F496404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2107 | 721 | 4212 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10322485|Ga0111539_103224852 |
| Length | 348 |
| Sequence | MFELLEIPPQALFGQLLLGLINGSFYAILSLGLAVIFGLLNIINFTHGAQYMMGAFVAWMLLNWLGLGYWWAFILSPVIVGIVGVVLERNLIAQLASTDKVRSLLFLVASLVVFIVSYGVFNWSMALSLFLALAIAGGLGAAWAHLARDRIGVVEGHVDHLYGLLLTFGLALIIQGLFRNEYGSSGLPYQIPAQLTGGQNLGFMFLPNYRGWVVVASLVVCLATWFVIEKTRLGAYLRAATENATLTQAFGINVPRLVTGLAAFAGVLAAPIYSVNPTMGENLIIVVFAVVVIGGMGSILGAIVTGFGLGLIEGLTKVFYPEASNTVIFIIMAIVLLIKPAGLFGRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 101 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 102 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 103 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 109 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 118 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 126 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 134 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 140 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 141 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 142 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 155 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 177 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 178 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 179 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 269 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 276 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 280 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 281 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 282 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 283 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 284 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 285 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 289 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 290 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 291 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 292 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 295 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 296 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 297 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 298 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 299 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 300 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 301 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 302 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 303 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 304 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 305 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 306 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 307 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 309 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 310 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 312 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 314 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 315 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 318 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 319 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 320 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 321 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 324 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 325 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 326 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 327 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 328 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 329 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 330 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 331 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 334 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 335 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 336 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 337 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 338 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 339 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 340 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 341 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 342 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 343 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 344 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 345 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 346 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 347 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 348 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 349 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 351 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 352 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 353 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 354 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 355 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 356 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 357 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 358 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 359 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 360 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 361 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 362 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 363 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 364 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 365 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 366 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 367 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 368 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 369 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 370 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 371 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 372 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 373 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 374 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 375 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 376 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 377 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 467 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 468 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 469 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 470 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 471 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 472 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 475 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 476 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 477 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 478 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 479 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 480 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 481 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 482 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 483 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 484 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 485 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 486 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 487 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 488 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 489 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 518 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 523 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 527 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 528 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 529 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 530 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 531 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 532 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 533 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 534 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 544 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 547 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 550 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 551 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 552 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 553 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 554 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 555 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 556 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 557 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 558 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 559 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 560 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 561 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 562 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 564 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 565 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 566 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 567 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 568 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 569 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 570 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 571 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 572 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 573 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 574 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 575 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 576 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 577 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 578 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 579 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 580 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 581 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 582 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 583 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 584 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 585 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 586 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 588 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 589 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 591 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 592 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 593 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 594 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 595 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 596 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 597 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 598 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 599 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 600 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 601 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 602 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 603 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 604 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 605 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 606 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 607 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 608 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 609 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 610 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 611 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 612 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 613 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 614 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 615 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 616 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 617 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 618 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 619 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 620 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 621 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 622 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 623 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 624 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 625 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 626 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 627 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 628 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 629 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 630 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 631 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 632 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 633 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 634 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 635 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 636 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 637 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 638 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 639 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 640 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 641 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 642 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 643 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 644 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 645 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 646 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 647 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 648 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 649 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 650 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 651 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 652 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 653 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 654 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 655 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 656 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 657 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 658 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 659 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 660 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 661 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 662 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 663 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 664 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 665 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 666 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 667 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 668 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 669 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 670 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 671 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 672 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 673 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 674 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 675 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 676 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 677 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 678 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 679 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 680 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 681 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 682 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 683 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 684 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 685 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 686 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 687 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 688 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 689 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 690 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 691 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 692 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 693 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 694 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 695 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 696 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 697 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 698 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 699 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 700 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 701 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 702 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 703 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 704 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 705 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 706 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 707 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 708 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 709 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 710 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 711 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 712 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 713 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 714 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 715 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 716 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 717 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 718 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 719 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 720 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 721 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.79 |
| Metatranscriptomes | 0.09 |
| Isolates | 7.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.68 |
| Nodule | 1.04 |
| Rhizoplane | 3.75 |
| Rhizosphere | 76.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0111539_10322485 | 3300009094 | Bacteria | 1798 |
| 2 | JGI24752J21851_1002365 | 3300001976 | Bacteria | 2508 |
| 3 | JGI24746J21847_1003310 | 3300001977 | Bacteria | 2534 |
| 4 | JGI24740J21852_10003776 | 3300001979 | Bacteria | 6599 |
| 5 | JGI24743J22301_10003473 | 3300001991 | Bacteria | 2498 |
| 6 | JGI24750J21931_1000181 | 3300002070 | Bacteria | 10568 |
| 7 | JGI24745J21846_1000318 | 3300002073 | Bacteria | 4145 |
| 8 | JGI24748J21848_1000571 | 3300002074 | Bacteria | 3977 |
| 9 | JGI24748J21848_1001710 | 3300002074 | Bacteria | 2435 |
| 10 | JGI24738J21930_10001393 | 3300002075 | Bacteria | 6712 |
| 11 | JGI24034J26672_10004122 | 3300002239 | Bacteria | 2049 |
| 12 | JGI25150J39212_1002294 | 3300002774 | Bacteria | 4834 |
| 13 | JGI25159J45721_1001628 | 3300002987 | Bacteria | 9133 |
| 14 | JGI25159J45721_1010099 | 3300002987 | Bacteria | 2435 |
| 15 | JGI25159J45721_1014733 | 3300002987 | Bacteria | 1747 |
| 16 | JGI25151J46595_10001132 | 3300003187 | Bacteria | 19370 |
| 17 | JGI25151J46595_10011005 | 3300003187 | Bacteria | 4178 |
| 18 | JGI25151J46595_10023031 | 3300003187 | Bacteria | 2575 |
| 19 | JGI25151J46595_10027382 | 3300003187 | Bacteria | 2286 |
| 20 | JGI25151J46595_10034292 | 3300003187 | Bacteria | 1943 |
| 21 | JGI25151J46595_10034941 | 3300003187 | Bacteria | 1915 |
| 22 | JGI25151J46595_10040727 | 3300003187 | Bacteria | 1698 |
| 23 | JGI25406J46586_10005366 | 3300003203 | Bacteria | 5949 |
| 24 | JGI26129J50193_1001475 | 3300003349 | Bacteria | 1599 |
| 25 | JGI25160J50197_1000319 | 3300003354 | Bacteria | 33363 |
| 26 | JGI25160J50197_1010760 | 3300003354 | Bacteria | 3287 |
| 27 | JGI25161J50226_1000092 | 3300003374 | Bacteria | 72932 |
| 28 | Ga0006562J51391_1013826 | 3300003578 | Bacteria | 5886 |
| 29 | Ga0006562J51391_1033002 | 3300003578 | Bacteria | 4745 |
| 30 | JGI25404J52841_10007519 | 3300003659 | Bacteria | 2306 |
| 31 | Ga0055532_1004429 | 3300003758 | Bacteria | 2124 |
| 32 | Ga0055525_1000036 | 3300003759 | Bacteria | 298878 |
| 33 | Ga0055526_1018980 | 3300003771 | Bacteria | 2529 |
| 34 | Ga0055537_1000104 | 3300003773 | Bacteria | 63394 |
| 35 | Ga0055537_1000780 | 3300003773 | Bacteria | 16027 |
| 36 | Ga0055537_1004214 | 3300003773 | Bacteria | 4166 |
| 37 | Ga0055537_1011246 | 3300003773 | Bacteria | 1830 |
| 38 | Ga0055524_1010401 | 3300003775 | Bacteria | 3707 |
| 39 | Ga0055524_1033844 | 3300003775 | Bacteria | 1423 |
| 40 | Ga0055536_1000430 | 3300003781 | Bacteria | 29951 |
| 41 | Ga0055536_1005578 | 3300003781 | Bacteria | 6105 |
| 42 | Ga0055536_1021898 | 3300003781 | Bacteria | 1923 |
| 43 | Ga0055536_1022508 | 3300003781 | Bacteria | 1879 |
| 44 | Ga0055534_1000042 | 3300003784 | Bacteria | 99433 |
| 45 | Ga0055534_1002677 | 3300003784 | Bacteria | 6022 |
| 46 | Ga0055534_1006261 | 3300003784 | Bacteria | 3029 |
| 47 | Ga0055534_1013054 | 3300003784 | Bacteria | 1611 |
| 48 | Ga0055528_1001367 | 3300003790 | Bacteria | 14998 |
| 49 | Ga0055528_1006579 | 3300003790 | Bacteria | 5258 |
| 50 | Ga0055530_10001578 | 3300003791 | Bacteria | 16321 |
| 51 | Ga0055530_10018244 | 3300003791 | Bacteria | 2171 |
| 52 | Ga0055540_1001235 | 3300003792 | Bacteria | 15714 |
| 53 | Ga0055540_1006428 | 3300003792 | Bacteria | 4670 |
| 54 | Ga0055540_1009999 | 3300003792 | Bacteria | 3199 |
| 55 | Ga0055540_1018294 | 3300003792 | Bacteria | 1923 |
| 56 | Ga0055531_10003091 | 3300003794 | Bacteria | 10752 |
| 57 | Ga0055531_10006139 | 3300003794 | Bacteria | 6877 |
| 58 | Ga0055543_1000207 | 3300004625 | Bacteria | 47618 |
| 59 | Ga0065165_1000132 | 3300005262 | Bacteria | 128732 |
| 60 | Ga0065165_1000409 | 3300005262 | Bacteria | 68773 |
| 61 | Ga0065714_10066083 | 3300005288 | Bacteria | 7644 |
| 62 | Ga0065712_10070978 | 3300005290 | Bacteria | 5563 |
| 63 | Ga0065712_10077719 | 3300005290 | Bacteria | 3442 |
| 64 | Ga0065712_10078399 | 3300005290 | Bacteria | 3350 |
| 65 | Ga0065712_10096189 | 3300005290 | Bacteria | 2192 |
| 66 | Ga0065712_10096243 | 3300005290 | Bacteria | 2190 |
| 67 | Ga0065715_10089022 | 3300005293 | Bacteria | 16633 |
| 68 | Ga0065715_10103856 | 3300005293 | Bacteria | 3003 |
| 69 | Ga0065715_10155662 | 3300005293 | Bacteria | 1675 |
| 70 | Ga0065707_10010755 | 3300005295 | Bacteria | 3314 |
| 71 | Ga0070658_10008174 | 3300005327 | Bacteria | 8410 |
| 72 | Ga0070676_10002898 | 3300005328 | Bacteria | 8857 |
| 73 | Ga0070676_10009564 | 3300005328 | Bacteria | 5236 |
| 74 | Ga0070676_10191182 | 3300005328 | Bacteria | 1337 |
| 75 | Ga0070683_100001166 | 3300005329 | Bacteria | 19905 |
| 76 | Ga0070683_100253033 | 3300005329 | Bacteria | 1675 |
| 77 | Ga0070683_100342098 | 3300005329 | Bacteria | 1424 |
| 78 | Ga0070683_100365580 | 3300005329 | Bacteria | 1374 |
| 79 | Ga0070690_100009650 | 3300005330 | Bacteria | 5597 |
| 80 | Ga0070690_100033483 | 3300005330 | Bacteria | 3217 |
| 81 | Ga0070690_100190929 | 3300005330 | Bacteria | 1420 |
| 82 | Ga0070670_100010109 | 3300005331 | Bacteria | 8049 |
| 83 | Ga0070670_100147377 | 3300005331 | Bacteria | 2037 |
| 84 | Ga0070677_10000126 | 3300005333 | Bacteria | 25482 |
| 85 | Ga0068869_100019670 | 3300005334 | Bacteria | 4619 |
| 86 | Ga0068869_100078992 | 3300005334 | Bacteria | 2451 |
| 87 | Ga0068869_100200685 | 3300005334 | Bacteria | 1573 |
| 88 | Ga0070666_10052952 | 3300005335 | Bacteria | 2736 |
| 89 | Ga0070666_10122253 | 3300005335 | Bacteria | 1806 |
| 90 | Ga0070666_10318119 | 3300005335 | Bacteria | 1110 |
| 91 | Ga0070680_100005116 | 3300005336 | Bacteria | 9901 |
| 92 | Ga0070680_100014771 | 3300005336 | Bacteria | 6108 |
| 93 | Ga0070680_100089145 | 3300005336 | Bacteria | 2552 |
| 94 | Ga0070680_100098840 | 3300005336 | Bacteria | 2421 |
| 95 | Ga0070680_100306506 | 3300005336 | Bacteria | 1347 |
| 96 | Ga0070682_100001533 | 3300005337 | Bacteria | 12954 |
| 97 | Ga0070682_100003724 | 3300005337 | Bacteria | 8473 |
| 98 | Ga0070682_100024957 | 3300005337 | Bacteria | 3564 |
| 99 | Ga0070682_100060172 | 3300005337 | Bacteria | 2402 |
| 100 | Ga0068868_100003027 | 3300005338 | Bacteria | 11693 |
| 101 | Ga0068868_100003608 | 3300005338 | Bacteria | 10786 |
| 102 | Ga0068868_100015802 | 3300005338 | Bacteria | 5592 |
| 103 | Ga0068868_100066200 | 3300005338 | Bacteria | 2872 |
| 104 | Ga0068868_100134926 | 3300005338 | Bacteria | 2022 |
| 105 | Ga0068868_100215626 | 3300005338 | Bacteria | 1606 |
| 106 | Ga0070660_100000724 | 3300005339 | Bacteria | 21893 |
| 107 | Ga0070660_100001299 | 3300005339 | Bacteria | 17019 |
| 108 | Ga0070660_100007902 | 3300005339 | Bacteria | 7422 |
| 109 | Ga0070660_100010060 | 3300005339 | Bacteria | 6672 |
| 110 | Ga0070660_100015241 | 3300005339 | Bacteria | 5545 |
| 111 | Ga0070660_100029404 | 3300005339 | Bacteria | 4118 |
| 112 | Ga0070689_100003384 | 3300005340 | Bacteria | 10600 |
