | Ga0070671_100005243 | |||
| 2279 | Ga0070671_100012027 | |||
| 2280 | Ga0070671_100020120 | |||
| 2281 | Ga0070671_100030436 | |||
| 2282 | Ga0070671_100096950 | |||
| 2283 | Ga0070671_100097548 | |||
| 2284 | Ga0070671_100493802 | |||
| 2285 | Ga0070671_100606729 | |||
| 2286 | Ga0070671_100997212 | |||
| 2287 | Ga0070674_100020612 | |||
| 2288 | Ga0070674_100112621 | |||
| 2289 | Ga0070674_100747418 | |||
| 2290 | Ga0070674_101283254 | |||
| 2291 | Ga0070674_101999688 | |||
| 2292 | Ga0070674_102222729 | |||
| 2293 | Ga0070673_100004636 | |||
| 2294 | Ga0070673_100007080 | |||
| 2295 | Ga0070673_100185191 | |||
| 2296 | Ga0070673_100471018 | |||
| 2297 | Ga0070673_100810366 | |||
| 2298 | Ga0070673_100945156 | |||
| 2299 | Ga0070673_101154408 | |||
| 2300 | Ga0070673_102143077 | |||
| 2301 | Ga0070688_100014902 | |||
| 2302 | Ga0070688_100051469 | |||
| 2303 | Ga0070688_100117718 | |||
| 2304 | Ga0070688_100353336 | |||
| 2305 | Ga0070688_100394796 | |||
| 2306 | Ga0070688_100867497 | |||
| 2307 | Ga0070688_101437557 | |||
| 2308 | Ga0070659_100014400 | |||
| 2309 | Ga0070659_100086754 | |||
| 2310 | Ga0070659_100102468 | |||
| 2311 | Ga0070659_100403801 | |||
| 2312 | Ga0070659_101074952 | |||
| 2313 | Ga0070659_101583937 | |||
| 2314 | Ga0070667_100015061 | |||
| 2315 | Ga0070667_100044677 | |||
| 2316 | Ga0070667_100130538 | |||
| 2317 | Ga0070667_100131297 | |||
| 2318 | Ga0070667_100147773 | |||
| 2319 | Ga0070667_100166491 | |||
| 2320 | Ga0070667_100283551 | |||
| 2321 | Ga0070667_100345310 | |||
| 2322 | Ga0070667_100609222 | |||
| 2323 | Ga0070709_10150585 | |||
| 2324 | Ga0070709_11166690 | |||
| 2325 | Ga0070709_11510710 | |||
| 2326 | Ga0070714_100088834 | |||
| 2327 | Ga0070714_100609579 | |||
| 2328 | Ga0070714_100691372 | |||
| 2329 | Ga0070714_100963202 | |||
| 2330 | Ga0070714_101336704 | |||
| 2331 | Ga0070713_100057257 | |||
| 2332 | Ga0070713_100127332 | |||
| 2333 | Ga0070713_100155469 | |||
| 2334 | Ga0070713_100206390 | |||
| 2335 | Ga0070713_100712154 | |||
| 2336 | Ga0070713_101532770 | |||
| 2337 | Ga0070713_102108127 | |||
| 2338 | Ga0070713_102152223 | |||
| 2339 | Ga0070713_102249063 | |||
| 2340 | Ga0070713_102259172 | |||
| 2341 | Ga0070710_10027829 | |||
| 2342 | Ga0070710_10060473 | |||
| 2343 | Ga0070710_10538722 | |||
| 2344 | Ga0070710_10775723 | |||
| 2345 | Ga0070701_10013627 | |||
| 2346 | Ga0070701_10864354 | |||
| 2347 | Ga0070711_100002516 | |||
| 2348 | Ga0070711_100023705 | |||
| 2349 | Ga0070711_100195614 | |||
| 2350 | Ga0070711_100423751 | |||
| 2351 | Ga0070711_100579932 | |||
| 2352 | Ga0070711_100680854 | |||
| 2353 | Ga0070711_100788670 | |||
| 2354 | Ga0070711_100939489 | |||
| 2355 | Ga0070711_101362511 | |||
| 2356 | Ga0070711_101497880 | |||
| 2357 | Ga0070705_100037482 | |||
| 2358 | Ga0070705_100071004 | |||
| 2359 | Ga0070705_100112251 | |||
| 2360 | Ga0070705_100187518 | |||
| 2361 | Ga0070705_100392457 | |||
| 2362 | Ga0070705_100537339 | |||
| 2363 | Ga0070705_100579563 | |||
| 2364 | Ga0070705_100867902 | |||
| 2365 | Ga0070700_101061962 | |||
| 2366 | Ga0070700_101300241 | |||
| 2367 | Ga0070694_100007686 | |||
| 2368 | Ga0070694_100039775 | |||
| 2369 | Ga0070708_100003720 | |||
| 2370 | Ga0070708_100026177 | |||
| 2371 | Ga0070708_100029039 | |||
| 2372 | Ga0070708_100180315 | |||
| 2373 | Ga0070708_100386475 | |||
| 2374 | Ga0070708_101316997 | |||
| 2375 | Ga0070708_102113767 | |||
| 2376 | Ga0070708_102166664 | |||
| 2377 | Ga0070663_100178428 | |||
| 2378 | Ga0070663_100289384 | |||
| 2379 | Ga0070663_101155862 | |||
| 2380 | Ga0070663_101328405 | |||
| 2381 | Ga0070663_101465067 | |||
| 2382 | Ga0070678_100056961 | |||
| 2383 | Ga0070678_100063338 | |||
| 2384 | Ga0070678_100237630 | |||
| 2385 | Ga0070678_100302016 | |||
| 2386 | Ga0070678_100569572 | |||
| 2387 | Ga0070678_100818481 | |||
| 2388 | Ga0070678_101989151 | |||
| 2389 | Ga0070678_102210954 | |||
| 2390 | Ga0070678_102254842 | |||
| 2391 | Ga0070662_100001580 | |||
| 2392 | Ga0070662_100032771 | |||
| 2393 | Ga0070662_100103381 | |||
| 2394 | Ga0070662_100377860 | |||
| 2395 | Ga0070662_100539848 | |||
| 2396 | Ga0070662_101168801 | |||
| 2397 | Ga0070662_101433963 | |||
| 2398 | Ga0070681_10057225 | |||
| 2399 | Ga0068867_100047794 | |||
| 2400 | Ga0068867_101970692 | |||
| 2401 | Ga0070685_10043123 | |||
| 2402 | Ga0070685_10157957 | |||
| 2403 | Ga0070685_11177935 | |||
| 2404 | Ga0070706_100001219 | |||
| 2405 | Ga0070706_100030253 | |||
| 2406 | Ga0070706_100030575 | |||
| 2407 | Ga0070706_100037742 | |||
| 2408 | Ga0070706_100054114 | |||
| 2409 | Ga0070706_100189339 | |||
| 2410 | Ga0070706_100202577 | |||
| 2411 | Ga0070706_100249380 | |||
| 2412 | Ga0070706_100314078 | |||
| 2413 | Ga0070706_100582147 | |||
| 2414 | Ga0070706_100734927 | |||
| 2415 | Ga0070706_101622026 | |||
| 2416 | Ga0070706_101628943 | |||
| 2417 | Ga0070706_101935015 | |||
| 2418 | Ga0070707_100029247 | |||
| 2419 | Ga0070707_100031437 | |||
| 2420 | Ga0070707_100038062 | |||
| 2421 | Ga0070707_100040090 | |||
| 2422 | Ga0070707_100087284 | |||
| 2423 | Ga0070707_100484228 | |||
| 2424 | Ga0070707_100519529 | |||
| 2425 | Ga0070707_100976501 | |||
| 2426 | Ga0070707_101245561 | |||
| 2427 | Ga0070707_101545180 | |||
| 2428 | Ga0070707_101781870 | |||
| 2429 | Ga0070698_100001369 | |||
| 2430 | Ga0070698_100010266 | |||
| 2431 | Ga0070698_100035064 | |||
| 2432 | Ga0070698_101534189 | |||
| 2433 | Ga0070699_100008480 | |||
| 2434 | Ga0070699_100009142 | |||
| 2435 | Ga0070699_100205700 | |||
| 2436 | Ga0070699_100496355 | |||
| 2437 | Ga0070699_100543596 | |||
| 2438 | Ga0070699_100633210 | |||
| 2439 | Ga0070699_101892348 | |||
| 2440 | Ga0070679_100077538 | |||
| 2441 | Ga0070679_100270687 | |||
| 2442 | Ga0070684_100007280 | |||
| 2443 | Ga0070684_100086281 | |||
| 2444 | Ga0070684_100173420 | |||
| 2445 | Ga0070684_100500451 | |||
| 2446 | Ga0070684_100637593 | |||
| 2447 | Ga0070697_100000699 | |||
| 2448 | Ga0070697_100005432 | |||
| 2449 | Ga0070697_100007588 | |||
| 2450 | Ga0070697_100009771 | |||
| 2451 | Ga0070697_100019645 | |||
| 2452 | Ga0070697_100021093 | |||
| 2453 | Ga0070697_100034246 | |||
| 2454 | Ga0070697_100093744 | |||
| 2455 | Ga0070697_100131293 | |||
| 2456 | Ga0070697_100177335 | |||
| 2457 | Ga0070697_100341249 | |||
| 2458 | Ga0068853_100000043 | |||
| 2459 | Ga0068853_101177274 | |||
| 2460 | Ga0068853_101268952 | |||
| 2461 | Ga0068853_101311143 | |||
| 2462 | Ga0070672_100019710 | |||
| 2463 | Ga0070672_100081912 | |||
| 2464 | Ga0070672_100089212 | |||
| 2465 | Ga0070672_100133307 | |||
| 2466 | Ga0070672_100146694 | |||
| 2467 | Ga0070672_100422890 | |||
| 2468 | Ga0070672_100824807 | |||
| 2469 | Ga0070672_100898655 | |||
| 2470 | Ga0070672_101203446 | |||
| 2471 | Ga0070686_100001412 | |||
| 2472 | Ga0070686_100003806 | |||
| 2473 | Ga0070686_100007629 | |||
| 2474 | Ga0070695_100178743 | |||
| 2475 | Ga0070695_100575156 | |||
| 2476 | Ga0070696_100174468 | |||
| 2477 | Ga0070696_100728147 | |||
| 2478 | Ga0070696_101132882 | |||
| 2479 | Ga0070696_101545555 | |||
| 2480 | Ga0070693_100428880 | |||
| 2481 | Ga0070693_100603426 | |||
| 2482 | Ga0070693_100734407 | |||
| 2483 | Ga0070665_100000030 | |||
| 2484 | Ga0070665_100020293 | |||
| 2485 | Ga0070665_100023029 | |||
| 2486 | Ga0070665_100047396 | |||
| 2487 | Ga0070665_100188017 | |||
| 2488 | Ga0070665_100202980 | |||
| 2489 | Ga0070665_100259845 | |||
| 2490 | Ga0070665_100295021 | |||
| 2491 | Ga0070665_100418587 | |||
| 2492 | Ga0070665_101282639 | |||
| 2493 | Ga0070704_100441085 | |||
| 2494 | Ga0070704_101555425 | |||
| 2495 | Ga0070704_101921635 | |||
| 2496 | Ga0068855_100003050 | |||
| 2497 | Ga0068855_100046518 | |||
| 2498 | Ga0068855_100337136 | |||
| 2499 | Ga0068855_100471299 | |||
| 2500 | Ga0068855_100620911 | |||
| 2501 | Ga0068855_101370013 | |||
| 2502 | Ga0068855_102428536 | |||
| 2503 | Ga0070664_100290513 | |||
| 2504 | Ga0070664_100487905 | |||
| 2505 | Ga0070664_102379281 | |||
| 2506 | Ga0068857_100652343 | |||
| 2507 | Ga0068857_100866608 | |||
| 2508 | Ga0068854_100907259 | |||
| 2509 | Ga0068856_100000532 | |||
| 2510 | Ga0068856_100001701 | |||
| 2511 | Ga0068856_100041874 | |||
| 2512 | Ga0068856_100157128 | |||
| 2513 | Ga0068856_100375898 | |||
| 2514 | Ga0068856_100808368 | |||
| 2515 | Ga0068856_100818154 | |||
| 2516 | Ga0070702_101804068 | |||
| 2517 | Ga0068852_100079670 | |||
| 2518 | Ga0068852_100133986 | |||