| 113 | Ga0070689_100007839 | 3300005340 | Bacteria | 7485 |
| 114 | Ga0070689_100048821 | 3300005340 | Bacteria | 3265 |
| 115 | Ga0070689_100165687 | 3300005340 | Bacteria | 1788 |
| 116 | Ga0070691_10000994 | 3300005341 | Bacteria | 11602 |
| 117 | Ga0070691_10004892 | 3300005341 | Bacteria | 6095 |
| 118 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 119 | Ga0070661_100002142 | 3300005344 | Bacteria | 13609 |
| 120 | Ga0070661_100014785 | 3300005344 | Bacteria | 5503 |
| 121 | Ga0070661_100026535 | 3300005344 | Bacteria | 4167 |
| 122 | Ga0070661_100035802 | 3300005344 | Bacteria | 3607 |
| 123 | Ga0070661_100219006 | 3300005344 | Bacteria | 1459 |
| 124 | Ga0070692_10000667 | 3300005345 | Bacteria | 10947 |
| 125 | Ga0070692_10002518 | 3300005345 | Bacteria | 7129 |
| 126 | Ga0070692_10173526 | 3300005345 | Bacteria | 1244 |
| 127 | Ga0070668_100001248 | 3300005347 | Bacteria | 18134 |
| 128 | Ga0070668_100145165 | 3300005347 | Bacteria | 1915 |
| 129 | Ga0070668_100159247 | 3300005347 | Bacteria | 1831 |
| 130 | Ga0070669_100005868 | 3300005353 | Bacteria | 8857 |
| 131 | Ga0070669_100375172 | 3300005353 | Bacteria | 1159 |
| 132 | Ga0070675_100043655 | 3300005354 | Bacteria | 3664 |
| 133 | Ga0070675_100173938 | 3300005354 | Bacteria | 1858 |
| 134 | Ga0070675_100280270 | 3300005354 | Bacteria | 1464 |
| 135 | Ga0070675_100372452 | 3300005354 | Bacteria | 1270 |
| 136 | Ga0070671_100009899 | 3300005355 | Bacteria | 7656 |
| 137 | Ga0070671_100010916 | 3300005355 | Bacteria | 7295 |
| 138 | Ga0070671_100021222 | 3300005355 | Bacteria | 5304 |
| 139 | Ga0070671_100023164 | 3300005355 | Bacteria | 5078 |
| 140 | Ga0070671_100046579 | 3300005355 | Bacteria | 3606 |
| 141 | Ga0070671_100086682 | 3300005355 | Bacteria | 2620 |
| 142 | Ga0070671_100148145 | 3300005355 | Bacteria | 1982 |
| 143 | Ga0070674_100003469 | 3300005356 | Bacteria | 8857 |
| 144 | Ga0070674_100011243 | 3300005356 | Bacteria | 5442 |
| 145 | Ga0070674_100091663 | 3300005356 | Bacteria | 2195 |
| 146 | Ga0070674_100315442 | 3300005356 | Bacteria | 1251 |
| 147 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 148 | Ga0070673_100001292 | 3300005364 | Bacteria | 14589 |
| 149 | Ga0070673_100007749 | 3300005364 | Bacteria | 7107 |
| 150 | Ga0070673_100022913 | 3300005364 | Bacteria | 4556 |
| 151 | Ga0070688_100000558 | 3300005365 | Bacteria | 18862 |
| 152 | Ga0070688_100012465 | 3300005365 | Bacteria | 4765 |
| 153 | Ga0070688_100023196 | 3300005365 | Bacteria | 3647 |
| 154 | Ga0070688_100112186 | 3300005365 | Bacteria | 1815 |
| 155 | Ga0070659_100000151 | 3300005366 | Bacteria | 53009 |
| 156 | Ga0070659_100002581 | 3300005366 | Bacteria | 12874 |
| 157 | Ga0070659_100011661 | 3300005366 | Bacteria | 6504 |
| 158 | Ga0070659_100044233 | 3300005366 | Bacteria | 3485 |
| 159 | Ga0070659_100102998 | 3300005366 | Bacteria | 2298 |
| 160 | Ga0070659_100160817 | 3300005366 | Bacteria | 1836 |
| 161 | Ga0070667_100005640 | 3300005367 | Bacteria | 10453 |
| 162 | Ga0070667_100042441 | 3300005367 | Bacteria | 3816 |
| 163 | Ga0070667_100167734 | 3300005367 | Bacteria | 1937 |
| 164 | Ga0070703_10003226 | 3300005406 | Bacteria | 4654 |
| 165 | Ga0070703_10008573 | 3300005406 | Bacteria | 2875 |
| 166 | Ga0070703_10017152 | 3300005406 | Bacteria | 2085 |
| 167 | Ga0070709_10001678 | 3300005434 | Bacteria | 12027 |
| 168 | Ga0070709_10028390 | 3300005434 | Bacteria | 3336 |
| 169 | Ga0070709_10030542 | 3300005434 | Bacteria | 3234 |
| 170 | Ga0070709_10127041 | 3300005434 | Bacteria | 1736 |
| 171 | Ga0070714_100058681 | 3300005435 | Bacteria | 3298 |
| 172 | Ga0070714_100068956 | 3300005435 | Bacteria | 3053 |
| 173 | Ga0070714_100231952 | 3300005435 | Bacteria | 1701 |
| 174 | Ga0070714_100695228 | 3300005435 | Bacteria | 981 |
| 175 | Ga0070713_100004299 | 3300005436 | Bacteria | 9545 |
| 176 | Ga0070713_100013856 | 3300005436 | Bacteria | 5966 |
| 177 | Ga0070713_100018974 | 3300005436 | Bacteria | 5237 |
| 178 | Ga0070713_100060940 | 3300005436 | Bacteria | 3155 |
| 179 | Ga0070710_10010866 | 3300005437 | Bacteria | 4483 |
| 180 | Ga0070710_10013537 | 3300005437 | Bacteria | 4090 |
| 181 | Ga0070710_10031626 | 3300005437 | Bacteria | 2859 |
| 182 | Ga0070711_100006663 | 3300005439 | Bacteria | 6982 |
| 183 | Ga0070711_100033311 | 3300005439 | Bacteria | 3430 |
| 184 | Ga0070711_100062704 | 3300005439 | Bacteria | 2592 |
| 185 | Ga0070711_100088211 | 3300005439 | Bacteria | 2228 |
| 186 | Ga0070711_100120247 | 3300005439 | Bacteria | 1941 |
| 187 | Ga0070711_100127762 | 3300005439 | Bacteria | 1889 |
| 188 | Ga0070711_100131967 | 3300005439 | Bacteria | 1861 |
| 189 | Ga0070705_100000874 | 3300005440 | Bacteria | 16855 |
| 190 | Ga0070705_100031418 | 3300005440 | Bacteria | 2940 |
| 191 | Ga0070705_100083692 | 3300005440 | Bacteria | 1967 |
| 192 | Ga0070705_100106424 | 3300005440 | Bacteria | 1783 |
| 193 | Ga0070705_100222061 | 3300005440 | Bacteria | 1309 |
| 194 | Ga0070700_100002863 | 3300005441 | Bacteria | 8853 |
| 195 | Ga0070700_100032741 | 3300005441 | Bacteria | 3126 |
| 196 | Ga0070700_100293672 | 3300005441 | Bacteria | 1183 |
| 197 | Ga0070694_100000390 | 3300005444 | Bacteria | 23753 |
| 198 | Ga0070694_100000998 | 3300005444 | Bacteria | 16064 |
| 199 | Ga0070694_100001507 | 3300005444 | Bacteria | 13661 |
| 200 | Ga0070694_100032223 | 3300005444 | Bacteria | 3441 |
| 201 | Ga0070694_100201333 | 3300005444 | Bacteria | 1484 |
| 202 | Ga0070694_100279091 | 3300005444 | Bacteria | 1273 |
| 203 | Ga0070708_100000402 | 3300005445 | Bacteria | 32565 |
| 204 | Ga0070708_100052979 | 3300005445 | Bacteria | 3599 |
| 205 | Ga0070708_100104286 | 3300005445 | Bacteria | 2600 |
| 206 | Ga0070708_100117348 | 3300005445 | Bacteria | 2451 |
| 207 | Ga0070708_100744908 | 3300005445 | Bacteria | 921 |
| 208 | Ga0070663_100018923 | 3300005455 | Bacteria | 4527 |
| 209 | Ga0070663_100025011 | 3300005455 | Bacteria | 4027 |
| 210 | Ga0070678_100010262 | 3300005456 | Bacteria | 5713 |
| 211 | Ga0070678_100601541 | 3300005456 | Bacteria | 982 |
| 212 | Ga0070662_100001666 | 3300005457 | Bacteria | 13661 |
| 213 | Ga0070662_100002564 | 3300005457 | Bacteria | 11189 |
| 214 | Ga0070662_100010579 | 3300005457 | Bacteria | 6063 |
| 215 | Ga0070662_100037200 | 3300005457 | Bacteria | 3450 |
| 216 | Ga0070662_100053117 | 3300005457 | Bacteria | 2932 |
| 217 | Ga0070662_100194336 | 3300005457 | Bacteria | 1607 |
| 218 | Ga0070681_10006870 | 3300005458 | Bacteria | 11073 |
| 219 | Ga0070681_10007824 | 3300005458 | Bacteria | 10454 |
| 220 | Ga0070681_10009162 | 3300005458 | Bacteria | 9725 |
| 221 | Ga0070681_10012069 | 3300005458 | Bacteria | 8567 |
| 222 | Ga0070681_10017661 | 3300005458 | Bacteria | 7129 |
| 223 | Ga0070681_10023442 | 3300005458 | Bacteria | 6206 |
| 224 | Ga0070681_10026806 | 3300005458 | Bacteria | 5793 |
| 225 | Ga0070681_10038004 | 3300005458 | Bacteria | 4827 |
| 226 | Ga0070681_10085486 | 3300005458 | Bacteria | 3106 |
| 227 | Ga0070681_10105363 | 3300005458 | Bacteria | 2762 |
| 228 | Ga0068867_100004614 | 3300005459 | Bacteria | 9695 |
| 229 | Ga0068867_100005662 | 3300005459 | Bacteria | 8853 |
| 230 | Ga0068867_100128668 | 3300005459 | Bacteria | 1965 |
| 231 | Ga0070685_10006948 | 3300005466 | Bacteria | 5775 |
| 232 | Ga0070685_10056750 | 3300005466 | Bacteria | 2277 |
| 233 | Ga0070685_10060826 | 3300005466 | Bacteria | 2210 |
| 234 | Ga0070706_100000099 | 3300005467 | Bacteria | 105782 |
| 235 | Ga0070706_100000367 | 3300005467 | Bacteria | 54314 |
| 236 | Ga0070706_100008099 | 3300005467 | Bacteria | 9801 |
| 237 | Ga0070706_100012270 | 3300005467 | Bacteria | 7940 |
| 238 | Ga0070706_100026434 | 3300005467 | Bacteria | 5340 |
| 239 | Ga0070706_100037537 | 3300005467 | Bacteria | 4475 |
| 240 | Ga0070706_100133062 | 3300005467 | Bacteria | 2321 |
| 241 | Ga0070706_100157311 | 3300005467 | Bacteria | 2121 |
| 242 | Ga0070707_100001543 | 3300005468 | Bacteria | 22396 |
| 243 | Ga0070707_100002214 | 3300005468 | Bacteria | 18546 |
| 244 | Ga0070707_100004554 | 3300005468 | Bacteria | 12984 |
| 245 | Ga0070707_100005782 | 3300005468 | Bacteria | 11537 |
| 246 | Ga0070707_100005986 | 3300005468 | Bacteria | 11345 |
| 247 | Ga0070707_100042488 | 3300005468 | Bacteria | 4352 |
| 248 | Ga0070707_100048743 | 3300005468 | Bacteria | 4058 |
| 249 | Ga0070707_100196986 | 3300005468 | Bacteria | 1964 |
| 250 | Ga0070698_100004215 | 3300005471 | Bacteria | 15801 |
| 251 | Ga0070698_100011760 | 3300005471 | Bacteria | 9285 |
| 252 | Ga0070698_100025889 | 3300005471 | Bacteria | 6112 |
| 253 | Ga0070698_100106065 | 3300005471 | Bacteria | 2779 |
| 254 | Ga0070698_100109546 | 3300005471 | Bacteria | 2728 |
| 255 | Ga0070698_100129567 | 3300005471 | Bacteria | 2479 |
| 256 | Ga0070698_100445469 | 3300005471 | Bacteria | 1230 |
| 257 | Ga0070699_100000945 | 3300005518 | Bacteria | 27089 |
| 258 | Ga0070699_100025311 | 3300005518 | Bacteria | 5118 |
| 259 | Ga0070699_100030144 | 3300005518 | Bacteria | 4681 |
| 260 | Ga0070699_100074275 | 3300005518 | Bacteria | 2958 |
| 261 | Ga0070699_100198039 | 3300005518 | Bacteria | 1786 |
| 262 | Ga0070699_100538096 | 3300005518 | Bacteria | 1063 |
| 263 | Ga0070679_100007489 | 3300005530 | Bacteria | 10209 |
| 264 | Ga0070679_100028360 | 3300005530 | Bacteria | 5519 |
| 265 | Ga0070679_100029489 | 3300005530 | Bacteria | 5414 |
| 266 | Ga0070679_100033784 | 3300005530 | Bacteria | 5065 |
| 267 | Ga0070679_100042170 | 3300005530 | Bacteria | 4544 |
| 268 | Ga0070679_100044073 | 3300005530 | Bacteria | 4444 |
| 269 | Ga0070679_100060853 | 3300005530 | Bacteria | 3764 |
| 270 | Ga0070679_100071614 | 3300005530 | Bacteria | 3457 |
| 271 | Ga0070679_100081922 | 3300005530 | Bacteria | 3217 |
| 272 | Ga0070679_100115247 | 3300005530 | Bacteria | 2673 |
| 273 | Ga0070684_100000894 | 3300005535 | Bacteria | 21105 |
| 274 | Ga0070684_100054573 | 3300005535 | Bacteria | 3481 |
| 275 | Ga0070684_100071707 | 3300005535 | Bacteria | 3048 |
| 276 | Ga0070684_100147943 | 3300005535 | Bacteria | 2127 |
| 277 | Ga0070697_100000582 | 3300005536 | Bacteria | 27575 |
| 278 | Ga0070697_100018950 | 3300005536 | Bacteria | 5429 |
| 279 | Ga0070697_100044697 | 3300005536 | Bacteria | 3588 |
| 280 | Ga0070697_100054382 | 3300005536 | Bacteria | 3254 |
| 281 | Ga0070697_100170879 | 3300005536 | Bacteria | 1840 |
| 282 | Ga0070697_100240935 | 3300005536 | Bacteria | 1544 |
| 283 | Ga0068853_100000770 | 3300005539 | Bacteria | 22242 |
| 284 | Ga0068853_100010158 | 3300005539 | Bacteria | 7605 |
| 285 | Ga0068853_100081728 | 3300005539 | Bacteria | 2829 |
| 286 | Ga0070672_100008661 | 3300005543 | Bacteria | 6974 |
| 287 | Ga0070672_100079516 | 3300005543 | Bacteria | 2625 |
| 288 | Ga0070672_100145320 | 3300005543 | Bacteria | 1959 |
| 289 | Ga0070686_100035163 | 3300005544 | Bacteria | 3093 |
| 290 | Ga0070695_100000741 | 3300005545 | Bacteria | 17438 |
| 291 | Ga0070695_100026614 | 3300005545 | Bacteria | 3580 |
| 292 | Ga0070695_100479347 | 3300005545 | Bacteria | 958 |
| 293 | Ga0070696_100003955 | 3300005546 | Bacteria | 9892 |
| 294 | Ga0070696_100005009 | 3300005546 | Bacteria | 8853 |
| 295 | Ga0070696_100006635 | 3300005546 | Bacteria | 7732 |
| 296 | Ga0070693_100000418 | 3300005547 | Bacteria | 19261 |
| 297 | Ga0070693_100001405 | 3300005547 | Bacteria | 10851 |
| 298 | Ga0070693_100411193 | 3300005547 | Bacteria | 940 |
| 299 | Ga0070665_100030194 | 3300005548 | Bacteria | 5455 |
| 300 | Ga0070665_100059697 | 3300005548 | Bacteria | 3823 |
| 301 | Ga0070665_100066956 | 3300005548 | Bacteria | 3602 |
| 302 | Ga0070665_100076797 | 3300005548 | Bacteria | 3347 |
| 303 | Ga0070665_100129403 | 3300005548 | Bacteria | 2526 |
| 304 | Ga0070704_100000428 | 3300005549 | Bacteria | 19609 |
| 305 | Ga0070704_100000772 | 3300005549 | Bacteria | 15796 |
| 306 | Ga0070704_100006965 | 3300005549 | Bacteria | 6706 |
| 307 | Ga0070704_100088006 | 3300005549 | Bacteria | 2307 |
| 308 | Ga0070704_100137037 | 3300005549 | Bacteria | 1905 |
| 309 | Ga0070704_100353715 | 3300005549 | Bacteria | 1241 |
| 310 | Ga0068855_100001154 | 3300005563 | Bacteria | 32715 |
| 311 | Ga0068855_100007545 | 3300005563 | Bacteria | 13158 |
| 312 | Ga0068855_100012186 | 3300005563 | Bacteria | 10389 |
| 313 | Ga0068855_100053556 | 3300005563 | Bacteria | 4747 |
| 314 | Ga0068855_100116783 | 3300005563 | Bacteria | 3058 |
| 315 | Ga0070664_100002406 | 3300005564 | Bacteria | 15035 |
| 316 | Ga0070664_100003967 | 3300005564 | Bacteria | 11906 |
| 317 | Ga0070664_100008025 | 3300005564 | Bacteria | 8528 |
| 318 | Ga0070664_100085392 | 3300005564 | Bacteria | 2726 |
| 319 | Ga0070664_100363973 | 3300005564 | Bacteria | 1317 |
| 320 | Ga0070664_100392677 | 3300005564 | Bacteria | 1268 |
| 321 | Ga0068857_100016930 | 3300005577 | Bacteria | 6386 |
| 322 | Ga0068857_100022565 | 3300005577 | Bacteria | 5535 |
| 323 | Ga0068854_100014300 | 3300005578 | Bacteria | 5230 |
| 324 | Ga0068854_100023974 | 3300005578 | Bacteria | 4172 |
| 325 | Ga0068854_100104826 | 3300005578 | Bacteria | 2125 |
| 326 | Ga0068854_100180757 | 3300005578 | Bacteria | 1647 |
| 327 | Ga0068856_100001185 | 3300005614 | Bacteria | 27475 |
| 328 | Ga0068856_100003112 | 3300005614 | Bacteria | 16941 |
| 329 | Ga0068856_100009875 | 3300005614 | Bacteria | 9268 |
| 330 | Ga0068856_100021406 | 3300005614 | Bacteria | 6286 |
| 331 | Ga0068856_100034152 | 3300005614 | Bacteria | 4982 |
| 332 | Ga0068856_100044461 | 3300005614 | Bacteria | 4372 |
| 333 | Ga0068856_100086371 | 3300005614 | Bacteria | 3117 |
| 334 | Ga0068856_100212109 | 3300005614 | Bacteria | 1952 |
| 335 | Ga0068856_100387666 | 3300005614 | Bacteria | 1417 |
| 336 | Ga0068856_100424473 | 3300005614 | Bacteria | 1350 |
| 337 | Ga0070702_100011295 | 3300005615 | Bacteria | 4437 |
| 338 | Ga0070702_100064532 | 3300005615 | Bacteria | 2142 |
| 339 | Ga0070702_100075856 | 3300005615 | Bacteria | 1999 |
| 340 | Ga0068852_100002115 | 3300005616 | Bacteria | 13595 |
| 341 | Ga0068852_100004876 | 3300005616 | Bacteria | 9529 |
| 342 | Ga0068852_100021891 | 3300005616 | Bacteria | 5115 |
| 343 | Ga0068852_100225271 | 3300005616 | Bacteria | 1785 |
| 344 | Ga0068852_100547946 | 3300005616 | Bacteria | 1157 |
| 345 | Ga0068859_100006242 | 3300005617 | Bacteria | 12100 |
| 346 | Ga0068859_100011156 | 3300005617 | Bacteria | 9035 |
| 347 | Ga0068859_100019359 | 3300005617 | Bacteria | 6839 |
| 348 | Ga0068859_100084462 | 3300005617 | Bacteria | 3220 |
| 349 | Ga0068859_100173819 | 3300005617 | Bacteria | 2236 |
| 350 | Ga0068864_100001224 | 3300005618 | Bacteria | 21327 |
| 351 | Ga0068864_100098615 | 3300005618 | Bacteria | 2588 |
| 352 | Ga0068864_100176349 | 3300005618 | Bacteria | 1952 |
| 353 | Ga0068866_10000301 | 3300005718 | Bacteria | 23583 |
| 354 | Ga0068866_10000527 | 3300005718 | Bacteria | 17621 |
| 355 | Ga0068866_10006508 | 3300005718 | Bacteria | 4868 |
| 356 | Ga0068861_100049597 | 3300005719 | Bacteria | 3179 |
| 357 | Ga0068861_100057538 | 3300005719 | Bacteria | 2970 |
| 358 | Ga0068861_100344061 | 3300005719 | Bacteria | 1306 |
| 359 | Ga0068851_10001590 | 3300005834 | Bacteria | 9966 |
| 360 | Ga0068851_10011381 | 3300005834 | Bacteria | 4170 |
| 361 | Ga0068851_10084263 | 3300005834 | Bacteria | 1664 |
| 362 | Ga0068870_10000280 | 3300005840 | Bacteria | 18887 |
| 363 | Ga0068870_10000354 | 3300005840 | Bacteria | 17200 |
| 364 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 365 | Ga0068863_100019545 | 3300005841 | Bacteria | 6478 |
| 366 | Ga0068863_100220895 | 3300005841 | Bacteria | 1826 |
| 367 | Ga0068863_100538014 | 3300005841 | Bacteria | 1153 |
| 368 | Ga0068858_100004859 | 3300005842 | Bacteria | 13181 |
| 369 | Ga0068858_100009915 | 3300005842 | Bacteria | 9049 |
| 370 | Ga0068858_100020715 | 3300005842 | Bacteria | 6143 |
| 371 | Ga0068858_100089416 | 3300005842 | Bacteria | 2866 |
| 372 | Ga0068858_100631469 | 3300005842 | Bacteria | 1040 |
| 373 | Ga0068860_100013035 | 3300005843 | Bacteria | 8161 |
| 374 | Ga0068860_100031227 | 3300005843 | Bacteria | 5121 |
| 375 | Ga0068860_100242756 | 3300005843 | Bacteria | 1752 |
| 376 | Ga0068862_100015630 | 3300005844 | Bacteria | 6304 |
| 377 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 378 | Ga0081455_10114013 | 3300005937 | Bacteria | 2142 |
| 379 | Ga0081538_10013234 | 3300005981 | Bacteria | 6546 |
| 380 | Ga0081538_10047803 | 3300005981 | Bacteria | 2619 |
| 381 | Ga0081538_10066749 | 3300005981 | Bacteria | 2014 |
| 382 | Ga0081540_1000283 | 3300005983 | Bacteria | 52870 |
| 383 | Ga0081540_1024058 | 3300005983 | Bacteria | 3543 |
| 384 | Ga0081540_1031565 | 3300005983 | Bacteria | 2910 |
| 385 | Ga0081539_10000009 | 3300005985 | Bacteria | 509286 |
| 386 | Ga0070717_10001010 | 3300006028 | Bacteria | 18846 |
| 387 | Ga0070717_10065674 | 3300006028 | Bacteria | 3016 |
| 388 | Ga0070717_10098072 | 3300006028 | Bacteria | 2484 |
| 389 | Ga0070717_10132896 | 3300006028 | Bacteria | 2141 |
| 390 | Ga0070717_10154069 | 3300006028 | Bacteria | 1990 |
| 391 | Ga0075365_10000088 | 3300006038 | Bacteria | 26738 |
| 392 | Ga0075365_10008838 | 3300006038 | Bacteria | 5747 |
| 393 | Ga0075365_10029017 | 3300006038 | Bacteria | 3531 |
| 394 | Ga0075365_10035993 | 3300006038 | Bacteria | 3206 |
| 395 | Ga0075368_10000101 | 3300006042 | Bacteria | 21910 |
| 396 | Ga0075363_100000128 | 3300006048 | Bacteria | 18164 |
| 397 | Ga0075363_100016970 | 3300006048 | Bacteria | 3604 |
| 398 | Ga0075363_100058287 | 3300006048 | Bacteria | 2074 |
| 399 | Ga0075364_10000004 | 3300006051 | Bacteria | 110554 |
| 400 | Ga0075364_10002167 | 3300006051 | Bacteria | 11001 |
| 401 | Ga0075364_10008524 | 3300006051 | Bacteria | 6133 |
| 402 | Ga0075364_10021617 | 3300006051 | Bacteria | 4055 |
| 403 | Ga0075432_10036358 | 3300006058 | Bacteria | 1712 |
| 404 | Ga0070716_100017441 | 3300006173 | Bacteria | 3722 |
| 405 | Ga0070716_100024257 | 3300006173 | Bacteria | 3227 |
| 406 | Ga0070712_100005678 | 3300006175 | Bacteria | 7715 |
| 407 | Ga0070712_100073676 | 3300006175 | Bacteria | 2450 |
| 408 | Ga0070712_100299661 | 3300006175 | Bacteria | 1301 |
| 409 | Ga0075362_10000009 | 3300006177 | Bacteria | 111748 |
| 410 | Ga0075362_10015262 | 3300006177 | Bacteria | 3120 |
| 411 | Ga0075362_10034931 | 3300006177 | Bacteria | 2193 |
| 412 | Ga0075367_10000018 | 3300006178 | Bacteria | 34198 |
| 413 | Ga0075367_10012900 | 3300006178 | Bacteria | 4476 |
| 414 | Ga0075367_10031905 | 3300006178 | Bacteria | 3027 |
| 415 | Ga0075369_10000011 | 3300006186 | Bacteria | 76681 |
| 416 | Ga0075369_10008188 | 3300006186 | Bacteria | 4013 |
| 417 | Ga0075366_10000085 | 3300006195 | Bacteria | 36576 |
| 418 | Ga0075366_10066754 | 3300006195 | Bacteria | 2140 |
| 419 | Ga0075366_10125502 | 3300006195 | Bacteria | 1548 |
| 420 | Ga0097621_100023624 | 3300006237 | Bacteria | 4788 |
| 421 | Ga0097621_100061761 | 3300006237 | Bacteria | 3074 |
| 422 | Ga0097621_100104722 | 3300006237 | Bacteria | 2384 |
| 423 | Ga0097621_100287147 | 3300006237 | Bacteria | 1449 |
| 424 | Ga0075370_10000120 | 3300006353 | Bacteria | 25762 |
| 425 | Ga0075370_10005461 | 3300006353 | Bacteria | 6323 |
| 426 | Ga0075370_10048586 | 3300006353 | Bacteria | 2404 |
| 427 | Ga0075370_10091980 | 3300006353 | Bacteria | 1750 |
| 428 | Ga0075370_10127830 | 3300006353 | Bacteria | 1482 |
| 429 | Ga0068871_100000301 | 3300006358 | Bacteria | 34368 |
| 430 | Ga0068871_100009125 | 3300006358 | Bacteria | 7167 |
| 431 | Ga0068871_100060760 | 3300006358 | Bacteria | 3083 |
| 432 | Ga0068871_100065274 | 3300006358 | Bacteria | 2981 |
| 433 | Ga0068871_100108380 | 3300006358 | Bacteria | 2334 |
| 434 | Ga0068871_100160284 | 3300006358 | Bacteria | 1924 |
| 435 | Ga0075428_100000643 | 3300006844 | Bacteria | 35894 |
| 436 | Ga0075428_100010432 | 3300006844 | Bacteria | 10318 |
| 437 | Ga0075428_100015421 | 3300006844 | Bacteria | 8470 |
| 438 | Ga0075428_100297474 | 3300006844 | Bacteria | 1736 |
| 439 | Ga0075430_100000052 | 3300006846 | Bacteria | 60703 |
| 440 | Ga0075430_100010397 | 3300006846 | Bacteria | 7881 |
| 441 | Ga0075430_100128790 | 3300006846 | Bacteria | 2110 |
| 442 | Ga0075430_100152287 | 3300006846 | Bacteria | 1926 |
| 443 | Ga0075430_100194390 | 3300006846 | Bacteria | 1686 |
| 444 | Ga0075430_100231916 | 3300006846 | Bacteria | 1530 |
| 445 | Ga0075430_100262916 | 3300006846 | Bacteria | 1429 |
| 446 | Ga0075431_100000441 | 3300006847 | Bacteria | 33990 |
| 447 | Ga0075431_100000689 | 3300006847 | Bacteria | 29038 |
| 448 | Ga0075431_100000802 | 3300006847 | Bacteria | 27440 |
| 449 | Ga0075431_100012575 | 3300006847 | Bacteria | 8542 |
| 450 | Ga0075431_100025533 | 3300006847 | Bacteria | 6057 |
| 451 | Ga0075431_100031754 | 3300006847 | Bacteria | 5440 |
| 452 | Ga0075431_100053455 | 3300006847 | Bacteria | 4164 |
| 453 | Ga0075431_100214516 | 3300006847 | Bacteria | 1965 |
| 454 | Ga0075431_100408396 | 3300006847 | Bacteria | 1358 |
| 455 | Ga0075433_10000276 | 3300006852 | Bacteria | 30320 |
| 456 | Ga0075433_10004677 | 3300006852 | Bacteria | 10670 |
| 457 | Ga0075433_10005682 | 3300006852 | Bacteria | 9802 |
| 458 | Ga0075433_10009124 | 3300006852 | Bacteria | 7919 |
| 459 | Ga0075433_10014960 | 3300006852 | Bacteria | 6352 |
| 460 | Ga0075433_10084163 | 3300006852 | Bacteria | 2807 |
| 461 | Ga0075433_10106133 | 3300006852 | Bacteria | 2489 |
| 462 | Ga0075433_10162345 | 3300006852 | Bacteria | 1989 |
| 463 | Ga0075434_100000597 | 3300006871 | Bacteria | 27906 |
| 464 | Ga0075434_100001420 | 3300006871 | Bacteria | 20108 |
| 465 | Ga0075434_100008472 | 3300006871 | Bacteria | 9565 |
| 466 | Ga0075434_100017859 | 3300006871 | Bacteria | 6843 |
| 467 | Ga0075434_100033864 | 3300006871 | Bacteria | 5043 |
| 468 | Ga0075434_100044791 | 3300006871 | Bacteria | 4388 |
| 469 | Ga0075434_100075504 | 3300006871 | Bacteria | 3364 |
| 470 | Ga0075434_100142880 | 3300006871 | Bacteria | 2413 |
| 471 | Ga0075434_100146816 | 3300006871 | Bacteria | 2379 |
| 472 | Ga0075429_100000001 | 3300006880 | Bacteria | 139031 |
| 473 | Ga0075429_100058076 | 3300006880 | Bacteria | 3369 |
| 474 | Ga0068865_100037927 | 3300006881 | Bacteria | 3258 |
| 475 | Ga0075436_100004744 | 3300006914 | Bacteria | 9328 |
| 476 | Ga0075436_100007341 | 3300006914 | Bacteria | 7532 |
| 477 | Ga0075436_100024561 | 3300006914 | Bacteria | 4142 |
| 478 | Ga0075436_100039347 | 3300006914 | Bacteria | 3264 |
| 479 | Ga0075436_100069505 | 3300006914 | Bacteria | 2433 |
| 480 | Ga0097620_100006242 | 3300006931 | Bacteria | 12100 |
| 481 | Ga0097620_100011157 | 3300006931 | Bacteria | 9035 |
| 482 | Ga0097620_100084465 | 3300006931 | Bacteria | 3220 |
| 483 | Ga0097620_100173817 | 3300006931 | Bacteria | 2236 |
| 484 | Ga0099826_10000113 | 3300006948 | Bacteria | 36930 |
| 485 | Ga0099826_10001604 | 3300006948 | Bacteria | 13793 |
| 486 | Ga0099826_10141128 | 3300006948 | Bacteria | 1391 |
| 487 | Ga0075435_100000328 | 3300007076 | Bacteria | 29254 |
| 488 | Ga0075435_100012560 | 3300007076 | Bacteria | 6274 |
| 489 | Ga0075435_100112587 | 3300007076 | Bacteria | 2264 |
| 490 | Ga0075435_100203262 | 3300007076 | Bacteria | 1679 |
| 491 | Ga0075435_100248681 | 3300007076 | Bacteria | 1513 |
| 492 | Ga0099794_10018817 | 3300007265 | Bacteria | 3102 |
| 493 | Ga0099794_10086255 | 3300007265 | Bacteria | 1554 |
| 494 | Ga0105244_10001556 | 3300009036 | Bacteria | 18234 |
| 495 | Ga0105244_10094140 | 3300009036 | Bacteria | 1471 |
| 496 | Ga0105240_10070766 | 3300009093 | Bacteria | 4314 |
| 497 | Ga0105240_10221940 | 3300009093 | Bacteria | 2201 |
| 498 | Ga0105240_10237545 | 3300009093 | Bacteria | 2114 |
| 499 | Ga0105240_10583978 | 3300009093 | Bacteria | 1232 |
| 500 | Ga0105240_10796390 | 3300009093 | Bacteria | 1024 |
| 501 | Ga0111539_10013178 | 3300009094 | Bacteria | 10337 |
| 502 | Ga0111539_10013469 | 3300009094 | Bacteria | 10221 |
| 503 | Ga0111539_10074229 | 3300009094 | Bacteria | 4008 |
| 504 | Ga0111539_10103845 | 3300009094 | Bacteria | 3335 |
| 505 | Ga0111539_10198119 | 3300009094 | Bacteria | 2343 |
| 506 | Ga0111539_10323377 | 3300009094 | Bacteria | 1795 |
| 507 | Ga0111539_10345404 | 3300009094 | Bacteria | 1732 |
| 508 | Ga0111539_10348986 | 3300009094 | Bacteria | 1722 |
| 509 | Ga0105245_10009808 | 3300009098 | Bacteria | 8344 |
| 510 | Ga0105245_10009817 | 3300009098 | Bacteria | 8341 |
| 511 | Ga0105245_10010701 | 3300009098 | Bacteria | 7981 |
| 512 | Ga0105245_10018932 | 3300009098 | Bacteria | 6026 |
| 513 | Ga0105245_10028859 | 3300009098 | Bacteria | 4897 |
| 514 | Ga0105245_10056957 | 3300009098 | Bacteria | 3514 |
| 515 | Ga0105245_10123740 | 3300009098 | Bacteria | 2418 |
| 516 | Ga0105245_10498456 | 3300009098 | Bacteria | 1234 |
| 517 | Ga0105247_10018307 | 3300009101 | Bacteria | 4203 |
| 518 | Ga0105247_10020638 | 3300009101 | Bacteria | 3961 |
| 519 | Ga0105247_10035792 | 3300009101 | Bacteria | 3027 |
| 520 | Ga0114129_10002725 | 3300009147 | Bacteria | 24625 |
| 521 | Ga0114129_10002794 | 3300009147 | Bacteria | 24351 |
| 522 | Ga0114129_10007546 | 3300009147 | Bacteria | 15485 |
| 523 | Ga0114129_10013314 | 3300009147 | Bacteria | 11724 |