| 2519 | Ga0068852_100536582 | |||
| 2520 | Ga0068859_100022627 | |||
| 2521 | Ga0068859_100659587 | |||
| 2522 | Ga0068859_100664414 | |||
| 2523 | Ga0068859_101030488 | |||
| 2524 | Ga0068859_101623114 | |||
| 2525 | Ga0068859_101842049 | |||
| 2526 | Ga0068864_100213123 | |||
| 2527 | Ga0068864_100480744 | |||
| 2528 | Ga0068864_100582093 | |||
| 2529 | Ga0068864_100694210 | |||
| 2530 | Ga0068864_100804509 | |||
| 2531 | Ga0068864_100896029 | |||
| 2532 | Ga0068864_100907765 | |||
| 2533 | Ga0068864_101479358 | |||
| 2534 | Ga0068866_10553231 | |||
| 2535 | Ga0068861_100818166 | |||
| 2536 | Ga0068861_101284250 | |||
| 2537 | Ga0068870_10924066 | |||
| 2538 | Ga0068863_100026665 | |||
| 2539 | Ga0068863_100041792 | |||
| 2540 | Ga0068863_100046621 | |||
| 2541 | Ga0068863_100481109 | |||
| 2542 | Ga0068863_100630874 | |||
| 2543 | Ga0068863_100990025 | |||
| 2544 | Ga0068858_100009520 | |||
| 2545 | Ga0068858_100018605 | |||
| 2546 | Ga0068858_100031411 | |||
| 2547 | Ga0068858_100107171 | |||
| 2548 | Ga0068858_100538712 | |||
| 2549 | Ga0068858_100810790 | |||
| 2550 | Ga0068858_100884762 | |||
| 2551 | Ga0068858_101223216 | |||
| 2552 | Ga0068858_101573175 | |||
| 2553 | Ga0068858_102155940 | |||
| 2554 | Ga0068858_102492096 | |||
| 2555 | Ga0068860_100000335 | |||
| 2556 | Ga0068860_100109821 | |||
| 2557 | Ga0068860_100796962 | |||
| 2558 | Ga0068860_100797344 | |||
| 2559 | Ga0068860_100876847 | |||
| 2560 | Ga0068860_100939343 | |||
| 2561 | Ga0068860_101178464 | |||
| 2562 | Ga0068860_102625806 | |||
| 2563 | Ga0068862_100011084 | |||
| 2564 | Ga0068862_100119819 | |||
| 2565 | Ga0068862_100686367 | |||
| 2566 | Ga0068862_101086220 | |||
| 2567 | Ga0068862_101263012 | |||
| 2568 | Ga0068862_101484002 | |||
| 2569 | Ga0081455_10001899 | |||
| 2570 | Ga0081455_10003193 | |||
| 2571 | Ga0081455_10012109 | |||
| 2572 | Ga0081455_10023526 | |||
| 2573 | Ga0081455_10032602 | |||
| 2574 | Ga0081455_10035518 | |||
| 2575 | Ga0081455_10041741 | |||
| 2576 | Ga0081455_10045480 | |||
| 2577 | Ga0081455_10085610 | |||
| 2578 | Ga0081538_10002489 | |||
| 2579 | Ga0081538_10020354 | |||
| 2580 | Ga0081538_10027511 | |||
| 2581 | Ga0081538_10096720 | |||
| 2582 | Ga0081538_10219365 | |||
| 2583 | Ga0081540_1012961 | |||
| 2584 | Ga0081540_1023742 | |||
| 2585 | Ga0081540_1151815 | |||
| 2586 | Ga0081540_1295909 | |||
| 2587 | Ga0081539_10006707 | |||
| 2588 | Ga0081539_10044293 | |||
| 2589 | Ga0070717_10006113 | |||
| 2590 | Ga0070717_10096911 | |||
| 2591 | Ga0070717_10193286 | |||
| 2592 | Ga0070717_10465390 | |||
| 2593 | Ga0070717_10475872 | |||
| 2594 | Ga0070717_10539626 | |||
| 2595 | Ga0070717_10641813 | |||
| 2596 | Ga0070717_10962249 | |||
| 2597 | Ga0070717_11031178 | |||
| 2598 | Ga0070717_11214571 | |||
| 2599 | Ga0070717_11711667 | |||
| 2600 | Ga0070717_11763010 | |||
| 2601 | Ga0075365_10822943 | |||
| 2602 | Ga0070715_10025081 | |||
| 2603 | Ga0070715_10373778 | |||
| 2604 | Ga0070715_10952455 | |||
| 2605 | Ga0070716_100089578 | |||
| 2606 | Ga0070716_100097232 | |||
| 2607 | Ga0070716_100110496 | |||
| 2608 | Ga0070716_100344226 | |||
| 2609 | Ga0070716_100379037 | |||
| 2610 | Ga0070716_101787988 | |||
| 2611 | Ga0070712_100004918 | |||
| 2612 | Ga0070712_100042146 | |||
| 2613 | Ga0070712_100104160 | |||
| 2614 | Ga0070712_100223872 | |||
| 2615 | Ga0070712_100225110 | |||
| 2616 | Ga0070712_100234621 | |||
| 2617 | Ga0070712_100426835 | |||
| 2618 | Ga0070712_100636948 | |||
| 2619 | Ga0070712_100729252 | |||
| 2620 | Ga0070712_100861417 | |||
| 2621 | Ga0070712_101367278 | |||
| 2622 | Ga0070712_101663103 | |||
| 2623 | Ga0075362_10126919 | |||
| 2624 | Ga0075362_10321528 | |||
| 2625 | Ga0075367_10656963 | |||
| 2626 | Ga0075366_10061709 | |||
| 2627 | Ga0075366_10396428 | |||
| 2628 | Ga0097621_100018151 | |||
| 2629 | Ga0097621_100218165 | |||
| 2630 | Ga0097621_100292569 | |||
| 2631 | Ga0097621_100537455 | |||
| 2632 | Ga0097621_100576960 | |||
| 2633 | Ga0097621_100676038 | |||
| 2634 | Ga0097621_101192036 | |||
| 2635 | Ga0097621_101805307 | |||
| 2636 | Ga0097621_102042424 | |||
| 2637 | Ga0075370_10130487 | |||
| 2638 | Ga0075370_10593246 | |||
| 2639 | Ga0068871_100013279 | |||
| 2640 | Ga0068871_100032502 | |||
| 2641 | Ga0068871_100105360 | |||
| 2642 | Ga0068871_100281501 | |||
| 2643 | Ga0068871_100455649 | |||
| 2644 | Ga0068871_100514049 | |||
| 2645 | Ga0068871_100546498 | |||
| 2646 | Ga0068871_100661912 | |||
| 2647 | Ga0068871_101920405 | |||
| 2648 | Ga0075428_100160071 | |||
| 2649 | Ga0075428_100618121 | |||
| 2650 | Ga0075428_101113763 | |||
| 2651 | Ga0075428_101397677 | |||
| 2652 | Ga0075431_100562344 | |||
| 2653 | Ga0075433_10590744 | |||
| 2654 | Ga0075434_100158787 | |||
| 2655 | Ga0075434_100308816 | |||
| 2656 | Ga0075434_100509841 | |||
| 2657 | Ga0075434_100690173 | |||
| 2658 | Ga0075434_100982034 | |||
| 2659 | Ga0075434_101047127 | |||
| 2660 | Ga0075434_101969807 | |||
| 2661 | Ga0075429_101439166 | |||
| 2662 | Ga0075429_101858807 | |||
| 2663 | Ga0068865_100059182 | |||
| 2664 | Ga0068865_100103672 | |||
| 2665 | Ga0068865_100123582 | |||
| 2666 | Ga0068865_100161898 | |||
| 2667 | Ga0068865_100465901 | |||
| 2668 | Ga0068865_100914587 | |||
| 2669 | Ga0068865_102096862 | |||
| 2670 | Ga0075436_100047012 | |||
| 2671 | Ga0075436_100201381 | |||
| 2672 | Ga0075436_101055670 | |||
| 2673 | Ga0097620_100022627 | |||
| 2674 | Ga0097620_100659594 | |||
| 2675 | Ga0097620_100664388 | |||
| 2676 | Ga0097620_101030498 | |||
| 2677 | Ga0097620_101622782 | |||
| 2678 | Ga0097620_101842973 | |||
| 2679 | Ga0075435_100001139 | |||
| 2680 | Ga0099795_10278224 | |||
| 2681 | Ga0099795_10359734 | |||
| 2682 | Ga0105244_10396862 | |||
| 2683 | Ga0105244_10447724 | |||
| 2684 | Ga0105250_10126745 | |||
| 2685 | Ga0105250_10432844 | |||
| 2686 | Ga0105240_10000021 | |||
| 2687 | Ga0105240_10010683 | |||
| 2688 | Ga0105240_10083852 | |||
| 2689 | Ga0105240_10091613 | |||
| 2690 | Ga0105240_10171193 | |||
| 2691 | Ga0105240_10511883 | |||
| 2692 | Ga0105240_10628531 | |||
| 2693 | Ga0111539_10032619 | |||
| 2694 | Ga0111539_10055404 | |||
| 2695 | Ga0111539_10217710 | |||
| 2696 | Ga0111539_10262359 | |||
| 2697 | Ga0111539_10401361 | |||
| 2698 | Ga0111539_10493864 | |||
| 2699 | Ga0111539_10500932 | |||
| 2700 | Ga0111539_10528962 | |||
| 2701 | Ga0111539_10777218 | |||
| 2702 | Ga0111539_11112917 | |||
| 2703 | Ga0111539_13371530 | |||
| 2704 | Ga0105245_10102481 | |||
| 2705 | Ga0105245_10143622 | |||
| 2706 | Ga0105245_10413129 | |||
| 2707 | Ga0105245_10592530 | |||
| 2708 | Ga0105245_11005655 | |||
| 2709 | Ga0105245_11337224 | |||
| 2710 | Ga0105245_11784438 | |||
| 2711 | Ga0105245_12131565 | |||
| 2712 | Ga0105245_12626424 | |||
| 2713 | Ga0105245_12997164 | |||
| 2714 | Ga0105247_10227186 | |||
| 2715 | Ga0105247_10511784 | |||
| 2716 | Ga0114129_10002693 | |||
| 2717 | Ga0114129_10405374 | |||
| 2718 | Ga0114129_12073999 | |||
| 2719 | Ga0105243_10002066 | |||
| 2720 | Ga0105243_11802948 | |||
| 2721 | Ga0105241_10313704 | |||
| 2722 | Ga0105241_12472556 | |||
| 2723 | Ga0105241_12677455 | |||
| 2724 | Ga0105242_10004325 | |||
| 2725 | Ga0105242_10445570 | |||
| 2726 | Ga0105242_11956742 | |||
| 2727 | Ga0105242_12334617 | |||
| 2728 | Ga0105242_13002620 | |||
| 2729 | Ga0105248_12138994 | |||
| 2730 | Ga0105237_10003664 | |||
| 2731 | Ga0105237_10004830 | |||
| 2732 | Ga0105237_10113997 | |||
| 2733 | Ga0105237_10479798 | |||
| 2734 | Ga0105237_10575334 | |||
| 2735 | Ga0105237_10634223 | |||
| 2736 | Ga0105237_10728534 | |||
| 2737 | Ga0105237_11727674 | |||
| 2738 | Ga0105237_12473903 | |||
| 2739 | Ga0105238_10012283 | |||
| 2740 | Ga0105238_10012559 | |||
| 2741 | Ga0105238_10047992 | |||
| 2742 | Ga0105238_10083256 | |||
| 2743 | Ga0105238_10753779 | |||
| 2744 | Ga0105238_11799451 | |||
| 2745 | Ga0105238_11956851 | |||
| 2746 | Ga0105238_12255789 | |||
| 2747 | Ga0105238_12404816 | |||
| 2748 | Ga0105249_10005644 | |||
| 2749 | Ga0105249_10018608 | |||
| 2750 | Ga0105249_10102576 | |||
| 2751 | Ga0105249_10188210 | |||
| 2752 | Ga0105249_10192478 | |||
| 2753 | Ga0105249_10488724 | |||
| 2754 | Ga0105249_10611148 | |||
| 2755 | Ga0105249_10916162 | |||
| 2756 | Ga0105249_11763975 | |||
| 2757 | Ga0105249_12285623 | |||
| 2758 | Ga0105249_12328180 | |||
| 2759 | Ga0099796_10431658 | |||
| 2760 | Ga0105239_10020017 | |||
| 2761 | Ga0105239_10170410 | |||
| 2762 | Ga0105239_10255355 | |||