| 524 | Ga0114129_10028184 | 3300009147 | Bacteria | 7957 |
| 525 | Ga0114129_10040610 | 3300009147 | Bacteria | 6558 |
| 526 | Ga0114129_10050894 | 3300009147 | Bacteria | 5817 |
| 527 | Ga0114129_10064301 | 3300009147 | Bacteria | 5119 |
| 528 | Ga0114129_10253007 | 3300009147 | Bacteria | 2364 |
| 529 | Ga0114129_10736463 | 3300009147 | Bacteria | 1263 |
| 530 | Ga0105243_10000362 | 3300009148 | Bacteria | 48567 |
| 531 | Ga0105243_10004388 | 3300009148 | Bacteria | 11162 |
| 532 | Ga0105243_10005539 | 3300009148 | Bacteria | 9837 |
| 533 | Ga0105243_10038463 | 3300009148 | Bacteria | 3725 |
| 534 | Ga0105243_10044624 | 3300009148 | Bacteria | 3479 |
| 535 | Ga0105241_10001943 | 3300009174 | Bacteria | 15638 |
| 536 | Ga0105241_10008605 | 3300009174 | Bacteria | 7500 |
| 537 | Ga0105241_10034109 | 3300009174 | Bacteria | 3823 |
| 538 | Ga0105241_10095574 | 3300009174 | Bacteria | 2352 |
| 539 | Ga0105241_10115813 | 3300009174 | Bacteria | 2152 |
| 540 | Ga0105241_10678090 | 3300009174 | Bacteria | 939 |
| 541 | Ga0105242_10004469 | 3300009176 | Bacteria | 10872 |
| 542 | Ga0105242_10007706 | 3300009176 | Bacteria | 8285 |
| 543 | Ga0105242_10013489 | 3300009176 | Bacteria | 6318 |
| 544 | Ga0105242_10029471 | 3300009176 | Bacteria | 4378 |
| 545 | Ga0105242_10352227 | 3300009176 | Bacteria | 1360 |
| 546 | Ga0105242_10369484 | 3300009176 | Bacteria | 1330 |
| 547 | Ga0105248_10003102 | 3300009177 | Bacteria | 18407 |
| 548 | Ga0105248_10043504 | 3300009177 | Bacteria | 5035 |
| 549 | Ga0105248_10153536 | 3300009177 | Bacteria | 2598 |
| 550 | Ga0105248_10184723 | 3300009177 | Bacteria | 2349 |
| 551 | Ga0105248_10229395 | 3300009177 | Bacteria | 2090 |
| 552 | Ga0105248_10526994 | 3300009177 | Bacteria | 1332 |
| 553 | Ga0105237_10082797 | 3300009545 | Bacteria | 3200 |
| 554 | Ga0105237_10130541 | 3300009545 | Bacteria | 2507 |
| 555 | Ga0105237_10160339 | 3300009545 | Bacteria | 2247 |
| 556 | Ga0105237_10316350 | 3300009545 | Bacteria | 1564 |
| 557 | Ga0105238_10156600 | 3300009551 | Bacteria | 2253 |
| 558 | Ga0105238_10243423 | 3300009551 | Bacteria | 1776 |
| 559 | Ga0105238_10259306 | 3300009551 | Bacteria | 1718 |
| 560 | Ga0105249_10001599 | 3300009553 | Bacteria | 19830 |
| 561 | Ga0105249_10070757 | 3300009553 | Bacteria | 3221 |
| 562 | Ga0105249_10158497 | 3300009553 | Bacteria | 2185 |
| 563 | Ga0105249_10231362 | 3300009553 | Bacteria | 1823 |
| 564 | Ga0099796_10010105 | 3300010159 | Bacteria | 2582 |
| 565 | Ga0105239_10009752 | 3300010375 | Bacteria | 10796 |
| 566 | Ga0105239_10081152 | 3300010375 | Bacteria | 3570 |
| 567 | Ga0105246_10007217 | 3300011119 | Bacteria | 6810 |
| 568 | Ga0105246_10106583 | 3300011119 | Bacteria | 2051 |
| 569 | Ga0105246_10200123 | 3300011119 | Bacteria | 1552 |
| 570 | Ga0157373_10000499 | 3300013100 | Bacteria | 30965 |
| 571 | Ga0157373_10001456 | 3300013100 | Bacteria | 18090 |
| 572 | Ga0157373_10012576 | 3300013100 | Bacteria | 6222 |
| 573 | Ga0157373_10014696 | 3300013100 | Bacteria | 5735 |
| 574 | Ga0157373_10040644 | 3300013100 | Bacteria | 3327 |
| 575 | Ga0157373_10201140 | 3300013100 | Bacteria | 1404 |
| 576 | Ga0157373_10295188 | 3300013100 | Bacteria | 1150 |
| 577 | Ga0157371_10001965 | 3300013102 | Bacteria | 20388 |
| 578 | Ga0157371_10010606 | 3300013102 | Bacteria | 7160 |
| 579 | Ga0157371_10037389 | 3300013102 | Bacteria | 3474 |
| 580 | Ga0157370_10003331 | 3300013104 | Bacteria | 18930 |
| 581 | Ga0157370_10048561 | 3300013104 | Bacteria | 4065 |
| 582 | Ga0157370_10057468 | 3300013104 | Bacteria | 3699 |
| 583 | Ga0157370_10138315 | 3300013104 | Bacteria | 2269 |
| 584 | Ga0157370_10147628 | 3300013104 | Bacteria | 2189 |
| 585 | Ga0157370_10202152 | 3300013104 | Bacteria | 1843 |
| 586 | Ga0157370_10206478 | 3300013104 | Bacteria | 1821 |
| 587 | Ga0157370_10216238 | 3300013104 | Bacteria | 1776 |
| 588 | Ga0157369_10003195 | 3300013105 | Bacteria | 19536 |
| 589 | Ga0157369_10004134 | 3300013105 | Bacteria | 17188 |
| 590 | Ga0157369_10029042 | 3300013105 | Bacteria | 6114 |
| 591 | Ga0157369_10045063 | 3300013105 | Bacteria | 4799 |
| 592 | Ga0157369_10066145 | 3300013105 | Bacteria | 3889 |
| 593 | Ga0157374_10001695 | 3300013296 | Bacteria | 18451 |
| 594 | Ga0157374_10002626 | 3300013296 | Bacteria | 15152 |
| 595 | Ga0157374_10057385 | 3300013296 | Bacteria | 3636 |
| 596 | Ga0157374_10567538 | 3300013296 | Bacteria | 1143 |
| 597 | Ga0157378_10003374 | 3300013297 | Bacteria | 14202 |
| 598 | Ga0157378_10009719 | 3300013297 | Bacteria | 8379 |
| 599 | Ga0157378_10043988 | 3300013297 | Bacteria | 3964 |
| 600 | Ga0157378_10128094 | 3300013297 | Bacteria | 2347 |
| 601 | Ga0157378_10145741 | 3300013297 | Bacteria | 2202 |
| 602 | Ga0163162_10010828 | 3300013306 | Bacteria | 8874 |
| 603 | Ga0163162_10038833 | 3300013306 | Bacteria | 4752 |
| 604 | Ga0163162_10124956 | 3300013306 | Bacteria | 2678 |
| 605 | Ga0163162_10136322 | 3300013306 | Bacteria | 2565 |
| 606 | Ga0163162_10140377 | 3300013306 | Bacteria | 2529 |
| 607 | Ga0163162_10607117 | 3300013306 | Bacteria | 1220 |
| 608 | Ga0157372_10001631 | 3300013307 | Bacteria | 24355 |
| 609 | Ga0157372_10002144 | 3300013307 | Bacteria | 21446 |
| 610 | Ga0157372_10004321 | 3300013307 | Bacteria | 15190 |
| 611 | Ga0157372_10005498 | 3300013307 | Bacteria | 13464 |
| 612 | Ga0157372_10017070 | 3300013307 | Bacteria | 7793 |
| 613 | Ga0157372_10033994 | 3300013307 | Bacteria | 5601 |
| 614 | Ga0157372_10149132 | 3300013307 | Bacteria | 2698 |
| 615 | Ga0157372_10210800 | 3300013307 | Bacteria | 2252 |
| 616 | Ga0157372_10212656 | 3300013307 | Bacteria | 2241 |
| 617 | Ga0157372_10323860 | 3300013307 | Bacteria | 1794 |
| 618 | Ga0157372_10358481 | 3300013307 | Bacteria | 1699 |
| 619 | Ga0157372_10402307 | 3300013307 | Bacteria | 1595 |
| 620 | Ga0157372_11015212 | 3300013307 | Bacteria | 961 |
| 621 | Ga0157375_10008254 | 3300013308 | Bacteria | 9115 |
| 622 | Ga0157375_10023648 | 3300013308 | Bacteria | 5673 |
| 623 | Ga0157375_10092120 | 3300013308 | Bacteria | 3094 |
| 624 | Ga0157375_10164395 | 3300013308 | Bacteria | 2363 |
| 625 | Ga0163163_10003775 | 3300014325 | Bacteria | 12906 |
| 626 | Ga0163163_10104554 | 3300014325 | Bacteria | 2857 |
| 627 | Ga0163163_10112333 | 3300014325 | Bacteria | 2754 |
| 628 | Ga0163163_10237660 | 3300014325 | Bacteria | 1871 |
| 629 | Ga0157380_10000891 | 3300014326 | Bacteria | 18753 |
| 630 | Ga0157380_10142966 | 3300014326 | Bacteria | 2058 |
| 631 | Ga0182008_10000923 | 3300014497 | Bacteria | 20481 |
| 632 | Ga0182008_10001629 | 3300014497 | Bacteria | 14878 |
| 633 | Ga0182008_10003912 | 3300014497 | Bacteria | 8823 |
| 634 | Ga0182008_10004163 | 3300014497 | Bacteria | 8506 |
| 635 | Ga0182008_10010606 | 3300014497 | Bacteria | 4928 |
| 636 | Ga0182008_10086624 | 3300014497 | Bacteria | 1543 |
| 637 | Ga0157377_10000517 | 3300014745 | Bacteria | 16366 |
| 638 | Ga0157377_10029892 | 3300014745 | Bacteria | 2947 |
| 639 | Ga0157379_10002694 | 3300014968 | Bacteria | 14977 |
| 640 | Ga0157379_10011995 | 3300014968 | Bacteria | 7571 |
| 641 | Ga0157379_10014180 | 3300014968 | Bacteria | 6989 |
| 642 | Ga0157379_10156053 | 3300014968 | Bacteria | 2059 |
| 643 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 644 | Ga0157376_10005595 | 3300014969 | Bacteria | 8792 |
| 645 | Ga0157376_10053185 | 3300014969 | Bacteria | 3370 |
| 646 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 647 | Ga0182006_1014285 | 3300015261 | Bacteria | 3426 |
| 648 | Ga0182006_1044633 | 3300015261 | Bacteria | 1728 |
| 649 | Ga0182007_10000022 | 3300015262 | Bacteria | 189018 |
| 650 | Ga0182007_10001812 | 3300015262 | Bacteria | 11153 |
| 651 | Ga0182007_10002663 | 3300015262 | Bacteria | 8769 |
| 652 | Ga0182007_10003476 | 3300015262 | Bacteria | 7415 |
| 653 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 654 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 655 | Ga0163161_10000157 | 3300017792 | Bacteria | 62919 |
| 656 | Ga0163161_10149013 | 3300017792 | Bacteria | 1777 |
| 657 | Ga0163161_10173782 | 3300017792 | Bacteria | 1648 |
| 658 | Ga0213873_10007625 | 3300021358 | Bacteria | 2177 |
| 659 | Ga0213872_10001066 | 3300021361 | Bacteria | 18945 |
| 660 | Ga0213872_10068185 | 3300021361 | Bacteria | 1605 |
| 661 | Ga0213875_10021717 | 3300021388 | Bacteria | 3071 |
| 662 | Ga0209672_102122 | 3300025228 | Bacteria | 5276 |
| 663 | Ga0209147_105210 | 3300025229 | Bacteria | 1986 |
| 664 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 665 | Ga0207425_1001149 | 3300025245 | Bacteria | 11896 |
| 666 | Ga0207425_1003000 | 3300025245 | Bacteria | 5624 |
| 667 | Ga0207425_1005417 | 3300025245 | Bacteria | 3641 |
| 668 | Ga0209129_1000083 | 3300025258 | Bacteria | 183270 |
| 669 | Ga0209129_1004634 | 3300025258 | Bacteria | 5263 |
| 670 | Ga0209129_1012302 | 3300025258 | Bacteria | 1973 |
| 671 | Ga0209565_1000083 | 3300025263 | Bacteria | 154007 |
| 672 | Ga0209565_1001165 | 3300025263 | Bacteria | 12620 |
| 673 | Ga0209565_1001782 | 3300025263 | Bacteria | 8700 |
| 674 | Ga0207666_1000059 | 3300025271 | Bacteria | 19909 |
| 675 | Ga0209673_1000089 | 3300025273 | Bacteria | 202240 |
| 676 | Ga0209673_1000323 | 3300025273 | Bacteria | 87588 |
| 677 | Ga0209673_1001607 | 3300025273 | Bacteria | 19784 |
| 678 | Ga0209673_1003753 | 3300025273 | Bacteria | 8657 |
| 679 | Ga0209673_1024705 | 3300025273 | Bacteria | 2013 |
| 680 | Ga0209130_1000208 | 3300025284 | Bacteria | 78707 |
| 681 | Ga0209130_1000231 | 3300025284 | Bacteria | 73279 |
| 682 | Ga0209130_1000400 | 3300025284 | Bacteria | 47474 |
| 683 | Ga0209130_1001602 | 3300025284 | Bacteria | 14108 |
| 684 | Ga0209130_1004131 | 3300025284 | Bacteria | 5702 |
| 685 | Ga0207673_1000330 | 3300025290 | Bacteria | 4761 |
| 686 | Ga0209675_1000081 | 3300025291 | Bacteria | 154007 |
| 687 | Ga0209675_1001031 | 3300025291 | Bacteria | 17390 |
| 688 | Ga0209675_1002633 | 3300025291 | Bacteria | 9075 |
| 689 | Ga0209675_1004304 | 3300025291 | Bacteria | 6389 |
| 690 | Ga0209675_1008754 | 3300025291 | Bacteria | 3667 |
| 691 | Ga0209675_1009968 | 3300025291 | Bacteria | 3294 |
| 692 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 693 | Ga0209676_1000183 | 3300025292 | Bacteria | 145352 |
| 694 | Ga0209676_1001760 | 3300025292 | Bacteria | 18385 |
| 695 | Ga0209676_1002922 | 3300025292 | Bacteria | 11168 |
| 696 | Ga0209676_1004535 | 3300025292 | Bacteria | 7696 |
| 697 | Ga0209676_1025810 | 3300025292 | Bacteria | 1877 |
| 698 | Ga0209025_1000049 | 3300025294 | Bacteria | 333459 |
| 699 | Ga0209025_1000518 | 3300025294 | Bacteria | 73450 |
| 700 | Ga0209025_1001724 | 3300025294 | Bacteria | 26449 |
| 701 | Ga0209025_1001836 | 3300025294 | Bacteria | 24946 |
| 702 | Ga0209025_1002225 | 3300025294 | Bacteria | 21372 |
| 703 | Ga0209025_1006047 | 3300025294 | Bacteria | 9571 |
| 704 | Ga0209025_1006883 | 3300025294 | Bacteria | 8670 |
| 705 | Ga0209025_1007740 | 3300025294 | Bacteria | 7919 |
| 706 | Ga0209025_1014013 | 3300025294 | Bacteria | 4981 |
| 707 | Ga0209025_1022168 | 3300025294 | Bacteria | 3382 |
| 708 | Ga0209025_1027136 | 3300025294 | Bacteria | 2850 |
| 709 | Ga0209025_1030957 | 3300025294 | Bacteria | 2545 |
| 710 | Ga0209025_1052245 | 3300025294 | Bacteria | 1615 |
| 711 | Ga0209564_1002924 | 3300025295 | Bacteria | 12417 |
| 712 | Ga0209564_1005879 | 3300025295 | Bacteria | 6809 |
| 713 | Ga0209564_1006290 | 3300025295 | Bacteria | 6463 |
| 714 | Ga0209564_1009425 | 3300025295 | Bacteria | 4648 |
| 715 | Ga0209758_1000132 | 3300025297 | Bacteria | 183273 |
| 716 | Ga0209758_1000628 | 3300025297 | Bacteria | 54130 |
| 717 | Ga0209758_1006941 | 3300025297 | Bacteria | 7896 |
| 718 | Ga0209758_1011111 | 3300025297 | Bacteria | 5263 |
| 719 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 720 | Ga0209050_1001170 | 3300025298 | Bacteria | 31017 |
| 721 | Ga0209050_1002672 | 3300025298 | Bacteria | 14542 |
| 722 | Ga0209050_1006110 | 3300025298 | Bacteria | 7265 |
| 723 | Ga0209050_1006526 | 3300025298 | Bacteria | 6874 |
| 724 | Ga0209050_1015580 | 3300025298 | Bacteria | 3179 |
| 725 | Ga0209256_1000492 | 3300025299 | Bacteria | 58194 |
| 726 | Ga0209256_1000973 | 3300025299 | Bacteria | 34412 |
| 727 | Ga0209256_1002639 | 3300025299 | Bacteria | 14108 |
| 728 | Ga0207426_1000046 | 3300025302 | Bacteria | 422271 |
| 729 | Ga0207426_1000197 | 3300025302 | Bacteria | 146366 |
| 730 | Ga0207426_1000584 | 3300025302 | Bacteria | 48547 |
| 731 | Ga0207426_1002041 | 3300025302 | Bacteria | 14108 |
| 732 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 733 | Ga0209051_1000533 | 3300025303 | Bacteria | 47141 |
| 734 | Ga0209051_1001870 | 3300025303 | Bacteria | 16527 |
| 735 | Ga0209051_1002364 | 3300025303 | Bacteria | 13645 |
| 736 | Ga0209051_1009018 | 3300025303 | Bacteria | 5195 |
| 737 | Ga0209051_1016781 | 3300025303 | Bacteria | 3293 |
| 738 | Ga0209051_1030165 | 3300025303 | Bacteria | 2108 |
| 739 | Ga0209051_1041625 | 3300025303 | Bacteria | 1632 |
| 740 | Ga0209051_1043267 | 3300025303 | Bacteria | 1582 |
| 741 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 742 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 743 | Ga0209257_1000361 | 3300025304 | Bacteria | 92239 |
| 744 | Ga0209257_1009329 | 3300025304 | Bacteria | 5291 |
| 745 | Ga0207697_10004888 | 3300025315 | Bacteria | 6320 |
| 746 | Ga0207697_10005773 | 3300025315 | Bacteria | 5706 |
| 747 | Ga0207697_10027556 | 3300025315 | Bacteria | 2323 |
| 748 | Ga0207656_10009568 | 3300025321 | Bacteria | 3600 |
| 749 | Ga0207656_10025330 | 3300025321 | Bacteria | 2407 |
| 750 | Ga0207656_10073882 | 3300025321 | Bacteria | 1520 |
| 751 | Ga0207655_1007936 | 3300025728 | Bacteria | 6816 |
| 752 | Ga0207653_10001520 | 3300025885 | Bacteria | 7508 |
| 753 | Ga0207653_10002470 | 3300025885 | Bacteria | 5874 |
| 754 | Ga0207653_10019309 | 3300025885 | Bacteria | 2149 |
| 755 | Ga0207682_10000233 | 3300025893 | Bacteria | 24983 |
| 756 | Ga0207682_10000509 | 3300025893 | Bacteria | 17874 |
| 757 | Ga0207692_10012403 | 3300025898 | Bacteria | 3660 |
| 758 | Ga0207692_10024508 | 3300025898 | Bacteria | 2806 |
| 759 | Ga0207692_10119408 | 3300025898 | Bacteria | 1474 |
| 760 | Ga0207710_10006153 | 3300025900 | Bacteria | 5135 |
| 761 | Ga0207688_10000167 | 3300025901 | Bacteria | 28809 |
| 762 | Ga0207688_10026635 | 3300025901 | Bacteria | 3180 |
| 763 | Ga0207688_10050276 | 3300025901 | Bacteria | 2333 |
| 764 | Ga0207680_10008068 | 3300025903 | Bacteria | 5158 |
| 765 | Ga0207680_10019296 | 3300025903 | Bacteria | 3643 |
| 766 | Ga0207680_10027653 | 3300025903 | Bacteria | 3162 |
| 767 | Ga0207680_10187827 | 3300025903 | Bacteria | 1401 |
| 768 | Ga0207647_10006799 | 3300025904 | Bacteria | 8296 |
| 769 | Ga0207647_10049731 | 3300025904 | Bacteria | 2599 |
| 770 | Ga0207647_10065911 | 3300025904 | Bacteria | 2197 |
| 771 | Ga0207685_10006792 | 3300025905 | Bacteria | 3145 |
| 772 | Ga0207685_10100918 | 3300025905 | Bacteria | 1234 |
| 773 | Ga0207699_10014979 | 3300025906 | Bacteria | 4016 |
| 774 | Ga0207699_10018629 | 3300025906 | Bacteria | 3683 |
| 775 | Ga0207699_10107246 | 3300025906 | Bacteria | 1784 |
| 776 | Ga0207699_10116909 | 3300025906 | Bacteria | 1718 |
| 777 | Ga0207699_10142209 | 3300025906 | Bacteria | 1578 |
| 778 | Ga0207645_10000059 | 3300025907 | Bacteria | 78254 |
| 779 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 780 | Ga0207645_10019420 | 3300025907 | Bacteria | 4455 |
| 781 | Ga0207645_10032640 | 3300025907 | Bacteria | 3347 |
| 782 | Ga0207645_10116715 | 3300025907 | Bacteria | 1731 |
| 783 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 784 | Ga0207643_10000014 | 3300025908 | Bacteria | 128891 |
| 785 | Ga0207643_10028396 | 3300025908 | Bacteria | 3107 |
| 786 | Ga0207705_10111477 | 3300025909 | Bacteria | 2022 |
| 787 | Ga0207705_10147049 | 3300025909 | Bacteria | 1764 |
| 788 | Ga0207705_10439103 | 3300025909 | Bacteria | 1011 |
| 789 | Ga0207684_10000047 | 3300025910 | Bacteria | 244386 |
| 790 | Ga0207684_10000370 | 3300025910 | Bacteria | 60789 |
| 791 | Ga0207684_10002538 | 3300025910 | Bacteria | 18333 |
| 792 | Ga0207684_10005313 | 3300025910 | Bacteria | 11914 |
| 793 | Ga0207684_10021471 | 3300025910 | Bacteria | 5513 |
| 794 | Ga0207684_10026392 | 3300025910 | Bacteria | 4952 |
| 795 | Ga0207684_10033330 | 3300025910 | Bacteria | 4379 |
| 796 | Ga0207684_10042118 | 3300025910 | Bacteria | 3870 |
| 797 | Ga0207684_10049950 | 3300025910 | Bacteria | 3548 |
| 798 | Ga0207684_10060104 | 3300025910 | Bacteria | 3227 |
| 799 | Ga0207684_10084595 | 3300025910 | Bacteria | 2702 |
| 800 | Ga0207684_10215618 | 3300025910 | Bacteria | 1656 |
| 801 | Ga0207654_10017742 | 3300025911 | Bacteria | 3726 |
| 802 | Ga0207654_10027404 | 3300025911 | Bacteria | 3096 |
| 803 | Ga0207654_10166523 | 3300025911 | Bacteria | 1428 |
| 804 | Ga0207654_10192175 | 3300025911 | Bacteria | 1339 |
| 805 | Ga0207707_10000138 | 3300025912 | Bacteria | 74881 |
| 806 | Ga0207707_10005018 | 3300025912 | Bacteria | 11624 |
| 807 | Ga0207707_10016070 | 3300025912 | Bacteria | 6527 |
| 808 | Ga0207707_10022060 | 3300025912 | Bacteria | 5566 |
| 809 | Ga0207707_10052281 | 3300025912 | Bacteria | 3557 |
| 810 | Ga0207707_10077610 | 3300025912 | Bacteria | 2899 |
| 811 | Ga0207707_10091096 | 3300025912 | Bacteria | 2665 |
| 812 | Ga0207707_10199984 | 3300025912 | Bacteria | 1742 |
| 813 | Ga0207707_10240676 | 3300025912 | Bacteria | 1573 |
| 814 | Ga0207695_10292264 | 3300025913 | Bacteria | 1522 |
| 815 | Ga0207695_10550983 | 3300025913 | Bacteria | 1035 |
| 816 | Ga0207671_10051675 | 3300025914 | Bacteria | 3046 |
| 817 | Ga0207671_10082753 | 3300025914 | Bacteria | 2409 |
| 818 | Ga0207671_10227462 | 3300025914 | Bacteria | 1463 |
| 819 | Ga0207693_10003697 | 3300025915 | Bacteria | 13040 |
| 820 | Ga0207693_10010251 | 3300025915 | Bacteria | 7607 |
| 821 | Ga0207693_10010690 | 3300025915 | Bacteria | 7449 |
| 822 | Ga0207693_10022705 | 3300025915 | Bacteria | 4985 |
| 823 | Ga0207693_10052278 | 3300025915 | Bacteria | 3204 |
| 824 | Ga0207693_10119313 | 3300025915 | Bacteria | 2071 |
| 825 | Ga0207693_10214991 | 3300025915 | Bacteria | 1511 |
| 826 | Ga0207663_10016769 | 3300025916 | Bacteria | 4070 |
| 827 | Ga0207663_10048579 | 3300025916 | Bacteria | 2627 |
| 828 | Ga0207663_10081072 | 3300025916 | Bacteria | 2124 |
| 829 | Ga0207663_10129197 | 3300025916 | Bacteria | 1743 |
| 830 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 831 | Ga0207660_10000848 | 3300025917 | Bacteria | 20138 |
| 832 | Ga0207660_10016588 | 3300025917 | Bacteria | 4878 |
| 833 | Ga0207660_10039418 | 3300025917 | Bacteria | 3302 |
| 834 | Ga0207660_10189221 | 3300025917 | Bacteria | 1602 |
| 835 | Ga0207662_10000195 | 3300025918 | Bacteria | 28315 |
| 836 | Ga0207662_10041918 | 3300025918 | Bacteria | 2696 |
| 837 | Ga0207657_10000135 | 3300025919 | Bacteria | 75248 |
| 838 | Ga0207657_10000371 | 3300025919 | Bacteria | 47425 |
| 839 | Ga0207657_10002386 | 3300025919 | Bacteria | 20326 |
| 840 | Ga0207657_10008450 | 3300025919 | Bacteria | 10444 |
| 841 | Ga0207657_10011112 | 3300025919 | Bacteria | 8950 |
| 842 | Ga0207657_10015145 | 3300025919 | Bacteria | 7489 |
| 843 | Ga0207657_10023887 | 3300025919 | Bacteria | 5678 |
| 844 | Ga0207657_10040173 | 3300025919 | Bacteria | 4148 |
| 845 | Ga0207649_10001482 | 3300025920 | Bacteria | 13783 |
| 846 | Ga0207649_10003041 | 3300025920 | Bacteria | 9241 |
| 847 | Ga0207649_10265585 | 3300025920 | Bacteria | 1242 |
| 848 | Ga0207652_10002995 | 3300025921 | Bacteria | 14105 |
| 849 | Ga0207652_10005355 | 3300025921 | Bacteria | 10409 |
| 850 | Ga0207652_10015708 | 3300025921 | Bacteria | 6167 |
| 851 | Ga0207652_10019549 | 3300025921 | Bacteria | 5572 |
| 852 | Ga0207652_10033023 | 3300025921 | Bacteria | 4356 |
| 853 | Ga0207652_10103601 | 3300025921 | Bacteria | 2516 |
| 854 | Ga0207652_10199221 | 3300025921 | Bacteria | 1802 |
| 855 | Ga0207652_10228996 | 3300025921 | Bacteria | 1675 |
| 856 | Ga0207652_10299556 | 3300025921 | Bacteria | 1451 |
| 857 | Ga0207652_10385584 | 3300025921 | Bacteria | 1265 |
| 858 | Ga0207646_10000466 | 3300025922 | Bacteria | 54002 |
| 859 | Ga0207646_10007223 | 3300025922 | Bacteria | 11333 |
| 860 | Ga0207646_10025133 | 3300025922 | Bacteria | 5451 |
| 861 | Ga0207646_10035640 | 3300025922 | Bacteria | 4493 |
| 862 | Ga0207646_10052656 | 3300025922 | Bacteria | 3643 |
| 863 | Ga0207646_10066999 | 3300025922 | Bacteria | 3205 |
| 864 | Ga0207681_10001546 | 3300025923 | Bacteria | 14821 |
| 865 | Ga0207681_10256360 | 3300025923 | Bacteria | 1368 |
| 866 | Ga0207694_10079410 | 3300025924 | Bacteria | 2573 |
| 867 | Ga0207694_10334017 | 3300025924 | Bacteria | 1252 |
| 868 | Ga0207650_10001317 | 3300025925 | Bacteria | 17984 |
| 869 | Ga0207650_10007958 | 3300025925 | Bacteria | 7225 |
| 870 | Ga0207650_10036096 | 3300025925 | Bacteria | 3594 |
| 871 | Ga0207659_10003760 | 3300025926 | Bacteria | 9152 |
| 872 | Ga0207659_10003917 | 3300025926 | Bacteria | 8979 |
| 873 | Ga0207659_10017546 | 3300025926 | Bacteria | 4678 |
| 874 | Ga0207659_10231822 | 3300025926 | Bacteria | 1489 |
| 875 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 876 | Ga0207687_10002399 | 3300025927 | Bacteria | 12708 |
| 877 | Ga0207687_10004046 | 3300025927 | Bacteria | 9824 |
| 878 | Ga0207687_10040930 | 3300025927 | Bacteria | 3179 |
| 879 | Ga0207687_10069085 | 3300025927 | Bacteria | 2518 |
| 880 | Ga0207700_10009195 | 3300025928 | Bacteria | 6161 |
| 881 | Ga0207700_10061588 | 3300025928 | Bacteria | 2846 |
| 882 | Ga0207700_10083552 | 3300025928 | Bacteria | 2500 |
| 883 | Ga0207700_10102963 | 3300025928 | Bacteria | 2281 |
| 884 | Ga0207700_10115658 | 3300025928 | Bacteria | 2166 |
| 885 | Ga0207700_10163367 | 3300025928 | Bacteria | 1851 |
| 886 | Ga0207700_10390726 | 3300025928 | Bacteria | 1218 |
| 887 | Ga0207664_10001202 | 3300025929 | Bacteria | 17189 |
| 888 | Ga0207664_10025036 | 3300025929 | Bacteria | 4488 |
| 889 | Ga0207664_10026888 | 3300025929 | Bacteria | 4355 |
| 890 | Ga0207664_10079180 | 3300025929 | Bacteria | 2667 |
| 891 | Ga0207664_10113689 | 3300025929 | Bacteria | 2255 |
| 892 | Ga0207644_10001292 | 3300025931 | Bacteria | 16118 |
| 893 | Ga0207644_10003302 | 3300025931 | Bacteria | 10425 |
| 894 | Ga0207644_10014609 | 3300025931 | Bacteria | 5257 |
| 895 | Ga0207644_10049977 | 3300025931 | Bacteria | 2995 |
| 896 | Ga0207644_10104400 | 3300025931 | Bacteria | 2133 |
| 897 | Ga0207644_10148953 | 3300025931 | Bacteria | 1809 |
| 898 | Ga0207690_10003300 | 3300025932 | Bacteria | 9652 |
| 899 | Ga0207690_10004975 | 3300025932 | Bacteria | 7849 |
| 900 | Ga0207690_10021253 | 3300025932 | Bacteria | 4023 |
| 901 | Ga0207690_10055902 | 3300025932 | Bacteria | 2660 |
| 902 | Ga0207690_10065899 | 3300025932 | Bacteria | 2478 |
| 903 | Ga0207690_10086957 | 3300025932 | Bacteria | 2198 |
| 904 | Ga0207690_10109014 | 3300025932 | Bacteria | 1991 |
| 905 | Ga0207690_10160875 | 3300025932 | Bacteria | 1673 |
| 906 | Ga0207690_10225340 | 3300025932 | Bacteria | 1436 |
| 907 | Ga0207706_10000179 | 3300025933 | Bacteria | 70768 |
| 908 | Ga0207706_10008198 | 3300025933 | Bacteria | 9637 |
| 909 | Ga0207706_10010659 | 3300025933 | Bacteria | 8395 |
| 910 | Ga0207706_10027673 | 3300025933 | Bacteria | 5069 |
| 911 | Ga0207706_10032369 | 3300025933 | Bacteria | 4657 |
| 912 | Ga0207706_10212362 | 3300025933 | Bacteria | 1696 |
| 913 | Ga0207686_10001034 | 3300025934 | Bacteria | 16473 |
| 914 | Ga0207686_10001546 | 3300025934 | Bacteria | 12982 |
| 915 | Ga0207686_10062493 | 3300025934 | Bacteria | 2365 |
| 916 | Ga0207686_10135099 | 3300025934 | Bacteria | 1697 |
| 917 | Ga0207686_10224025 | 3300025934 | Bacteria | 1360 |
| 918 | Ga0207709_10000323 | 3300025935 | Bacteria | 51730 |
| 919 | Ga0207709_10001423 | 3300025935 | Bacteria | 16760 |
| 920 | Ga0207709_10002180 | 3300025935 | Bacteria | 12510 |
| 921 | Ga0207709_10010841 | 3300025935 | Bacteria | 5020 |
| 922 | Ga0207670_10007269 | 3300025936 | Bacteria | 6170 |
| 923 | Ga0207670_10007607 | 3300025936 | Bacteria | 6060 |
| 924 | Ga0207670_10033916 | 3300025936 | Bacteria | 3294 |
| 925 | Ga0207670_10177187 | 3300025936 | Bacteria | 1603 |
| 926 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 927 | Ga0207669_10021922 | 3300025937 | Bacteria | 3383 |
| 928 | Ga0207704_10013299 | 3300025938 | Bacteria | 4114 |
| 929 | Ga0207704_10065340 | 3300025938 | Bacteria | 2277 |
| 930 | Ga0207704_10548285 | 3300025938 | Bacteria | 939 |
| 931 | Ga0207665_10002312 | 3300025939 | Bacteria | 12865 |
| 932 | Ga0207665_10014000 | 3300025939 | Bacteria | 5275 |
| 933 | Ga0207665_10028429 | 3300025939 | Bacteria | 3692 |
| 934 | Ga0207691_10005440 | 3300025940 | Bacteria | 12297 |
| 935 | Ga0207691_10008719 | 3300025940 | Bacteria | 9727 |
| 936 | Ga0207691_10024412 | 3300025940 | Bacteria | 5686 |
| 937 | Ga0207711_10001106 | 3300025941 | Bacteria | 25759 |
| 938 | Ga0207711_10001412 | 3300025941 | Bacteria | 22485 |
| 939 | Ga0207711_10054504 | 3300025941 | Bacteria | 3432 |
| 940 | Ga0207711_10297221 | 3300025941 | Bacteria | 1489 |
| 941 | Ga0207689_10000340 | 3300025942 | Bacteria | 43593 |
| 942 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 943 | Ga0207689_10011579 | 3300025942 | Bacteria | 7557 |
| 944 | Ga0207689_10075610 | 3300025942 | Bacteria | 2768 |
| 945 | Ga0207689_10239592 | 3300025942 | Bacteria | 1500 |
| 946 | Ga0207689_10258146 | 3300025942 | Bacteria | 1442 |
| 947 | Ga0207689_10273117 | 3300025942 | Bacteria | 1400 |
| 948 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 949 | Ga0207661_10324767 | 3300025944 | Bacteria | 1384 |
| 950 | Ga0207661_10340880 | 3300025944 | Bacteria | 1350 |
| 951 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 952 | Ga0207679_10000212 | 3300025945 | Bacteria | 46385 |
| 953 | Ga0207679_10004897 | 3300025945 | Bacteria | 8346 |
| 954 | Ga0207679_10017886 | 3300025945 | Bacteria | 4738 |
| 955 | Ga0207679_10020500 | 3300025945 | Bacteria | 4462 |
| 956 | Ga0207679_10038663 | 3300025945 | Bacteria | 3401 |
| 957 | Ga0207679_10190787 | 3300025945 | Bacteria | 1704 |
| 958 | Ga0207667_10000296 | 3300025949 | Bacteria | 68803 |
| 959 | Ga0207667_10026324 | 3300025949 | Bacteria | 6358 |
| 960 | Ga0207667_10071531 | 3300025949 | Bacteria | 3606 |
| 961 | Ga0207667_10109162 | 3300025949 | Bacteria | 2854 |
| 962 | Ga0207667_10171393 | 3300025949 | Bacteria | 2230 |
| 963 | Ga0207667_10374146 | 3300025949 | Bacteria | 1452 |
| 964 | Ga0207651_10001426 | 3300025960 | Bacteria | 10879 |
| 965 | Ga0207651_10004291 | 3300025960 | Bacteria | 7158 |
| 966 | Ga0207651_10029362 | 3300025960 | Bacteria | 3483 |
| 967 | Ga0207651_10085237 | 3300025960 | Bacteria | 2291 |
| 968 | Ga0207651_10461367 | 3300025960 | Bacteria | 1092 |
| 969 | Ga0207712_10001547 | 3300025961 | Bacteria | 15511 |
| 970 | Ga0207712_10262138 | 3300025961 | Bacteria | 1402 |
| 971 | Ga0207712_10384491 | 3300025961 | Bacteria | 1176 |
| 972 | Ga0207640_10001474 | 3300025981 | Bacteria | 12692 |
| 973 | Ga0207640_10004722 | 3300025981 | Bacteria | 7399 |
| 974 | Ga0207640_10078853 | 3300025981 | Bacteria | 2243 |
| 975 | Ga0207640_10079397 | 3300025981 | Bacteria | 2236 |
| 976 | Ga0207640_10082980 | 3300025981 | Bacteria | 2196 |
| 977 | Ga0207640_10090523 | 3300025981 | Bacteria | 2117 |
| 978 | Ga0207658_10005146 | 3300025986 | Bacteria | 9004 |
| 979 | Ga0207658_10020207 | 3300025986 | Bacteria | 4612 |
| 980 | Ga0207658_10049391 | 3300025986 | Bacteria | 3091 |
| 981 | Ga0207677_10005872 | 3300026023 | Bacteria | 6679 |
| 982 | Ga0207677_10007549 | 3300026023 | Bacteria | 6030 |
| 983 | Ga0207677_10032098 | 3300026023 | Bacteria | 3372 |
| 984 | Ga0207677_10072219 | 3300026023 | Bacteria | 2439 |
| 985 | Ga0207677_10104308 | 3300026023 | Bacteria | 2095 |
| 986 | Ga0207677_10184137 | 3300026023 | Bacteria | 1645 |
| 987 | Ga0207703_10001566 | 3300026035 | Bacteria | 20744 |
| 988 | Ga0207703_10026810 | 3300026035 | Bacteria | 4539 |
| 989 | Ga0207639_10001773 | 3300026041 | Bacteria | 14523 |
| 990 | Ga0207639_10009108 | 3300026041 | Bacteria | 6840 |
| 991 | Ga0207639_10030650 | 3300026041 | Bacteria | 3946 |
| 992 | Ga0207639_10139704 | 3300026041 | Bacteria | 2017 |
| 993 | Ga0207678_10006632 | 3300026067 | Bacteria | 10261 |
| 994 | Ga0207678_10007393 | 3300026067 | Bacteria | 9727 |
| 995 | Ga0207678_10059246 | 3300026067 | Bacteria | 3294 |
| 996 | Ga0207708_10007017 | 3300026075 | Bacteria | 8325 |
| 997 | Ga0207708_10068643 | 3300026075 | Bacteria | 2713 |
| 998 | Ga0207702_10000997 | 3300026078 | Bacteria | 29032 |
| 999 | Ga0207702_10001150 | 3300026078 | Bacteria | 27070 |
| 1000 | Ga0207702_10002232 | 3300026078 | Bacteria | 18580 |
| 1001 | Ga0207702_10015638 | 3300026078 | Bacteria | 6281 |
| 1002 | Ga0207702_10065241 | 3300026078 | Bacteria | 3118 |
| 1003 | Ga0207702_10208236 | 3300026078 | Bacteria | 1817 |
| 1004 | Ga0207641_10011956 | 3300026088 | Bacteria | 7121 |
| 1005 | Ga0207641_10014477 | 3300026088 | Bacteria | 6462 |
| 1006 | Ga0207641_10153500 | 3300026088 | Bacteria | 2087 |
| 1007 | Ga0207641_10302361 | 3300026088 | Bacteria | 1512 |
| 1008 | Ga0207641_10505287 | 3300026088 | Bacteria | 1174 |
| 1009 | Ga0207648_10001239 | 3300026089 | Bacteria | 28649 |
| 1010 | Ga0207648_10003625 | 3300026089 | Bacteria | 16145 |
| 1011 | Ga0207648_10008796 | 3300026089 | Bacteria | 9727 |
| 1012 | Ga0207648_10249840 | 3300026089 | Bacteria | 1581 |
| 1013 | Ga0207648_10276416 | 3300026089 | Bacteria | 1501 |
| 1014 | Ga0207676_10000429 | 3300026095 | Bacteria | 35426 |
| 1015 | Ga0207676_10001946 | 3300026095 | Bacteria | 15063 |
| 1016 | Ga0207676_10004807 | 3300026095 | Bacteria | 9584 |
| 1017 | Ga0207676_10013792 | 3300026095 | Bacteria | 5802 |
| 1018 | Ga0207676_10325736 | 3300026095 | Bacteria | 1412 |
| 1019 | Ga0207674_10000684 | 3300026116 | Bacteria | 44066 |
| 1020 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 1021 | Ga0207674_10023874 | 3300026116 | Bacteria | 6541 |
| 1022 | Ga0207674_10028853 | 3300026116 | Bacteria | 5849 |
| 1023 | Ga0207674_10068749 | 3300026116 | Bacteria | 3563 |
| 1024 | Ga0207674_10416664 | 3300026116 | Bacteria | 1298 |
| 1025 | Ga0207675_100005465 | 3300026118 | Bacteria | 12176 |
| 1026 | Ga0207675_100013598 | 3300026118 | Bacteria | 7598 |
| 1027 | Ga0207675_100021301 | 3300026118 | Bacteria | 6038 |
| 1028 | Ga0207675_100209693 | 3300026118 | Bacteria | 1873 |
| 1029 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 1030 | Ga0207683_10001317 | 3300026121 | Bacteria | 22408 |
| 1031 | Ga0207683_10030000 | 3300026121 | Bacteria | 4711 |
| 1032 | Ga0207683_10052262 | 3300026121 | Bacteria | 3580 |
| 1033 | Ga0207683_10160885 | 3300026121 | Bacteria | 2029 |
| 1034 | Ga0207683_10199221 | 3300026121 | Bacteria | 1819 |
| 1035 | Ga0207683_10239388 | 3300026121 | Bacteria | 1655 |
| 1036 | Ga0207698_10018865 | 3300026142 | Bacteria | 4711 |
| 1037 | Ga0207698_10023805 | 3300026142 | Bacteria | 4286 |
| 1038 | Ga0207698_10045457 | 3300026142 | Bacteria | 3308 |
| 1039 | Ga0207698_10084889 | 3300026142 | Bacteria | 2568 |
| 1040 | Ga0207698_10102579 | 3300026142 | Bacteria | 2375 |
| 1041 | Ga0207698_10123448 | 3300026142 | Bacteria | 2197 |
| 1042 | Ga0207698_10434318 | 3300026142 | Bacteria | 1263 |
| 1043 | Ga0209179_1025133 | 3300027512 | Bacteria | 1186 |
| 1044 | Ga0209983_1005029 | 3300027665 | Bacteria | 2757 |
| 1045 | Ga0209282_1000165 | 3300027666 | Bacteria | 37517 |
| 1046 | Ga0209282_1002509 | 3300027666 | Bacteria | 10644 |
| 1047 | Ga0209588_1050337 | 3300027671 | Bacteria | 1348 |
| 1048 | Ga0209971_1003527 | 3300027682 | Bacteria | 3701 |
| 1049 | Ga0209966_1013384 | 3300027695 | Bacteria | 1518 |
| 1050 | Ga0209998_10001898 | 3300027717 | Bacteria | 4926 |
| 1051 | Ga0209813_10000254 | 3300027866 | Bacteria | 15521 |
| 1052 | Ga0209974_10002097 | 3300027876 | Bacteria | 7300 |
| 1053 | Ga0209974_10007927 | 3300027876 | Bacteria | 3641 |
| 1054 | Ga0209974_10011487 | 3300027876 | Bacteria | 2972 |
| 1055 | Ga0209974_10030952 | 3300027876 | Bacteria | 1772 |
| 1056 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 1057 | Ga0207428_10000119 | 3300027907 | Bacteria | 106261 |
| 1058 | Ga0207428_10010298 | 3300027907 | Bacteria | 8357 |
| 1059 | Ga0207428_10180526 | 3300027907 | Bacteria | 1595 |
| 1060 | Ga0268266_10040823 | 3300028379 | Bacteria | 3956 |
| 1061 | Ga0268266_10042868 | 3300028379 | Bacteria | 3866 |
| 1062 | Ga0268266_10049818 | 3300028379 | Bacteria | 3593 |
| 1063 | Ga0268266_10088876 | 3300028379 | Bacteria | 2704 |
| 1064 | Ga0268266_10098594 | 3300028379 | Bacteria | 2571 |
| 1065 | Ga0268265_10024411 | 3300028380 | Bacteria | 4276 |
| 1066 | Ga0268265_10074098 | 3300028380 | Bacteria | 2661 |
| 1067 | Ga0268264_10002968 | 3300028381 | Bacteria | 14738 |
| 1068 | Ga0268264_10021447 | 3300028381 | Bacteria | 5274 |
| 1069 | Ga0268264_10070544 | 3300028381 | Bacteria | 2958 |
| 1070 | Ga0268264_10502935 | 3300028381 | Bacteria | 1182 |
| 1071 | Ga0307515_10000195 | 3300028794 | Bacteria | 148138 |
| 1072 | Ga0307515_10000515 | 3300028794 | Bacteria | 92187 |
| 1073 | Ga0307515_10088375 | 3300028794 | Bacteria | 3918 |
| 1074 | Ga0307512_10148172 | 3300030522 | Bacteria | 1413 |
| 1075 | Ga0316177_1194083 | 3300030731 | Bacteria | 3178 |
| 1076 | Ga0316176_1194494 | 3300030732 | Bacteria | 2372 |
| 1077 | Ga0314311_1187085 | 3300030733 | Bacteria | 4178 |
| 1078 | Ga0316178_1021905 | 3300030735 | Bacteria | 9973 |
| 1079 | Ga0265330_10000033 | 3300031235 | Bacteria | 126931 |
| 1080 | Ga0265330_10007169 | 3300031235 | Bacteria | 5461 |
| 1081 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 1082 | Ga0265339_10143330 | 3300031249 | Bacteria | 1214 |
| 1083 | Ga0265327_10000425 | 3300031251 | Bacteria | 77143 |
| 1084 | Ga0265327_10095537 | 3300031251 | Bacteria | 1442 |
| 1085 | Ga0307513_10048235 | 3300031456 | Bacteria | 4624 |
| 1086 | Ga0307513_10178655 | 3300031456 | Bacteria | 1989 |
| 1087 | Ga0307513_10440065 | 3300031456 | Bacteria | 1030 |
| 1088 | Ga0307408_100000039 | 3300031548 | Bacteria | 177825 |
| 1089 | Ga0307408_100006354 | 3300031548 | Bacteria | 7841 |
| 1090 | Ga0307408_100020361 | 3300031548 | Bacteria | 4476 |
| 1091 | Ga0307408_100044908 | 3300031548 | Bacteria | 3152 |
| 1092 | Ga0307408_100089774 | 3300031548 | Bacteria | 2317 |
| 1093 | Ga0307408_100145730 | 3300031548 | Bacteria | 1863 |
| 1094 | Ga0307408_100170044 | 3300031548 | Bacteria | 1739 |
| 1095 | Ga0307408_100202823 | 3300031548 | Bacteria | 1606 |
| 1096 | Ga0307408_100224907 | 3300031548 | Bacteria | 1533 |
| 1097 | Ga0307514_10000529 | 3300031649 | Bacteria | 74752 |
| 1098 | Ga0307514_10063859 | 3300031649 | Bacteria | 2794 |
| 1099 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 1100 | Ga0265314_10171258 | 3300031711 | Bacteria | 1310 |
| 1101 | Ga0307405_10020362 | 3300031731 | Bacteria | 3706 |
| 1102 | Ga0307405_10071647 | 3300031731 | Bacteria | 2230 |
| 1103 | Ga0307405_10104581 | 3300031731 | Bacteria | 1905 |
| 1104 | Ga0307405_10265491 | 3300031731 | Bacteria | 1284 |
| 1105 | Ga0307518_10003759 | 3300031838 | Bacteria | 10903 |
| 1106 | Ga0307406_10002205 | 3300031901 | Bacteria | 10598 |
| 1107 | Ga0307406_10005358 | 3300031901 | Bacteria | 7022 |
| 1108 | Ga0307406_10102155 | 3300031901 | Bacteria | 1955 |
| 1109 | Ga0307406_10270813 | 3300031901 | Bacteria | 1290 |
| 1110 | Ga0307412_10001651 | 3300031911 | Bacteria | 12316 |
| 1111 | Ga0307412_10023576 | 3300031911 | Bacteria | 3789 |
| 1112 | Ga0307412_10039518 | 3300031911 | Bacteria | 3046 |
| 1113 | Ga0307412_10272685 | 3300031911 | Bacteria | 1324 |
| 1114 | Ga0307409_100228525 | 3300031995 | Bacteria | 1685 |
| 1115 | Ga0307409_100264339 | 3300031995 | Bacteria | 1581 |
| 1116 | Ga0307416_100039425 | 3300032002 | Bacteria | 3657 |
| 1117 | Ga0307416_100063101 | 3300032002 | Bacteria | 3033 |
| 1118 | Ga0307416_100077640 | 3300032002 | Bacteria | 2790 |
| 1119 | Ga0307416_100207503 | 3300032002 | Bacteria | 1865 |
| 1120 | Ga0307416_100260270 | 3300032002 | Bacteria | 1695 |
| 1121 | Ga0307416_100459308 | 3300032002 | Bacteria | 1328 |
| 1122 | Ga0307414_10021629 | 3300032004 | Bacteria | 4042 |
| 1123 | Ga0307414_10060819 | 3300032004 | Bacteria | 2673 |
| 1124 | Ga0307414_10149531 | 3300032004 | Bacteria | 1840 |
| 1125 | Ga0307414_10248893 | 3300032004 | Bacteria | 1476 |
| 1126 | Ga0307414_10273759 | 3300032004 | Bacteria | 1415 |
| 1127 | Ga0307414_10299834 | 3300032004 | Bacteria | 1359 |
| 1128 | Ga0307411_10011834 | 3300032005 | Bacteria | 4730 |
| 1129 | Ga0307411_10055799 | 3300032005 | Bacteria | 2601 |
| 1130 | Ga0307411_10138759 | 3300032005 | Bacteria | 1789 |
| 1131 | Ga0373930_0023220 | 3300034816 | Bacteria | 1232 |
| 1132 | Ga0373938_0003291 | 3300034957 | Bacteria | 2638 |
| 1133 | Ga0373926_0028170 | 3300035083 | Bacteria | 1971 |
| 1134 | Ga0373934_0000354 | 3300035086 | Bacteria | 16098 |
| 1135 | Ga0373934_0043424 | 3300035086 | Bacteria | 1776 |
| 1136 | Ga0373940_0003500 | 3300035088 | Bacteria | 3212 |
| 1137 | Ga0373949_0001408 | 3300035090 | Bacteria | 6875 |
| 1138 | Ga0373951_0003300 | 3300035091 | Bacteria | 3944 |
| 1139 | Ga0373951_0024329 | 3300035091 | Bacteria | 1402 |
| 1140 | Ga0373952_0009002 | 3300035092 | Bacteria | 1903 |
| 1141 | Ga0373923_0068441 | 3300035111 | Bacteria | 1520 |
| 1142 | Ga0373932_0081864 | 3300035112 | Bacteria | 1021 |
| 1143 | Ga0373939_0000003 | 3300035114 | Bacteria | 111914 |
| 1144 | Ga0373939_0001446 | 3300035114 | Bacteria | 5745 |
| 1145 | Ga0373939_0154864 | 3300035114 | Bacteria | 837 |
| 1146 | Ga0373941_0035388 | 3300035115 | Bacteria | 1512 |
| 1147 | Ga0373945_0004052 | 3300035116 | Bacteria | 4636 |
| 1148 | Ga0373953_0035690 | 3300035117 | Bacteria | 1955 |
| 1149 | Ga0373954_0001840 | 3300035118 | Bacteria | 8754 |
| 1150 | Ga0373954_0016077 | 3300035118 | Bacteria | 3348 |
| 1151 | Ga0373956_0000015 | 3300035119 | Bacteria | 52635 |
| 1152 | Ga0373957_0017254 | 3300035120 | Bacteria | 2511 |
| 1153 | Ga0373957_0094294 | 3300035120 | Bacteria | 1192 |
| 1154 | Ga0373960_0008398 | 3300035121 | Bacteria | 2474 |
| 1155 | Ga0373960_0010251 | 3300035121 | Bacteria | 2285 |
| 1156 | Ga0373943_0098144 | 3300035170 | Bacteria | 1528 |
| 1157 | Ga0373946_0013975 | 3300035171 | Bacteria | 3023 |
| 1158 | Ga0373946_0082579 | 3300035171 | Bacteria | 1410 |
| 1159 | Ga0373955_0006536 | 3300035172 | Bacteria | 5316 |
| 1160 | Ga0373942_0010868 | 3300035207 | Bacteria | 2148 |
| 1161 | Ga0373942_0035350 | 3300035207 | Bacteria | 1340 |
| 1162 | Ga0373961_0001706 | 3300035241 | Bacteria | 6116 |
| 1163 | Ga0373961_0013496 | 3300035241 | Bacteria | 2061 |
| 1164 | Ga0373961_0068433 | 3300035241 | Bacteria | 1093 |
| 1165 | Ga0373962_0018254 | 3300035242 | Bacteria | 1824 |
| 1166 | Ga0373962_0029896 | 3300035242 | Bacteria | 1488 |
| 1167 | Ga0373924_0009830 | 3300035410 | Bacteria | 3515 |
| 1168 | Ga0373924_0012738 | 3300035410 | Bacteria | 3147 |
| 1169 | Ga0373924_0034289 | 3300035410 | Bacteria | 2054 |
| 1170 | Ga0373931_0001534 | 3300035691 | Bacteria | 9955 |
| 1171 | Ga0373931_0008185 | 3300035691 | Bacteria | 4952 |
| 1172 | Ga0373931_0013914 | 3300035691 | Bacteria | 3926 |
| 1173 | Ga0373931_0052791 | 3300035691 | Bacteria | 2168 |
| 1174 | Ga0373931_0152206 | 3300035691 | Bacteria | 1349 |
| 1175 | Ga0373935_0020975 | 3300035692 | Bacteria | 3996 |
| 1176 | Ga0373935_0468308 | 3300035692 | Bacteria | 912 |
| 1177 | Ga0373927_0009992 | 3300035695 | Bacteria | 6359 |
| 1178 | Ga0373933_0001774 | 3300035724 | Bacteria | 12484 |
| 1179 | Ga0373933_0009434 | 3300035724 | Bacteria | 5330 |
| 1180 | Ga0373933_0056290 | 3300035724 | Bacteria | 2360 |
| 1181 | Ga0373947_0032531 | 3300035725 | Bacteria | 3074 |
| 1182 | Ga0373947_0033135 | 3300035725 | Bacteria | 3048 |
| 1183 | Ga0373937_0000182 | 3300036401 | Bacteria | 61628 |
| 1184 | Ga0373937_0020416 | 3300036401 | Bacteria | 5940 |
| 1185 | Ga0373937_0030398 | 3300036401 | Bacteria | 4893 |
| 1186 | Ga0373937_0056076 | 3300036401 | Bacteria | 3618 |
| 1187 | Ga0373937_0098771 | 3300036401 | Bacteria | 2708 |
| 1188 | Ga0373937_0150551 | 3300036401 | Bacteria | 2179 |
| 1189 | Ga0373937_0417361 | 3300036401 | Bacteria | 1273 |
| 1190 | Ga0373937_0723199 | 3300036401 | Bacteria | 942 |
| 1191 | Ga0373937_0723241 | 3300036401 | Bacteria | 942 |
| 1192 | Ga0373925_0004459 | 3300037068 | Bacteria | 10584 |
| 1193 | Ga0373925_0027813 | 3300037068 | Bacteria | 4139 |
| 1194 | Ga0373925_0037130 | 3300037068 | Bacteria | 3595 |
| 1195 | Ga0373925_0056356 | 3300037068 | Bacteria | 2944 |
| 1196 | Ga0373925_0079858 | 3300037068 | Bacteria | 2486 |
| 1197 | Ga0373925_0127429 | 3300037068 | Bacteria | 1982 |
| 1198 | Ga0395899_0003231 | 3300037312 | Bacteria | 12927 |
| 1199 | Ga0395899_0168227 | 3300037312 | Bacteria | 1545 |
| 1200 | Ga0395900_0000067 | 3300037418 | Bacteria | 193958 |
| 1201 | Ga0395900_0020030 | 3300037418 | Bacteria | 6821 |
| 1202 | Ga0395900_0282082 | 3300037418 | Bacteria | 1653 |
| 1203 | Ga0395898_0000214 | 3300037466 | Bacteria | 149002 |
| 1204 | Ga0395898_0002933 | 3300037466 | Bacteria | 19401 |
| 1205 | Ga0395898_0012009 | 3300037466 | Bacteria | 8967 |
| 1206 | Ga0395905_0000060 | 3300037471 | Bacteria | 193958 |
| 1207 | Ga0395905_0001506 | 3300037471 | Bacteria | 27863 |
| 1208 | Ga0395905_0002575 | 3300037471 | Bacteria | 19972 |
| 1209 | Ga0395905_0007574 | 3300037471 | Bacteria | 10789 |
| 1210 | Ga0395905_0030893 | 3300037471 | Bacteria | 5045 |
| 1211 | Ga0395905_0038449 | 3300037471 | Bacteria | 4490 |
| 1212 | Ga0395905_0068103 | 3300037471 | Bacteria | 3334 |
| 1213 | Ga0395905_0117467 | 3300037471 | Bacteria | 2499 |
| 1214 | Ga0395905_0418529 | 3300037471 | Bacteria | 1236 |
| 1215 | Ga0436364_0010042 | 3300037853 | Bacteria | 102214 |
| 1216 | Ga0436364_0062636 | 3300037853 | Bacteria | 1847 |
| 1217 | Ga0436364_0566936 | 3300037853 | Bacteria | 6471 |
| 1218 | Ga0436364_0839268 | 3300037853 | Bacteria | 1480 |
| 1219 | Ga0436364_1169737 | 3300037853 | Bacteria | 2077 |
| 1220 | Ga0436364_1266276 | 3300037853 | Bacteria | 2234 |
| 1221 | Ga0395901_0000063 | 3300038443 | Bacteria | 149493 |
| 1222 | Ga0395901_0019056 | 3300038443 | Bacteria | 7016 |
| 1223 | Ga0395901_0029770 | 3300038443 | Bacteria | 5623 |
| 1224 | Ga0395901_0059936 | 3300038443 | Bacteria | 3960 |
| 1225 | Ga0395901_0288219 | 3300038443 | Bacteria | 1704 |
| 1226 | Ga0395901_0431073 | 3300038443 | Bacteria | 1351 |
| 1227 | Ga0242420_015158 | 3300038996 | Bacteria | 1331 |
| 1228 | Ga0436365_1366850 | 3300039437 | Bacteria | 3078 |
| 1229 | Ga0436365_1630009 | 3300039437 | Bacteria | 3393 |
| 1230 | Ga0436365_1916586 | 3300039437 | Bacteria | 1313 |
| 1231 | Ga0436360_0286842 | 3300039438 | Bacteria | 1960 |
| 1232 | Ga0436360_0355657 | 3300039438 | Bacteria | 1509 |
| 1233 | Ga0436361_0225003 | 3300039447 | Bacteria | 2861 |
| 1234 | Ga0436361_0243008 | 3300039447 | Bacteria | 1980 |
| 1235 | Ga0436361_0953105 | 3300039447 | Bacteria | 3070 |
| 1236 | Ga0436361_0993124 | 3300039447 | Bacteria | 4758 |
| 1237 | Ga0436361_1161676 | 3300039447 | Bacteria | 1730 |
| 1238 | Ga0436363_0156420 | 3300039450 | Bacteria | 4595 |
| 1239 | Ga0436362_0196742 | 3300039453 | Bacteria | 2403 |
| 1240 | Ga0436362_0834131 | 3300039453 | Bacteria | 5455 |
| 1241 | Ga0439436_0001036 | 3300041404 | Bacteria | 7795 |
| 1242 | Ga0439436_0029804 | 3300041404 | Bacteria | 1587 |
| 1243 | Ga0439453_0001687 | 3300041408 | Bacteria | 2893 |
| 1244 | Ga0439453_0006616 | 3300041408 | Bacteria | 1811 |
| 1245 | Ga0439466_0004105 | 3300041411 | Bacteria | 5624 |
| 1246 | Ga0439465_0003246 | 3300041413 | Bacteria | 5308 |
| 1247 | Ga0439465_0030452 | 3300041413 | Bacteria | 1717 |
| 1248 | Ga0451793_0984015 | 3300041452 | Bacteria | 1481 |
| 1249 | Ga0451855_0956808 | 3300041511 | Bacteria | 996 |
| 1250 | Ga0439441_000869 | 3300042001 | Bacteria | 3641 |
| 1251 | Ga0439441_005968 | 3300042001 | Bacteria | 1913 |
| 1252 | Ga0439441_006581 | 3300042001 | Bacteria | 1849 |
| 1253 | Ga0439442_006805 | 3300042002 | Bacteria | 2295 |
| 1254 | Ga0439445_0004602 | 3300042004 | Bacteria | 3125 |
| 1255 | Ga0439448_0006616 | 3300042005 | Bacteria | 3336 |
| 1256 | Ga0439432_011973 | 3300042006 | Bacteria | 2980 |
| 1257 | Ga0439432_033561 | 3300042006 | Bacteria | 1650 |
| 1258 | Ga0439449_0005851 | 3300042007 | Bacteria | 4701 |
| 1259 | Ga0439450_011365 | 3300042008 | Bacteria | 1743 |
| 1260 | Ga0439452_001501 | 3300042010 | Bacteria | 9458 |
| 1261 | Ga0439452_007901 | 3300042010 | Bacteria | 3225 |
| 1262 | Ga0439457_005546 | 3300042014 | Bacteria | 3165 |
| 1263 | Ga0450898_013732 | 3300042134 | Bacteria | 1354 |
| 1264 | Ga0450904_000354 | 3300042139 | Bacteria | 9595 |
| 1265 | Ga0439435_0000194 | 3300042436 | Bacteria | 8520 |
| 1266 | Ga0439435_0017059 | 3300042436 | Bacteria | 1830 |
| 1267 | Ga0439444_0000843 | 3300042437 | Bacteria | 3709 |
| 1268 | Ga0439459_0000155 | 3300042438 | Bacteria | 7102 |
| 1269 | Ga0439464_0000442 | 3300042439 | Bacteria | 8224 |
| 1270 | Ga0439460_0000838 | 3300042461 | Bacteria | 7002 |
| 1271 | Ga0450918_002634 | 3300042531 | Bacteria | 3384 |
| 1272 | Ga0451577_0001624 | 3300042876 | Bacteria | 29180 |
| 1273 | Ga0451577_0001635 | 3300042876 | Bacteria | 29060 |
| 1274 | Ga0451577_0003247 | 3300042876 | Bacteria | 18283 |
| 1275 | Ga0451577_0005276 | 3300042876 | Bacteria | 13281 |
| 1276 | Ga0451577_0218301 | 3300042876 | Bacteria | 1723 |
| 1277 | Ga0451577_0298719 | 3300042876 | Bacteria | 1459 |
| 1278 | Ga0451577_0356967 | 3300042876 | Bacteria | 1326 |
| 1279 | Ga0451577_0463770 | 3300042876 | Bacteria | 1150 |
| 1280 | Ga0453683_0000034 | 3300044673 | Bacteria | 235218 |
| 1281 | Ga0453683_0000062 | 3300044673 | Bacteria | 179392 |
| 1282 | Ga0453683_0006980 | 3300044673 | Bacteria | 7698 |
| 1283 | Ga0453683_0023611 | 3300044673 | Bacteria | 3917 |
| 1284 | Ga0453683_0047761 | 3300044673 | Bacteria | 2684 |
| 1285 | Ga0466961_0005894 | 3300044693 | Bacteria | 7765 |
| 1286 | Ga0466964_0087945 | 3300044706 | Bacteria | 1347 |
| 1287 | Ga0453684_0000176 | 3300044712 | Bacteria | 283097 |
| 1288 | Ga0453684_0001136 | 3300044712 | Bacteria | 83233 |
| 1289 | Ga0453684_0001504 | 3300044712 | Bacteria | 65595 |
| 1290 | Ga0453684_0003087 | 3300044712 | Bacteria | 38449 |
| 1291 | Ga0453684_0070906 | 3300044712 | Bacteria | 4409 |
| 1292 | Ga0453684_0075888 | 3300044712 | Bacteria | 4222 |
| 1293 | Ga0453684_0085668 | 3300044712 | Bacteria | 3914 |
| 1294 | Ga0453684_0127159 | 3300044712 | Bacteria | 3065 |
| 1295 | Ga0453684_0146890 | 3300044712 | Bacteria | 2807 |
| 1296 | Ga0453684_0147429 | 3300044712 | Bacteria | 2801 |
| 1297 | Ga0453684_0229254 | 3300044712 | Bacteria | 2145 |
| 1298 | Ga0453684_0341477 | 3300044712 | Bacteria | 1690 |
| 1299 | Ga0453684_0475312 | 3300044712 | Bacteria | 1387 |
| 1300 | Ga0466968_0058950 | 3300044735 | Bacteria | 1653 |
| 1301 | Ga0466968_0078020 | 3300044735 | Bacteria | 1451 |
| 1302 | Ga0466960_0078530 | 3300044901 | Bacteria | 1658 |
| 1303 | Ga0451576_0000260 | 3300045051 | Bacteria | 129222 |
| 1304 | Ga0451576_0001433 | 3300045051 | Bacteria | 40801 |
| 1305 | Ga0451576_0003830 | 3300045051 | Bacteria | 20213 |
| 1306 | Ga0451576_0019396 | 3300045051 | Bacteria | 7423 |
| 1307 | Ga0451576_0021367 | 3300045051 | Bacteria | 7033 |
| 1308 | Ga0451576_0048843 | 3300045051 | Bacteria | 4442 |
| 1309 | Ga0451576_0177123 | 3300045051 | Bacteria | 2226 |
| 1310 | Ga0451576_0342782 | 3300045051 | Bacteria | 1564 |
| 1311 | Ga0451576_0520121 | 3300045051 | Bacteria | 1250 |
| 1312 | Ga0466967_0126727 | 3300045976 | Bacteria | 2366 |
| 1313 | Ga0495592_0024915 | 3300046454 | Bacteria | 4546 |
| 1314 | Ga0495592_0086140 | 3300046454 | Bacteria | 2263 |
| 1315 | Ga0495603_0005200 | 3300046455 | Bacteria | 7769 |
| 1316 | Ga0495603_0095269 | 3300046455 | Bacteria | 1739 |
| 1317 | Ga0495603_0100081 | 3300046455 | Bacteria | 1692 |
| 1318 | Ga0495590_0061125 | 3300046457 | Bacteria | 1319 |
| 1319 | Ga0495629_0000037 | 3300046459 | Bacteria | 117099 |
| 1320 | Ga0495629_0001156 | 3300046459 | Bacteria | 20848 |
| 1321 | Ga0495629_0001563 | 3300046459 | Bacteria | 17991 |
| 1322 | Ga0495629_0033042 | 3300046459 | Bacteria | 3661 |
| 1323 | Ga0495629_0042196 | 3300046459 | Bacteria | 3206 |
| 1324 | Ga0495638_0000141 | 3300046460 | Bacteria | 114543 |
| 1325 | Ga0495638_0000224 | 3300046460 | Bacteria | 77870 |
| 1326 | Ga0495638_0043959 | 3300046460 | Bacteria | 2816 |
| 1327 | Ga0495638_0222369 | 3300046460 | Bacteria | 1054 |
| 1328 | Ga0495651_0000027 | 3300046462 | Bacteria | 107496 |
| 1329 | Ga0495651_0000976 | 3300046462 | Bacteria | 22172 |
| 1330 | Ga0495651_0088242 | 3300046462 | Bacteria | 2331 |
| 1331 | Ga0495651_0094542 | 3300046462 | Bacteria | 2236 |
| 1332 | Ga0495653_0000048 | 3300046463 | Bacteria | 109560 |
| 1333 | Ga0495653_0024941 | 3300046463 | Bacteria | 4812 |
| 1334 | Ga0495653_0030237 | 3300046463 | Bacteria | 4316 |
| 1335 | Ga0495650_0000826 | 3300046471 | Bacteria | 37460 |
| 1336 | Ga0495650_0001789 | 3300046471 | Bacteria | 19410 |
| 1337 | Ga0495580_0000118 | 3300046472 | Bacteria | 54013 |
| 1338 | Ga0495580_0002319 | 3300046472 | Bacteria | 16596 |
| 1339 | Ga0495580_0006778 | 3300046472 | Bacteria | 9286 |
| 1340 | Ga0495580_0010671 | 3300046472 | Bacteria | 7135 |
| 1341 | Ga0495580_0031152 | 3300046472 | Bacteria | 3857 |
| 1342 | Ga0495580_0077628 | 3300046472 | Bacteria | 2316 |
| 1343 | Ga0495580_0271061 | 3300046472 | Bacteria | 1159 |
| 1344 | Ga0495580_0296838 | 3300046472 | Bacteria | 1101 |
| 1345 | Ga0495582_0037321 | 3300046473 | Bacteria | 2672 |
| 1346 | Ga0495582_0044004 | 3300046473 | Bacteria | 2459 |
| 1347 | Ga0495582_0052018 | 3300046473 | Bacteria | 2259 |
| 1348 | Ga0495582_0056914 | 3300046473 | Bacteria | 2155 |
| 1349 | Ga0495582_0083908 | 3300046473 | Bacteria | 1770 |
| 1350 | Ga0495605_0001125 | 3300046474 | Bacteria | 17767 |
| 1351 | Ga0495605_0029999 | 3300046474 | Bacteria | 2792 |
| 1352 | Ga0495639_0018609 | 3300046475 | Bacteria | 3026 |
| 1353 | Ga0495639_0038886 | 3300046475 | Bacteria | 2137 |
| 1354 | Ga0495664_0018484 | 3300046477 | Bacteria | 3995 |
| 1355 | Ga0495584_0017031 | 3300046491 | Bacteria | 3704 |