| 2763 | Ga0105239_10475571 | |||
| 2764 | Ga0105239_10697421 | |||
| 2765 | Ga0105239_11339011 | |||
| 2766 | Ga0105239_11413218 | |||
| 2767 | Ga0105239_12093503 | |||
| 2768 | Ga0105239_13054564 | |||
| 2769 | Ga0105246_10026336 | |||
| 2770 | Ga0105246_10128603 | |||
| 2771 | Ga0105246_10422781 | |||
| 2772 | Ga0105246_10622570 | |||
| 2773 | Ga0105246_11316824 | |||
| 2774 | Ga0157324_1057153 | |||
| 2775 | Ga0157324_1065394 | |||
| 2776 | Ga0157342_1009614 | |||
| 2777 | Ga0157327_1077038 | |||
| 2778 | Ga0157373_10464273 | |||
| 2779 | Ga0157373_11203774 | |||
| 2780 | Ga0157371_10008630 | |||
| 2781 | Ga0157369_10121539 | |||
| 2782 | Ga0157369_11618021 | |||
| 2783 | Ga0157369_12533073 | |||
| 2784 | Ga0157374_10012398 | |||
| 2785 | Ga0157374_10016525 | |||
| 2786 | Ga0157374_10056139 | |||
| 2787 | Ga0157374_10074319 | |||
| 2788 | Ga0157374_10129870 | |||
| 2789 | Ga0157374_10156550 | |||
| 2790 | Ga0157374_10254291 | |||
| 2791 | Ga0157374_10270216 | |||
| 2792 | Ga0157374_10856309 | |||
| 2793 | Ga0157374_10866332 | |||
| 2794 | Ga0157374_10882366 | |||
| 2795 | Ga0157374_10975885 | |||
| 2796 | Ga0157378_10004018 | |||
| 2797 | Ga0157378_10005168 | |||
| 2798 | Ga0157378_10027051 | |||
| 2799 | Ga0157378_10036652 | |||
| 2800 | Ga0157378_10072741 | |||
| 2801 | Ga0157378_10093354 | |||
| 2802 | Ga0157378_10124846 | |||
| 2803 | Ga0157378_10148704 | |||
| 2804 | Ga0157378_10245551 | |||
| 2805 | Ga0157378_10352872 | |||
| 2806 | Ga0157378_10402399 | |||
| 2807 | Ga0157378_10433292 | |||
| 2808 | Ga0157378_10554062 | |||
| 2809 | Ga0157378_10974932 | |||
| 2810 | Ga0157378_11121831 | |||
| 2811 | Ga0157378_11413397 | |||
| 2812 | Ga0157378_11571794 | |||
| 2813 | Ga0157378_12035313 | |||
| 2814 | Ga0157378_13186095 | |||
| 2815 | Ga0163162_10012601 | |||
| 2816 | Ga0163162_10027417 | |||
| 2817 | Ga0163162_10047319 | |||
| 2818 | Ga0163162_10158835 | |||
| 2819 | Ga0163162_10201949 | |||
| 2820 | Ga0163162_10365762 | |||
| 2821 | Ga0163162_10401006 | |||
| 2822 | Ga0163162_10510573 | |||
| 2823 | Ga0163162_10742020 | |||
| 2824 | Ga0163162_11030998 | |||
| 2825 | Ga0163162_11616497 | |||
| 2826 | Ga0163162_12216823 | |||
| 2827 | Ga0163162_13251090 | |||
| 2828 | Ga0163162_13321546 | |||
| 2829 | Ga0157372_10671132 | |||
| 2830 | Ga0157375_10007506 | |||
| 2831 | Ga0157375_10010785 | |||
| 2832 | Ga0157375_10014362 | |||
| 2833 | Ga0157375_10044447 | |||
| 2834 | Ga0157375_10046780 | |||
| 2835 | Ga0157375_10103089 | |||
| 2836 | Ga0157375_10151701 | |||
| 2837 | Ga0157375_10165999 | |||
| 2838 | Ga0157375_10546491 | |||
| 2839 | Ga0157375_10692500 | |||
| 2840 | Ga0157375_10934585 | |||
| 2841 | Ga0157375_11531971 | |||
| 2842 | Ga0157375_11556369 | |||
| 2843 | Ga0157375_11960293 | |||
| 2844 | Ga0157375_13080755 | |||
| 2845 | Ga0157375_13781017 | |||
| 2846 | Ga0163163_10103428 | |||
| 2847 | Ga0163163_10511774 | |||
| 2848 | Ga0163163_10619591 | |||
| 2849 | Ga0163163_11065491 | |||
| 2850 | Ga0163163_11167478 | |||
| 2851 | Ga0157380_10094673 | |||
| 2852 | Ga0157380_10183437 | |||
| 2853 | Ga0157380_11044407 | |||
| 2854 | Ga0157380_12173601 | |||
| 2855 | Ga0182008_10021914 | |||
| 2856 | Ga0157377_10068102 | |||
| 2857 | Ga0157377_10458336 | |||
| 2858 | Ga0157379_10004631 | |||
| 2859 | Ga0157379_10953954 | |||
| 2860 | Ga0157379_11676150 | |||
| 2861 | Ga0157379_12264049 | |||
| 2862 | Ga0157376_10001227 | |||
| 2863 | Ga0157376_10020873 | |||
| 2864 | Ga0157376_10041051 | |||
| 2865 | Ga0157376_10083550 | |||
| 2866 | Ga0157376_10154311 | |||
| 2867 | Ga0157376_10430454 | |||
| 2868 | Ga0157376_10529104 | |||
| 2869 | Ga0157376_10939618 | |||
| 2870 | Ga0157376_11178938 | |||
| 2871 | Ga0157376_11654515 | |||
| 2872 | Ga0157376_12055981 | |||
| 2873 | Ga0157376_12113010 | |||
| 2874 | Ga0157376_12518328 | |||
| 2875 | Ga0182007_10117656 | |||
| 2876 | Ga0182007_10238889 | |||
| 2877 | Ga0182007_10264437 | |||
| 2878 | Ga0182005_1118238 | |||
| 2879 | Ga0163161_10036397 | |||
| 2880 | Ga0163161_10104703 | |||
| 2881 | Ga0163161_10275084 | |||
| 2882 | Ga0163161_10380623 | |||
| 2883 | Ga0163161_10777273 | |||
| 2884 | Ga0163161_11039188 | |||
| 2885 | Ga0163161_11489141 | |||
| 2886 | Ga0163161_11691730 | |||
| 2887 | Ga0163161_11785325 | |||
| 2888 | Ga0206356_11167105 | |||
| 2889 | Ga0213873_10065272 | |||
| 2890 | Ga0213873_10239200 | |||
| 2891 | Ga0213872_10002717 | |||
| 2892 | Ga0213872_10020372 | |||
| 2893 | Ga0213872_10030861 | |||
| 2894 | Ga0213872_10060081 | |||
| 2895 | Ga0213872_10106654 | |||
| 2896 | Ga0213872_10129238 | |||
| 2897 | Ga0213874_10010920 | |||
| 2898 | Ga0213874_10017223 | |||
| 2899 | Ga0213876_10003351 | |||
| 2900 | Ga0213876_10025981 | |||
| 2901 | Ga0213876_10148606 | |||
| 2902 | Ga0213876_10195731 | |||
| 2903 | Ga0213876_10515126 | |||
| 2904 | Ga0213876_10656165 | |||
| 2905 | Ga0213875_10146532 | |||
| 2906 | Ga0213875_10290432 | |||
| 2907 | Ga0213875_10664909 | |||
| 2908 | Ga0213871_10006967 | |||
| 2909 | Ga0213871_10070427 | |||
| 2910 | Ga0224712_10241735 | |||
| 2911 | Ga0224572_1060923 | |||
| 2912 | Ga0207666_1000173 | |||
| 2913 | Ga0207666_1031112 | |||
| 2914 | Ga0207673_1002648 | |||
| 2915 | Ga0207673_1017938 | |||
| 2916 | Ga0207673_1036913 | |||
| 2917 | Ga0209050_1000597 | |||
| 2918 | Ga0207697_10000708 | |||
| 2919 | Ga0207697_10001975 | |||
| 2920 | Ga0207697_10008102 | |||
| 2921 | Ga0207697_10019530 | |||
| 2922 | Ga0207697_10112148 | |||
| 2923 | Ga0207697_10208433 | |||
| 2924 | Ga0207697_10228776 | |||
| 2925 | Ga0207697_10269005 | |||
| 2926 | Ga0207697_10298120 | |||
| 2927 | Ga0207697_10357473 | |||
| 2928 | Ga0207697_10524147 | |||
| 2929 | Ga0207656_10220102 | |||
| 2930 | Ga0207653_10058385 | |||
| 2931 | Ga0207653_10178608 | |||
| 2932 | Ga0207653_10253636 | |||
| 2933 | Ga0207653_10348386 | |||
| 2934 | Ga0207653_10374256 | |||
| 2935 | Ga0207682_10033191 | |||
| 2936 | Ga0207682_10320017 | |||
| 2937 | Ga0207682_10360016 | |||
| 2938 | Ga0207692_10098835 | |||
| 2939 | Ga0207692_10104716 | |||
| 2940 | Ga0207692_10205220 | |||
| 2941 | Ga0207692_10421403 | |||
| 2942 | Ga0207642_10002474 | |||
| 2943 | Ga0207642_10324034 | |||
| 2944 | Ga0207642_10714072 | |||
| 2945 | Ga0207642_11001219 | |||
| 2946 | Ga0207710_10262033 | |||
| 2947 | Ga0207688_10006693 | |||
| 2948 | Ga0207688_10023264 | |||
| 2949 | Ga0207688_10044048 | |||
| 2950 | Ga0207688_10089078 | |||
| 2951 | Ga0207688_10505652 | |||
| 2952 | Ga0207688_10656618 | |||
| 2953 | Ga0207688_10720435 | |||
| 2954 | Ga0207680_10021316 | |||
| 2955 | Ga0207680_10073182 | |||
| 2956 | Ga0207680_10079338 | |||
| 2957 | Ga0207680_10302795 | |||
| 2958 | Ga0207680_10814542 | |||
| 2959 | Ga0207680_10848186 | |||
| 2960 | Ga0207647_10180287 | |||
| 2961 | Ga0207647_10617726 | |||
| 2962 | Ga0207685_10023234 | |||
| 2963 | Ga0207685_10114633 | |||
| 2964 | Ga0207685_10142578 | |||
| 2965 | Ga0207685_10724984 | |||
| 2966 | Ga0207699_10120190 | |||
| 2967 | Ga0207699_10186453 | |||
| 2968 | Ga0207699_10400193 | |||
| 2969 | Ga0207699_10653315 | |||
| 2970 | Ga0207699_11010850 | |||
| 2971 | Ga0207699_11360087 | |||
| 2972 | Ga0207645_10001061 | |||
| 2973 | Ga0207645_10002307 | |||
| 2974 | Ga0207645_10003112 | |||
| 2975 | Ga0207645_10021393 | |||
| 2976 | Ga0207645_10184136 | |||
| 2977 | Ga0207645_10260550 | |||
| 2978 | Ga0207643_10109221 | |||
| 2979 | Ga0207643_10306214 | |||
| 2980 | Ga0207643_10781739 | |||
| 2981 | Ga0207705_10011248 | |||
| 2982 | Ga0207705_10058614 | |||
| 2983 | Ga0207705_10399338 | |||
| 2984 | Ga0207705_10539864 | |||
| 2985 | Ga0207705_10806092 | |||
| 2986 | Ga0207705_11029367 | |||
| 2987 | Ga0207684_10004166 | |||
| 2988 | Ga0207684_10006584 | |||
| 2989 | Ga0207684_10027724 | |||
| 2990 | Ga0207684_10269571 | |||
| 2991 | Ga0207684_10363473 | |||
| 2992 | Ga0207684_10477640 | |||
| 2993 | Ga0207684_10638434 | |||
| 2994 | Ga0207684_10640349 | |||
| 2995 | Ga0207684_11004756 | |||
| 2996 | Ga0207654_10358633 | |||
| 2997 | Ga0207654_10692529 | |||
| 2998 | Ga0207654_11245367 | |||
| 2999 | Ga0207707_10082901 | |||
| 3000 | Ga0207707_10587926 | |||
| 3001 | Ga0207695_10008487 | |||
| 3002 | Ga0207695_10180201 | |||
| 3003 | Ga0207695_10359602 | |||
| 3004 | Ga0207695_10821108 | |||
| 3005 | Ga0207695_11246602 | |||
| 3006 | Ga0207671_10008359 | |||
| 3007 | Ga0207671_10077451 | |||
| 3008 | Ga0207671_10270884 | |||
| 3009 | Ga0207671_10427384 | |||
| 3010 | Ga0207671_10550964 | |||