| 1356 | Ga0495584_0040860 | 3300046491 | Bacteria | 2341 |
| 1357 | Ga0495584_0069962 | 3300046491 | Bacteria | 1763 |
| 1358 | Ga0495585_0060670 | 3300046492 | Bacteria | 2081 |
| 1359 | Ga0495594_0096669 | 3300046499 | Bacteria | 1659 |
| 1360 | Ga0495594_0250500 | 3300046499 | Bacteria | 1009 |
| 1361 | Ga0495596_0001244 | 3300046500 | Bacteria | 14824 |
| 1362 | Ga0495583_0003335 | 3300046506 | Bacteria | 12418 |
| 1363 | Ga0495583_0007472 | 3300046506 | Bacteria | 6854 |
| 1364 | Ga0495583_0031542 | 3300046506 | Bacteria | 2568 |
| 1365 | Ga0495583_0075780 | 3300046506 | Bacteria | 1471 |
| 1366 | Ga0495606_0007939 | 3300046507 | Bacteria | 9349 |
| 1367 | Ga0495606_0015733 | 3300046507 | Bacteria | 5809 |
| 1368 | Ga0495606_0152013 | 3300046507 | Bacteria | 1358 |
| 1369 | Ga0495608_0005730 | 3300046511 | Bacteria | 8865 |
| 1370 | Ga0495608_0059291 | 3300046511 | Bacteria | 2522 |
| 1371 | Ga0495610_0001332 | 3300046512 | Bacteria | 21933 |
| 1372 | Ga0495610_0009568 | 3300046512 | Bacteria | 6112 |
| 1373 | Ga0495610_0071087 | 3300046512 | Bacteria | 1623 |
| 1374 | Ga0495610_0090370 | 3300046512 | Bacteria | 1389 |
| 1375 | Ga0495616_0002253 | 3300046513 | Bacteria | 12909 |
| 1376 | Ga0495616_0048733 | 3300046513 | Bacteria | 2126 |
| 1377 | Ga0495618_0050931 | 3300046514 | Bacteria | 2616 |
| 1378 | Ga0495618_0236487 | 3300046514 | Bacteria | 1149 |
| 1379 | Ga0495620_0001081 | 3300046515 | Bacteria | 16662 |
| 1380 | Ga0495620_0026465 | 3300046515 | Bacteria | 2728 |
| 1381 | Ga0495628_0008183 | 3300046516 | Bacteria | 8992 |
| 1382 | Ga0495628_0253991 | 3300046516 | Bacteria | 1311 |
| 1383 | Ga0495630_0020974 | 3300046517 | Bacteria | 4823 |
| 1384 | Ga0495630_0106023 | 3300046517 | Bacteria | 2128 |
| 1385 | Ga0495631_0000589 | 3300046518 | Bacteria | 24095 |
| 1386 | Ga0495631_0008142 | 3300046518 | Bacteria | 5292 |
| 1387 | Ga0495632_0053727 | 3300046519 | Bacteria | 1977 |
| 1388 | Ga0495637_0004897 | 3300046520 | Bacteria | 6893 |
| 1389 | Ga0495643_0020848 | 3300046522 | Bacteria | 3771 |
| 1390 | Ga0495648_0009825 | 3300046524 | Bacteria | 7354 |
| 1391 | Ga0495648_0022823 | 3300046524 | Bacteria | 4297 |
| 1392 | Ga0495648_0102298 | 3300046524 | Bacteria | 1578 |
| 1393 | Ga0495663_0076584 | 3300046525 | Bacteria | 1072 |
| 1394 | Ga0495642_0005361 | 3300046528 | Bacteria | 4918 |
| 1395 | Ga0495652_0010377 | 3300046529 | Bacteria | 8442 |
| 1396 | Ga0495652_0021029 | 3300046529 | Bacteria | 5800 |
| 1397 | Ga0495652_0037153 | 3300046529 | Bacteria | 4227 |
| 1398 | Ga0495654_0005300 | 3300046530 | Bacteria | 7518 |
| 1399 | Ga0495654_0025422 | 3300046530 | Bacteria | 3050 |
| 1400 | Ga0495654_0063047 | 3300046530 | Bacteria | 1776 |
| 1401 | Ga0495665_0000612 | 3300046531 | Bacteria | 18163 |
| 1402 | Ga0495665_0019635 | 3300046531 | Bacteria | 3635 |
| 1403 | Ga0495665_0021631 | 3300046531 | Bacteria | 3457 |
| 1404 | Ga0495640_0168370 | 3300046533 | Bacteria | 1401 |
| 1405 | Ga0495586_0009675 | 3300046535 | Bacteria | 5133 |
| 1406 | Ga0495587_0000911 | 3300046536 | Bacteria | 19535 |
| 1407 | Ga0495587_0066254 | 3300046536 | Bacteria | 2107 |
| 1408 | Ga0495598_0033446 | 3300046537 | Bacteria | 1460 |
| 1409 | Ga0495598_0095558 | 3300046537 | Bacteria | 976 |
| 1410 | Ga0495609_0000638 | 3300046538 | Bacteria | 27258 |
| 1411 | Ga0495621_0002683 | 3300046539 | Bacteria | 4821 |
| 1412 | Ga0495597_0000116 | 3300046542 | Bacteria | 72210 |
| 1413 | Ga0495597_0000268 | 3300046542 | Bacteria | 47622 |
| 1414 | Ga0495597_0005056 | 3300046542 | Bacteria | 7056 |
| 1415 | Ga0495597_0010288 | 3300046542 | Bacteria | 4578 |
| 1416 | Ga0495597_0082770 | 3300046542 | Bacteria | 1371 |
| 1417 | Ga0495645_0002149 | 3300046543 | Bacteria | 13377 |
| 1418 | Ga0495645_0013977 | 3300046543 | Bacteria | 5689 |
| 1419 | Ga0495645_0116543 | 3300046543 | Bacteria | 1885 |
| 1420 | Ga0495645_0126428 | 3300046543 | Bacteria | 1796 |
| 1421 | Ga0495622_0020911 | 3300046557 | Bacteria | 3047 |
| 1422 | Ga0495622_0068712 | 3300046557 | Bacteria | 1636 |
| 1423 | Ga0495633_0004788 | 3300046558 | Bacteria | 8483 |
| 1424 | Ga0495633_0019675 | 3300046558 | Bacteria | 3410 |
| 1425 | Ga0495667_0003799 | 3300046559 | Bacteria | 10137 |
| 1426 | Ga0495667_0090727 | 3300046559 | Bacteria | 1980 |
| 1427 | Ga0495667_0099507 | 3300046559 | Bacteria | 1882 |
| 1428 | Ga0495656_0002728 | 3300046615 | Bacteria | 5899 |
| 1429 | Ga0495656_0008420 | 3300046615 | Bacteria | 3679 |
| 1430 | Ga0495656_0172689 | 3300046615 | Bacteria | 1058 |
| 1431 | Ga0495668_0047548 | 3300046616 | Bacteria | 2382 |
| 1432 | Ga0495668_0150835 | 3300046616 | Bacteria | 1273 |
| 1433 | Ga0495634_0232010 | 3300046642 | Bacteria | 1135 |
| 1434 | Ga0495611_0012765 | 3300046648 | Bacteria | 3570 |
| 1435 | Ga0495611_0081780 | 3300046648 | Bacteria | 1486 |
| 1436 | Ga0495625_0001339 | 3300046660 | Bacteria | 30508 |
| 1437 | Ga0495625_0008416 | 3300046660 | Bacteria | 8808 |
| 1438 | Ga0495625_0057538 | 3300046660 | Bacteria | 2764 |
| 1439 | Ga0495625_0134870 | 3300046660 | Bacteria | 1670 |
| 1440 | Ga0495625_0187669 | 3300046660 | Bacteria | 1371 |
| 1441 | Ga0495635_0010092 | 3300046663 | Bacteria | 6603 |
| 1442 | Ga0495635_0033796 | 3300046663 | Bacteria | 3547 |
| 1443 | Ga0495659_0011648 | 3300046664 | Bacteria | 2834 |
| 1444 | Ga0495661_0050951 | 3300046665 | Bacteria | 2502 |
| 1445 | Ga0495588_0014032 | 3300046674 | Bacteria | 3828 |
| 1446 | Ga0495588_0049665 | 3300046674 | Bacteria | 2158 |
| 1447 | Ga0495588_0082506 | 3300046674 | Bacteria | 1679 |
| 1448 | Ga0495588_0245111 | 3300046674 | Bacteria | 945 |
| 1449 | Ga0495657_0024016 | 3300046675 | Bacteria | 4348 |
| 1450 | Ga0495657_0181205 | 3300046675 | Bacteria | 1293 |
| 1451 | Ga0495599_0011662 | 3300046678 | Bacteria | 5407 |
| 1452 | Ga0495599_0151313 | 3300046678 | Bacteria | 1437 |
| 1453 | Ga0495623_0023846 | 3300046679 | Bacteria | 3947 |
| 1454 | Ga0495623_0036194 | 3300046679 | Bacteria | 3163 |
| 1455 | Ga0495623_0053265 | 3300046679 | Bacteria | 2555 |
| 1456 | Ga0495646_0006008 | 3300046680 | Bacteria | 7696 |
| 1457 | Ga0495646_0015480 | 3300046680 | Bacteria | 4839 |
| 1458 | Ga0495646_0028518 | 3300046680 | Bacteria | 3494 |
| 1459 | Ga0495647_0039540 | 3300046681 | Bacteria | 1788 |
| 1460 | Ga0495658_0010276 | 3300046683 | Bacteria | 4681 |
| 1461 | Ga0495658_0017275 | 3300046683 | Bacteria | 3724 |
| 1462 | Ga0495658_0035696 | 3300046683 | Bacteria | 2738 |
| 1463 | Ga0495658_0091110 | 3300046683 | Bacteria | 1805 |
| 1464 | Ga0495613_0004559 | 3300046689 | Bacteria | 10393 |
| 1465 | Ga0495613_0010190 | 3300046689 | Bacteria | 6982 |
| 1466 | Ga0495613_0031127 | 3300046689 | Bacteria | 3963 |
| 1467 | Ga0495613_0034682 | 3300046689 | Bacteria | 3747 |
| 1468 | Ga0495613_0075962 | 3300046689 | Bacteria | 2446 |
| 1469 | Ga0495624_0010363 | 3300046690 | Bacteria | 6422 |
| 1470 | Ga0495624_0044611 | 3300046690 | Bacteria | 2826 |
| 1471 | Ga0495670_0032094 | 3300046691 | Bacteria | 2611 |
| 1472 | Ga0495670_0035154 | 3300046691 | Bacteria | 2496 |
| 1473 | Ga0495670_0099230 | 3300046691 | Bacteria | 1498 |
| 1474 | Ga0495670_0115320 | 3300046691 | Bacteria | 1393 |
| 1475 | Ga0495671_0029873 | 3300046692 | Bacteria | 2795 |
| 1476 | Ga0495649_0007039 | 3300046694 | Bacteria | 6924 |
| 1477 | Ga0495649_0012076 | 3300046694 | Bacteria | 5039 |
| 1478 | Ga0495649_0027776 | 3300046694 | Bacteria | 3138 |
| 1479 | Ga0495649_0032739 | 3300046694 | Bacteria | 2862 |
| 1480 | Ga0495649_0164652 | 3300046694 | Bacteria | 1162 |
| 1481 | Ga0495589_0011570 | 3300046794 | Bacteria | 4581 |
| 1482 | Ga0495589_0018414 | 3300046794 | Bacteria | 3580 |
| 1483 | Ga0495600_0021667 | 3300046809 | Bacteria | 4119 |
| 1484 | Ga0495600_0045959 | 3300046809 | Bacteria | 2849 |
| 1485 | Ga0495600_0056973 | 3300046809 | Bacteria | 2553 |
| 1486 | Ga0495600_0108390 | 3300046809 | Bacteria | 1809 |
| 1487 | Ga0495600_0161621 | 3300046809 | Bacteria | 1448 |
| 1488 | Ga0495660_0046843 | 3300046810 | Bacteria | 2370 |
| 1489 | Ga0495581_0001747 | 3300047315 | Bacteria | 12126 |
| 1490 | Ga0495581_0002351 | 3300047315 | Bacteria | 10667 |
| 1491 | Ga0495604_0001863 | 3300047317 | Bacteria | 17177 |
| 1492 | Ga0495604_0020790 | 3300047317 | Bacteria | 5240 |
| 1493 | Ga0495674_0001578 | 3300047319 | Bacteria | 22344 |
| 1494 | Ga0495674_0002056 | 3300047319 | Bacteria | 19727 |
| 1495 | Ga0495674_0002205 | 3300047319 | Bacteria | 19149 |
| 1496 | Ga0495674_0005323 | 3300047319 | Bacteria | 12343 |
| 1497 | Ga0495674_0203242 | 3300047319 | Bacteria | 1643 |
| 1498 | Ga0495674_0363455 | 3300047319 | Bacteria | 1173 |
| 1499 | Ga0495674_0408047 | 3300047319 | Bacteria | 1096 |
| 1500 | Ga0495672_0003207 | 3300047320 | Bacteria | 14219 |
| 1501 | Ga0495672_0003446 | 3300047320 | Bacteria | 13529 |
| 1502 | Ga0495672_0011051 | 3300047320 | Bacteria | 6394 |
| 1503 | Ga0495672_0026030 | 3300047320 | Bacteria | 3737 |
| 1504 | Ga0495672_0057541 | 3300047320 | Bacteria | 2257 |
| 1505 | Ga0495672_0088939 | 3300047320 | Bacteria | 1701 |
| 1506 | Ga0495676_0024655 | 3300047321 | Bacteria | 5203 |
| 1507 | Ga0495676_0052608 | 3300047321 | Bacteria | 3249 |
| 1508 | Ga0495676_0428655 | 3300047321 | Bacteria | 874 |
| 1509 | Ga0495680_0007430 | 3300047322 | Bacteria | 10048 |
| 1510 | Ga0495680_0016527 | 3300047322 | Bacteria | 6335 |
| 1511 | Ga0495680_0028529 | 3300047322 | Bacteria | 4575 |
| 1512 | Ga0495680_0040974 | 3300047322 | Bacteria | 3685 |
| 1513 | Ga0495683_0002291 | 3300047323 | Bacteria | 11670 |
| 1514 | Ga0495683_0019244 | 3300047323 | Bacteria | 3524 |
| 1515 | Ga0495683_0096770 | 3300047323 | Bacteria | 1424 |
| 1516 | Ga0495687_003219 | 3300047443 | Bacteria | 12089 |
| 1517 | Ga0495675_0053087 | 3300047444 | Bacteria | 2573 |
| 1518 | Ga0495677_0005821 | 3300047445 | Bacteria | 4665 |
| 1519 | Ga0495673_0020505 | 3300047469 | Bacteria | 3289 |
| 1520 | Ga0495673_0083582 | 3300047469 | Bacteria | 1317 |
| 1521 | Ga0495684_0011986 | 3300047471 | Bacteria | 6684 |
| 1522 | Ga0495684_0015752 | 3300047471 | Bacteria | 5817 |
| 1523 | Ga0495684_0210709 | 3300047471 | Bacteria | 1429 |
| 1524 | Ga0495593_0003668 | 3300047673 | Bacteria | 9166 |
| 1525 | Ga0495593_0014086 | 3300047673 | Bacteria | 4551 |
| 1526 | Ga0495593_0026716 | 3300047673 | Bacteria | 3184 |
| 1527 | Ga0495593_0050189 | 3300047673 | Bacteria | 2211 |
| 1528 | Ga0495602_0012427 | 3300048088 | Bacteria | 8754 |
| 1529 | Ga0495602_0013432 | 3300048088 | Bacteria | 8370 |
| 1530 | Ga0495602_0030864 | 3300048088 | Bacteria | 5076 |
| 1531 | Ga0495602_0040234 | 3300048088 | Bacteria | 4291 |
| 1532 | Ga0495602_0151047 | 3300048088 | Bacteria | 1826 |
| 1533 | Ga0495614_0002409 | 3300048089 | Bacteria | 8314 |
| 1534 | Ga0495614_0003269 | 3300048089 | Bacteria | 7242 |
| 1535 | Ga0495614_0039818 | 3300048089 | Bacteria | 2017 |
| 1536 | Ga0495614_0122828 | 3300048089 | Bacteria | 1146 |
| 1537 | Ga0495615_0006944 | 3300048090 | Bacteria | 2126 |
| 1538 | Ga0495626_0011832 | 3300048091 | Bacteria | 4596 |
| 1539 | Ga0495626_0026060 | 3300048091 | Bacteria | 2853 |
| 1540 | Ga0496100_0002293 | 3300048903 | Bacteria | 9676 |
| 1541 | Ga0496100_0013989 | 3300048903 | Bacteria | 4646 |
| 1542 | Ga0496100_0046783 | 3300048903 | Bacteria | 2784 |
| 1543 | Ga0496100_0176376 | 3300048903 | Bacteria | 1543 |
| 1544 | Ga0496101_0003592 | 3300048904 | Bacteria | 9679 |
| 1545 | Ga0496101_0040730 | 3300048904 | Bacteria | 3309 |
| 1546 | Ga0496101_0113226 | 3300048904 | Bacteria | 2044 |
| 1547 | Ga0496101_0159102 | 3300048904 | Bacteria | 1732 |
| 1548 | Ga0496101_0245487 | 3300048904 | Bacteria | 1394 |
| 1549 | Ga0496102_0005918 | 3300048905 | Bacteria | 10413 |
| 1550 | Ga0496102_0016898 | 3300048905 | Bacteria | 6385 |
| 1551 | Ga0496102_0273735 | 3300048905 | Bacteria | 1592 |
| 1552 | Ga0496103_0002596 | 3300048906 | Bacteria | 11311 |
| 1553 | Ga0496103_0006318 | 3300048906 | Bacteria | 7084 |
| 1554 | Ga0496103_0053072 | 3300048906 | Bacteria | 2512 |
| 1555 | Ga0496103_0071606 | 3300048906 | Bacteria | 2170 |
| 1556 | Ga0496104_0006365 | 3300048907 | Bacteria | 10386 |
| 1557 | Ga0496104_0012609 | 3300048907 | Bacteria | 7607 |
| 1558 | Ga0496104_0013003 | 3300048907 | Bacteria | 7494 |
| 1559 | Ga0496104_0015712 | 3300048907 | Bacteria | 6866 |
| 1560 | Ga0496104_0059727 | 3300048907 | Bacteria | 3610 |
| 1561 | Ga0496104_0129718 | 3300048907 | Bacteria | 2421 |
| 1562 | Ga0496104_0210022 | 3300048907 | Bacteria | 1858 |
| 1563 | Ga0496104_0226187 | 3300048907 | Bacteria | 1783 |
| 1564 | Ga0496104_0605812 | 3300048907 | Bacteria | 1005 |
| 1565 | Ga0496105_0001841 | 3300048908 | Bacteria | 15201 |
| 1566 | Ga0496105_0004700 | 3300048908 | Bacteria | 10297 |
| 1567 | Ga0496105_0029729 | 3300048908 | Bacteria | 4473 |
| 1568 | Ga0496105_0265993 | 3300048908 | Bacteria | 1386 |
| 1569 | Ga0496106_0011982 | 3300048909 | Bacteria | 6398 |
| 1570 | Ga0496106_0022766 | 3300048909 | Bacteria | 4655 |
| 1571 | Ga0496106_0066727 | 3300048909 | Bacteria | 2741 |
| 1572 | Ga0496106_0192365 | 3300048909 | Bacteria | 1623 |
| 1573 | Ga0496106_0253620 | 3300048909 | Bacteria | 1407 |
| 1574 | Ga0496107_0028075 | 3300048910 | Bacteria | 3998 |
| 1575 | Ga0496107_0052544 | 3300048910 | Bacteria | 2939 |
| 1576 | Ga0496107_0194657 | 3300048910 | Bacteria | 1507 |
| 1577 | Ga0496108_0008415 | 3300048911 | Bacteria | 8373 |
| 1578 | Ga0496108_0020388 | 3300048911 | Bacteria | 5450 |
| 1579 | Ga0496108_0173537 | 3300048911 | Bacteria | 1866 |
| 1580 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 1581 | Ga0496109_0030918 | 3300048912 | Bacteria | 4801 |
| 1582 | Ga0496109_0089960 | 3300048912 | Bacteria | 2839 |
| 1583 | Ga0496109_0094897 | 3300048912 | Bacteria | 2761 |
| 1584 | Ga0496109_0151258 | 3300048912 | Bacteria | 2173 |
| 1585 | Ga0496110_0011628 | 3300048913 | Bacteria | 7216 |
| 1586 | Ga0496110_0039591 | 3300048913 | Bacteria | 4105 |
| 1587 | Ga0496110_0163165 | 3300048913 | Bacteria | 2020 |
| 1588 | Ga0496110_0189532 | 3300048913 | Bacteria | 1868 |
| 1589 | Ga0496110_0264582 | 3300048913 | Bacteria | 1565 |
| 1590 | Ga0496110_0374126 | 3300048913 | Bacteria | 1298 |
| 1591 | Ga0496111_0014962 | 3300048914 | Bacteria | 5315 |
| 1592 | Ga0496111_0219626 | 3300048914 | Bacteria | 1412 |
| 1593 | Ga0496112_0008342 | 3300048915 | Bacteria | 9275 |
| 1594 | Ga0496112_0175434 | 3300048915 | Bacteria | 2108 |
| 1595 | Ga0496112_0189155 | 3300048915 | Bacteria | 2021 |
| 1596 | Ga0496112_0418747 | 3300048915 | Bacteria | 1278 |
| 1597 | Ga0496112_0480506 | 3300048915 | Bacteria | 1179 |
| 1598 | Ga0496113_0022983 | 3300048916 | Bacteria | 4418 |
| 1599 | Ga0496113_0109824 | 3300048916 | Bacteria | 2145 |
| 1600 | Ga0496113_0262484 | 3300048916 | Bacteria | 1380 |
| 1601 | Ga0496114_0004834 | 3300048917 | Bacteria | 10496 |
| 1602 | Ga0496114_0011440 | 3300048917 | Bacteria | 7091 |
| 1603 | Ga0496114_0030392 | 3300048917 | Bacteria | 4444 |
| 1604 | Ga0496114_0134938 | 3300048917 | Bacteria | 2134 |
| 1605 | Ga0496114_0333219 | 3300048917 | Bacteria | 1342 |
| 1606 | Ga0496114_0546153 | 3300048917 | Bacteria | 1024 |
| 1607 | Ga0496115_0019198 | 3300048918 | Bacteria | 5259 |
| 1608 | Ga0496115_0042078 | 3300048918 | Bacteria | 3639 |
| 1609 | Ga0496116_0002454 | 3300048919 | Bacteria | 19457 |
| 1610 | Ga0496116_0022481 | 3300048919 | Bacteria | 4723 |
| 1611 | Ga0496116_0027209 | 3300048919 | Bacteria | 4166 |
| 1612 | Ga0496116_0032935 | 3300048919 | Bacteria | 3686 |
| 1613 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1614 | Ga0496117_0000105 | 3300048920 | Bacteria | 188970 |
| 1615 | Ga0496117_0020434 | 3300048920 | Bacteria | 5398 |
| 1616 | Ga0496117_0083704 | 3300048920 | Bacteria | 2084 |
| 1617 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 1618 | Ga0496118_0004662 | 3300048921 | Bacteria | 16079 |
| 1619 | Ga0496118_0089002 | 3300048921 | Bacteria | 2133 |
| 1620 | Ga0496118_0107375 | 3300048921 | Bacteria | 1864 |
| 1621 | Ga0496121_0000511 | 3300048924 | Bacteria | 73863 |
| 1622 | Ga0496121_0005938 | 3300048924 | Bacteria | 15445 |
| 1623 | Ga0496121_0010809 | 3300048924 | Bacteria | 10222 |
| 1624 | Ga0496121_0012354 | 3300048924 | Bacteria | 9334 |
| 1625 | Ga0496121_0041760 | 3300048924 | Bacteria | 4003 |
| 1626 | Ga0496121_0171540 | 3300048924 | Bacteria | 1575 |
| 1627 | Ga0496122_0000342 | 3300048925 | Bacteria | 100753 |
| 1628 | Ga0496122_0002912 | 3300048925 | Bacteria | 23381 |
| 1629 | Ga0496122_0025741 | 3300048925 | Bacteria | 5097 |
| 1630 | Ga0496122_0029962 | 3300048925 | Bacteria | 4572 |
| 1631 | Ga0496122_0058371 | 3300048925 | Bacteria | 2857 |
| 1632 | Ga0496122_0146357 | 3300048925 | Bacteria | 1467 |
| 1633 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 1634 | Ga0496123_0002872 | 3300048926 | Bacteria | 20237 |
| 1635 | Ga0496123_0055606 | 3300048926 | Bacteria | 2594 |
| 1636 | Ga0496124_0043856 | 3300048927 | Bacteria | 3841 |
| 1637 | Ga0496124_0127138 | 3300048927 | Bacteria | 2029 |
| 1638 | Ga0496124_0157093 | 3300048927 | Bacteria | 1777 |
| 1639 | Ga0496125_0001605 | 3300048928 | Bacteria | 31945 |
| 1640 | Ga0496125_0009940 | 3300048928 | Bacteria | 9672 |
| 1641 | Ga0496125_0011221 | 3300048928 | Bacteria | 8981 |
| 1642 | Ga0496125_0045201 | 3300048928 | Bacteria | 3710 |
| 1643 | Ga0496125_0048499 | 3300048928 | Bacteria | 3540 |
| 1644 | Ga0496125_0055066 | 3300048928 | Bacteria | 3244 |
| 1645 | Ga0496125_0111121 | 3300048928 | Bacteria | 1984 |
| 1646 | Ga0496126_0148492 | 3300048929 | Bacteria | 2011 |
| 1647 | Ga0496126_0330767 | 3300048929 | Bacteria | 1250 |
| 1648 | Ga0495678_023009 | 3300049459 | Bacteria | 2716 |
| 1649 | Ga0495682_0036496 | 3300049460 | Bacteria | 1810 |
| 1650 | Ga0501031_0098741 | 3300049568 | Bacteria | 1905 |
| 1651 | Ga0501032_0016838 | 3300049569 | Bacteria | 5136 |
| 1652 | Ga0501033_0000318 | 3300049570 | Bacteria | 45707 |
| 1653 | Ga0501033_0008248 | 3300049570 | Bacteria | 8065 |
| 1654 | Ga0501033_0035836 | 3300049570 | Bacteria | 3719 |
| 1655 | Ga0501033_0042576 | 3300049570 | Bacteria | 3385 |
| 1656 | Ga0501034_0000067 | 3300049571 | Bacteria | 184398 |
| 1657 | Ga0501034_0000423 | 3300049571 | Bacteria | 70979 |
| 1658 | Ga0501034_0000516 | 3300049571 | Bacteria | 62005 |
| 1659 | Ga0501034_0012327 | 3300049571 | Bacteria | 8831 |
| 1660 | Ga0501034_0026019 | 3300049571 | Bacteria | 5960 |
| 1661 | Ga0501034_0137086 | 3300049571 | Bacteria | 2428 |
| 1662 | Ga0501034_0144539 | 3300049571 | Bacteria | 2356 |
| 1663 | Ga0501036_0049064 | 3300049572 | Bacteria | 3574 |
| 1664 | Ga0501036_0105363 | 3300049572 | Bacteria | 2385 |
| 1665 | Ga0501036_0236317 | 3300049572 | Bacteria | 1533 |
| 1666 | Ga0501036_0475565 | 3300049572 | Bacteria | 1040 |
| 1667 | Ga0501037_0000136 | 3300049573 | Bacteria | 68536 |
| 1668 | Ga0501038_0035538 | 3300049574 | Bacteria | 4374 |
| 1669 | Ga0501038_0070876 | 3300049574 | Bacteria | 2958 |
| 1670 | Ga0501039_0078580 | 3300049575 | Bacteria | 2567 |
| 1671 | Ga0501039_0344861 | 3300049575 | Bacteria | 1170 |
| 1672 | Ga0501040_0000097 | 3300049576 | Bacteria | 43974 |
| 1673 | Ga0501040_0007189 | 3300049576 | Bacteria | 7210 |
| 1674 | Ga0501040_0013223 | 3300049576 | Bacteria | 5428 |
| 1675 | Ga0501040_0060122 | 3300049576 | Bacteria | 2611 |
| 1676 | Ga0501040_0222903 | 3300049576 | Bacteria | 1342 |
| 1677 | Ga0501041_0002429 | 3300049577 | Bacteria | 10567 |
| 1678 | Ga0501041_0004393 | 3300049577 | Bacteria | 8160 |
| 1679 | Ga0501041_0011279 | 3300049577 | Bacteria | 5283 |
| 1680 | Ga0501041_0105269 | 3300049577 | Bacteria | 1748 |
| 1681 | Ga0501042_0000054 | 3300049578 | Bacteria | 40211 |
| 1682 | Ga0501042_0001617 | 3300049578 | Bacteria | 13402 |
| 1683 | Ga0501042_0087488 | 3300049578 | Bacteria | 2235 |
| 1684 | Ga0501042_0089192 | 3300049578 | Bacteria | 2213 |
| 1685 | Ga0501042_0114618 | 3300049578 | Bacteria | 1941 |
| 1686 | Ga0501043_0000006 | 3300049579 | Bacteria | 234413 |
| 1687 | Ga0501043_0037239 | 3300049579 | Bacteria | 3826 |
| 1688 | Ga0501043_0076715 | 3300049579 | Bacteria | 2626 |
| 1689 | Ga0501043_0503752 | 3300049579 | Bacteria | 904 |
| 1690 | Ga0501046_0000221 | 3300049580 | Bacteria | 59296 |
| 1691 | Ga0501046_0046978 | 3300049580 | Bacteria | 3425 |
| 1692 | Ga0501046_0080662 | 3300049580 | Bacteria | 2514 |
| 1693 | Ga0501047_0005589 | 3300049581 | Bacteria | 11838 |
| 1694 | Ga0501047_0014025 | 3300049581 | Bacteria | 7615 |
| 1695 | Ga0501047_0055700 | 3300049581 | Bacteria | 3823 |
| 1696 | Ga0501047_0129283 | 3300049581 | Bacteria | 2406 |
| 1697 | Ga0501047_0198610 | 3300049581 | Bacteria | 1867 |
| 1698 | Ga0501047_0456691 | 3300049581 | Bacteria | 1106 |
| 1699 | Ga0501048_0023635 | 3300049582 | Bacteria | 4491 |
| 1700 | Ga0501048_0224488 | 3300049582 | Bacteria | 1333 |
| 1701 | Ga0501067_0012440 | 3300049583 | Bacteria | 4721 |
| 1702 | Ga0501067_0288806 | 3300049583 | Bacteria | 913 |
| 1703 | Ga0501068_0028661 | 3300049584 | Bacteria | 3294 |
| 1704 | Ga0501068_0038398 | 3300049584 | Bacteria | 2869 |
| 1705 | Ga0501069_0000024 | 3300049585 | Bacteria | 117140 |
| 1706 | Ga0501069_0008395 | 3300049585 | Bacteria | 5426 |
| 1707 | Ga0501069_0037849 | 3300049585 | Bacteria | 2662 |
| 1708 | Ga0501069_0074531 | 3300049585 | Bacteria | 1904 |
| 1709 | Ga0501070_0000093 | 3300049586 | Bacteria | 76623 |
| 1710 | Ga0501070_0001707 | 3300049586 | Bacteria | 19484 |
| 1711 | Ga0501070_0003776 | 3300049586 | Bacteria | 13081 |
| 1712 | Ga0501070_0004270 | 3300049586 | Bacteria | 12288 |
| 1713 | Ga0501070_0142156 | 3300049586 | Bacteria | 1981 |
| 1714 | Ga0501070_0163546 | 3300049586 | Bacteria | 1834 |
| 1715 | Ga0501071_0014312 | 3300049587 | Bacteria | 5426 |
| 1716 | Ga0501071_0037623 | 3300049587 | Bacteria | 3455 |
| 1717 | Ga0501071_0043546 | 3300049587 | Bacteria | 3219 |
| 1718 | Ga0501072_0005845 | 3300049588 | Bacteria | 9375 |
| 1719 | Ga0501072_0023240 | 3300049588 | Bacteria | 4814 |
| 1720 | Ga0501073_0011759 | 3300049589 | Bacteria | 6391 |
| 1721 | Ga0501073_0016103 | 3300049589 | Bacteria | 5420 |
| 1722 | Ga0501073_0045453 | 3300049589 | Bacteria | 3092 |
| 1723 | Ga0501074_0001523 | 3300049590 | Bacteria | 15668 |
| 1724 | Ga0501074_0004672 | 3300049590 | Bacteria | 9810 |
| 1725 | Ga0501074_0007470 | 3300049590 | Bacteria | 7904 |
| 1726 | Ga0501075_0007289 | 3300049591 | Bacteria | 7670 |
| 1727 | Ga0501075_0009385 | 3300049591 | Bacteria | 6844 |
| 1728 | Ga0501075_0100865 | 3300049591 | Bacteria | 2192 |
| 1729 | Ga0501075_0291105 | 3300049591 | Bacteria | 1244 |
| 1730 | Ga0501076_0002094 | 3300049592 | Bacteria | 13687 |
| 1731 | Ga0501076_0004801 | 3300049592 | Bacteria | 9647 |
| 1732 | Ga0501076_0056115 | 3300049592 | Bacteria | 3125 |
| 1733 | Ga0501077_0004048 | 3300049593 | Bacteria | 8852 |
| 1734 | Ga0501077_0013437 | 3300049593 | Bacteria | 5135 |
| 1735 | Ga0501077_0015498 | 3300049593 | Bacteria | 4799 |
| 1736 | Ga0501249_002446 | 3300049679 | Bacteria | 3753 |
| 1737 | Ga0501079_0000054 | 3300049741 | Bacteria | 51028 |
| 1738 | Ga0501079_0002815 | 3300049741 | Bacteria | 12686 |
| 1739 | Ga0501079_0022471 | 3300049741 | Bacteria | 4837 |
| 1740 | Ga0501080_0001346 | 3300049742 | Bacteria | 20520 |
| 1741 | Ga0501080_0011055 | 3300049742 | Bacteria | 8260 |
| 1742 | Ga0501080_0038346 | 3300049742 | Bacteria | 4473 |
| 1743 | Ga0501080_0048499 | 3300049742 | Bacteria | 3953 |
| 1744 | Ga0501080_0167951 | 3300049742 | Bacteria | 2024 |
| 1745 | Ga0501080_0232814 | 3300049742 | Bacteria | 1683 |
| 1746 | Ga0501080_0342006 | 3300049742 | Bacteria | 1352 |
| 1747 | Ga0501080_0375523 | 3300049742 | Bacteria | 1281 |
| 1748 | Ga0501081_0001342 | 3300049743 | Bacteria | 15013 |
| 1749 | Ga0501081_0025641 | 3300049743 | Bacteria | 3968 |
| 1750 | Ga0501081_0058602 | 3300049743 | Bacteria | 2665 |
| 1751 | Ga0501083_0000097 | 3300049744 | Bacteria | 59474 |
| 1752 | Ga0501083_0008220 | 3300049744 | Bacteria | 7378 |
| 1753 | Ga0501083_0023124 | 3300049744 | Bacteria | 4312 |
| 1754 | Ga0501262_000184 | 3300049759 | Bacteria | 7786 |
| 1755 | Ga0501035_0000068 | 3300049822 | Bacteria | 128392 |
| 1756 | Ga0501035_0001129 | 3300049822 | Bacteria | 27882 |
| 1757 | Ga0501035_0006366 | 3300049822 | Bacteria | 11103 |
| 1758 | Ga0501035_0008638 | 3300049822 | Bacteria | 9482 |
| 1759 | Ga0501035_0015071 | 3300049822 | Bacteria | 7132 |
| 1760 | Ga0501035_0047639 | 3300049822 | Bacteria | 3846 |
| 1761 | Ga0501035_0112108 | 3300049822 | Bacteria | 2390 |
| 1762 | Ga0501035_0122409 | 3300049822 | Bacteria | 2273 |
| 1763 | Ga0501044_0000084 | 3300049823 | Bacteria | 114544 |
| 1764 | Ga0501044_0000096 | 3300049823 | Bacteria | 109532 |
| 1765 | Ga0501044_0015238 | 3300049823 | Bacteria | 8281 |
| 1766 | Ga0501044_0016109 | 3300049823 | Bacteria | 8036 |
| 1767 | Ga0501044_0017784 | 3300049823 | Bacteria | 7625 |
| 1768 | Ga0501044_0078478 | 3300049823 | Bacteria | 3346 |
| 1769 | Ga0501044_0114010 | 3300049823 | Bacteria | 2709 |
| 1770 | Ga0501044_0615659 | 3300049823 | Bacteria | 978 |
| 1771 | Ga0501045_0000766 | 3300049824 | Bacteria | 20598 |