| 3011 | Ga0207671_10776678 | |||
| 3012 | Ga0207693_10005851 | |||
| 3013 | Ga0207693_10008150 | |||
| 3014 | Ga0207693_10057969 | |||
| 3015 | Ga0207693_10079292 | |||
| 3016 | Ga0207693_10134757 | |||
| 3017 | Ga0207693_10164776 | |||
| 3018 | Ga0207693_10544067 | |||
| 3019 | Ga0207693_10567022 | |||
| 3020 | Ga0207693_10631323 | |||
| 3021 | Ga0207693_10704082 | |||
| 3022 | Ga0207693_10916282 | |||
| 3023 | Ga0207663_10032433 | |||
| 3024 | Ga0207663_10076086 | |||
| 3025 | Ga0207663_10160649 | |||
| 3026 | Ga0207663_10249089 | |||
| 3027 | Ga0207663_10267563 | |||
| 3028 | Ga0207663_10305675 | |||
| 3029 | Ga0207663_10329742 | |||
| 3030 | Ga0207663_10433696 | |||
| 3031 | Ga0207663_10746280 | |||
| 3032 | Ga0207660_10261545 | |||
| 3033 | Ga0207660_11034482 | |||
| 3034 | Ga0207660_11687088 | |||
| 3035 | Ga0207662_10002029 | |||
| 3036 | Ga0207662_10219987 | |||
| 3037 | Ga0207662_10314592 | |||
| 3038 | Ga0207662_11174464 | |||
| 3039 | Ga0207657_10076450 | |||
| 3040 | Ga0207657_10157502 | |||
| 3041 | Ga0207657_10196731 | |||
| 3042 | Ga0207657_10656393 | |||
| 3043 | Ga0207657_10842684 | |||
| 3044 | Ga0207649_10001369 | |||
| 3045 | Ga0207649_10009962 | |||
| 3046 | Ga0207649_10348131 | |||
| 3047 | Ga0207649_10461741 | |||
| 3048 | Ga0207652_10046754 | |||
| 3049 | Ga0207646_10026329 | |||
| 3050 | Ga0207646_10037463 | |||
| 3051 | Ga0207646_10043842 | |||
| 3052 | Ga0207646_10051531 | |||
| 3053 | Ga0207646_10058770 | |||
| 3054 | Ga0207646_10103473 | |||
| 3055 | Ga0207646_10202351 | |||
| 3056 | Ga0207646_10214886 | |||
| 3057 | Ga0207646_10234370 | |||
| 3058 | Ga0207646_10535830 | |||
| 3059 | Ga0207646_10696943 | |||
| 3060 | Ga0207646_10970037 | |||
| 3061 | Ga0207646_11412598 | |||
| 3062 | Ga0207646_11666288 | |||
| 3063 | Ga0207681_10011144 | |||
| 3064 | Ga0207681_10033022 | |||
| 3065 | Ga0207681_10052822 | |||
| 3066 | Ga0207681_10062385 | |||
| 3067 | Ga0207681_10332145 | |||
| 3068 | Ga0207681_10378213 | |||
| 3069 | Ga0207681_10879291 | |||
| 3070 | Ga0207681_10991541 | |||
| 3071 | Ga0207681_11037637 | |||
| 3072 | Ga0207681_11106208 | |||
| 3073 | Ga0207681_11386174 | |||
| 3074 | Ga0207694_10126770 | |||
| 3075 | Ga0207694_10179043 | |||
| 3076 | Ga0207694_10303739 | |||
| 3077 | Ga0207694_10700915 | |||
| 3078 | Ga0207694_10983487 | |||
| 3079 | Ga0207694_11196310 | |||
| 3080 | Ga0207694_11787738 | |||
| 3081 | Ga0207650_10016550 | |||
| 3082 | Ga0207650_10067678 | |||
| 3083 | Ga0207650_10070019 | |||
| 3084 | Ga0207650_10106265 | |||
| 3085 | Ga0207650_10150292 | |||
| 3086 | Ga0207650_10566369 | |||
| 3087 | Ga0207650_10601367 | |||
| 3088 | Ga0207650_10973539 | |||
| 3089 | Ga0207650_11515092 | |||
| 3090 | Ga0207650_11601333 | |||
| 3091 | Ga0207659_10012375 | |||
| 3092 | Ga0207659_10013549 | |||
| 3093 | Ga0207659_10021808 | |||
| 3094 | Ga0207659_10044527 | |||
| 3095 | Ga0207659_10044673 | |||
| 3096 | Ga0207659_10084453 | |||
| 3097 | Ga0207659_10101212 | |||
| 3098 | Ga0207659_10209359 | |||
| 3099 | Ga0207659_10541733 | |||
| 3100 | Ga0207659_10652807 | |||
| 3101 | Ga0207659_10678256 | |||
| 3102 | Ga0207659_11123819 | |||
| 3103 | Ga0207687_10286759 | |||
| 3104 | Ga0207687_10485712 | |||
| 3105 | Ga0207687_10572072 | |||
| 3106 | Ga0207687_10592272 | |||
| 3107 | Ga0207687_10677020 | |||
| 3108 | Ga0207700_10165824 | |||
| 3109 | Ga0207700_10183223 | |||
| 3110 | Ga0207700_10434368 | |||
| 3111 | Ga0207700_10470353 | |||
| 3112 | Ga0207700_11054937 | |||
| 3113 | Ga0207700_11625833 | |||
| 3114 | Ga0207700_11729164 | |||
| 3115 | Ga0207700_11771464 | |||
| 3116 | Ga0207664_10958836 | |||
| 3117 | Ga0207664_11283320 | |||
| 3118 | Ga0207664_11839213 | |||
| 3119 | Ga0207644_10073252 | |||
| 3120 | Ga0207644_10095915 | |||
| 3121 | Ga0207644_10097127 | |||
| 3122 | Ga0207644_10158315 | |||
| 3123 | Ga0207644_10267575 | |||
| 3124 | Ga0207644_10350023 | |||
| 3125 | Ga0207644_10488368 | |||
| 3126 | Ga0207644_10618165 | |||
| 3127 | Ga0207690_10009051 | |||
| 3128 | Ga0207690_10068248 | |||
| 3129 | Ga0207690_10073094 | |||
| 3130 | Ga0207690_10109769 | |||
| 3131 | Ga0207690_10276882 | |||
| 3132 | Ga0207690_11200390 | |||
| 3133 | Ga0207706_10000683 | |||
| 3134 | Ga0207706_10001838 | |||
| 3135 | Ga0207706_10026901 | |||
| 3136 | Ga0207706_10113505 | |||
| 3137 | Ga0207706_10191585 | |||
| 3138 | Ga0207706_10248354 | |||
| 3139 | Ga0207706_10326975 | |||
| 3140 | Ga0207706_10341722 | |||
| 3141 | Ga0207706_11269430 | |||
| 3142 | Ga0207686_10000067 | |||
| 3143 | Ga0207686_10104433 | |||
| 3144 | Ga0207686_10123554 | |||
| 3145 | Ga0207686_11013572 | |||
| 3146 | Ga0207686_11107494 | |||
| 3147 | Ga0207709_10001490 | |||
| 3148 | Ga0207709_10008591 | |||
| 3149 | Ga0207709_10462738 | |||
| 3150 | Ga0207670_10015302 | |||
| 3151 | Ga0207670_10055090 | |||
| 3152 | Ga0207670_10094855 | |||
| 3153 | Ga0207670_10189207 | |||
| 3154 | Ga0207670_10190777 | |||
| 3155 | Ga0207670_10431835 | |||
| 3156 | Ga0207670_10712104 | |||
| 3157 | Ga0207670_10859199 | |||
| 3158 | Ga0207670_10971494 | |||
| 3159 | Ga0207670_11075425 | |||
| 3160 | Ga0207670_11103500 | |||
| 3161 | Ga0207670_11339890 | |||
| 3162 | Ga0207670_11343549 | |||
| 3163 | Ga0207669_10000496 | |||
| 3164 | Ga0207669_10011752 | |||
| 3165 | Ga0207669_10535098 | |||
| 3166 | Ga0207669_10556434 | |||
| 3167 | Ga0207669_10676574 | |||
| 3168 | Ga0207669_10693034 | |||
| 3169 | Ga0207669_10829594 | |||
| 3170 | Ga0207669_11135931 | |||
| 3171 | Ga0207669_11215857 | |||
| 3172 | Ga0207669_11399667 | |||
| 3173 | Ga0207704_10000383 | |||
| 3174 | Ga0207704_10049497 | |||
| 3175 | Ga0207704_10412826 | |||
| 3176 | Ga0207704_10446999 | |||
| 3177 | Ga0207704_10649450 | |||
| 3178 | Ga0207704_10948975 | |||
| 3179 | Ga0207704_11288427 | |||
| 3180 | Ga0207704_11763891 | |||
| 3181 | Ga0207665_10027602 | |||
| 3182 | Ga0207665_10058893 | |||
| 3183 | Ga0207665_10099264 | |||
| 3184 | Ga0207665_10164742 | |||
| 3185 | Ga0207665_10313542 | |||
| 3186 | Ga0207665_10386188 | |||
| 3187 | Ga0207665_10423106 | |||
| 3188 | Ga0207665_10439113 | |||
| 3189 | Ga0207665_10490786 | |||
| 3190 | Ga0207665_10516809 | |||
| 3191 | Ga0207665_10585357 | |||
| 3192 | Ga0207665_11486791 | |||
| 3193 | Ga0207691_10002751 | |||
| 3194 | Ga0207691_10084055 | |||
| 3195 | Ga0207691_10131884 | |||
| 3196 | Ga0207691_10147194 | |||
| 3197 | Ga0207691_10167102 | |||
| 3198 | Ga0207691_10315499 | |||
| 3199 | Ga0207691_10464137 | |||
| 3200 | Ga0207691_10487387 | |||
| 3201 | Ga0207691_10770813 | |||
| 3202 | Ga0207691_11291529 | |||
| 3203 | Ga0207711_10000687 | |||
| 3204 | Ga0207711_10253917 | |||
| 3205 | Ga0207711_11240986 | |||
| 3206 | Ga0207711_11263259 | |||
| 3207 | Ga0207689_11720161 | |||
| 3208 | Ga0207661_10023175 | |||
| 3209 | Ga0207661_10193619 | |||
| 3210 | Ga0207661_10409892 | |||
| 3211 | Ga0207661_10961742 | |||
| 3212 | Ga0207661_10997321 | |||
| 3213 | Ga0207679_10043113 | |||
| 3214 | Ga0207679_10218420 | |||
| 3215 | Ga0207679_10304436 | |||
| 3216 | Ga0207679_10325647 | |||
| 3217 | Ga0207679_10331811 | |||
| 3218 | Ga0207679_11174963 | |||
| 3219 | Ga0207679_11244339 | |||
| 3220 | Ga0207667_10005991 | |||
| 3221 | Ga0207667_10146074 | |||
| 3222 | Ga0207667_10221355 | |||
| 3223 | Ga0207667_10399735 | |||
| 3224 | Ga0207667_10437437 | |||
| 3225 | Ga0207667_10746278 | |||
| 3226 | Ga0207667_10772788 | |||
| 3227 | Ga0207667_11269944 | |||
| 3228 | Ga0207667_12156072 | |||
| 3229 | Ga0207651_10012729 | |||
| 3230 | Ga0207651_10056846 | |||
| 3231 | Ga0207651_10161242 | |||
| 3232 | Ga0207651_10603549 | |||
| 3233 | Ga0207651_10610231 | |||
| 3234 | Ga0207651_10613050 | |||
| 3235 | Ga0207651_10690545 | |||
| 3236 | Ga0207651_10823037 | |||
| 3237 | Ga0207651_11156749 | |||
| 3238 | Ga0207651_11238491 | |||
| 3239 | Ga0207651_11351382 | |||
| 3240 | Ga0207712_10000422 | |||
| 3241 | Ga0207712_10115324 | |||
| 3242 | Ga0207712_10189804 | |||
| 3243 | Ga0207712_10195145 | |||
| 3244 | Ga0207712_10338429 | |||
| 3245 | Ga0207712_10667183 | |||
| 3246 | Ga0207712_11069587 | |||
| 3247 | Ga0207712_11090498 | |||
| 3248 | Ga0207712_11607063 | |||
| 3249 | Ga0207712_12118196 | |||
| 3250 | Ga0207668_10008111 | |||
| 3251 | Ga0207668_10029829 | |||
| 3252 | Ga0207668_10089985 | |||
| 3253 | Ga0207668_10109810 | |||
| 3254 | Ga0207668_10833667 | |||
| 3255 | Ga0207668_10881402 | |||
| 3256 | Ga0207668_11290713 | |||
| 3257 | Ga0207668_11734783 | |||
| 3258 | Ga0207668_11780447 | |||
| 3259 | Ga0207640_10001771 | |||
| 3260 | Ga0207640_10371902 | |||
| 3261 | Ga0207640_10628406 | |||
| 3262 | Ga0207640_11188970 | |||
| 3263 | Ga0207658_10005779 | |||
| 3264 | Ga0207658_10152106 | |||
| 3265 | Ga0207658_10170219 | |||
| 3266 | Ga0207658_10442317 | |||
| 3267 | Ga0207658_10657076 | |||
| 3268 | Ga0207658_10832849 | |||
| 3269 | Ga0207658_10980291 | |||
| 3270 | Ga0207658_11153898 | |||
| 3271 | Ga0207658_11469160 | |||
| 3272 | Ga0207658_11999587 | |||
| 3273 | Ga0207658_12173926 | |||
| 3274 | Ga0207677_10055174 | |||
| 3275 | Ga0207677_10081818 | |||
| 3276 | Ga0207677_10102621 | |||
| 3277 | Ga0207677_10148454 | |||
| 3278 | Ga0207677_10585261 | |||
| 3279 | Ga0207677_10753603 | |||
| 3280 | Ga0207677_11389288 | |||
| 3281 | Ga0207703_10007776 | |||
| 3282 | Ga0207703_10018959 | |||
| 3283 | Ga0207703_10053903 | |||
| 3284 | Ga0207703_10133057 | |||
| 3285 | Ga0207703_10609806 | |||
| 3286 | Ga0207703_10655802 | |||
| 3287 | Ga0207703_11086685 | |||
| 3288 | Ga0207639_10000002 | |||
| 3289 | Ga0207639_10205773 | |||
| 3290 | Ga0207639_10654560 | |||
| 3291 | Ga0207678_10076735 | |||
| 3292 | Ga0207678_10095292 | |||
| 3293 | Ga0207678_10266782 | |||
| 3294 | Ga0207678_10521838 | |||
| 3295 | Ga0207678_10550534 | |||
| 3296 | Ga0207678_11454139 | |||
| 3297 | Ga0207708_10006632 | |||
| 3298 | Ga0207708_10097558 | |||
| 3299 | Ga0207708_10257878 | |||
| 3300 | Ga0207708_10375537 | |||
| 3301 | Ga0207702_10001504 | |||
| 3302 | Ga0207702_10002467 | |||
| 3303 | Ga0207702_10049604 | |||
| 3304 | Ga0207702_10228340 | |||
| 3305 | Ga0207702_10646637 | |||
| 3306 | Ga0207702_11497995 | |||
| 3307 | Ga0207641_10032948 | |||
| 3308 | Ga0207641_10036408 | |||
| 3309 | Ga0207641_10060341 | |||
| 3310 | Ga0207641_10128608 | |||
| 3311 | Ga0207641_10362709 | |||
| 3312 | Ga0207641_10618282 | |||
| 3313 | Ga0207641_11043400 | |||
| 3314 | Ga0207641_11306106 | |||
| 3315 | Ga0207641_11381735 | |||
| 3316 | Ga0207641_11480833 | |||
| 3317 | Ga0207648_10000612 | |||
| 3318 | Ga0207648_10064653 | |||
| 3319 | Ga0207648_10653012 | |||
| 3320 | Ga0207648_10875495 | |||
| 3321 | Ga0207648_11129022 | |||
| 3322 | Ga0207676_10012822 | |||
| 3323 | Ga0207676_10044354 | |||
| 3324 | Ga0207676_10187659 | |||
| 3325 | Ga0207676_10194360 | |||
| 3326 | Ga0207676_10402926 | |||
| 3327 | Ga0207676_10899002 | |||
| 3328 | Ga0207676_10972788 | |||
| 3329 | Ga0207676_11876748 | |||
| 3330 | Ga0207676_12267316 | |||
| 3331 | Ga0207676_12277330 | |||
| 3332 | Ga0207674_10013415 | |||
| 3333 | Ga0207674_10135214 | |||
| 3334 | Ga0207674_10335803 | |||
| 3335 | Ga0207674_11609942 | |||
| 3336 | Ga0207675_100020388 | |||
| 3337 | Ga0207675_100353104 | |||
| 3338 | Ga0207675_100519711 | |||
| 3339 | Ga0207675_100524426 | |||
| 3340 | Ga0207675_100572425 | |||
| 3341 | Ga0207675_100587627 | |||
| 3342 | Ga0207675_101003326 | |||
| 3343 | Ga0207675_102687646 | |||
| 3344 | Ga0207683_10009358 | |||
| 3345 | Ga0207683_10036687 | |||
| 3346 | Ga0207683_10080355 | |||
| 3347 | Ga0207683_10125371 | |||
| 3348 | Ga0207683_10246548 | |||
| 3349 | Ga0207683_10371229 | |||
| 3350 | Ga0207683_10562634 | |||
| 3351 | Ga0207683_11745733 | |||
| 3352 | Ga0207683_12130165 | |||
| 3353 | Ga0207698_10117274 | |||
| 3354 | Ga0207698_10620146 | |||
| 3355 | Ga0207698_10801523 | |||
| 3356 | Ga0207698_11472055 | |||
| 3357 | Ga0207698_12029469 | |||
| 3358 | Ga0209969_1075083 | |||
| 3359 | Ga0209179_1038669 | |||
| 3360 | Ga0209968_1104973 | |||
| 3361 | Ga0210002_1029966 | |||
| 3362 | Ga0209998_10200725 | |||
| 3363 | Ga0209974_10112043 | |||
| 3364 | Ga0209974_10147754 | |||
| 3365 | Ga0209974_10171331 | |||
| 3366 | Ga0209974_10273834 | |||
| 3367 | Ga0207428_10126902 | |||
| 3368 | Ga0207428_10140317 | |||
| 3369 | Ga0207428_10184025 | |||
| 3370 | Ga0207428_10394927 | |||
| 3371 | Ga0268266_10000031 | |||
| 3372 | Ga0268266_10002821 | |||
| 3373 | Ga0268266_10047522 | |||
| 3374 | Ga0268266_10141881 | |||
| 3375 | Ga0268266_10147762 | |||
| 3376 | Ga0268266_10156877 | |||
| 3377 | Ga0268266_10514334 | |||
| 3378 | Ga0268266_10706271 | |||
| 3379 | Ga0268266_10744803 | |||
| 3380 | Ga0268266_10915275 | |||
| 3381 | Ga0268266_11383296 | |||
| 3382 | Ga0268266_11466802 | |||
| 3383 | Ga0268265_10143675 | |||
| 3384 | Ga0268265_10336624 | |||
| 3385 | Ga0268265_10390961 | |||
| 3386 | Ga0268265_10588176 | |||
| 3387 | Ga0268265_11007178 | |||
| 3388 | Ga0268265_12637424 | |||
| 3389 | Ga0268264_10000490 | |||
| 3390 | Ga0268264_10010376 | |||
| 3391 | Ga0268264_10040759 | |||
| 3392 | Ga0268264_10152610 | |||
| 3393 | Ga0268264_10263862 | |||
| 3394 | Ga0268264_10843530 | |||
| 3395 | Ga0268264_10975788 | |||
| 3396 | Ga0268264_11065684 | |||
| 3397 | Ga0268264_11102274 | |||
| 3398 | Ga0268264_11735586 | |||
| 3399 | Ga0265337_1011579 | |||
| 3400 | Ga0265326_10004921 | |||
| 3401 | Ga0265319_1090682 | |||
| 3402 | Ga0265323_10004821 | |||
| 3403 | Ga0265338_10042182 | |||
| 3404 | Ga0265338_10055943 | |||
| 3405 | Ga0265338_10057989 | |||
| 3406 | Ga0265338_10078952 | |||
| 3407 | Ga0265338_10120162 | |||
| 3408 | Ga0265338_10185306 | |||
| 3409 | Ga0265338_10234227 | |||
| 3410 | Ga0265338_10392461 | |||
| 3411 | Ga0265324_10000744 | |||
| 3412 | Ga0265324_10005663 | |||
| 3413 | Ga0265324_10056285 | |||
| 3414 | Ga0265324_10205455 | |||
| 3415 | Ga0265324_10260613 | |||
| 3416 | Ga0307511_10000356 | |||
| 3417 | Ga0265325_10092814 | |||
| 3418 | Ga0265325_10432668 | |||
| 3419 | Ga0265340_10004729 | |||
| 3420 | Ga0265327_10000981 | |||
| 3421 | Ga0265327_10001732 | |||
| 3422 | Ga0265327_10506298 | |||
| 3423 | Ga0265327_10515495 | |||
| 3424 | Ga0265316_10065020 | |||
| 3425 | Ga0307513_10024894 | |||
| 3426 | Ga0307408_100071641 | |||
| 3427 | Ga0307408_100093208 | |||
| 3428 | Ga0307408_100425310 | |||
| 3429 | Ga0307408_100849871 | |||
| 3430 | Ga0307408_100906181 | |||
| 3431 | Ga0307408_101947599 | |||
| 3432 | Ga0265314_10103220 | |||
| 3433 | Ga0265314_10378101 | |||
| 3434 | Ga0265342_10068536 | |||
| 3435 | Ga0307405_10063523 | |||
| 3436 | Ga0307405_10095620 | |||
| 3437 | Ga0307405_10231625 | |||
| 3438 | Ga0307405_10408954 | |||
| 3439 | Ga0307405_10679078 | |||
| 3440 | Ga0307405_10992433 | |||
| 3441 | Ga0307413_10010373 | |||
| 3442 | Ga0307413_10015554 | |||
| 3443 | Ga0307413_10051152 | |||
| 3444 | Ga0307413_10099797 | |||
| 3445 | Ga0307413_10150839 | |||
| 3446 | Ga0307413_10201561 | |||
| 3447 | Ga0307413_10320086 | |||
| 3448 | Ga0307410_10006805 | |||
| 3449 | Ga0307410_10008590 | |||
| 3450 | Ga0307410_10020165 | |||
| 3451 | Ga0307410_10041478 | |||
| 3452 | Ga0307410_10057779 | |||
| 3453 | Ga0307410_10346664 | |||
| 3454 | Ga0307410_10475971 | |||
| 3455 | Ga0307410_11334514 | |||
| 3456 | Ga0307410_11711602 | |||
| 3457 | Ga0307410_12092265 | |||
| 3458 | Ga0307406_10008452 | |||
| 3459 | Ga0307406_10044210 | |||
| 3460 | Ga0307406_10148028 | |||
| 3461 | Ga0307406_10179223 | |||
| 3462 | Ga0307406_11642959 | |||
| 3463 | Ga0307406_12087218 | |||
| 3464 | Ga0307407_10005095 | |||
| 3465 | Ga0307407_10039348 | |||
| 3466 | Ga0307407_10090773 | |||
| 3467 | Ga0307407_10454268 | |||
| 3468 | Ga0307407_10762030 | |||
| 3469 | Ga0307407_10766904 | |||
| 3470 | Ga0307412_10042584 | |||
| 3471 | Ga0307412_10514252 | |||
| 3472 | Ga0307412_10894624 | |||
| 3473 | Ga0307409_100003004 | |||
| 3474 | Ga0307409_100014634 | |||
| 3475 | Ga0307409_100023493 | |||
| 3476 | Ga0307409_100042998 | |||
| 3477 | Ga0307409_100045105 | |||
| 3478 | Ga0307409_100083572 | |||
| 3479 | Ga0307409_100286353 | |||
| 3480 | Ga0307409_100356146 | |||
| 3481 | Ga0307409_100619445 | |||
| 3482 | Ga0307409_102470349 | |||
| 3483 | Ga0307416_100009633 | |||
| 3484 | Ga0307416_100027570 | |||
| 3485 | Ga0307416_100045957 | |||
| 3486 | Ga0307416_100053571 | |||
| 3487 | Ga0307416_100058553 | |||
| 3488 | Ga0307416_100076924 | |||
| 3489 | Ga0307416_100236469 | |||
| 3490 | Ga0307416_100246682 | |||
| 3491 | Ga0307416_100441448 | |||
| 3492 | Ga0307416_100652717 | |||
| 3493 | Ga0307416_100984322 | |||
| 3494 | Ga0307416_101664852 | |||
| 3495 | Ga0307416_103046012 | |||
| 3496 | Ga0307414_10018396 | |||
| 3497 | Ga0307414_10046014 | |||
| 3498 | Ga0307414_10067533 | |||
| 3499 | Ga0307414_10179811 | |||
| 3500 | Ga0307414_10190725 | |||
| 3501 | Ga0307414_10317095 | |||
| 3502 | Ga0307414_10449004 | |||
| 3503 | Ga0307414_11337357 | |||
| 3504 | Ga0307411_10003099 | |||