| 1772 | Ga0501045_0028180 | 3300049824 | Bacteria | 4051 |
| 1773 | Ga0501045_0031830 | 3300049824 | Bacteria | 3820 |
| 1774 | Ga0501045_0090040 | 3300049824 | Bacteria | 2267 |
| 1775 | nmdc:mga03683_11_c1 | 3300050489 | Bacteria | 120565 |
| 1776 | nmdc:mga03683_29395_c1 | 3300050489 | Bacteria | 2191 |
| 1777 | nmdc:mga03683_44378_c1 | 3300050489 | Bacteria | 1837 |
| 1778 | nmdc:mga03n38_18256_c1 | 3300050490 | Bacteria | 2766 |
| 1779 | nmdc:mga03n38_1_c1 | 3300050490 | Bacteria | 91975 |
| 1780 | nmdc:mga03n38_22503_c1 | 3300050490 | Bacteria | 2552 |
| 1781 | nmdc:mga00v17_1_c1 | 3300050491 | Bacteria | 292294 |
| 1782 | nmdc:mga00v17_2288_c1 | 3300050491 | Bacteria | 9831 |
| 1783 | nmdc:mga00v17_48740_c1 | 3300050491 | Bacteria | 2568 |
| 1784 | nmdc:mga0yw44_10209_c1 | 3300050492 | Bacteria | 4788 |
| 1785 | nmdc:mga0yw44_61_c1 | 3300050492 | Bacteria | 34409 |
| 1786 | nmdc:mga0k408_1033_c1 | 3300050493 | Bacteria | 15290 |
| 1787 | nmdc:mga0k408_41530_c1 | 3300050493 | Bacteria | 2648 |
| 1788 | nmdc:mga06z11_50492_c1 | 3300050494 | Bacteria | 2126 |
| 1789 | nmdc:mga06z11_6052_c1 | 3300050494 | Bacteria | 4894 |
| 1790 | nmdc:mga06z11_800_c1 | 3300050494 | Bacteria | 11496 |
| 1791 | nmdc:mga04h51_245_c1 | 3300050495 | Bacteria | 14216 |
| 1792 | nmdc:mga07m45_408_c1 | 3300050496 | Bacteria | 7392 |
| 1793 | nmdc:mga07m45_4403_c2 | 3300050496 | Bacteria | 3027 |
| 1794 | nmdc:mga07m45_447_c1 | 3300050496 | Bacteria | 17238 |
| 1795 | nmdc:mga07m45_49601_c1 | 3300050496 | Bacteria | 1274 |
| 1796 | nmdc:mga07m45_59826_c1 | 3300050496 | Bacteria | 2155 |
| 1797 | nmdc:mga07m45_73_c1 | 3300050496 | Bacteria | 25931 |
| 1798 | nmdc:mga05p37_19161_c1 | 3300050507 | Bacteria | 8276 |
| 1799 | nmdc:mga05p37_246876_c1 | 3300050507 | Bacteria | 2143 |
| 1800 | nmdc:mga05p37_251472_c1 | 3300050507 | Bacteria | 2120 |
| 1801 | nmdc:mga05p37_3855_c1 | 3300050507 | Bacteria | 17548 |
| 1802 | nmdc:mga05p37_38812_c1 | 3300050507 | Bacteria | 5843 |
| 1803 | nmdc:mga05p37_45113_c1 | 3300050507 | Bacteria | 5423 |
| 1804 | nmdc:mga05p37_51739_c1 | 3300050507 | Bacteria | 5050 |
| 1805 | nmdc:mga05p37_6370_c1 | 3300050507 | Bacteria | 13904 |
| 1806 | nmdc:mga05p37_877695_c1 | 3300050507 | Bacteria | 970 |
| 1807 | nmdc:mga09592_1525_c1 | 3300050508 | Bacteria | 18665 |
| 1808 | nmdc:mga09592_44489_c1 | 3300050508 | Bacteria | 3738 |
| 1809 | nmdc:mga09592_797_c1 | 3300050508 | Bacteria | 24389 |
| 1810 | nmdc:mga0qj67_130126_c1 | 3300050509 | Bacteria | 2038 |
| 1811 | nmdc:mga0qj67_1874_c1 | 3300050509 | Bacteria | 14910 |
| 1812 | nmdc:mga0qj67_201182_c1 | 3300050509 | Bacteria | 1618 |
| 1813 | nmdc:mga0qj67_232546_c1 | 3300050509 | Bacteria | 1496 |
| 1814 | nmdc:mga0qj67_379714_c1 | 3300050509 | Bacteria | 1141 |
| 1815 | nmdc:mga06r32_148638_c1 | 3300050510 | Bacteria | 2320 |
| 1816 | nmdc:mga06r32_1637_c1 | 3300050510 | Bacteria | 20211 |
| 1817 | nmdc:mga06r32_200246_c1 | 3300050510 | Bacteria | 1985 |
| 1818 | nmdc:mga06r32_2962_c1 | 3300050510 | Bacteria | 12463 |
| 1819 | nmdc:mga06r32_30241_c1 | 3300050510 | Bacteria | 5082 |
| 1820 | nmdc:mga06r32_543_c1 | 3300050510 | Bacteria | 32734 |
| 1821 | nmdc:mga06r32_61287_c1 | 3300050510 | Bacteria | 3621 |
| 1822 | nmdc:mga06r32_62871_c1 | 3300050510 | Bacteria | 3577 |
| 1823 | nmdc:mga06r32_639325_c1 | 3300050510 | Bacteria | 1033 |
| 1824 | nmdc:mga06r32_759070_c1 | 3300050510 | Bacteria | 933 |
| 1825 | nmdc:mga08y16_1196_c1 | 3300050511 | Bacteria | 25597 |
| 1826 | nmdc:mga08y16_176140_c1 | 3300050511 | Bacteria | 2221 |
| 1827 | nmdc:mga08y16_268513_c1 | 3300050511 | Bacteria | 1761 |
| 1828 | nmdc:mga08y16_282920_c1 | 3300050511 | Bacteria | 1710 |
| 1829 | nmdc:mga08y16_287910_c1 | 3300050511 | Bacteria | 1694 |
| 1830 | nmdc:mga08y16_326820_c1 | 3300050511 | Bacteria | 1578 |
| 1831 | nmdc:mga08y16_349639_c1 | 3300050511 | Bacteria | 1519 |
| 1832 | nmdc:mga08y16_35524_c1 | 3300050511 | Bacteria | 5234 |
| 1833 | nmdc:mga08y16_6264_c1 | 3300050511 | Bacteria | 12472 |
| 1834 | nmdc:mga08y16_6269_c1 | 3300050511 | Bacteria | 12468 |
| 1835 | nmdc:mga08y16_95139_c1 | 3300050511 | Bacteria | 3103 |
| 1836 | nmdc:mga0n895_103852_c1 | 3300050512 | Bacteria | 2854 |
| 1837 | nmdc:mga0n895_10962_c1 | 3300050512 | Bacteria | 8056 |
| 1838 | nmdc:mga0n895_2213_c1 | 3300050512 | Bacteria | 15039 |
| 1839 | nmdc:mga0n895_2422_c1 | 3300050512 | Bacteria | 14549 |
| 1840 | nmdc:mga0n895_480965_c1 | 3300050512 | Bacteria | 1252 |
| 1841 | nmdc:mga0n895_54879_c1 | 3300050512 | Bacteria | 3920 |
| 1842 | nmdc:mga0n895_668_c1 | 3300050512 | Bacteria | 24028 |
| 1843 | nmdc:mga0n895_90961_c1 | 3300050512 | Bacteria | 3053 |
| 1844 | nmdc:mga0rr50_148687_c1 | 3300050513 | Bacteria | 1891 |
| 1845 | nmdc:mga0rr50_2496_c1 | 3300050513 | Bacteria | 10402 |
| 1846 | nmdc:mga0rr50_331294_c1 | 3300050513 | Bacteria | 1278 |
| 1847 | nmdc:mga0rr50_43903_c1 | 3300050513 | Bacteria | 3275 |
| 1848 | nmdc:mga08x19_288458_c1 | 3300050514 | Bacteria | 1138 |
| 1849 | nmdc:mga08x19_3746_c1 | 3300050514 | Bacteria | 9052 |
| 1850 | nmdc:mga08x19_52786_c1 | 3300050514 | Bacteria | 2615 |
| 1851 | nmdc:mga08x19_550_c1 | 3300050514 | Bacteria | 24591 |
| 1852 | nmdc:mga08x19_55517_c1 | 3300050514 | Bacteria | 2553 |
| 1853 | nmdc:mga08x19_6928_c1 | 3300050514 | Bacteria | 6732 |
| 1854 | nmdc:mga08x19_98851_c1 | 3300050514 | Bacteria | 1934 |
| 1855 | nmdc:mga0a205_10565_c1 | 3300050515 | Bacteria | 8483 |
| 1856 | nmdc:mga0a205_16908_c1 | 3300050515 | Bacteria | 6829 |
| 1857 | nmdc:mga0a205_211454_c1 | 3300050515 | Bacteria | 1828 |
| 1858 | nmdc:mga0a205_26496_c1 | 3300050515 | Bacteria | 5530 |
| 1859 | nmdc:mga0a205_32349_c1 | 3300050515 | Bacteria | 5016 |
| 1860 | nmdc:mga0a205_34820_c1 | 3300050515 | Bacteria | 4833 |
| 1861 | nmdc:mga0a205_584_c1 | 3300050515 | Bacteria | 28859 |
| 1862 | nmdc:mga0a205_68159_c1 | 3300050515 | Bacteria | 3436 |
| 1863 | nmdc:mga0a205_7303_c1 | 3300050515 | Bacteria | 9995 |
| 1864 | nmdc:mga0a205_89630_c1 | 3300050515 | Bacteria | 2973 |
| 1865 | nmdc:mga0a205_9995_c1 | 3300050515 | Bacteria | 8706 |
| 1866 | nmdc:mga0sz30_121302_c1 | 3300050516 | Bacteria | 1149 |
| 1867 | nmdc:mga0sz30_26045_c1 | 3300050516 | Bacteria | 2395 |
| 1868 | nmdc:mga0sz30_5_c1 | 3300050516 | Bacteria | 189060 |
| 1869 | nmdc:mga0sz30_89117_c1 | 3300050516 | Bacteria | 1341 |
| 1870 | Ga0495601_0108249 | 3300053077 | Bacteria | 1798 |
| 1871 | Ga0495612_0003957 | 3300053078 | Bacteria | 6150 |
| 1872 | Ga0500610_0000402 | 3300053079 | Bacteria | 13215 |
| 1873 | Ga0495595_0000244 | 3300053084 | Bacteria | 21433 |
| 1874 | Ga0495595_0038397 | 3300053084 | Bacteria | 2181 |
| 1875 | Ga0495619_0006093 | 3300053085 | Bacteria | 7635 |
| 1876 | Ga0495619_0061218 | 3300053085 | Bacteria | 2504 |
| 1877 | Ga0500578_0047317 | 3300053086 | Bacteria | 2760 |
| 1878 | Ga0500643_010551 | 3300053087 | Bacteria | 3426 |
| 1879 | Ga0500644_0003444 | 3300053088 | Bacteria | 3912 |
| 1880 | Ga0500646_0029413 | 3300053090 | Bacteria | 1504 |
| 1881 | Ga0500651_0000164 | 3300053093 | Bacteria | 42896 |
| 1882 | Ga0500651_0089158 | 3300053093 | Bacteria | 1901 |
| 1883 | Ga0500566_0005587 | 3300053094 | Bacteria | 7469 |
| 1884 | Ga0500641_0020853 | 3300053096 | Bacteria | 2490 |
| 1885 | Ga0500641_0049599 | 3300053096 | Bacteria | 1722 |
| 1886 | Ga0500650_0029685 | 3300053098 | Bacteria | 2475 |
| 1887 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 1888 | Ga0500557_003445 | 3300053105 | Bacteria | 3142 |
| 1889 | Ga0500560_001919 | 3300053107 | Bacteria | 3808 |
| 1890 | Ga0500569_016797 | 3300053109 | Bacteria | 1861 |
| 1891 | Ga0500571_045129 | 3300053110 | Bacteria | 2345 |
| 1892 | Ga0500572_000095 | 3300053111 | Bacteria | 28917 |
| 1893 | Ga0500572_001864 | 3300053111 | Bacteria | 5337 |
| 1894 | Ga0500594_0004273 | 3300053118 | Bacteria | 3152 |
| 1895 | Ga0500595_013922 | 3300053119 | Bacteria | 3067 |
| 1896 | Ga0500607_000307 | 3300053121 | Bacteria | 46367 |
| 1897 | Ga0500607_025574 | 3300053121 | Bacteria | 3284 |
| 1898 | Ga0500608_001229 | 3300053122 | Bacteria | 9146 |
| 1899 | Ga0500608_003410 | 3300053122 | Bacteria | 5953 |
| 1900 | Ga0500608_075018 | 3300053122 | Bacteria | 1604 |
| 1901 | Ga0500618_001780 | 3300053125 | Bacteria | 9105 |
| 1902 | Ga0500642_0000186 | 3300053130 | Bacteria | 25633 |
| 1903 | Ga0500642_0012991 | 3300053130 | Bacteria | 3043 |
| 1904 | Ga0500658_0000132 | 3300053134 | Bacteria | 35240 |
| 1905 | Ga0500658_0003190 | 3300053134 | Bacteria | 6248 |
| 1906 | Ga0500658_0070848 | 3300053134 | Bacteria | 1470 |
| 1907 | Ga0500559_0000067 | 3300053136 | Bacteria | 83330 |
| 1908 | Ga0500559_0000298 | 3300053136 | Bacteria | 38374 |
| 1909 | Ga0500559_0021198 | 3300053136 | Bacteria | 2752 |
| 1910 | Ga0500561_0000180 | 3300053137 | Bacteria | 11594 |
| 1911 | Ga0500568_0000269 | 3300053139 | Bacteria | 44003 |
| 1912 | Ga0500568_0000447 | 3300053139 | Bacteria | 31023 |
| 1913 | Ga0500568_0001151 | 3300053139 | Bacteria | 17695 |
| 1914 | Ga0500568_0001430 | 3300053139 | Bacteria | 15482 |
| 1915 | Ga0500568_0007916 | 3300053139 | Bacteria | 5170 |
| 1916 | Ga0500574_000961 | 3300053141 | Bacteria | 4022 |
| 1917 | Ga0500577_0064643 | 3300053142 | Bacteria | 1417 |
| 1918 | Ga0500586_004477 | 3300053145 | Bacteria | 3428 |
| 1919 | Ga0500590_135140 | 3300053148 | Bacteria | 1135 |
| 1920 | Ga0500604_0053435 | 3300053151 | Bacteria | 1252 |
| 1921 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1922 | Ga0500616_0000931 | 3300053153 | Bacteria | 32000 |
| 1923 | Ga0500616_0042090 | 3300053153 | Bacteria | 2447 |
| 1924 | Ga0500616_0150462 | 3300053153 | Bacteria | 1078 |
| 1925 | Ga0500622_0000513 | 3300053156 | Bacteria | 35999 |
| 1926 | Ga0500622_0002182 | 3300053156 | Bacteria | 14471 |
| 1927 | Ga0500624_006778 | 3300053157 | Bacteria | 1558 |
| 1928 | Ga0500633_0067692 | 3300053160 | Bacteria | 1270 |
| 1929 | Ga0500634_0006941 | 3300053161 | Bacteria | 5532 |
| 1930 | Ga0500634_0045881 | 3300053161 | Bacteria | 2363 |
| 1931 | Ga0500634_0151615 | 3300053161 | Bacteria | 1083 |
| 1932 | Ga0500639_019482 | 3300053163 | Bacteria | 3581 |
| 1933 | Ga0500636_0000163 | 3300053177 | Bacteria | 34947 |
| 1934 | Ga0500636_0020857 | 3300053177 | Bacteria | 3878 |
| 1935 | Ga0500645_001533 | 3300053730 | Bacteria | 11552 |
| 1936 | Ga0500645_002397 | 3300053730 | Bacteria | 8411 |
| 1937 | Ga0500645_016490 | 3300053730 | Bacteria | 2325 |
| 1938 | Ga0500645_034041 | 3300053730 | Bacteria | 1522 |
| 1939 | Ga0501084_0002533 | 3300054114 | Bacteria | 14728 |
| 1940 | Ga0501084_0005314 | 3300054114 | Bacteria | 10543 |
| 1941 | Ga0501084_0006726 | 3300054114 | Bacteria | 9450 |
| 1942 | Ga0501084_0013576 | 3300054114 | Bacteria | 6740 |
| 1943 | Ga0501084_0071275 | 3300054114 | Bacteria | 2910 |
| 1944 | Ga0501084_0075593 | 3300054114 | Bacteria | 2822 |
| 1945 | Ga0501084_0283140 | 3300054114 | Bacteria | 1400 |
| 1946 | Ga0501084_0314889 | 3300054114 | Bacteria | 1322 |
| 1947 | Ga0500661_016256 | 3300055283 | Bacteria | 1331 |
| 1948 | Ga0590075_028269 | 3300059424 | Bacteria | 1416 |
| 1949 | Ga0501082_0000389 | 3300060353 | Bacteria | 38981 |
| 1950 | Ga0501082_0001815 | 3300060353 | Bacteria | 18801 |
| 1951 | Ga0501082_0023411 | 3300060353 | Bacteria | 5328 |
| 1952 | Ga0501082_0117115 | 3300060353 | Bacteria | 2308 |
| 1953 | Ga0501082_0352999 | 3300060353 | Bacteria | 1282 |
| 1954 | Ga0530510_0005953 | 3300061734 | Bacteria | 8458 |
| 1955 | Ga0530510_0019782 | 3300061734 | Bacteria | 4783 |
| 1956 | Ga0530510_0080989 | 3300061734 | Bacteria | 2363 |
| 1957 | 2508732941 | 2508501050 | Bacteria | 9633614 |
| 1958 | 2509128038 | 2508501125 | Bacteria | 7208311 |
| 1959 | 2511243175 | 2511231002 | Bacteria | 5042903 |
| 1960 | 2511391037 | 2511231027 | Bacteria | 5013807 |
| 1961 | 2512032988 | 2511231221 | Bacteria | 6846400 |
| 1962 | 2513228370 | 2513020051 | Bacteria | 6053213 |
| 1963 | 2513556031 | 2513237082 | Bacteria | 8640282 |
| 1964 | 2513952711 | 2513237150 | Bacteria | 6553639 |
| 1965 | 2514002663 | 2513237159 | Bacteria | 6810126 |
| 1966 | 2514590722 | 2513237351 | Bacteria | 6968952 |
| 1967 | 2519457298 | 2519103095 | Bacteria | 6629912 |
| 1968 | 2523104543 | 2522572158 | Bacteria | 6514390 |
| 1969 | 2523106040 | 2522572158 | Bacteria | 6514390 |
| 1970 | 2523107591 | 2522572158 | Bacteria | 6514390 |
| 1971 | 2527078479 | 2526164713 | Bacteria | 6780608 |
| 1972 | 2548500060 | 2547132374 | Bacteria | 5530232 |
| 1973 | 2585232900 | 2582581299 | Bacteria | 6518058 |
| 1974 | 2585292160 | 2582581311 | Bacteria | 6763856 |
| 1975 | 2585399502 | 2582581867 | Bacteria | 7184437 |
| 1976 | 2585542906 | 2585427528 | Bacteria | 6842387 |
| 1977 | 2585841152 | 2585427593 | Bacteria | 7141551 |
| 1978 | 2599622949 | 2599185214 | Bacteria | 8209958 |
| 1979 | 2599671428 | 2599185226 | Bacteria | 8233575 |
| 1980 | 2599679535 | 2599185227 | Bacteria | 8246414 |
| 1981 | 2599691551 | 2599185229 | Bacteria | 8216126 |
| 1982 | 2599738762 | 2599185239 | Bacteria | 8686614 |
| 1983 | 2599747628 | 2599185240 | Bacteria | 7968121 |
| 1984 | 2600209512 | 2599185355 | Bacteria | 7968906 |
| 1985 | 2600814246 | 2600255067 | Bacteria | 6795583 |
| 1986 | 2603859617 | 2602042107 | Bacteria | 6226103 |
| 1987 | 2643743489 | 2643221544 | Bacteria | 5886209 |
| 1988 | 2643993734 | 2643221596 | Bacteria | 5006805 |
| 1989 | 2644162769 | 2643221628 | Bacteria | 5745828 |
| 1990 | 2644325076 | 2643221658 | Bacteria | 6064537 |
| 1991 | 2644400196 | 2643221672 | Bacteria | 6322190 |
| 1992 | 2644467629 | 2643221683 | Bacteria | 5749203 |
| 1993 | 2644743511 | 2643221736 | Bacteria | 6608466 |
| 1994 | 2676745571 | 2675903129 | Bacteria | 7964495 |
| 1995 | 2738718800 | 2738541277 | Bacteria | 7458140 |
| 1996 | 2738723560 | 2738541277 | Bacteria | 7458140 |
| 1997 | 2738886625 | 2738541307 | Bacteria | 8606193 |
| 1998 | 2738945094 | 2738541317 | Bacteria | 5340176 |
| 1999 | 2739252279 | 2738543013 | Bacteria | 5618633 |
| 2000 | 2739280818 | 2738543019 | Bacteria | 7459457 |
| 2001 | 2739284291 | 2738543019 | Bacteria | 7459457 |
| 2002 | 2739612164 | 2739367655 | Bacteria | 4051151 |
| 2003 | 2739612371 | 2739367655 | Bacteria | 4051151 |
| 2004 | 2770198869 | 2767802442 | Bacteria | 5747986 |
| 2005 | 2774870336 | 2773857925 | Bacteria | 6472445 |
| 2006 | 2776272904 | 2775506902 | Bacteria | 6208009 |
| 2007 | 2776282253 | 2775506904 | Bacteria | 5954060 |
| 2008 | 2792839293 | 2791355137 | Bacteria | 9654227 |
| 2009 | 2817259499 | 2816332253 | Bacteria | 6764532 |
| 2010 | 2817277168 | 2816332256 | Bacteria | 6891714 |
| 2011 | 2817454082 | 2816332286 | Bacteria | 6853759 |
| 2012 | 2819602258 | 2818991446 | Bacteria | 7757362 |
| 2013 | 2819613960 | 2818991449 | Bacteria | 5518009 |
| 2014 | 2819634715 | 2818991452 | Bacteria | 8442785 |
| 2015 | 2821450646 | 2821443989 | Bacteria | 7658172 |
| 2016 | 2831265780 | 2831265667 | Bacteria | 7184833 |
| 2017 | 2838056494 | 2838054893 | Bacteria | 7451788 |
| 2018 | 2838127293 | 2838122688 | Bacteria | 8803140 |
| 2019 | 2840770330 | 2840764183 | Bacteria | 6358399 |
| 2020 | 2841764523 | 2841760612 | Bacteria | 6454112 |
| 2021 | 2841915672 | 2841911363 | Bacteria | 6173697 |
| 2022 | 2841920874 | 2841917233 | Bacteria | 6173500 |
| 2023 | 2841987393 | 2841983080 | Bacteria | 8395090 |
| 2024 | 2842681769 | 2842677519 | Bacteria | 5615038 |
| 2025 | 2842694737 | 2842694124 | Bacteria | 4063419 |
| 2026 | 2842736211 | 2842733646 | Bacteria | 5716726 |
| 2027 | 2842748047 | 2842747753 | Bacteria | 5578255 |
| 2028 | 2842874239 | 2842871566 | Bacteria | 4827117 |
| 2029 | 2844108029 | 2844104063 | Bacteria | 6440972 |
| 2030 | 2844537839 | 2844533157 | Bacteria | 7517899 |
| 2031 | 2851187961 | 2851182111 | Bacteria | 6047226 |
| 2032 | 2851250135 | 2851246043 | Bacteria | 6439203 |
| 2033 | 2857528976 | 2857524615 | Bacteria | 6615449 |
| 2034 | 2863425403 | 2863421361 | Bacteria | 7300805 |
| 2035 | 2870069642 | 2870068957 | Bacteria | 8925310 |
| 2036 | 2881103105 | 2881101125 | Bacteria | 4590519 |
| 2037 | 2881103565 | 2881101125 | Bacteria | 4590519 |
| 2038 | 2885196124 | 2885192300 | Bacteria | 5882526 |
| 2039 | 2885203364 | 2885198086 | Bacteria | 7212419 |
| 2040 | 2885217286 | 2885211737 | Bacteria | 7212420 |
| 2041 | 2893070433 | 2893066018 | Bacteria | 6158120 |
| 2042 | 2894772696 | 2894772417 | Bacteria | 5305674 |
| 2043 | 2897808291 | 2897803580 | Bacteria | 7000062 |
| 2044 | 2897809074 | 2897803580 | Bacteria | 7000062 |
| 2045 | 2899930537 | 2899924645 | Bacteria | 7487985 |
| 2046 | 2900636813 | 2900634093 | Bacteria | 10263517 |
| 2047 | 2900643336 | 2900634093 | Bacteria | 10263517 |
| 2048 | 2901307418 | 2901300506 | Bacteria | 8463898 |
| 2049 | 2904454891 | 2904449895 | Bacteria | 6927402 |
| 2050 | 2904456328 | 2904449895 | Bacteria | 6927402 |
| 2051 | 2904462837 | 2904456579 | Bacteria | 6819253 |
| 2052 | 2904480485 | 2904479285 | Bacteria | 5073931 |
| 2053 | 2904542273 | 2904541872 | Bacteria | 8915136 |
| 2054 | 2904543368 | 2904541872 | Bacteria | 8915136 |
| 2055 | 2904546890 | 2904541872 | Bacteria | 8915136 |
| 2056 | 2904570149 | 2904564687 | Bacteria | 7609577 |
| 2057 | 2904577319 | 2904571731 | Bacteria | 7608790 |
| 2058 | 2904582528 | 2904578770 | Bacteria | 5302906 |
| 2059 | 2913309720 | 2913308742 | Bacteria | 5350706 |
| 2060 | 2919076375 | 2919073203 | Bacteria | 6531949 |
| 2061 | 2919463988 | 2919462493 | Bacteria | 5817112 |
| 2062 | 2928039651 | 2928037797 | Bacteria | 7273642 |
| 2063 | 2928044744 | 2928044640 | Bacteria | 7271509 |
| 2064 | 2928052544 | 2928051484 | Bacteria | 7773759 |
| 2065 | 2928064793 | 2928064002 | Bacteria | 7419480 |
| 2066 | 2928074739 | 2928070936 | Bacteria | 8062541 |
| 2067 | 2928077669 | 2928070936 | Bacteria | 8062541 |
| 2068 | 2928087125 | 2928084124 | Bacteria | 7159212 |
| 2069 | 2928115318 | 2928115317 | Bacteria | 6477646 |
| 2070 | 2928163718 | 2928157003 | Bacteria | 7522202 |
| 2071 | 2928170531 | 2928163908 | Bacteria | 7561269 |
| 2072 | 2928175852 | 2928170801 | Bacteria | 8785406 |
| 2073 | 2928525028 | 2928521798 | Bacteria | 4960112 |
| 2074 | 2928541492 | 2928536128 | Bacteria | 7657547 |
| 2075 | 2929160601 | 2929160207 | Bacteria | 9075316 |
| 2076 | 2929164362 | 2929160207 | Bacteria | 9075316 |
| 2077 | 2929167558 | 2929160207 | Bacteria | 9075316 |
| 2078 | 2929524412 | 2929520902 | Bacteria | 6765052 |
| 2079 | 2929525113 | 2929520902 | Bacteria | 6765052 |
| 2080 | 2937844861 | 2937843397 | Bacteria | 5256375 |
| 2081 | 2945910938 | 2945909444 | Bacteria | 7065066 |
| 2082 | 2945976513 | 2945972063 | Bacteria | 6086495 |
| 2083 | 2945986824 | 2945984333 | Bacteria | 7358892 |
| 2084 | 2954011359 | 2954011201 | Bacteria | 4762601 |
| 2085 | 2954771537 | 2954767861 | Bacteria | 5535784 |
| 2086 | 2981992008 | 2981990288 | Bacteria | 7590678 |
| 2087 | 2981995757 | 2981990288 | Bacteria | 7590678 |
| 2088 | 2990711666 | 2990710928 | Bacteria | 5002431 |
| 2089 | 3002145543 | 3002141150 | Bacteria | 5254435 |
| 2090 | 3005411712 | 3005409236 | Bacteria | 7188837 |
| 2091 | 3005450327 | 3005445848 | Bacteria | 6906074 |
| 2092 | 639785226 | 639633007 | Bacteria | 4376040 |
| 2093 | 642416026 | 641736154 | Bacteria | 7689995 |
| 2094 | 8018848089 | 8018845410 | Bacteria | 8933938 |
| 2095 | 8020810289 | 8020807995 | Bacteria | 6801506 |
| 2096 | 8020939189 | 8020938398 | Bacteria | 7472757 |
| 2097 | 8020948520 | 8020945358 | Bacteria | 8467355 |
| 2098 | 8020956247 | 8020953355 | Bacteria | 7439080 |
| 2099 | 8021127048 | 8021120328 | Bacteria | 8782274 |
| 2100 | 8039101471 | 8039098773 | Bacteria | 6602928 |
| 2101 | 8040169595 | 8040167225 | Bacteria | 6542727 |
| 2102 | 8040174628 | 8040173305 | Bacteria | 6827067 |
| 2103 | 8054002373 | 8054002106 | Bacteria | 7987183 |
| 2104 | 8054006769 | 8054002106 | Bacteria | 7987183 |
| 2105 | 8054007356 | 8054002106 | Bacteria | 7987183 |
| 2106 | 8054008292 | 8054002106 | Bacteria | 7987183 |
| 2107 | Ga0111539_10322485 | |||
| 2108 | JGI24752J21851_1002365 | |||
| 2109 | JGI24746J21847_1003310 | |||
| 2110 | JGI24740J21852_10003776 | |||
| 2111 | JGI24743J22301_10003473 | |||
| 2112 | JGI24750J21931_1000181 | |||
| 2113 | JGI24745J21846_1000318 | |||
| 2114 | JGI24748J21848_1000571 | |||
| 2115 | JGI24748J21848_1001710 | |||
| 2116 | JGI24738J21930_10001393 | |||
| 2117 | JGI24034J26672_10004122 | |||
| 2118 | JGI25150J39212_1002294 | |||
| 2119 | JGI25159J45721_1001628 | |||
| 2120 | JGI25159J45721_1010099 | |||
| 2121 | JGI25159J45721_1014733 | |||
| 2122 | JGI25151J46595_10001132 | |||
| 2123 | JGI25151J46595_10011005 | |||
| 2124 | JGI25151J46595_10023031 | |||
| 2125 | JGI25151J46595_10027382 | |||
| 2126 | JGI25151J46595_10034292 | |||
| 2127 | JGI25151J46595_10034941 | |||
| 2128 | JGI25151J46595_10040727 | |||
| 2129 | JGI25406J46586_10005366 | |||
| 2130 | JGI26129J50193_1001475 | |||
| 2131 | JGI25160J50197_1000319 | |||
| 2132 | JGI25160J50197_1010760 | |||
| 2133 | JGI25161J50226_1000092 | |||
| 2134 | Ga0006562J51391_1013826 | |||
| 2135 | Ga0006562J51391_1033002 | |||
| 2136 | JGI25404J52841_10007519 | |||
| 2137 | Ga0055532_1004429 | |||
| 2138 | Ga0055525_1000036 | |||
| 2139 | Ga0055526_1018980 | |||
| 2140 | Ga0055537_1000104 | |||
| 2141 | Ga0055537_1000780 | |||
| 2142 | Ga0055537_1004214 | |||
| 2143 | Ga0055537_1011246 | |||
| 2144 | Ga0055524_1010401 | |||
| 2145 | Ga0055524_1033844 | |||
| 2146 | Ga0055536_1000430 | |||
| 2147 | Ga0055536_1005578 | |||
| 2148 | Ga0055536_1021898 | |||
| 2149 | Ga0055536_1022508 | |||
| 2150 | Ga0055534_1000042 | |||
| 2151 | Ga0055534_1002677 | |||
| 2152 | Ga0055534_1006261 | |||
| 2153 | Ga0055534_1013054 | |||
| 2154 | Ga0055528_1001367 | |||
| 2155 | Ga0055528_1006579 | |||
| 2156 | Ga0055530_10001578 | |||
| 2157 | Ga0055530_10018244 | |||
| 2158 | Ga0055540_1001235 | |||
| 2159 | Ga0055540_1006428 | |||
| 2160 | Ga0055540_1009999 | |||
| 2161 | Ga0055540_1018294 | |||
| 2162 | Ga0055531_10003091 | |||
| 2163 | Ga0055531_10006139 | |||
| 2164 | Ga0055543_1000207 | |||
| 2165 | Ga0065165_1000132 | |||
| 2166 | Ga0065165_1000409 | |||
| 2167 | Ga0065714_10066083 | |||
| 2168 | Ga0065712_10070978 | |||
| 2169 | Ga0065712_10077719 | |||
| 2170 | Ga0065712_10078399 | |||
| 2171 | Ga0065712_10096189 | |||
| 2172 | Ga0065712_10096243 | |||
| 2173 | Ga0065715_10089022 | |||
| 2174 | Ga0065715_10103856 | |||
| 2175 | Ga0065715_10155662 | |||
| 2176 | Ga0065707_10010755 | |||
| 2177 | Ga0070658_10008174 | |||
| 2178 | Ga0070676_10002898 | |||
| 2179 | Ga0070676_10009564 | |||
| 2180 | Ga0070676_10191182 | |||
| 2181 | Ga0070683_100001166 | |||
| 2182 | Ga0070683_100253033 | |||
| 2183 | Ga0070683_100342098 | |||
| 2184 | Ga0070683_100365580 | |||
| 2185 | Ga0070690_100009650 | |||
| 2186 | Ga0070690_100033483 | |||
| 2187 | Ga0070690_100190929 | |||
| 2188 | Ga0070670_100010109 | |||
| 2189 | Ga0070670_100147377 | |||
| 2190 | Ga0070677_10000126 | |||
| 2191 | Ga0068869_100019670 | |||
| 2192 | Ga0068869_100078992 | |||
| 2193 | Ga0068869_100200685 | |||
| 2194 | Ga0070666_10052952 | |||
| 2195 | Ga0070666_10122253 | |||
| 2196 | Ga0070666_10318119 | |||
| 2197 | Ga0070680_100005116 | |||
| 2198 | Ga0070680_100014771 | |||
| 2199 | Ga0070680_100089145 | |||
| 2200 | Ga0070680_100098840 | |||
| 2201 | Ga0070680_100306506 | |||
| 2202 | Ga0070682_100001533 | |||
| 2203 | Ga0070682_100003724 | |||
| 2204 | Ga0070682_100024957 | |||
| 2205 | Ga0070682_100060172 | |||
| 2206 | Ga0068868_100003027 | |||
| 2207 | Ga0068868_100003608 | |||
| 2208 | Ga0068868_100015802 | |||
| 2209 | Ga0068868_100066200 | |||
| 2210 | Ga0068868_100134926 | |||
| 2211 | Ga0068868_100215626 | |||
| 2212 | Ga0070660_100000724 | |||
| 2213 | Ga0070660_100001299 | |||
| 2214 | Ga0070660_100007902 | |||
| 2215 | Ga0070660_100010060 | |||
| 2216 | Ga0070660_100015241 | |||
| 2217 | Ga0070660_100029404 | |||
| 2218 | Ga0070689_100003384 | |||
| 2219 | Ga0070689_100007839 | |||
| 2220 | Ga0070689_100048821 | |||
| 2221 | Ga0070689_100165687 | |||
| 2222 | Ga0070691_10000994 | |||
| 2223 | Ga0070691_10004892 | |||
| 2224 | Ga0070687_100000085 | |||
| 2225 | Ga0070661_100002142 | |||
| 2226 | Ga0070661_100014785 | |||
| 2227 | Ga0070661_100026535 | |||
| 2228 | Ga0070661_100035802 | |||
| 2229 | Ga0070661_100219006 | |||
| 2230 | Ga0070692_10000667 | |||
| 2231 | Ga0070692_10002518 | |||
| 2232 | Ga0070692_10173526 | |||
| 2233 | Ga0070668_100001248 | |||
| 2234 | Ga0070668_100145165 | |||
| 2235 | Ga0070668_100159247 | |||
| 2236 | Ga0070669_100005868 | |||
| 2237 | Ga0070669_100375172 | |||
| 2238 | Ga0070675_100043655 | |||
| 2239 | Ga0070675_100173938 | |||
| 2240 | Ga0070675_100280270 | |||
| 2241 | Ga0070675_100372452 | |||
| 2242 | Ga0070671_100009899 | |||
| 2243 | Ga0070671_100010916 | |||
| 2244 | Ga0070671_100021222 | |||
| 2245 | Ga0070671_100023164 | |||
| 2246 | Ga0070671_100046579 | |||
| 2247 | Ga0070671_100086682 | |||
| 2248 | Ga0070671_100148145 | |||
| 2249 | Ga0070674_100003469 | |||
| 2250 | Ga0070674_100011243 | |||
| 2251 | Ga0070674_100091663 | |||