| 3505 | Ga0307411_10005029 | |||
| 3506 | Ga0307411_10024400 | |||
| 3507 | Ga0307411_10055315 | |||
| 3508 | Ga0307411_10095416 | |||
| 3509 | Ga0307411_10298164 | |||
| 3510 | Ga0307411_10611506 | |||
| 3511 | Ga0307411_10698205 | |||
| 3512 | Ga0307411_11780090 | |||
| 3513 | Ga0307415_100000666 | |||
| 3514 | Ga0307415_100077683 | |||
| 3515 | Ga0307415_100148040 | |||
| 3516 | Ga0307415_100174589 | |||
| 3517 | Ga0307415_100608123 | |||
| 3518 | Ga0307415_100711555 | |||
| 3519 | Ga0307415_101584614 | |||
| 3520 | Ga0373948_0090104 | |||
| 3521 | Ga0373959_0048516 | |||
| 3522 | Ga0373959_0141689 | |||
| 3523 | Ga0373938_0024118 | |||
| 3524 | Ga0373934_0261097 | |||
| 3525 | Ga0373940_0103172 | |||
| 3526 | Ga0373940_0221816 | |||
| 3527 | Ga0373944_0098620 | |||
| 3528 | Ga0373944_0376766 | |||
| 3529 | Ga0373949_0124666 | |||
| 3530 | Ga0373923_0325355 | |||
| 3531 | Ga0373932_0221417 | |||
| 3532 | Ga0373939_0193889 | |||
| 3533 | Ga0373939_0253374 | |||
| 3534 | Ga0373939_0321875 | |||
| 3535 | Ga0373941_0058935 | |||
| 3536 | Ga0373941_0281300 | |||
| 3537 | Ga0373945_0176235 | |||
| 3538 | Ga0373953_0024734 | |||
| 3539 | Ga0373953_0202213 | |||
| 3540 | Ga0373953_0234936 | |||
| 3541 | Ga0373954_0021839 | |||
| 3542 | Ga0373954_0152775 | |||
| 3543 | Ga0373956_0492958 | |||
| 3544 | Ga0373957_0145856 | |||
| 3545 | Ga0373957_0313091 | |||
| 3546 | Ga0373960_0147520 | |||
| 3547 | Ga0373943_0219330 | |||
| 3548 | Ga0373943_0299460 | |||
| 3549 | Ga0373943_0304300 | |||
| 3550 | Ga0373943_0444201 | |||
| 3551 | Ga0373943_0936307 | |||
| 3552 | Ga0373946_0328342 | |||
| 3553 | Ga0373955_0115760 | |||
| 3554 | Ga0373955_0446899 | |||
| 3555 | Ga0373955_0595079 | |||
| 3556 | Ga0373961_0025608 | |||
| 3557 | Ga0373961_0225914 | |||
| 3558 | Ga0373962_0086686 | |||
| 3559 | Ga0316574_0528705 | |||
| 3560 | Ga0373924_0049684 | |||
| 3561 | Ga0373931_0040722 | |||
| 3562 | Ga0373931_0089040 | |||
| 3563 | Ga0373931_0090386 | |||
| 3564 | Ga0373931_0124824 | |||
| 3565 | Ga0373931_0204509 | |||
| 3566 | Ga0373931_1025801 | |||
| 3567 | Ga0373935_0012815 | |||
| 3568 | Ga0373935_0688124 | |||
| 3569 | Ga0373927_0001027 | |||
| 3570 | Ga0373927_0240924 | |||
| 3571 | Ga0373927_1092565 | |||
| 3572 | Ga0373927_1199743 | |||
| 3573 | Ga0373933_0682409 | |||
| 3574 | Ga0373947_0006561 | |||
| 3575 | Ga0373947_0045704 | |||
| 3576 | Ga0373947_0064308 | |||
| 3577 | Ga0373937_0017356 | |||
| 3578 | Ga0373937_0177494 | |||
| 3579 | Ga0373937_0319398 | |||
| 3580 | Ga0373937_1633811 | |||
| 3581 | Ga0373925_0034723 | |||
| 3582 | Ga0373925_0098578 | |||
| 3583 | Ga0373925_0188911 | |||
| 3584 | Ga0373925_0643059 | |||
| 3585 | Ga0373925_0682257 | |||
| 3586 | Ga0395899_0000020 | |||
| 3587 | Ga0395899_0147628 | |||
| 3588 | Ga0395899_0977859 | |||
| 3589 | Ga0395900_0025758 | |||
| 3590 | Ga0395900_0204403 | |||
| 3591 | Ga0395900_0563951 | |||
| 3592 | Ga0395900_1568402 | |||
| 3593 | Ga0395898_0000005 | |||
| 3594 | Ga0395898_0346400 | |||
| 3595 | Ga0395898_0417235 | |||
| 3596 | Ga0395898_0612638 | |||
| 3597 | Ga0395905_0010612 | |||
| 3598 | Ga0395905_0150611 | |||
| 3599 | Ga0395905_0308654 | |||
| 3600 | Ga0395905_0716654 | |||
| 3601 | Ga0395905_0881465 | |||
| 3602 | Ga0436364_0505772 | |||
| 3603 | Ga0436364_0823930 | |||
| 3604 | Ga0436364_1396628 | |||
| 3605 | Ga0436364_1512261 | |||
| 3606 | Ga0395901_0035274 | |||
| 3607 | Ga0395901_0346224 | |||
| 3608 | Ga0395901_0363995 | |||
| 3609 | Ga0395901_0379938 | |||
| 3610 | Ga0395901_0387784 | |||
| 3611 | Ga0395901_0911573 | |||
| 3612 | Ga0242420_049142 | |||
| 3613 | Ga0242420_070842 | |||
| 3614 | Ga0400487_17689 | |||
| 3615 | Ga0436365_0124390 | |||
| 3616 | Ga0436365_0373930 | |||
| 3617 | Ga0436365_0449926 | |||
| 3618 | Ga0436365_0568727 | |||
| 3619 | Ga0436365_1024521 | |||
| 3620 | Ga0436365_1112867 | |||
| 3621 | Ga0436365_1621097 | |||
| 3622 | Ga0436360_0633339 | |||
| 3623 | Ga0436360_0691807 | |||
| 3624 | Ga0436360_1033638 | |||
| 3625 | Ga0436360_1107696 | |||
| 3626 | Ga0436361_0045124 | |||
| 3627 | Ga0436361_0147811 | |||
| 3628 | Ga0436361_0155125 | |||
| 3629 | Ga0436361_0169046 | |||
| 3630 | Ga0436361_0344738 | |||
| 3631 | Ga0436361_0405526 | |||
| 3632 | Ga0436361_0626659 | |||
| 3633 | Ga0436361_0917304 | |||
| 3634 | Ga0436361_0981451 | |||
| 3635 | Ga0436363_0803061 | |||
| 3636 | Ga0436363_0848729 | |||
| 3637 | Ga0436363_1578574 | |||
| 3638 | Ga0436362_0213225 | |||
| 3639 | Ga0436362_0310560 | |||
| 3640 | Ga0436362_0336515 | |||
| 3641 | Ga0436362_0616189 | |||
| 3642 | Ga0436362_0955727 | |||
| 3643 | Ga0436362_1222664 | |||
| 3644 | Ga0439436_0142735 | |||
| 3645 | Ga0439461_0082667 | |||
| 3646 | Ga0439461_0115238 | |||
| 3647 | Ga0439466_0146094 | |||
| 3648 | Ga0439465_0120502 | |||
| 3649 | Ga0439465_0222847 | |||
| 3650 | Ga0451789_0209120 | |||
| 3651 | Ga0451793_1292636 | |||
| 3652 | Ga0451798_0000265 | |||
| 3653 | Ga0451798_0249200 | |||
| 3654 | Ga0451798_0656924 | |||
| 3655 | Ga0451798_1034082 | |||
| 3656 | Ga0451800_0130657 | |||
| 3657 | Ga0451802_0846379 | |||
| 3658 | Ga0451805_049017 | |||
| 3659 | Ga0451804_0729216 | |||
| 3660 | Ga0451807_0449875 | |||
| 3661 | Ga0451807_0559256 | |||
| 3662 | Ga0451807_0937083 | |||
| 3663 | Ga0451807_0937796 | |||
| 3664 | Ga0451807_1346229 | |||
| 3665 | Ga0451835_0845796 | |||
| 3666 | Ga0451839_1339201 | |||
| 3667 | Ga0451839_1548798 | |||
| 3668 | Ga0451845_0752156 | |||
| 3669 | Ga0451849_0485370 | |||
| 3670 | Ga0451849_1349095 | |||
| 3671 | Ga0451851_0507346 | |||
| 3672 | Ga0451853_3595515 | |||
| 3673 | Ga0439431_0251742 | |||
| 3674 | Ga0439437_030251 | |||
| 3675 | Ga0439443_073159 | |||
| 3676 | Ga0439448_0008572 | |||
| 3677 | Ga0439448_0158797 | |||
| 3678 | Ga0439451_013570 | |||
| 3679 | Ga0439454_037404 | |||
| 3680 | Ga0439455_0003989 | |||
| 3681 | Ga0439446_0011270 | |||
| 3682 | Ga0439446_0127685 | |||
| 3683 | Ga0439458_0146728 | |||
| 3684 | Ga0439435_0059806 | |||
| 3685 | Ga0439459_0018953 | |||
| 3686 | Ga0439464_0115806 | |||
| 3687 | Ga0439460_0025430 | |||
| 3688 | Ga0439460_0333553 | |||
| 3689 | Ga0450893_0089392 | |||
| 3690 | Ga0451577_0007985 | |||
| 3691 | Ga0451577_0012394 | |||
| 3692 | Ga0451577_0118766 | |||
| 3693 | Ga0439440_0159075 | |||
| 3694 | Ga0439440_0252031 | |||
| 3695 | Ga0466969_0395508 | |||
| 3696 | Ga0453683_0316127 | |||
| 3697 | Ga0466965_0005363 | |||
| 3698 | Ga0466966_0335277 | |||
| 3699 | Ga0466963_0575770 | |||
| 3700 | Ga0466964_0009690 | |||
| 3701 | Ga0453684_0263704 | |||
| 3702 | Ga0466971_0000058 | |||
| 3703 | Ga0466957_0046058 | |||
| 3704 | Ga0466957_0768439 | |||
| 3705 | Ga0466960_0149466 | |||
| 3706 | Ga0466960_0436220 | |||
| 3707 | Ga0466960_0827205 | |||
| 3708 | Ga0451576_0072646 | |||
| 3709 | Ga0451576_0084931 | |||
| 3710 | Ga0451576_0131093 | |||
| 3711 | Ga0451576_0383999 | |||
| 3712 | Ga0451576_0958705 | |||
| 3713 | Ga0451576_1516917 | |||
| 3714 | Ga0451576_1830484 | |||
| 3715 | Ga0466967_0015079 | |||
| 3716 | Ga0466967_0354280 | |||
| 3717 | Ga0466967_0580955 | |||
| 3718 | Ga0466967_0789694 | |||
| 3719 | Ga0495592_0000006 | |||
| 3720 | Ga0495592_0069715 | |||
| 3721 | Ga0495592_0146039 | |||
| 3722 | Ga0495603_0015630 | |||
| 3723 | Ga0495603_0248231 | |||
| 3724 | Ga0495590_0230280 | |||
| 3725 | Ga0495629_0496486 | |||
| 3726 | Ga0495641_0023473 | |||
| 3727 | Ga0495651_0030156 | |||
| 3728 | Ga0495651_0733126 | |||
| 3729 | Ga0495653_0267718 | |||
| 3730 | Ga0495580_0292722 | |||
| 3731 | Ga0495580_0867852 | |||
| 3732 | Ga0495582_0004514 | |||
| 3733 | Ga0495582_0167005 | |||
| 3734 | Ga0495605_0449914 | |||
| 3735 | Ga0495639_0062925 | |||
| 3736 | Ga0495639_0233681 | |||
| 3737 | Ga0495662_0016393 | |||
| 3738 | Ga0495662_0040643 | |||
| 3739 | Ga0495585_0630480 | |||
| 3740 | Ga0495594_0009810 | |||
| 3741 | Ga0495594_0034317 | |||
| 3742 | Ga0495594_0125728 | |||
| 3743 | Ga0495608_0263156 | |||
| 3744 | Ga0495618_0015859 | |||
| 3745 | Ga0495618_0069098 | |||
| 3746 | Ga0495618_0111345 | |||
| 3747 | Ga0495628_0000138 | |||
| 3748 | Ga0495628_0054183 | |||
| 3749 | Ga0495628_0504838 | |||
| 3750 | Ga0495628_0702890 | |||
| 3751 | Ga0495630_0001362 | |||
| 3752 | Ga0495630_0041633 | |||
| 3753 | Ga0495630_0278163 | |||
| 3754 | Ga0495630_0380399 | |||
| 3755 | Ga0495630_0603123 | |||
| 3756 | Ga0495643_0000820 | |||
| 3757 | Ga0495666_0000412 | |||
| 3758 | Ga0495666_0016355 | |||
| 3759 | Ga0495666_0185182 | |||