| 2252 | Ga0070674_100315442 | |||
| 2253 | Ga0070673_100000152 | |||
| 2254 | Ga0070673_100001292 | |||
| 2255 | Ga0070673_100007749 | |||
| 2256 | Ga0070673_100022913 | |||
| 2257 | Ga0070688_100000558 | |||
| 2258 | Ga0070688_100012465 | |||
| 2259 | Ga0070688_100023196 | |||
| 2260 | Ga0070688_100112186 | |||
| 2261 | Ga0070659_100000151 | |||
| 2262 | Ga0070659_100002581 | |||
| 2263 | Ga0070659_100011661 | |||
| 2264 | Ga0070659_100044233 | |||
| 2265 | Ga0070659_100102998 | |||
| 2266 | Ga0070659_100160817 | |||
| 2267 | Ga0070667_100005640 | |||
| 2268 | Ga0070667_100042441 | |||
| 2269 | Ga0070667_100167734 | |||
| 2270 | Ga0070703_10003226 | |||
| 2271 | Ga0070703_10008573 | |||
| 2272 | Ga0070703_10017152 | |||
| 2273 | Ga0070709_10001678 | |||
| 2274 | Ga0070709_10028390 | |||
| 2275 | Ga0070709_10030542 | |||
| 2276 | Ga0070709_10127041 | |||
| 2277 | Ga0070714_100058681 | |||
| 2278 | Ga0070714_100068956 | |||
| 2279 | Ga0070714_100231952 | |||
| 2280 | Ga0070714_100695228 | |||
| 2281 | Ga0070713_100004299 | |||
| 2282 | Ga0070713_100013856 | |||
| 2283 | Ga0070713_100018974 | |||
| 2284 | Ga0070713_100060940 | |||
| 2285 | Ga0070710_10010866 | |||
| 2286 | Ga0070710_10013537 | |||
| 2287 | Ga0070710_10031626 | |||
| 2288 | Ga0070711_100006663 | |||
| 2289 | Ga0070711_100033311 | |||
| 2290 | Ga0070711_100062704 | |||
| 2291 | Ga0070711_100088211 | |||
| 2292 | Ga0070711_100120247 | |||
| 2293 | Ga0070711_100127762 | |||
| 2294 | Ga0070711_100131967 | |||
| 2295 | Ga0070705_100000874 | |||
| 2296 | Ga0070705_100031418 | |||
| 2297 | Ga0070705_100083692 | |||
| 2298 | Ga0070705_100106424 | |||
| 2299 | Ga0070705_100222061 | |||
| 2300 | Ga0070700_100002863 | |||
| 2301 | Ga0070700_100032741 | |||
| 2302 | Ga0070700_100293672 | |||
| 2303 | Ga0070694_100000390 | |||
| 2304 | Ga0070694_100000998 | |||
| 2305 | Ga0070694_100001507 | |||
| 2306 | Ga0070694_100032223 | |||
| 2307 | Ga0070694_100201333 | |||
| 2308 | Ga0070694_100279091 | |||
| 2309 | Ga0070708_100000402 | |||
| 2310 | Ga0070708_100052979 | |||
| 2311 | Ga0070708_100104286 | |||
| 2312 | Ga0070708_100117348 | |||
| 2313 | Ga0070708_100744908 | |||
| 2314 | Ga0070663_100018923 | |||
| 2315 | Ga0070663_100025011 | |||
| 2316 | Ga0070678_100010262 | |||
| 2317 | Ga0070678_100601541 | |||
| 2318 | Ga0070662_100001666 | |||
| 2319 | Ga0070662_100002564 | |||
| 2320 | Ga0070662_100010579 | |||
| 2321 | Ga0070662_100037200 | |||
| 2322 | Ga0070662_100053117 | |||
| 2323 | Ga0070662_100194336 | |||
| 2324 | Ga0070681_10006870 | |||
| 2325 | Ga0070681_10007824 | |||
| 2326 | Ga0070681_10009162 | |||
| 2327 | Ga0070681_10012069 | |||
| 2328 | Ga0070681_10017661 | |||
| 2329 | Ga0070681_10023442 | |||
| 2330 | Ga0070681_10026806 | |||
| 2331 | Ga0070681_10038004 | |||
| 2332 | Ga0070681_10085486 | |||
| 2333 | Ga0070681_10105363 | |||
| 2334 | Ga0068867_100004614 | |||
| 2335 | Ga0068867_100005662 | |||
| 2336 | Ga0068867_100128668 | |||
| 2337 | Ga0070685_10006948 | |||
| 2338 | Ga0070685_10056750 | |||
| 2339 | Ga0070685_10060826 | |||
| 2340 | Ga0070706_100000099 | |||
| 2341 | Ga0070706_100000367 | |||
| 2342 | Ga0070706_100008099 | |||
| 2343 | Ga0070706_100012270 | |||
| 2344 | Ga0070706_100026434 | |||
| 2345 | Ga0070706_100037537 | |||
| 2346 | Ga0070706_100133062 | |||
| 2347 | Ga0070706_100157311 | |||
| 2348 | Ga0070707_100001543 | |||
| 2349 | Ga0070707_100002214 | |||
| 2350 | Ga0070707_100004554 | |||
| 2351 | Ga0070707_100005782 | |||
| 2352 | Ga0070707_100005986 | |||
| 2353 | Ga0070707_100042488 | |||
| 2354 | Ga0070707_100048743 | |||
| 2355 | Ga0070707_100196986 | |||
| 2356 | Ga0070698_100004215 | |||
| 2357 | Ga0070698_100011760 | |||
| 2358 | Ga0070698_100025889 | |||
| 2359 | Ga0070698_100106065 | |||
| 2360 | Ga0070698_100109546 | |||
| 2361 | Ga0070698_100129567 | |||
| 2362 | Ga0070698_100445469 | |||
| 2363 | Ga0070699_100000945 | |||
| 2364 | Ga0070699_100025311 | |||
| 2365 | Ga0070699_100030144 | |||
| 2366 | Ga0070699_100074275 | |||
| 2367 | Ga0070699_100198039 | |||
| 2368 | Ga0070699_100538096 | |||
| 2369 | Ga0070679_100007489 | |||
| 2370 | Ga0070679_100028360 | |||
| 2371 | Ga0070679_100029489 | |||
| 2372 | Ga0070679_100033784 | |||
| 2373 | Ga0070679_100042170 | |||
| 2374 | Ga0070679_100044073 | |||
| 2375 | Ga0070679_100060853 | |||
| 2376 | Ga0070679_100071614 | |||
| 2377 | Ga0070679_100081922 | |||
| 2378 | Ga0070679_100115247 | |||
| 2379 | Ga0070684_100000894 | |||
| 2380 | Ga0070684_100054573 | |||
| 2381 | Ga0070684_100071707 | |||
| 2382 | Ga0070684_100147943 | |||
| 2383 | Ga0070697_100000582 | |||
| 2384 | Ga0070697_100018950 | |||
| 2385 | Ga0070697_100044697 | |||
| 2386 | Ga0070697_100054382 | |||
| 2387 | Ga0070697_100170879 | |||
| 2388 | Ga0070697_100240935 | |||
| 2389 | Ga0068853_100000770 | |||
| 2390 | Ga0068853_100010158 | |||
| 2391 | Ga0068853_100081728 | |||
| 2392 | Ga0070672_100008661 | |||
| 2393 | Ga0070672_100079516 | |||
| 2394 | Ga0070672_100145320 | |||
| 2395 | Ga0070686_100035163 | |||
| 2396 | Ga0070695_100000741 | |||
| 2397 | Ga0070695_100026614 | |||
| 2398 | Ga0070695_100479347 | |||
| 2399 | Ga0070696_100003955 | |||
| 2400 | Ga0070696_100005009 | |||
| 2401 | Ga0070696_100006635 | |||
| 2402 | Ga0070693_100000418 | |||
| 2403 | Ga0070693_100001405 | |||
| 2404 | Ga0070693_100411193 | |||
| 2405 | Ga0070665_100030194 | |||
| 2406 | Ga0070665_100059697 | |||
| 2407 | Ga0070665_100066956 | |||
| 2408 | Ga0070665_100076797 | |||
| 2409 | Ga0070665_100129403 | |||
| 2410 | Ga0070704_100000428 | |||
| 2411 | Ga0070704_100000772 | |||
| 2412 | Ga0070704_100006965 | |||
| 2413 | Ga0070704_100088006 | |||
| 2414 | Ga0070704_100137037 | |||
| 2415 | Ga0070704_100353715 | |||
| 2416 | Ga0068855_100001154 | |||
| 2417 | Ga0068855_100007545 | |||
| 2418 | Ga0068855_100012186 | |||
| 2419 | Ga0068855_100053556 | |||
| 2420 | Ga0068855_100116783 | |||
| 2421 | Ga0070664_100002406 | |||
| 2422 | Ga0070664_100003967 | |||
| 2423 | Ga0070664_100008025 | |||
| 2424 | Ga0070664_100085392 | |||
| 2425 | Ga0070664_100363973 | |||
| 2426 | Ga0070664_100392677 | |||
| 2427 | Ga0068857_100016930 | |||
| 2428 | Ga0068857_100022565 | |||
| 2429 | Ga0068854_100014300 | |||
| 2430 | Ga0068854_100023974 | |||
| 2431 | Ga0068854_100104826 | |||
| 2432 | Ga0068854_100180757 | |||
| 2433 | Ga0068856_100001185 | |||
| 2434 | Ga0068856_100003112 | |||
| 2435 | Ga0068856_100009875 | |||
| 2436 | Ga0068856_100021406 | |||
| 2437 | Ga0068856_100034152 | |||
| 2438 | Ga0068856_100044461 | |||
| 2439 | Ga0068856_100086371 | |||
| 2440 | Ga0068856_100212109 | |||
| 2441 | Ga0068856_100387666 | |||
| 2442 | Ga0068856_100424473 | |||
| 2443 | Ga0070702_100011295 | |||
| 2444 | Ga0070702_100064532 | |||
| 2445 | Ga0070702_100075856 | |||
| 2446 | Ga0068852_100002115 | |||
| 2447 | Ga0068852_100004876 | |||
| 2448 | Ga0068852_100021891 | |||
| 2449 | Ga0068852_100225271 | |||
| 2450 | Ga0068852_100547946 | |||
| 2451 | Ga0068859_100006242 | |||
| 2452 | Ga0068859_100011156 | |||
| 2453 | Ga0068859_100019359 | |||
| 2454 | Ga0068859_100084462 | |||
| 2455 | Ga0068859_100173819 | |||
| 2456 | Ga0068864_100001224 | |||
| 2457 | Ga0068864_100098615 | |||
| 2458 | Ga0068864_100176349 | |||
| 2459 | Ga0068866_10000301 | |||
| 2460 | Ga0068866_10000527 | |||
| 2461 | Ga0068866_10006508 | |||
| 2462 | Ga0068861_100049597 | |||
| 2463 | Ga0068861_100057538 | |||
| 2464 | Ga0068861_100344061 | |||
| 2465 | Ga0068851_10001590 | |||
| 2466 | Ga0068851_10011381 | |||
| 2467 | Ga0068851_10084263 | |||
| 2468 | Ga0068870_10000280 | |||
| 2469 | Ga0068870_10000354 | |||
| 2470 | Ga0068863_100000340 | |||
| 2471 | Ga0068863_100019545 | |||
| 2472 | Ga0068863_100220895 | |||
| 2473 | Ga0068863_100538014 | |||
| 2474 | Ga0068858_100004859 | |||
| 2475 | Ga0068858_100009915 | |||
| 2476 | Ga0068858_100020715 | |||
| 2477 | Ga0068858_100089416 | |||
| 2478 | Ga0068858_100631469 | |||
| 2479 | Ga0068860_100013035 | |||
| 2480 | Ga0068860_100031227 | |||
| 2481 | Ga0068860_100242756 | |||
| 2482 | Ga0068862_100015630 | |||
| 2483 | Ga0081455_10000007 | |||
| 2484 | Ga0081455_10114013 | |||
| 2485 | Ga0081538_10013234 | |||
| 2486 | Ga0081538_10047803 | |||
| 2487 | Ga0081538_10066749 | |||
| 2488 | Ga0081540_1000283 | |||
| 2489 | Ga0081540_1024058 | |||
| 2490 | Ga0081540_1031565 | |||
| 2491 | Ga0081539_10000009 | |||
| 2492 | Ga0070717_10001010 | |||
| 2493 | Ga0070717_10065674 | |||
| 2494 | Ga0070717_10098072 | |||
| 2495 | Ga0070717_10132896 | |||
| 2496 | Ga0070717_10154069 | |||
| 2497 | Ga0075365_10000088 | |||
| 2498 | Ga0075365_10008838 | |||
| 2499 | Ga0075365_10029017 | |||
| 2500 | Ga0075365_10035993 | |||
| 2501 | Ga0075368_10000101 | |||
| 2502 | Ga0075363_100000128 | |||
| 2503 | Ga0075363_100016970 | |||
| 2504 | Ga0075363_100058287 | |||
| 2505 | Ga0075364_10000004 | |||
| 2506 | Ga0075364_10002167 | |||
| 2507 | Ga0075364_10008524 | |||
| 2508 | Ga0075364_10021617 | |||
| 2509 | Ga0075432_10036358 | |||
| 2510 | Ga0070716_100017441 | |||
| 2511 | Ga0070716_100024257 | |||
| 2512 | Ga0070712_100005678 | |||
| 2513 | Ga0070712_100073676 | |||
| 2514 | Ga0070712_100299661 | |||
| 2515 | Ga0075362_10000009 | |||
| 2516 | Ga0075362_10015262 | |||
| 2517 | Ga0075362_10034931 | |||
| 2518 | Ga0075367_10000018 | |||
| 2519 | Ga0075367_10012900 | |||
| 2520 | Ga0075367_10031905 | |||
| 2521 | Ga0075369_10000011 | |||
| 2522 | Ga0075369_10008188 | |||
| 2523 | Ga0075366_10000085 | |||
| 2524 | Ga0075366_10066754 | |||
| 2525 | Ga0075366_10125502 | |||
| 2526 | Ga0097621_100023624 | |||
| 2527 | Ga0097621_100061761 | |||
| 2528 | Ga0097621_100104722 | |||
| 2529 | Ga0097621_100287147 | |||
| 2530 | Ga0075370_10000120 | |||
| 2531 | Ga0075370_10005461 | |||
| 2532 | Ga0075370_10048586 | |||
| 2533 | Ga0075370_10091980 | |||
| 2534 | Ga0075370_10127830 | |||
| 2535 | Ga0068871_100000301 | |||
| 2536 | Ga0068871_100009125 | |||
| 2537 | Ga0068871_100060760 | |||
| 2538 | Ga0068871_100065274 | |||
| 2539 | Ga0068871_100108380 | |||
| 2540 | Ga0068871_100160284 | |||
| 2541 | Ga0075428_100000643 | |||
| 2542 | Ga0075428_100010432 | |||
| 2543 | Ga0075428_100015421 | |||
| 2544 | Ga0075428_100297474 | |||
| 2545 | Ga0075430_100000052 | |||
| 2546 | Ga0075430_100010397 | |||
| 2547 | Ga0075430_100128790 | |||
| 2548 | Ga0075430_100152287 | |||
| 2549 | Ga0075430_100194390 | |||
| 2550 | Ga0075430_100231916 | |||
| 2551 | Ga0075430_100262916 | |||
| 2552 | Ga0075431_100000441 | |||
| 2553 | Ga0075431_100000689 | |||
| 2554 | Ga0075431_100000802 | |||
| 2555 | Ga0075431_100012575 | |||
| 2556 | Ga0075431_100025533 | |||
| 2557 | Ga0075431_100031754 | |||
| 2558 | Ga0075431_100053455 | |||
| 2559 | Ga0075431_100214516 | |||
| 2560 | Ga0075431_100408396 | |||
| 2561 | Ga0075433_10000276 | |||
| 2562 | Ga0075433_10004677 | |||
| 2563 | Ga0075433_10005682 | |||
| 2564 | Ga0075433_10009124 | |||
| 2565 | Ga0075433_10014960 | |||
| 2566 | Ga0075433_10084163 | |||
| 2567 | Ga0075433_10106133 | |||
| 2568 | Ga0075433_10162345 | |||
| 2569 | Ga0075434_100000597 | |||
| 2570 | Ga0075434_100001420 | |||
| 2571 | Ga0075434_100008472 | |||
| 2572 | Ga0075434_100017859 | |||
| 2573 | Ga0075434_100033864 | |||
| 2574 | Ga0075434_100044791 | |||
| 2575 | Ga0075434_100075504 | |||
| 2576 | Ga0075434_100142880 | |||
| 2577 | Ga0075434_100146816 | |||
| 2578 | Ga0075429_100000001 | |||
| 2579 | Ga0075429_100058076 | |||
| 2580 | Ga0068865_100037927 | |||
| 2581 | Ga0075436_100004744 | |||
| 2582 | Ga0075436_100007341 | |||
| 2583 | Ga0075436_100024561 | |||
| 2584 | Ga0075436_100039347 | |||
| 2585 | Ga0075436_100069505 | |||
| 2586 | Ga0097620_100006242 | |||
| 2587 | Ga0097620_100011157 | |||
| 2588 | Ga0097620_100084465 | |||
| 2589 | Ga0097620_100173817 | |||
| 2590 | Ga0099826_10000113 | |||
| 2591 | Ga0099826_10001604 | |||
| 2592 | Ga0099826_10141128 | |||
| 2593 | Ga0075435_100000328 | |||
| 2594 | Ga0075435_100012560 | |||
| 2595 | Ga0075435_100112587 | |||
| 2596 | Ga0075435_100203262 | |||
| 2597 | Ga0075435_100248681 | |||
| 2598 | Ga0099794_10018817 | |||
| 2599 | Ga0099794_10086255 | |||
| 2600 | Ga0105244_10001556 | |||
| 2601 | Ga0105244_10094140 | |||
| 2602 | Ga0105240_10070766 | |||
| 2603 | Ga0105240_10221940 | |||
| 2604 | Ga0105240_10237545 | |||
| 2605 | Ga0105240_10583978 | |||
| 2606 | Ga0105240_10796390 | |||
| 2607 | Ga0111539_10013178 | |||
| 2608 | Ga0111539_10013469 | |||
| 2609 | Ga0111539_10074229 | |||
| 2610 | Ga0111539_10103845 | |||
| 2611 | Ga0111539_10198119 | |||
| 2612 | Ga0111539_10323377 | |||
| 2613 | Ga0111539_10345404 | |||
| 2614 | Ga0111539_10348986 | |||
| 2615 | Ga0105245_10009808 | |||
| 2616 | Ga0105245_10009817 | |||
| 2617 | Ga0105245_10010701 | |||
| 2618 | Ga0105245_10018932 | |||
| 2619 | Ga0105245_10028859 | |||
| 2620 | Ga0105245_10056957 | |||
| 2621 | Ga0105245_10123740 | |||
| 2622 | Ga0105245_10498456 | |||
| 2623 | Ga0105247_10018307 | |||
| 2624 | Ga0105247_10020638 | |||
| 2625 | Ga0105247_10035792 | |||
| 2626 | Ga0114129_10002725 | |||
| 2627 | Ga0114129_10002794 | |||
| 2628 | Ga0114129_10007546 | |||
| 2629 | Ga0114129_10013314 | |||
| 2630 | Ga0114129_10028184 | |||
| 2631 | Ga0114129_10040610 | |||
| 2632 | Ga0114129_10050894 | |||
| 2633 | Ga0114129_10064301 | |||
| 2634 | Ga0114129_10253007 | |||
| 2635 | Ga0114129_10736463 | |||
| 2636 | Ga0105243_10000362 | |||
| 2637 | Ga0105243_10004388 | |||
| 2638 | Ga0105243_10005539 | |||
| 2639 | Ga0105243_10038463 | |||
| 2640 | Ga0105243_10044624 | |||
| 2641 | Ga0105241_10001943 | |||
| 2642 | Ga0105241_10008605 | |||
| 2643 | Ga0105241_10034109 | |||
| 2644 | Ga0105241_10095574 | |||
| 2645 | Ga0105241_10115813 | |||
| 2646 | Ga0105241_10678090 | |||
| 2647 | Ga0105242_10004469 | |||
| 2648 | Ga0105242_10007706 | |||
| 2649 | Ga0105242_10013489 | |||
| 2650 | Ga0105242_10029471 | |||
| 2651 | Ga0105242_10352227 | |||
| 2652 | Ga0105242_10369484 | |||
| 2653 | Ga0105248_10003102 | |||
| 2654 | Ga0105248_10043504 | |||
| 2655 | Ga0105248_10153536 | |||
| 2656 | Ga0105248_10184723 | |||
| 2657 | Ga0105248_10229395 | |||
| 2658 | Ga0105248_10526994 | |||
| 2659 | Ga0105237_10082797 | |||
| 2660 | Ga0105237_10130541 | |||
| 2661 | Ga0105237_10160339 | |||
| 2662 | Ga0105237_10316350 | |||
| 2663 | Ga0105238_10156600 | |||
| 2664 | Ga0105238_10243423 | |||
| 2665 | Ga0105238_10259306 | |||
| 2666 | Ga0105249_10001599 | |||
| 2667 | Ga0105249_10070757 | |||
| 2668 | Ga0105249_10158497 | |||
| 2669 | Ga0105249_10231362 | |||
| 2670 | Ga0099796_10010105 | |||
| 2671 | Ga0105239_10009752 | |||
| 2672 | Ga0105239_10081152 | |||
| 2673 | Ga0105246_10007217 | |||
| 2674 | Ga0105246_10106583 | |||
| 2675 | Ga0105246_10200123 | |||
| 2676 | Ga0157373_10000499 | |||
| 2677 | Ga0157373_10001456 | |||
| 2678 | Ga0157373_10012576 | |||
| 2679 | Ga0157373_10014696 | |||
| 2680 | Ga0157373_10040644 | |||
| 2681 | Ga0157373_10201140 | |||
| 2682 | Ga0157373_10295188 | |||
| 2683 | Ga0157371_10001965 | |||
| 2684 | Ga0157371_10010606 | |||
| 2685 | Ga0157371_10037389 | |||
| 2686 | Ga0157370_10003331 | |||
| 2687 | Ga0157370_10048561 | |||
| 2688 | Ga0157370_10057468 | |||
| 2689 | Ga0157370_10138315 | |||
| 2690 | Ga0157370_10147628 | |||
| 2691 | Ga0157370_10202152 | |||
| 2692 | Ga0157370_10206478 | |||
| 2693 | Ga0157370_10216238 | |||
| 2694 | Ga0157369_10003195 | |||
| 2695 | Ga0157369_10004134 | |||
| 2696 | Ga0157369_10029042 | |||
| 2697 | Ga0157369_10045063 | |||
| 2698 | Ga0157369_10066145 | |||
| 2699 | Ga0157374_10001695 | |||
| 2700 | Ga0157374_10002626 | |||
| 2701 | Ga0157374_10057385 | |||
| 2702 | Ga0157374_10567538 | |||
| 2703 | Ga0157378_10003374 | |||
| 2704 | Ga0157378_10009719 | |||
| 2705 | Ga0157378_10043988 | |||
| 2706 | Ga0157378_10128094 | |||
| 2707 | Ga0157378_10145741 | |||
| 2708 | Ga0163162_10010828 | |||
| 2709 | Ga0163162_10038833 | |||
| 2710 | Ga0163162_10124956 | |||
| 2711 | Ga0163162_10136322 | |||
| 2712 | Ga0163162_10140377 | |||
| 2713 | Ga0163162_10607117 | |||
| 2714 | Ga0157372_10001631 | |||
| 2715 | Ga0157372_10002144 | |||
| 2716 | Ga0157372_10004321 | |||
| 2717 | Ga0157372_10005498 | |||
| 2718 | Ga0157372_10017070 | |||
| 2719 | Ga0157372_10033994 | |||
| 2720 | Ga0157372_10149132 | |||
| 2721 | Ga0157372_10210800 | |||
| 2722 | Ga0157372_10212656 | |||
| 2723 | Ga0157372_10323860 | |||
| 2724 | Ga0157372_10358481 | |||
| 2725 | Ga0157372_10402307 | |||
| 2726 | Ga0157372_11015212 | |||
| 2727 | Ga0157375_10008254 | |||
| 2728 | Ga0157375_10023648 | |||
| 2729 | Ga0157375_10092120 | |||
| 2730 | Ga0157375_10164395 | |||
| 2731 | Ga0163163_10003775 | |||
| 2732 | Ga0163163_10104554 | |||
| 2733 | Ga0163163_10112333 | |||
| 2734 | Ga0163163_10237660 | |||
| 2735 | Ga0157380_10000891 | |||
| 2736 | Ga0157380_10142966 | |||
| 2737 | Ga0182008_10000923 | |||
| 2738 | Ga0182008_10001629 | |||
| 2739 | Ga0182008_10003912 | |||
| 2740 | Ga0182008_10004163 | |||
| 2741 | Ga0182008_10010606 | |||
| 2742 | Ga0182008_10086624 | |||
| 2743 | Ga0157377_10000517 | |||
| 2744 | Ga0157377_10029892 | |||
| 2745 | Ga0157379_10002694 | |||
| 2746 | Ga0157379_10011995 | |||
| 2747 | Ga0157379_10014180 | |||
| 2748 | Ga0157379_10156053 | |||
| 2749 | Ga0157376_10000088 | |||
| 2750 | Ga0157376_10005595 | |||
| 2751 | Ga0157376_10053185 | |||
| 2752 | Ga0182006_1000007 | |||
| 2753 | Ga0182006_1014285 | |||
| 2754 | Ga0182006_1044633 | |||
| 2755 | Ga0182007_10000022 | |||
| 2756 | Ga0182007_10001812 | |||
| 2757 | Ga0182007_10002663 | |||
| 2758 | Ga0182007_10003476 | |||
| 2759 | Ga0182005_1000010 | |||
| 2760 | Ga0163161_10000144 | |||
| 2761 | Ga0163161_10000157 | |||
| 2762 | Ga0163161_10149013 | |||
| 2763 | Ga0163161_10173782 | |||
| 2764 | Ga0213873_10007625 | |||
| 2765 | Ga0213872_10001066 | |||
| 2766 | Ga0213872_10068185 | |||
| 2767 | Ga0213875_10021717 | |||
| 2768 | Ga0209672_102122 | |||
| 2769 | Ga0209147_105210 | |||
| 2770 | Ga0209563_100014 | |||
| 2771 | Ga0207425_1001149 | |||
| 2772 | Ga0207425_1003000 | |||
| 2773 | Ga0207425_1005417 | |||
| 2774 | Ga0209129_1000083 | |||
| 2775 | Ga0209129_1004634 | |||
| 2776 | Ga0209129_1012302 | |||
| 2777 | Ga0209565_1000083 | |||
| 2778 | Ga0209565_1001165 | |||
| 2779 | Ga0209565_1001782 | |||
| 2780 | Ga0207666_1000059 | |||
| 2781 | Ga0209673_1000089 | |||
| 2782 | Ga0209673_1000323 | |||
| 2783 | Ga0209673_1001607 | |||
| 2784 | Ga0209673_1003753 | |||
| 2785 | Ga0209673_1024705 | |||
| 2786 | Ga0209130_1000208 | |||
| 2787 | Ga0209130_1000231 | |||
| 2788 | Ga0209130_1000400 | |||
| 2789 | Ga0209130_1001602 | |||
| 2790 | Ga0209130_1004131 | |||
| 2791 | Ga0207673_1000330 | |||
| 2792 | Ga0209675_1000081 | |||
| 2793 | Ga0209675_1001031 | |||
| 2794 | Ga0209675_1002633 | |||
| 2795 | Ga0209675_1004304 | |||
| 2796 | Ga0209675_1008754 | |||
| 2797 | Ga0209675_1009968 | |||
| 2798 | Ga0209676_1000004 | |||
| 2799 | Ga0209676_1000183 | |||
| 2800 | Ga0209676_1001760 | |||
| 2801 | Ga0209676_1002922 | |||
| 2802 | Ga0209676_1004535 | |||
| 2803 | Ga0209676_1025810 | |||
| 2804 | Ga0209025_1000049 | |||
| 2805 | Ga0209025_1000518 | |||
| 2806 | Ga0209025_1001724 | |||
| 2807 | Ga0209025_1001836 | |||
| 2808 | Ga0209025_1002225 | |||
| 2809 | Ga0209025_1006047 | |||
| 2810 | Ga0209025_1006883 | |||
| 2811 | Ga0209025_1007740 | |||
| 2812 | Ga0209025_1014013 | |||
| 2813 | Ga0209025_1022168 | |||
| 2814 | Ga0209025_1027136 | |||
| 2815 | Ga0209025_1030957 | |||
| 2816 | Ga0209025_1052245 | |||
| 2817 | Ga0209564_1002924 | |||
| 2818 | Ga0209564_1005879 | |||
| 2819 | Ga0209564_1006290 | |||
| 2820 | Ga0209564_1009425 | |||
| 2821 | Ga0209758_1000132 | |||
| 2822 | Ga0209758_1000628 | |||
| 2823 | Ga0209758_1006941 | |||
| 2824 | Ga0209758_1011111 | |||
| 2825 | Ga0209050_1000002 | |||
| 2826 | Ga0209050_1001170 | |||
| 2827 | Ga0209050_1002672 | |||
| 2828 | Ga0209050_1006110 | |||
| 2829 | Ga0209050_1006526 | |||
| 2830 | Ga0209050_1015580 | |||
| 2831 | Ga0209256_1000492 | |||
| 2832 | Ga0209256_1000973 | |||
| 2833 | Ga0209256_1002639 | |||
| 2834 | Ga0207426_1000046 | |||
| 2835 | Ga0207426_1000197 | |||
| 2836 | Ga0207426_1000584 | |||
| 2837 | Ga0207426_1002041 | |||
| 2838 | Ga0209051_1000002 | |||
| 2839 | Ga0209051_1000533 | |||
| 2840 | Ga0209051_1001870 | |||
| 2841 | Ga0209051_1002364 | |||
| 2842 | Ga0209051_1009018 | |||
| 2843 | Ga0209051_1016781 | |||
| 2844 | Ga0209051_1030165 | |||
| 2845 | Ga0209051_1041625 | |||
| 2846 | Ga0209051_1043267 | |||
| 2847 | Ga0209257_1000002 | |||
| 2848 | Ga0209257_1000016 | |||
| 2849 | Ga0209257_1000361 | |||
| 2850 | Ga0209257_1009329 | |||
| 2851 | Ga0207697_10004888 | |||
| 2852 | Ga0207697_10005773 | |||
| 2853 | Ga0207697_10027556 | |||
| 2854 | Ga0207656_10009568 | |||
| 2855 | Ga0207656_10025330 | |||
| 2856 | Ga0207656_10073882 | |||
| 2857 | Ga0207655_1007936 | |||
| 2858 | Ga0207653_10001520 | |||
| 2859 | Ga0207653_10002470 | |||
| 2860 | Ga0207653_10019309 | |||
| 2861 | Ga0207682_10000233 | |||
| 2862 | Ga0207682_10000509 | |||
| 2863 | Ga0207692_10012403 | |||
| 2864 | Ga0207692_10024508 | |||
| 2865 | Ga0207692_10119408 | |||
| 2866 | Ga0207710_10006153 | |||
| 2867 | Ga0207688_10000167 | |||
| 2868 | Ga0207688_10026635 | |||
| 2869 | Ga0207688_10050276 | |||
| 2870 | Ga0207680_10008068 | |||
| 2871 | Ga0207680_10019296 | |||
| 2872 | Ga0207680_10027653 | |||
| 2873 | Ga0207680_10187827 | |||
| 2874 | Ga0207647_10006799 | |||
| 2875 | Ga0207647_10049731 | |||
| 2876 | Ga0207647_10065911 | |||
| 2877 | Ga0207685_10006792 | |||
| 2878 | Ga0207685_10100918 | |||
| 2879 | Ga0207699_10014979 | |||
| 2880 | Ga0207699_10018629 | |||
| 2881 | Ga0207699_10107246 | |||
| 2882 | Ga0207699_10116909 | |||
| 2883 | Ga0207699_10142209 | |||
| 2884 | Ga0207645_10000059 | |||
| 2885 | Ga0207645_10000100 | |||
| 2886 | Ga0207645_10019420 | |||
| 2887 | Ga0207645_10032640 | |||
| 2888 | Ga0207645_10116715 | |||
| 2889 | Ga0207643_10000007 | |||
| 2890 | Ga0207643_10000014 | |||
| 2891 | Ga0207643_10028396 | |||
| 2892 | Ga0207705_10111477 | |||
| 2893 | Ga0207705_10147049 | |||
| 2894 | Ga0207705_10439103 | |||
| 2895 | Ga0207684_10000047 | |||
| 2896 | Ga0207684_10000370 | |||
| 2897 | Ga0207684_10002538 | |||
| 2898 | Ga0207684_10005313 | |||
| 2899 | Ga0207684_10021471 | |||
| 2900 | Ga0207684_10026392 | |||
| 2901 | Ga0207684_10033330 | |||
| 2902 | Ga0207684_10042118 | |||
| 2903 | Ga0207684_10049950 | |||
| 2904 | Ga0207684_10060104 | |||
| 2905 | Ga0207684_10084595 | |||
| 2906 | Ga0207684_10215618 | |||
| 2907 | Ga0207654_10017742 | |||
| 2908 | Ga0207654_10027404 | |||
| 2909 | Ga0207654_10166523 | |||
| 2910 | Ga0207654_10192175 | |||
| 2911 | Ga0207707_10000138 | |||
| 2912 | Ga0207707_10005018 | |||
| 2913 | Ga0207707_10016070 | |||
| 2914 | Ga0207707_10022060 | |||
| 2915 | Ga0207707_10052281 | |||
| 2916 | Ga0207707_10077610 | |||
| 2917 | Ga0207707_10091096 | |||
| 2918 | Ga0207707_10199984 | |||
| 2919 | Ga0207707_10240676 | |||
| 2920 | Ga0207695_10292264 | |||
| 2921 | Ga0207695_10550983 | |||
| 2922 | Ga0207671_10051675 | |||
| 2923 | Ga0207671_10082753 | |||
| 2924 | Ga0207671_10227462 | |||
| 2925 | Ga0207693_10003697 | |||
| 2926 | Ga0207693_10010251 | |||
| 2927 | Ga0207693_10010690 | |||
| 2928 | Ga0207693_10022705 | |||
| 2929 | Ga0207693_10052278 | |||
| 2930 | Ga0207693_10119313 | |||
| 2931 | Ga0207693_10214991 | |||
| 2932 | Ga0207663_10016769 | |||
| 2933 | Ga0207663_10048579 | |||
| 2934 | Ga0207663_10081072 | |||
| 2935 | Ga0207663_10129197 | |||
| 2936 | Ga0207660_10000041 | |||
| 2937 | Ga0207660_10000848 | |||
| 2938 | Ga0207660_10016588 | |||
| 2939 | Ga0207660_10039418 | |||
| 2940 | Ga0207660_10189221 | |||
| 2941 | Ga0207662_10000195 | |||
| 2942 | Ga0207662_10041918 | |||
| 2943 | Ga0207657_10000135 | |||
| 2944 | Ga0207657_10000371 | |||
| 2945 | Ga0207657_10002386 | |||
| 2946 | Ga0207657_10008450 | |||
| 2947 | Ga0207657_10011112 | |||
| 2948 | Ga0207657_10015145 | |||
| 2949 | Ga0207657_10023887 | |||
| 2950 | Ga0207657_10040173 | |||
| 2951 | Ga0207649_10001482 | |||
| 2952 | Ga0207649_10003041 | |||
| 2953 | Ga0207649_10265585 | |||
| 2954 | Ga0207652_10002995 | |||
| 2955 | Ga0207652_10005355 | |||
| 2956 | Ga0207652_10015708 | |||
| 2957 | Ga0207652_10019549 | |||
| 2958 | Ga0207652_10033023 | |||
| 2959 | Ga0207652_10103601 | |||
| 2960 | Ga0207652_10199221 | |||
| 2961 | Ga0207652_10228996 | |||
| 2962 | Ga0207652_10299556 | |||
| 2963 | Ga0207652_10385584 | |||
| 2964 | Ga0207646_10000466 | |||
| 2965 | Ga0207646_10007223 | |||
| 2966 | Ga0207646_10025133 | |||
| 2967 | Ga0207646_10035640 | |||
| 2968 | Ga0207646_10052656 | |||
| 2969 | Ga0207646_10066999 | |||
| 2970 | Ga0207681_10001546 | |||
| 2971 | Ga0207681_10256360 | |||
| 2972 | Ga0207694_10079410 | |||
| 2973 | Ga0207694_10334017 | |||
| 2974 | Ga0207650_10001317 | |||
| 2975 | Ga0207650_10007958 | |||
| 2976 | Ga0207650_10036096 | |||
| 2977 | Ga0207659_10003760 | |||
| 2978 | Ga0207659_10003917 | |||
| 2979 | Ga0207659_10017546 | |||
| 2980 | Ga0207659_10231822 | |||
| 2981 | Ga0207687_10000072 | |||
| 2982 | Ga0207687_10002399 | |||
| 2983 | Ga0207687_10004046 | |||
| 2984 | Ga0207687_10040930 | |||
| 2985 | Ga0207687_10069085 | |||
| 2986 | Ga0207700_10009195 | |||
| 2987 | Ga0207700_10061588 | |||
| 2988 | Ga0207700_10083552 | |||
| 2989 | Ga0207700_10102963 | |||
| 2990 | Ga0207700_10115658 | |||
| 2991 | Ga0207700_10163367 | |||
| 2992 | Ga0207700_10390726 | |||
| 2993 | Ga0207664_10001202 | |||
| 2994 | Ga0207664_10025036 | |||
| 2995 | Ga0207664_10026888 | |||
| 2996 | Ga0207664_10079180 | |||
| 2997 | Ga0207664_10113689 | |||
| 2998 | Ga0207644_10001292 | |||
| 2999 | Ga0207644_10003302 | |||
| 3000 | Ga0207644_10014609 | |||
| 3001 | Ga0207644_10049977 | |||
| 3002 | Ga0207644_10104400 | |||
| 3003 | Ga0207644_10148953 | |||
| 3004 | Ga0207690_10003300 | |||
| 3005 | Ga0207690_10004975 | |||
| 3006 | Ga0207690_10021253 | |||
| 3007 | Ga0207690_10055902 | |||
| 3008 | Ga0207690_10065899 | |||
| 3009 | Ga0207690_10086957 | |||
| 3010 | Ga0207690_10109014 | |||
| 3011 | Ga0207690_10160875 | |||
| 3012 | Ga0207690_10225340 | |||
| 3013 | Ga0207706_10000179 | |||
| 3014 | Ga0207706_10008198 | |||
| 3015 | Ga0207706_10010659 | |||
| 3016 | Ga0207706_10027673 | |||
| 3017 | Ga0207706_10032369 | |||
| 3018 | Ga0207706_10212362 | |||
| 3019 | Ga0207686_10001034 | |||
| 3020 | Ga0207686_10001546 | |||
| 3021 | Ga0207686_10062493 | |||
| 3022 | Ga0207686_10135099 | |||
| 3023 | Ga0207686_10224025 | |||
| 3024 | Ga0207709_10000323 | |||
| 3025 | Ga0207709_10001423 | |||
| 3026 | Ga0207709_10002180 | |||
| 3027 | Ga0207709_10010841 | |||
| 3028 | Ga0207670_10007269 | |||
| 3029 | Ga0207670_10007607 | |||
| 3030 | Ga0207670_10033916 | |||
| 3031 | Ga0207670_10177187 | |||
| 3032 | Ga0207669_10000176 | |||
| 3033 | Ga0207669_10021922 | |||
| 3034 | Ga0207704_10013299 | |||
| 3035 | Ga0207704_10065340 | |||
| 3036 | Ga0207704_10548285 | |||
| 3037 | Ga0207665_10002312 | |||
| 3038 | Ga0207665_10014000 | |||
| 3039 | Ga0207665_10028429 | |||
| 3040 | Ga0207691_10005440 | |||
| 3041 | Ga0207691_10008719 | |||
| 3042 | Ga0207691_10024412 | |||
| 3043 | Ga0207711_10001106 | |||
| 3044 | Ga0207711_10001412 | |||
| 3045 | Ga0207711_10054504 | |||
| 3046 | Ga0207711_10297221 | |||
| 3047 | Ga0207689_10000340 | |||
| 3048 | Ga0207689_10000366 | |||
| 3049 | Ga0207689_10011579 | |||
| 3050 | Ga0207689_10075610 | |||
| 3051 | Ga0207689_10239592 | |||
| 3052 | Ga0207689_10258146 | |||
| 3053 | Ga0207689_10273117 | |||
| 3054 | Ga0207661_10000087 | |||
| 3055 | Ga0207661_10324767 | |||
| 3056 | Ga0207661_10340880 | |||
| 3057 | Ga0207679_10000029 | |||
| 3058 | Ga0207679_10000212 | |||
| 3059 | Ga0207679_10004897 | |||
| 3060 | Ga0207679_10017886 | |||
| 3061 | Ga0207679_10020500 | |||
| 3062 | Ga0207679_10038663 | |||
| 3063 | Ga0207679_10190787 | |||
| 3064 | Ga0207667_10000296 | |||
| 3065 | Ga0207667_10026324 | |||
| 3066 | Ga0207667_10071531 | |||
| 3067 | Ga0207667_10109162 | |||
| 3068 | Ga0207667_10171393 | |||
| 3069 | Ga0207667_10374146 | |||
| 3070 | Ga0207651_10001426 | |||
| 3071 | Ga0207651_10004291 | |||
| 3072 | Ga0207651_10029362 | |||
| 3073 | Ga0207651_10085237 | |||
| 3074 | Ga0207651_10461367 | |||
| 3075 | Ga0207712_10001547 | |||
| 3076 | Ga0207712_10262138 | |||
| 3077 | Ga0207712_10384491 | |||
| 3078 | Ga0207640_10001474 | |||
| 3079 | Ga0207640_10004722 | |||
| 3080 | Ga0207640_10078853 | |||
| 3081 | Ga0207640_10079397 | |||
| 3082 | Ga0207640_10082980 | |||
| 3083 | Ga0207640_10090523 | |||
| 3084 | Ga0207658_10005146 | |||
| 3085 | Ga0207658_10020207 | |||
| 3086 | Ga0207658_10049391 | |||
| 3087 | Ga0207677_10005872 | |||
| 3088 | Ga0207677_10007549 | |||
| 3089 | Ga0207677_10032098 | |||
| 3090 | Ga0207677_10072219 | |||
| 3091 | Ga0207677_10104308 | |||
| 3092 | Ga0207677_10184137 | |||
| 3093 | Ga0207703_10001566 | |||
| 3094 | Ga0207703_10026810 | |||
| 3095 | Ga0207639_10001773 | |||
| 3096 | Ga0207639_10009108 | |||
| 3097 | Ga0207639_10030650 | |||
| 3098 | Ga0207639_10139704 | |||
| 3099 | Ga0207678_10006632 | |||
| 3100 | Ga0207678_10007393 | |||
| 3101 | Ga0207678_10059246 | |||
| 3102 | Ga0207708_10007017 | |||
| 3103 | Ga0207708_10068643 | |||
| 3104 | Ga0207702_10000997 | |||
| 3105 | Ga0207702_10001150 | |||
| 3106 | Ga0207702_10002232 | |||
| 3107 | Ga0207702_10015638 | |||
| 3108 | Ga0207702_10065241 | |||
| 3109 | Ga0207702_10208236 | |||
| 3110 | Ga0207641_10011956 | |||
| 3111 | Ga0207641_10014477 | |||
| 3112 | Ga0207641_10153500 | |||
| 3113 | Ga0207641_10302361 | |||
| 3114 | Ga0207641_10505287 | |||
| 3115 | Ga0207648_10001239 | |||
| 3116 | Ga0207648_10003625 | |||
| 3117 | Ga0207648_10008796 | |||
| 3118 | Ga0207648_10249840 | |||
| 3119 | Ga0207648_10276416 | |||
| 3120 | Ga0207676_10000429 | |||
| 3121 | Ga0207676_10001946 | |||
| 3122 | Ga0207676_10004807 | |||
| 3123 | Ga0207676_10013792 | |||
| 3124 | Ga0207676_10325736 | |||
| 3125 | Ga0207674_10000684 | |||
| 3126 | Ga0207674_10000697 | |||
| 3127 | Ga0207674_10023874 | |||
| 3128 | Ga0207674_10028853 | |||
| 3129 | Ga0207674_10068749 | |||
| 3130 | Ga0207674_10416664 | |||
| 3131 | Ga0207675_100005465 | |||
| 3132 | Ga0207675_100013598 | |||
| 3133 | Ga0207675_100021301 | |||
| 3134 | Ga0207675_100209693 | |||
| 3135 | Ga0207683_10000029 | |||
| 3136 | Ga0207683_10001317 | |||
| 3137 | Ga0207683_10030000 | |||
| 3138 | Ga0207683_10052262 | |||
| 3139 | Ga0207683_10160885 | |||
| 3140 | Ga0207683_10199221 | |||
| 3141 | Ga0207683_10239388 | |||
| 3142 | Ga0207698_10018865 | |||
| 3143 | Ga0207698_10023805 | |||
| 3144 | Ga0207698_10045457 | |||
| 3145 | Ga0207698_10084889 | |||
| 3146 | Ga0207698_10102579 | |||
| 3147 | Ga0207698_10123448 | |||
| 3148 | Ga0207698_10434318 | |||
| 3149 | Ga0209179_1025133 | |||
| 3150 | Ga0209983_1005029 | |||
| 3151 | Ga0209282_1000165 | |||
| 3152 | Ga0209282_1002509 | |||
| 3153 | Ga0209588_1050337 | |||
| 3154 | Ga0209971_1003527 | |||
| 3155 | Ga0209966_1013384 | |||
| 3156 | Ga0209998_10001898 | |||
| 3157 | Ga0209813_10000254 | |||
| 3158 | Ga0209974_10002097 | |||
| 3159 | Ga0209974_10007927 | |||
| 3160 | Ga0209974_10011487 | |||
| 3161 | Ga0209974_10030952 | |||
| 3162 | Ga0207428_10000100 | |||
| 3163 | Ga0207428_10000119 | |||
| 3164 | Ga0207428_10010298 | |||
| 3165 | Ga0207428_10180526 | |||
| 3166 | Ga0268266_10040823 | |||
| 3167 | Ga0268266_10042868 | |||
| 3168 | Ga0268266_10049818 | |||
| 3169 | Ga0268266_10088876 | |||
| 3170 | Ga0268266_10098594 | |||
| 3171 | Ga0268265_10024411 | |||
| 3172 | Ga0268265_10074098 | |||
| 3173 | Ga0268264_10002968 | |||
| 3174 | Ga0268264_10021447 | |||
| 3175 | Ga0268264_10070544 | |||
| 3176 | Ga0268264_10502935 | |||
| 3177 | Ga0307515_10000195 | |||
| 3178 | Ga0307515_10000515 | |||
| 3179 | Ga0307515_10088375 | |||
| 3180 | Ga0307512_10148172 | |||
| 3181 | Ga0316177_1194083 | |||
| 3182 | Ga0316176_1194494 | |||
| 3183 | Ga0314311_1187085 | |||
| 3184 | Ga0316178_1021905 | |||
| 3185 | Ga0265330_10000033 | |||
| 3186 | Ga0265330_10007169 | |||
| 3187 | Ga0265332_10000001 | |||
| 3188 | Ga0265339_10143330 | |||
| 3189 | Ga0265327_10000425 | |||
| 3190 | Ga0265327_10095537 | |||
| 3191 | Ga0307513_10048235 | |||
| 3192 | Ga0307513_10178655 | |||
| 3193 | Ga0307513_10440065 | |||
| 3194 | Ga0307408_100000039 | |||
| 3195 | Ga0307408_100006354 | |||
| 3196 | Ga0307408_100020361 | |||
| 3197 | Ga0307408_100044908 | |||
| 3198 | Ga0307408_100089774 | |||
| 3199 | Ga0307408_100145730 | |||
| 3200 | Ga0307408_100170044 | |||
| 3201 | Ga0307408_100202823 | |||
| 3202 | Ga0307408_100224907 | |||
| 3203 | Ga0307514_10000529 | |||
| 3204 | Ga0307514_10063859 | |||
| 3205 | Ga0265314_10000022 | |||
| 3206 | Ga0265314_10171258 | |||
| 3207 | Ga0307405_10020362 | |||
| 3208 | Ga0307405_10071647 | |||
| 3209 | Ga0307405_10104581 | |||
| 3210 | Ga0307405_10265491 | |||
| 3211 | Ga0307518_10003759 | |||
| 3212 | Ga0307406_10002205 | |||
| 3213 | Ga0307406_10005358 | |||
| 3214 | Ga0307406_10102155 | |||
| 3215 | Ga0307406_10270813 | |||
| 3216 | Ga0307412_10001651 | |||
| 3217 | Ga0307412_10023576 | |||
| 3218 | Ga0307412_10039518 | |||
| 3219 | Ga0307412_10272685 | |||
| 3220 | Ga0307409_100228525 | |||
| 3221 | Ga0307409_100264339 | |||
| 3222 | Ga0307416_100039425 | |||
| 3223 | Ga0307416_100063101 | |||
| 3224 | Ga0307416_100077640 | |||
| 3225 | Ga0307416_100207503 | |||
| 3226 | Ga0307416_100260270 | |||
| 3227 | Ga0307416_100459308 | |||
| 3228 | Ga0307414_10021629 | |||
| 3229 | Ga0307414_10060819 | |||
| 3230 | Ga0307414_10149531 | |||
| 3231 | Ga0307414_10248893 | |||
| 3232 | Ga0307414_10273759 | |||
| 3233 | Ga0307414_10299834 | |||
| 3234 | Ga0307411_10011834 | |||
| 3235 | Ga0307411_10055799 | |||
| 3236 | Ga0307411_10138759 | |||
| 3237 | Ga0373930_0023220 | |||
| 3238 | Ga0373938_0003291 | |||
| 3239 | Ga0373926_0028170 | |||
| 3240 | Ga0373934_0000354 | |||
| 3241 | Ga0373934_0043424 | |||
| 3242 | Ga0373940_0003500 | |||
| 3243 | Ga0373949_0001408 | |||
| 3244 | Ga0373951_0003300 | |||
| 3245 | Ga0373951_0024329 | |||
| 3246 | Ga0373952_0009002 | |||
| 3247 | Ga0373923_0068441 | |||
| 3248 | Ga0373932_0081864 | |||
| 3249 | Ga0373939_0000003 | |||
| 3250 | Ga0373939_0001446 | |||
| 3251 | Ga0373939_0154864 | |||
| 3252 | Ga0373941_0035388 | |||
| 3253 | Ga0373945_0004052 | |||
| 3254 | Ga0373953_0035690 | |||
| 3255 | Ga0373954_0001840 | |||
| 3256 | Ga0373954_0016077 | |||
| 3257 | Ga0373956_0000015 | |||
| 3258 | Ga0373957_0017254 | |||
| 3259 | Ga0373957_0094294 | |||
| 3260 | Ga0373960_0008398 | |||
| 3261 | Ga0373960_0010251 | |||
| 3262 | Ga0373943_0098144 | |||
| 3263 | Ga0373946_0013975 | |||
| 3264 | Ga0373946_0082579 | |||
| 3265 | Ga0373955_0006536 | |||
| 3266 | Ga0373942_0010868 | |||
| 3267 | Ga0373942_0035350 | |||
| 3268 | Ga0373961_0001706 | |||
| 3269 | Ga0373961_0013496 | |||
| 3270 | Ga0373961_0068433 | |||
| 3271 | Ga0373962_0018254 | |||
| 3272 | Ga0373962_0029896 | |||
| 3273 | Ga0373924_0009830 | |||
| 3274 | Ga0373924_0012738 | |||
| 3275 | Ga0373924_0034289 | |||
| 3276 | Ga0373931_0001534 | |||
| 3277 | Ga0373931_0008185 | |||
| 3278 | Ga0373931_0013914 | |||
| 3279 | Ga0373931_0052791 | |||
| 3280 | Ga0373931_0152206 | |||
| 3281 | Ga0373935_0020975 | |||
| 3282 | Ga0373935_0468308 | |||
| 3283 | Ga0373927_0009992 | |||
| 3284 | Ga0373933_0001774 | |||
| 3285 | Ga0373933_0009434 | |||
| 3286 | Ga0373933_0056290 | |||
| 3287 | Ga0373947_0032531 | |||
| 3288 | Ga0373947_0033135 | |||
| 3289 | Ga0373937_0000182 | |||
| 3290 | Ga0373937_0020416 | |||
| 3291 | Ga0373937_0030398 | |||
| 3292 | Ga0373937_0056076 | |||
| 3293 | Ga0373937_0098771 | |||
| 3294 | Ga0373937_0150551 | |||
| 3295 | Ga0373937_0417361 | |||
| 3296 | Ga0373937_0723199 | |||
| 3297 | Ga0373937_0723241 | |||
| 3298 | Ga0373925_0004459 | |||
| 3299 | Ga0373925_0027813 | |||
| 3300 | Ga0373925_0037130 | |||
| 3301 | Ga0373925_0056356 | |||
| 3302 | Ga0373925_0079858 | |||
| 3303 | Ga0373925_0127429 | |||
| 3304 | Ga0395899_0003231 | |||
| 3305 | Ga0395899_0168227 | |||
| 3306 | Ga0395900_0000067 | |||
| 3307 | Ga0395900_0020030 | |||
| 3308 | Ga0395900_0282082 | |||
| 3309 | Ga0395898_0000214 | |||
| 3310 | Ga0395898_0002933 | |||
| 3311 | Ga0395898_0012009 | |||
| 3312 | Ga0395905_0000060 | |||
| 3313 | Ga0395905_0001506 | |||
| 3314 | Ga0395905_0002575 | |||
| 3315 | Ga0395905_0007574 | |||
| 3316 | Ga0395905_0030893 | |||
| 3317 | Ga0395905_0038449 | |||
| 3318 | Ga0395905_0068103 | |||
| 3319 | Ga0395905_0117467 | |||
| 3320 | Ga0395905_0418529 | |||
| 3321 | Ga0436364_0010042 | |||
| 3322 | Ga0436364_0062636 | |||
| 3323 | Ga0436364_0566936 | |||
| 3324 | Ga0436364_0839268 | |||
| 3325 | Ga0436364_1169737 | |||
| 3326 | Ga0436364_1266276 | |||
| 3327 | Ga0395901_0000063 | |||
| 3328 | Ga0395901_0019056 | |||
| 3329 | Ga0395901_0029770 | |||
| 3330 | Ga0395901_0059936 | |||
| 3331 | Ga0395901_0288219 | |||
| 3332 | Ga0395901_0431073 | |||
| 3333 | Ga0242420_015158 | |||
| 3334 | Ga0436365_1366850 | |||
| 3335 | Ga0436365_1630009 | |||
| 3336 | Ga0436365_1916586 | |||
| 3337 | Ga0436360_0286842 | |||
| 3338 | Ga0436360_0355657 | |||
| 3339 | Ga0436361_0225003 | |||
| 3340 | Ga0436361_0243008 | |||
| 3341 | Ga0436361_0953105 | |||
| 3342 | Ga0436361_0993124 | |||
| 3343 | Ga0436361_1161676 | |||
| 3344 | Ga0436363_0156420 | |||
| 3345 | Ga0436362_0196742 | |||
| 3346 | Ga0436362_0834131 | |||
| 3347 | Ga0439436_0001036 | |||
| 3348 | Ga0439436_0029804 | |||
| 3349 | Ga0439453_0001687 | |||
| 3350 | Ga0439453_0006616 | |||
| 3351 | Ga0439466_0004105 | |||
| 3352 | Ga0439465_0003246 | |||
| 3353 | Ga0439465_0030452 | |||
| 3354 | Ga0451793_0984015 | |||
| 3355 | Ga0451855_0956808 | |||
| 3356 | Ga0439441_000869 | |||
| 3357 | Ga0439441_005968 | |||
| 3358 | Ga0439441_006581 | |||
| 3359 | Ga0439442_006805 | |||
| 3360 | Ga0439445_0004602 | |||
| 3361 | Ga0439448_0006616 | |||
| 3362 | Ga0439432_011973 | |||
| 3363 | Ga0439432_033561 | |||
| 3364 | Ga0439449_0005851 | |||
| 3365 | Ga0439450_011365 | |||
| 3366 | Ga0439452_001501 | |||
| 3367 | Ga0439452_007901 | |||
| 3368 | Ga0439457_005546 | |||
| 3369 | Ga0450898_013732 | |||
| 3370 | Ga0450904_000354 | |||
| 3371 | Ga0439435_0000194 | |||
| 3372 | Ga0439435_0017059 | |||
| 3373 | Ga0439444_0000843 | |||
| 3374 | Ga0439459_0000155 | |||
| 3375 | Ga0439464_0000442 | |||
| 3376 | Ga0439460_0000838 | |||
| 3377 | Ga0450918_002634 | |||
| 3378 | Ga0451577_0001624 | |||
| 3379 | Ga0451577_0001635 | |||
| 3380 | Ga0451577_0003247 | |||
| 3381 | Ga0451577_0005276 | |||
| 3382 | Ga0451577_0218301 | |||
| 3383 | Ga0451577_0298719 | |||
| 3384 | Ga0451577_0356967 | |||
| 3385 | Ga0451577_0463770 | |||
| 3386 | Ga0453683_0000034 | |||
| 3387 | Ga0453683_0000062 | |||
| 3388 | Ga0453683_0006980 | |||
| 3389 | Ga0453683_0023611 | |||
| 3390 | Ga0453683_0047761 | |||
| 3391 | Ga0466961_0005894 | |||
| 3392 | Ga0466964_0087945 | |||
| 3393 | Ga0453684_0000176 | |||
| 3394 | Ga0453684_0001136 | |||
| 3395 | Ga0453684_0001504 | |||
| 3396 | Ga0453684_0003087 | |||
| 3397 | Ga0453684_0070906 | |||
| 3398 | Ga0453684_0075888 | |||
| 3399 | Ga0453684_0085668 | |||
| 3400 | Ga0453684_0127159 | |||
| 3401 | Ga0453684_0146890 | |||
| 3402 | Ga0453684_0147429 | |||
| 3403 | Ga0453684_0229254 | |||
| 3404 | Ga0453684_0341477 | |||
| 3405 | Ga0453684_0475312 | |||
| 3406 | Ga0466968_0058950 | |||
| 3407 | Ga0466968_0078020 | |||
| 3408 | Ga0466960_0078530 | |||
| 3409 | Ga0451576_0000260 | |||
| 3410 | Ga0451576_0001433 | |||
| 3411 | Ga0451576_0003830 | |||
| 3412 | Ga0451576_0019396 | |||
| 3413 | Ga0451576_0021367 | |||
| 3414 | Ga0451576_0048843 | |||
| 3415 | Ga0451576_0177123 | |||
| 3416 | Ga0451576_0342782 | |||
| 3417 | Ga0451576_0520121 | |||
| 3418 | Ga0466967_0126727 | |||
| 3419 | Ga0495592_0024915 | |||
| 3420 | Ga0495592_0086140 | |||
| 3421 | Ga0495603_0005200 | |||
| 3422 | Ga0495603_0095269 | |||
| 3423 | Ga0495603_0100081 | |||
| 3424 | Ga0495590_0061125 | |||
| 3425 | Ga0495629_0000037 | |||
| 3426 | Ga0495629_0001156 | |||
| 3427 | Ga0495629_0001563 | |||
| 3428 | Ga0495629_0033042 | |||
| 3429 | Ga0495629_0042196 | |||
| 3430 | Ga0495638_0000141 | |||
| 3431 | Ga0495638_0000224 | |||
| 3432 | Ga0495638_0043959 | |||
| 3433 | Ga0495638_0222369 | |||
| 3434 | Ga0495651_0000027 | |||
| 3435 | Ga0495651_0000976 | |||
| 3436 | Ga0495651_0088242 | |||
| 3437 | Ga0495651_0094542 | |||
| 3438 | Ga0495653_0000048 | |||
| 3439 | Ga0495653_0024941 | |||
| 3440 | Ga0495653_0030237 | |||
| 3441 | Ga0495650_0000826 | |||
| 3442 | Ga0495650_0001789 | |||
| 3443 | Ga0495580_0000118 | |||
| 3444 | Ga0495580_0002319 | |||
| 3445 | Ga0495580_0006778 | |||
| 3446 | Ga0495580_0010671 | |||
| 3447 | Ga0495580_0031152 | |||
| 3448 | Ga0495580_0077628 | |||
| 3449 | Ga0495580_0271061 | |||
| 3450 | Ga0495580_0296838 | |||
| 3451 | Ga0495582_0037321 | |||
| 3452 | Ga0495582_0044004 | |||
| 3453 | Ga0495582_0052018 | |||
| 3454 | Ga0495582_0056914 | |||
| 3455 | Ga0495582_0083908 | |||
| 3456 | Ga0495605_0001125 | |||
| 3457 | Ga0495605_0029999 | |||
| 3458 | Ga0495639_0018609 | |||
| 3459 | Ga0495639_0038886 | |||
| 3460 | Ga0495664_0018484 | |||
| 3461 | Ga0495584_0017031 | |||
| 3462 | Ga0495584_0040860 | |||
| 3463 | Ga0495584_0069962 | |||
| 3464 | Ga0495585_0060670 | |||
| 3465 | Ga0495594_0096669 | |||
| 3466 | Ga0495594_0250500 | |||
| 3467 | Ga0495596_0001244 | |||
| 3468 | Ga0495583_0003335 | |||
| 3469 | Ga0495583_0007472 | |||
| 3470 | Ga0495583_0031542 | |||
| 3471 | Ga0495583_0075780 | |||
| 3472 | Ga0495606_0007939 | |||
| 3473 | Ga0495606_0015733 | |||
| 3474 | Ga0495606_0152013 | |||
| 3475 | Ga0495608_0005730 | |||
| 3476 | Ga0495608_0059291 | |||
| 3477 | Ga0495610_0001332 | |||
| 3478 | Ga0495610_0009568 | |||
| 3479 | Ga0495610_0071087 | |||
| 3480 | Ga0495610_0090370 | |||
| 3481 | Ga0495616_0002253 | |||
| 3482 | Ga0495616_0048733 | |||
| 3483 | Ga0495618_0050931 | |||
| 3484 | Ga0495618_0236487 | |||
| 3485 | Ga0495620_0001081 | |||
| 3486 | Ga0495620_0026465 | |||
| 3487 | Ga0495628_0008183 | |||
| 3488 | Ga0495628_0253991 | |||
| 3489 | Ga0495630_0020974 | |||
| 3490 | Ga0495630_0106023 | |||
| 3491 | Ga0495631_0000589 | |||
| 3492 | Ga0495631_0008142 | |||
| 3493 | Ga0495632_0053727 | |||
| 3494 | Ga0495637_0004897 | |||
| 3495 | Ga0495643_0020848 | |||
| 3496 | Ga0495648_0009825 | |||
| 3497 | Ga0495648_0022823 | |||
| 3498 | Ga0495648_0102298 | |||
| 3499 | Ga0495663_0076584 | |||
| 3500 | Ga0495642_0005361 | |||
| 3501 | Ga0495652_0010377 | |||
| 3502 | Ga0495652_0021029 | |||
| 3503 | Ga0495652_0037153 | |||
| 3504 | Ga0495654_0005300 | |||
| 3505 | Ga0495654_0025422 | |||
| 3506 | Ga0495654_0063047 | |||
| 3507 | Ga0495665_0000612 | |||
| 3508 | Ga0495665_0019635 | |||
| 3509 | Ga0495665_0021631 | |||
| 3510 | Ga0495640_0168370 | |||
| 3511 | Ga0495586_0009675 | |||
| 3512 | Ga0495587_0000911 | |||
| 3513 | Ga0495587_0066254 | |||
| 3514 | Ga0495598_0033446 | |||
| 3515 | Ga0495598_0095558 | |||
| 3516 | Ga0495609_0000638 | |||
| 3517 | Ga0495621_0002683 | |||
| 3518 | Ga0495597_0000116 | |||
| 3519 | Ga0495597_0000268 | |||
| 3520 | Ga0495597_0005056 | |||
| 3521 | Ga0495597_0010288 | |||
| 3522 | Ga0495597_0082770 | |||
| 3523 | Ga0495645_0002149 | |||
| 3524 | Ga0495645_0013977 | |||
| 3525 | Ga0495645_0116543 | |||
| 3526 | Ga0495645_0126428 | |||
| 3527 | Ga0495622_0020911 | |||
| 3528 | Ga0495622_0068712 | |||
| 3529 | Ga0495633_0004788 | |||
| 3530 | Ga0495633_0019675 | |||
| 3531 | Ga0495667_0003799 | |||
| 3532 | Ga0495667_0090727 | |||
| 3533 | Ga0495667_0099507 | |||
| 3534 | Ga0495656_0002728 | |||
| 3535 | Ga0495656_0008420 | |||
| 3536 | Ga0495656_0172689 | |||
| 3537 | Ga0495668_0047548 | |||
| 3538 | Ga0495668_0150835 | |||
| 3539 | Ga0495634_0232010 | |||
| 3540 | Ga0495611_0012765 | |||
| 3541 | Ga0495611_0081780 | |||
| 3542 | Ga0495625_0001339 | |||
| 3543 | Ga0495625_0008416 | |||
| 3544 | Ga0495625_0057538 | |||
| 3545 | Ga0495625_0134870 | |||
| 3546 | Ga0495625_0187669 | |||
| 3547 | Ga0495635_0010092 | |||
| 3548 | Ga0495635_0033796 | |||
| 3549 | Ga0495659_0011648 | |||
| 3550 | Ga0495661_0050951 | |||
| 3551 | Ga0495588_0014032 | |||
| 3552 | Ga0495588_0049665 | |||
| 3553 | Ga0495588_0082506 | |||
| 3554 | Ga0495588_0245111 | |||
| 3555 | Ga0495657_0024016 | |||
| 3556 | Ga0495657_0181205 | |||
| 3557 | Ga0495599_0011662 | |||
| 3558 | Ga0495599_0151313 | |||
| 3559 | Ga0495623_0023846 | |||
| 3560 | Ga0495623_0036194 | |||
| 3561 | Ga0495623_0053265 | |||
| 3562 | Ga0495646_0006008 | |||
| 3563 | Ga0495646_0015480 | |||
| 3564 | Ga0495646_0028518 | |||
| 3565 | Ga0495647_0039540 | |||
| 3566 | Ga0495658_0010276 | |||
| 3567 | Ga0495658_0017275 | |||
| 3568 | Ga0495658_0035696 | |||
| 3569 | Ga0495658_0091110 | |||
| 3570 | Ga0495613_0004559 | |||
| 3571 | Ga0495613_0010190 | |||
| 3572 | Ga0495613_0031127 | |||
| 3573 | Ga0495613_0034682 | |||
| 3574 | Ga0495613_0075962 | |||
| 3575 | Ga0495624_0010363 | |||
| 3576 | Ga0495624_0044611 | |||
| 3577 | Ga0495670_0032094 | |||
| 3578 | Ga0495670_0035154 | |||
| 3579 | Ga0495670_0099230 | |||
| 3580 | Ga0495670_0115320 | |||
| 3581 | Ga0495671_0029873 | |||
| 3582 | Ga0495649_0007039 | |||
| 3583 | Ga0495649_0012076 | |||
| 3584 | Ga0495649_0027776 | |||
| 3585 | Ga0495649_0032739 | |||
| 3586 | Ga0495649_0164652 | |||
| 3587 | Ga0495589_0011570 | |||
| 3588 | Ga0495589_0018414 | |||
| 3589 | Ga0495600_0021667 | |||
| 3590 | Ga0495600_0045959 | |||
| 3591 | Ga0495600_0056973 | |||
| 3592 | Ga0495600_0108390 | |||
| 3593 | Ga0495600_0161621 | |||
| 3594 | Ga0495660_0046843 | |||
| 3595 | Ga0495581_0001747 | |||
| 3596 | Ga0495581_0002351 | |||
| 3597 | Ga0495604_0001863 | |||
| 3598 | Ga0495604_0020790 | |||
| 3599 | Ga0495674_0001578 | |||
| 3600 | Ga0495674_0002056 | |||
| 3601 | Ga0495674_0002205 | |||
| 3602 | Ga0495674_0005323 | |||
| 3603 | Ga0495674_0203242 | |||
| 3604 | Ga0495674_0363455 | |||
| 3605 | Ga0495674_0408047 | |||
| 3606 | Ga0495672_0003207 | |||
| 3607 | Ga0495672_0003446 | |||
| 3608 | Ga0495672_0011051 | |||
| 3609 | Ga0495672_0026030 | |||
| 3610 | Ga0495672_0057541 | |||
| 3611 | Ga0495672_0088939 | |||
| 3612 | Ga0495676_0024655 | |||
| 3613 | Ga0495676_0052608 | |||
| 3614 | Ga0495676_0428655 | |||
| 3615 | Ga0495680_0007430 | |||
| 3616 | Ga0495680_0016527 | |||
| 3617 | Ga0495680_0028529 | |||
| 3618 | Ga0495680_0040974 | |||
| 3619 | Ga0495683_0002291 | |||
| 3620 | Ga0495683_0019244 | |||
| 3621 | Ga0495683_0096770 | |||
| 3622 | Ga0495687_003219 | |||
| 3623 | Ga0495675_0053087 | |||
| 3624 | Ga0495677_0005821 | |||
| 3625 | Ga0495673_0020505 | |||
| 3626 | Ga0495673_0083582 | |||
| 3627 | Ga0495684_0011986 | |||
| 3628 | Ga0495684_0015752 | |||
| 3629 | Ga0495684_0210709 | |||
| 3630 | Ga0495593_0003668 | |||
| 3631 | Ga0495593_0014086 | |||
| 3632 | Ga0495593_0026716 | |||
| 3633 | Ga0495593_0050189 | |||
| 3634 | Ga0495602_0012427 | |||
| 3635 | Ga0495602_0013432 | |||
| 3636 | Ga0495602_0030864 | |||
| 3637 | Ga0495602_0040234 | |||
| 3638 | Ga0495602_0151047 | |||
| 3639 | Ga0495614_0002409 | |||
| 3640 | Ga0495614_0003269 | |||
| 3641 | Ga0495614_0039818 | |||
| 3642 | Ga0495614_0122828 | |||
| 3643 | Ga0495615_0006944 | |||
| 3644 | Ga0495626_0011832 | |||
| 3645 | Ga0495626_0026060 | |||
| 3646 | Ga0496100_0002293 | |||
| 3647 | Ga0496100_0013989 | |||
| 3648 | Ga0496100_0046783 | |||
| 3649 | Ga0496100_0176376 | |||
| 3650 | Ga0496101_0003592 | |||
| 3651 | Ga0496101_0040730 | |||
| 3652 | Ga0496101_0113226 | |||
| 3653 | Ga0496101_0159102 | |||
| 3654 | Ga0496101_0245487 | |||
| 3655 | Ga0496102_0005918 | |||
| 3656 | Ga0496102_0016898 | |||
| 3657 | Ga0496102_0273735 | |||
| 3658 | Ga0496103_0002596 | |||
| 3659 | Ga0496103_0006318 | |||
| 3660 | Ga0496103_0053072 | |||
| 3661 | Ga0496103_0071606 | |||
| 3662 | Ga0496104_0006365 | |||
| 3663 | Ga0496104_0012609 | |||
| 3664 | Ga0496104_0013003 | |||
| 3665 | Ga0496104_0015712 | |||
| 3666 | Ga0496104_0059727 | |||
| 3667 | Ga0496104_0129718 | |||
| 3668 | Ga0496104_0210022 | |||
| 3669 | Ga0496104_0226187 | |||
| 3670 | Ga0496104_0605812 | |||
| 3671 | Ga0496105_0001841 | |||
| 3672 | Ga0496105_0004700 | |||
| 3673 | Ga0496105_0029729 | |||
| 3674 | Ga0496105_0265993 | |||
| 3675 | Ga0496106_0011982 | |||
| 3676 | Ga0496106_0022766 | |||
| 3677 | Ga0496106_0066727 | |||
| 3678 | Ga0496106_0192365 | |||
| 3679 | Ga0496106_0253620 | |||
| 3680 | Ga0496107_0028075 | |||
| 3681 | Ga0496107_0052544 | |||
| 3682 | Ga0496107_0194657 | |||
| 3683 | Ga0496108_0008415 | |||
| 3684 | Ga0496108_0020388 | |||
| 3685 | Ga0496108_0173537 | |||
| 3686 | Ga0496109_0000488 | |||
| 3687 | Ga0496109_0030918 | |||
| 3688 | Ga0496109_0089960 | |||
| 3689 | Ga0496109_0094897 | |||
| 3690 | Ga0496109_0151258 | |||
| 3691 | Ga0496110_0011628 | |||
| 3692 | Ga0496110_0039591 | |||
| 3693 | Ga0496110_0163165 | |||
| 3694 | Ga0496110_0189532 | |||
| 3695 | Ga0496110_0264582 | |||
| 3696 | Ga0496110_0374126 | |||
| 3697 | Ga0496111_0014962 | |||
| 3698 | Ga0496111_0219626 | |||
| 3699 | Ga0496112_0008342 | |||
| 3700 | Ga0496112_0175434 | |||
| 3701 | Ga0496112_0189155 | |||
| 3702 | Ga0496112_0418747 | |||
| 3703 | Ga0496112_0480506 | |||
| 3704 | Ga0496113_0022983 | |||
| 3705 | Ga0496113_0109824 | |||
| 3706 | Ga0496113_0262484 | |||
| 3707 | Ga0496114_0004834 | |||
| 3708 | Ga0496114_0011440 | |||
| 3709 | Ga0496114_0030392 | |||
| 3710 | Ga0496114_0134938 | |||
| 3711 | Ga0496114_0333219 | |||
| 3712 | Ga0496114_0546153 | |||
| 3713 | Ga0496115_0019198 | |||
| 3714 | Ga0496115_0042078 | |||
| 3715 | Ga0496116_0002454 | |||
| 3716 | Ga0496116_0022481 | |||
| 3717 | Ga0496116_0027209 | |||
| 3718 | Ga0496116_0032935 | |||
| 3719 | Ga0496117_0000005 | |||
| 3720 | Ga0496117_0000105 | |||
| 3721 | Ga0496117_0020434 | |||
| 3722 | Ga0496117_0083704 | |||
| 3723 | Ga0496118_0000022 | |||
| 3724 | Ga0496118_0004662 | |||
| 3725 | Ga0496118_0089002 | |||
| 3726 | Ga0496118_0107375 | |||
| 3727 | Ga0496121_0000511 | |||
| 3728 | Ga0496121_0005938 | |||
| 3729 | Ga0496121_0010809 | |||
| 3730 | Ga0496121_0012354 | |||
| 3731 | Ga0496121_0041760 | |||
| 3732 | Ga0496121_0171540 | |||
| 3733 | Ga0496122_0000342 | |||
| 3734 | Ga0496122_0002912 | |||
| 3735 | Ga0496