| 3760 | Ga0495652_0011918 | |||
| 3761 | Ga0495652_0021022 | |||
| 3762 | Ga0495652_0495464 | |||
| 3763 | Ga0495652_0930270 | |||
| 3764 | Ga0495665_0082900 | |||
| 3765 | Ga0495640_0051905 | |||
| 3766 | Ga0495640_0059807 | |||
| 3767 | Ga0495640_0070443 | |||
| 3768 | Ga0495640_0626695 | |||
| 3769 | Ga0495586_0007175 | |||
| 3770 | Ga0495586_0080014 | |||
| 3771 | Ga0495586_0300278 | |||
| 3772 | Ga0495587_0543044 | |||
| 3773 | Ga0495598_0068478 | |||
| 3774 | Ga0495598_0069336 | |||
| 3775 | Ga0495598_0178890 | |||
| 3776 | Ga0495621_0109494 | |||
| 3777 | Ga0495645_0000530 | |||
| 3778 | Ga0495645_0236083 | |||
| 3779 | Ga0495645_0426986 | |||
| 3780 | Ga0495622_0108379 | |||
| 3781 | Ga0495633_0175650 | |||
| 3782 | Ga0495667_0103225 | |||
| 3783 | Ga0495667_0212469 | |||
| 3784 | Ga0495656_0322171 | |||
| 3785 | Ga0495656_0490469 | |||
| 3786 | Ga0495634_0027622 | |||
| 3787 | Ga0495611_0328004 | |||
| 3788 | Ga0495611_0537065 | |||
| 3789 | Ga0495635_0187952 | |||
| 3790 | Ga0495659_0035560 | |||
| 3791 | Ga0495659_0439624 | |||
| 3792 | Ga0495588_0028500 | |||
| 3793 | Ga0495599_0014142 | |||
| 3794 | Ga0495599_0039473 | |||
| 3795 | Ga0495599_0076713 | |||
| 3796 | Ga0495623_0401985 | |||
| 3797 | Ga0495623_0501902 | |||
| 3798 | Ga0495646_0046577 | |||
| 3799 | Ga0495647_0009796 | |||
| 3800 | Ga0495647_0540985 | |||
| 3801 | Ga0495658_0003313 | |||
| 3802 | Ga0495658_0082489 | |||
| 3803 | Ga0495658_0610881 | |||
| 3804 | Ga0495658_0647435 | |||
| 3805 | Ga0495658_0981682 | |||
| 3806 | Ga0495669_0017769 | |||
| 3807 | Ga0495669_0081814 | |||
| 3808 | Ga0495669_0094927 | |||
| 3809 | Ga0495613_0028431 | |||
| 3810 | Ga0495624_0829280 | |||
| 3811 | Ga0495600_0222407 | |||
| 3812 | Ga0495600_0337033 | |||
| 3813 | Ga0495581_0075383 | |||
| 3814 | Ga0495636_0630205 | |||
| 3815 | Ga0495674_0020816 | |||
| 3816 | Ga0495674_0029534 | |||
| 3817 | Ga0495674_0056074 | |||
| 3818 | Ga0495674_0104815 | |||
| 3819 | Ga0495674_1080123 | |||
| 3820 | Ga0495676_0285364 | |||
| 3821 | Ga0495680_0004984 | |||
| 3822 | Ga0495680_0214010 | |||
| 3823 | Ga0495680_0233196 | |||
| 3824 | Ga0495675_0355540 | |||
| 3825 | Ga0495684_0012158 | |||
| 3826 | Ga0495684_0201224 | |||
| 3827 | Ga0495684_0948808 | |||
| 3828 | Ga0495684_1061214 | |||
| 3829 | Ga0495593_0634469 | |||
| 3830 | Ga0495602_0192709 | |||
| 3831 | Ga0495602_0730402 | |||
| 3832 | Ga0495602_0740979 | |||
| 3833 | Ga0495614_0207287 | |||
| 3834 | Ga0496100_0172922 | |||
| 3835 | Ga0496100_0280389 | |||
| 3836 | Ga0496100_0603781 | |||
| 3837 | Ga0496100_1198301 | |||
| 3838 | Ga0496100_1523895 | |||
| 3839 | Ga0496100_1688245 | |||
| 3840 | Ga0496101_0048241 | |||
| 3841 | Ga0496101_0074470 | |||
| 3842 | Ga0496101_0118421 | |||
| 3843 | Ga0496101_0640258 | |||
| 3844 | Ga0496101_1090128 | |||
| 3845 | Ga0496101_1189898 | |||
| 3846 | Ga0496102_0007849 | |||
| 3847 | Ga0496102_0078030 | |||
| 3848 | Ga0496102_0086480 | |||
| 3849 | Ga0496102_0127536 | |||
| 3850 | Ga0496102_0150845 | |||
| 3851 | Ga0496102_0905632 | |||
| 3852 | Ga0496102_1110744 | |||
| 3853 | Ga0496103_0020270 | |||
| 3854 | Ga0496103_0069235 | |||
| 3855 | Ga0496103_0602123 | |||
| 3856 | Ga0496103_0982504 | |||
| 3857 | Ga0496104_0011908 | |||
| 3858 | Ga0496104_0031019 | |||
| 3859 | Ga0496104_0031930 | |||
| 3860 | Ga0496104_0768535 | |||
| 3861 | Ga0496104_0826109 | |||
| 3862 | Ga0496105_0036763 | |||
| 3863 | Ga0496105_0039455 | |||
| 3864 | Ga0496105_0184169 | |||
| 3865 | Ga0496105_0495071 | |||
| 3866 | Ga0496106_0005482 | |||
| 3867 | Ga0496106_0068421 | |||
| 3868 | Ga0496106_0343786 | |||
| 3869 | Ga0496106_0500957 | |||
| 3870 | Ga0496106_0699765 | |||
| 3871 | Ga0496107_0166569 | |||
| 3872 | Ga0496107_0555043 | |||
| 3873 | Ga0496107_1071665 | |||
| 3874 | Ga0496107_1107019 | |||
| 3875 | Ga0496107_1374055 | |||
| 3876 | Ga0496108_0006558 | |||
| 3877 | Ga0496108_0123529 | |||
| 3878 | Ga0496108_0541551 | |||
| 3879 | Ga0496108_0773275 | |||
| 3880 | Ga0496108_0972326 | |||
| 3881 | Ga0496108_1334947 | |||
| 3882 | Ga0496109_0002800 | |||
| 3883 | Ga0496109_0015170 | |||
| 3884 | Ga0496109_0069389 | |||
| 3885 | Ga0496109_0088911 | |||
| 3886 | Ga0496109_0738515 | |||
| 3887 | Ga0496109_1546157 | |||
| 3888 | Ga0496109_1618180 | |||
| 3889 | Ga0496109_1626732 | |||
| 3890 | Ga0496109_1932102 | |||
| 3891 | Ga0496110_0009675 | |||
| 3892 | Ga0496110_0012160 | |||
| 3893 | Ga0496110_0302004 | |||
| 3894 | Ga0496110_0397376 | |||
| 3895 | Ga0496111_0075485 | |||
| 3896 | Ga0496111_0170029 | |||
| 3897 | Ga0496111_0206796 | |||
| 3898 | Ga0496112_0006373 | |||
| 3899 | Ga0496112_0022700 | |||
| 3900 | Ga0496112_0104761 | |||
| 3901 | Ga0496112_0129284 | |||
| 3902 | Ga0496112_0179616 | |||
| 3903 | Ga0496112_0286398 | |||
| 3904 | Ga0496112_0529452 | |||
| 3905 | Ga0496112_1518690 | |||
| 3906 | Ga0496113_0004859 | |||
| 3907 | Ga0496113_0013512 | |||
| 3908 | Ga0496113_0424943 | |||
| 3909 | Ga0496113_0662430 | |||
| 3910 | Ga0496113_0757873 | |||
| 3911 | Ga0496113_1506768 | |||
| 3912 | Ga0496113_1606987 | |||
| 3913 | Ga0496114_0018469 | |||
| 3914 | Ga0496114_0040825 | |||
| 3915 | Ga0496114_1528654 | |||
| 3916 | Ga0496115_0001343 | |||
| 3917 | Ga0496115_0002505 | |||
| 3918 | Ga0496115_1220364 | |||
| 3919 | Ga0496115_1372819 | |||
| 3920 | Ga0496121_0506800 | |||
| 3921 | Ga0496124_0420591 | |||
| 3922 | Ga0496125_0000832 | |||
| 3923 | Ga0501305_073781 | |||
| 3924 | Ga0501291_062011 | |||
| 3925 | Ga0501291_122024 | |||
| 3926 | Ga0501294_008815 | |||
| 3927 | Ga0501298_070428 | |||
| 3928 | Ga0501299_103058 | |||
| 3929 | Ga0501299_228561 | |||
| 3930 | Ga0501303_034026 | |||
| 3931 | Ga0501336_028030 | |||
| 3932 | Ga0501031_0000638 | |||
| 3933 | Ga0501031_0019681 | |||
| 3934 | Ga0501031_0059313 | |||
| 3935 | Ga0501031_0064858 | |||
| 3936 | Ga0501032_0015768 | |||
| 3937 | Ga0501032_0056199 | |||
| 3938 | Ga0501032_0067166 | |||
| 3939 | Ga0501032_0374219 | |||
| 3940 | Ga0501033_0000020 | |||
| 3941 | Ga0501033_0004029 | |||
| 3942 | Ga0501033_0051628 | |||
| 3943 | Ga0501033_0122327 | |||
| 3944 | Ga0501034_0189620 | |||
| 3945 | Ga0501036_0011557 | |||
| 3946 | Ga0501036_0462012 | |||
| 3947 | Ga0501036_0535761 | |||
| 3948 | Ga0501036_0672000 | |||
| 3949 | Ga0501037_0000022 | |||
| 3950 | Ga0501037_0104183 | |||
| 3951 | Ga0501037_0142320 | |||
| 3952 | Ga0501037_0312123 | |||
| 3953 | Ga0501038_0000194 | |||
| 3954 | Ga0501038_0002823 | |||
| 3955 | Ga0501038_0029243 | |||
| 3956 | Ga0501039_0224793 | |||
| 3957 | Ga0501039_0642511 | |||
| 3958 | Ga0501039_0835447 | |||
| 3959 | Ga0501039_1043354 | |||
| 3960 | Ga0501039_1399420 | |||
| 3961 | Ga0501040_0224812 | |||
| 3962 | Ga0501040_0325871 | |||
| 3963 | Ga0501040_0523563 | |||
| 3964 | Ga0501041_0013861 | |||
| 3965 | Ga0501041_0197319 | |||
| 3966 | Ga0501041_0283737 | |||
| 3967 | Ga0501041_0362990 | |||
| 3968 | Ga0501042_0014238 | |||
| 3969 | Ga0501042_0023610 | |||
| 3970 | Ga0501042_1323978 | |||
| 3971 | Ga0501043_0248688 | |||
| 3972 | Ga0501043_0364029 | |||
| 3973 | Ga0501043_0366021 | |||
| 3974 | Ga0501043_0405146 | |||
| 3975 | Ga0501046_0050662 | |||
| 3976 | Ga0501046_0179628 | |||
| 3977 | Ga0501047_0010776 | |||
| 3978 | Ga0501047_0498503 | |||
| 3979 | Ga0501048_0017270 | |||
| 3980 | Ga0501048_0664849 | |||
| 3981 | Ga0501048_0719627 | |||
| 3982 | Ga0501067_0008076 | |||
| 3983 | Ga0501067_0028695 | |||
| 3984 | Ga0501067_0401888 | |||
| 3985 | Ga0501068_0035332 | |||
| 3986 | Ga0501069_0080801 | |||
| 3987 | Ga0501069_0383334 | |||
| 3988 | Ga0501070_0286107 | |||
| 3989 | Ga0501071_0418529 | |||
| 3990 | Ga0501071_0425077 | |||
| 3991 | Ga0501071_0498616 | |||
| 3992 | Ga0501072_0561209 | |||
| 3993 | Ga0501072_0577338 | |||
| 3994 | Ga0501072_0615454 | |||
| 3995 | Ga0501072_0667020 | |||
| 3996 | Ga0501072_1042757 | |||
| 3997 | Ga0501073_0229342 | |||
| 3998 | Ga0501074_0365701 | |||
| 3999 | Ga0501074_0380994 | |||
| 4000 | Ga0501075_0166364 | |||
| 4001 | Ga0501075_0168266 | |||
| 4002 | Ga0501075_0281800 | |||
| 4003 | Ga0501075_0320372 | |||
| 4004 | Ga0501075_0543274 | |||
| 4005 | Ga0501075_0708031 | |||
| 4006 | Ga0501076_0011287 | |||
| 4007 | Ga0501076_0180929 | |||
| 4008 | Ga0501076_0515766 | |||
| 4009 | Ga0501076_0756095 | |||
| 4010 | Ga0501076_1425902 | |||
| 4011 | Ga0501077_0000313 | |||
| 4012 | Ga0501077_0020354 | |||
| 4013 | Ga0501077_0047849 | |||
| 4014 | Ga0501199_014038 | |||
| 4015 | Ga0501201_056199 | |||
| 4016 | Ga0501208_133923 | |||
| 4017 | Ga0501214_031081 | |||
| 4018 | Ga0501217_040783 | |||
| 4019 | Ga0501224_059530 | |||
| 4020 | Ga0501228_004781 | |||
| 4021 | Ga0501228_008776 | |||
| 4022 | Ga0501230_036559 | |||
| 4023 | Ga0501233_011819 | |||
| 4024 | Ga0501233_249769 | |||
| 4025 | Ga0501235_030904 | |||
| 4026 | Ga0501235_043292 | |||
| 4027 | Ga0501243_006374 | |||
| 4028 | Ga0501243_049497 | |||
| 4029 | Ga0501246_005560 | |||
| 4030 | Ga0501247_025754 | |||
| 4031 | Ga0501248_018578 | |||
| 4032 | Ga0501249_048107 | |||
| 4033 | Ga0501249_062617 | |||
| 4034 | Ga0501250_024265 | |||
| 4035 | Ga0501250_031006 | |||
| 4036 | Ga0501252_039290 | |||
| 4037 | Ga0501253_050690 | |||
| 4038 | Ga0501255_089336 | |||
| 4039 | Ga0501257_108042 | |||
| 4040 | Ga0501261_016191 | |||
| 4041 | Ga0501221_041047 | |||
| 4042 | Ga0501229_019955 | |||
| 4043 | Ga0501229_061267 | |||
| 4044 | Ga0501234_065863 | |||
| 4045 | Ga0501245_056828 | |||
| 4046 | Ga0501079_0037314 | |||
| 4047 | Ga0501079_0270749 | |||
| 4048 | Ga0501079_0303378 | |||
| 4049 | Ga0501080_0031612 | |||
| 4050 | Ga0501080_0138044 | |||
| 4051 | Ga0501080_0368987 | |||
| 4052 | Ga0501080_0374339 | |||
| 4053 | Ga0501080_0570190 | |||
| 4054 | Ga0501080_0739595 | |||
| 4055 | Ga0501081_0065826 | |||
| 4056 | Ga0501081_0124166 | |||
| 4057 | Ga0501083_0026321 | |||
| 4058 | Ga0501083_0064606 | |||
| 4059 | Ga0501083_0471338 | |||
| 4060 | Ga0501083_1096309 | |||
| 4061 | Ga0501232_026783 | |||
| 4062 | Ga0501262_010341 | |||
| 4063 | Ga0501263_035636 | |||
| 4064 | Ga0501265_093333 | |||
| 4065 | Ga0501266_019519 | |||
| 4066 | Ga0501267_038016 | |||
| 4067 | Ga0501269_057670 | |||
| 4068 | Ga0501270_026374 | |||
| 4069 | Ga0501270_116527 | |||
| 4070 | Ga0501271_011350 | |||
| 4071 | Ga0501273_003901 | |||
| 4072 | Ga0501273_029852 | |||
| 4073 | Ga0501283_013090 | |||
| 4074 | Ga0501035_0000018 | |||
| 4075 | Ga0501035_0007736 | |||
| 4076 | Ga0501035_0061691 | |||
| 4077 | Ga0501035_0228806 | |||
| 4078 | Ga0501035_0440402 | |||
| 4079 | Ga0501035_0528385 | |||
| 4080 | Ga0501035_0683417 | |||
| 4081 | Ga0501044_0000356 | |||
| 4082 | Ga0501044_0000611 | |||
| 4083 | Ga0501044_0050422 | |||
| 4084 | Ga0501044_0262866 | |||
| 4085 | Ga0501044_0395442 | |||
| 4086 | Ga0501045_0069044 | |||
| 4087 | Ga0501045_0221429 | |||
| 4088 | Ga0501204_043361 | |||
| 4089 | Ga0501212_061998 | |||
| 4090 | Ga0501226_019273 | |||
| 4091 | nmdc:mga03683_191095_c1 | |||
| 4092 | nmdc:mga03683_257698_c1 | |||
| 4093 | nmdc:mga03683_480164_c1 | |||
| 4094 | nmdc:mga03n38_291639_c1 | |||
| 4095 | nmdc:mga0yw44_884437_c1 | |||
| 4096 | nmdc:mga0k408_422_c1 | |||
| 4097 | nmdc:mga0k408_519_c1 | |||
| 4098 | nmdc:mga0k408_758255_c1 | |||
| 4099 | nmdc:mga07m45_127955_c1 | |||
| 4100 | nmdc:mga05p37_147719_c1 | |||
| 4101 | nmdc:mga05p37_1804585_c1 | |||
| 4102 | nmdc:mga05p37_2139670_c1 | |||
| 4103 | nmdc:mga05p37_2158795_c1 | |||
| 4104 | nmdc:mga05p37_225902_c1 | |||
| 4105 | nmdc:mga05p37_226446_c1 | |||
| 4106 | nmdc:mga05p37_228803_c1 | |||
| 4107 | nmdc:mga05p37_2996_c1 | |||
| 4108 | nmdc:mga05p37_423550_c1 | |||
| 4109 | nmdc:mga05p37_508909_c1 | |||
| 4110 | nmdc:mga05p37_5420_c1 | |||
| 4111 | nmdc:mga09592_217940_c1 | |||
| 4112 | nmdc:mga09592_260903_c1 | |||
| 4113 | nmdc:mga09592_848776_c1 | |||
| 4114 | nmdc:mga0qj67_18879_c1 | |||
| 4115 | nmdc:mga0qj67_434176_c1 | |||
| 4116 | nmdc:mga06r32_112696_c1 | |||
| 4117 | nmdc:mga06r32_1982616_c1 | |||
| 4118 | nmdc:mga06r32_58625_c1 | |||
| 4119 | nmdc:mga08y16_105403_c1 | |||
| 4120 | nmdc:mga08y16_1517870_c1 | |||
| 4121 | nmdc:mga08y16_155223_c1 | |||
| 4122 | nmdc:mga08y16_155856_c1 | |||
| 4123 | nmdc:mga08y16_166580_c1 | |||
| 4124 | nmdc:mga08y16_22076_c1 | |||
| 4125 | nmdc:mga08y16_425312_c1 | |||
| 4126 | nmdc:mga08y16_440777_c1 | |||
| 4127 | nmdc:mga08y16_604273_c1 | |||
| 4128 | nmdc:mga08y16_612479_c1 | |||
| 4129 | nmdc:mga08y16_934735_c1 | |||
| 4130 | nmdc:mga0n895_1043242_c1 | |||
| 4131 | nmdc:mga0n895_1179667_c1 | |||
| 4132 | nmdc:mga0n895_1832291_c1 | |||
| 4133 | nmdc:mga0n895_2026989_c1 | |||
| 4134 | nmdc:mga0n895_256254_c1 | |||
| 4135 | nmdc:mga0n895_263767_c1 | |||
| 4136 | nmdc:mga0n895_272159_c1 | |||
| 4137 | nmdc:mga0n895_297981_c1 | |||
| 4138 | nmdc:mga0n895_383596_c1 | |||
| 4139 | nmdc:mga0n895_45713_c1 | |||
| 4140 | nmdc:mga0n895_475657_c1 | |||
| 4141 | nmdc:mga0n895_624280_c1 | |||
| 4142 | nmdc:mga0n895_810979_c1 | |||
| 4143 | nmdc:mga0rr50_1086598_c1 | |||
| 4144 | nmdc:mga0rr50_123189_c1 | |||
| 4145 | nmdc:mga0rr50_1273581_c1 | |||
| 4146 | nmdc:mga0rr50_1434932_c1 | |||
| 4147 | nmdc:mga0rr50_16705_c1 | |||
| 4148 | nmdc:mga0rr50_263162_c1 | |||
| 4149 | nmdc:mga0rr50_339624_c1 | |||
| 4150 | nmdc:mga08x19_36841_c1 | |||
| 4151 | nmdc:mga08x19_843611_c1 | |||
| 4152 | nmdc:mga08x19_936947_c1 | |||
| 4153 | nmdc:mga0a205_185032_c1 | |||
| 4154 | nmdc:mga0a205_23268_c1 | |||
| 4155 | nmdc:mga0a205_261998_c1 | |||
| 4156 | nmdc:mga0a205_34062_c1 | |||
| 4157 | nmdc:mga0a205_52758_c2 | |||
| 4158 | nmdc:mga0a205_643938_c1 | |||
| 4159 | nmdc:mga0a205_871790_c1 | |||
| 4160 | Ga0495601_0128111 | |||
| 4161 | Ga0495601_0452533 | |||
| 4162 | Ga0495595_0326040 | |||
| 4163 | Ga0495595_0462310 | |||
| 4164 | Ga0495619_0142554 | |||
| 4165 | Ga0500651_0190029 | |||
| 4166 | Ga0500555_000378 | |||
| 4167 | Ga0500556_0000453 | |||
| 4168 | Ga0500594_0014244 | |||
| 4169 | Ga0500595_017957 | |||
| 4170 | Ga0500642_0046777 | |||
| 4171 | Ga0500655_081180 | |||
| 4172 | Ga0500658_0109300 | |||
| 4173 | Ga0500568_0008069 | |||
| 4174 | Ga0500573_0425060 | |||
| 4175 | Ga0500616_0005196 | |||
| 4176 | Ga0500616_0024716 | |||
| 4177 | Ga0500645_191810 | |||
| 4178 | Ga0501084_0037665 | |||
| 4179 | Ga0501084_0040152 | |||
| 4180 | Ga0501084_0071596 | |||
| 4181 | Ga0501084_0250030 | |||
| 4182 | Ga0590071_005233 | |||
| 4183 | Ga0590074_003362 | |||
| 4184 | Ga0590074_006539 | |||
| 4185 | Ga0590077_066256 | |||
| 4186 | Ga0587073_0243779 | |||
| 4187 | Ga0587077_245141 | |||
| 4188 | Ga0587080_172255 | |||
| 4189 | Ga0587086_069257 | |||
| 4190 | Ga0587088_015612 | |||
| 4191 | Ga0587088_145992 | |||
| 4192 | Ga0587089_036292 | |||
| 4193 | Ga0587091_027861 | |||
| 4194 | Ga0587094_022810 | |||
| 4195 | Ga0587094_092795 | |||
| 4196 | Ga0587125_051191 | |||
| 4197 | Ga0587113_039157 | |||
| 4198 | Ga0587067_206071 | |||
| 4199 | Ga0587075_073606 | |||
| 4200 | Ga0587107_153127 | |||
| 4201 | Ga0587071_113982 | |||
| 4202 | Ga0501082_0938735 | |||
| 4203 | Ga0501082_1663186 | |||
| 4204 | Ga0466962_0000021 | |||
| 4205 | Ga0530510_0067414 | |||
| 4206 | Ga0530510_0160452 | |||
| 4207 | Ga0530510_0234640 | |||
| 4208 | Ga0530510_0272885 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f80-assembly1.cif.gz_F | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.9915 | 6 | 75 |
| 1f80-assembly1.cif.gz_E | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.9909 | 7 | 76 |
| 2ehs-assembly1.cif.gz_A | crystal structure of acyl carrier protein from aquifex aeolicus (form 1) | 0.9901 | 6 | 78 |
| 1l0i-assembly1.cif.gz_A | crystal structure of butyryl-acp i62m mutant | 0.9878 | 6 | 77 |
| 1f80-assembly1.cif.gz_D | holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) | 0.9878 | 7 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6A8_1_78_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 1.001 | 6 | 79 | 1.10.1200.10 |
| 1f80F00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9915 | 6 | 75 | 1.10.1200.10 |
| 1f80E00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9909 | 7 | 76 | 1.10.1200.10 |
| 1f80D00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9878 | 7 | 75 | 1.10.1200.10 |
| 3gzmB00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9822 | 7 | 77 | 1.10.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4T0ZNC5-F1-model_v4 | deleted | 1.01 | 6 | 77 |
|
| AF-V6J8H5-F1-model_v4 | Acyl carrier protein (ACP) | 1.01 | 6 | 77 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A2V9JRB8-F1-model_v4 | Acyl carrier protein (ACP) | 1.009 | 6 | 77 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A7V6U9F7-F1-model_v4 | Acyl carrier protein (ACP) | 1.009 | 6 | 77 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 GO:0031177 |
| AF-A0A1G6KLE4-F1-model_v4 | Acyl carrier protein (ACP) | 1.009 | 6 | 77 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |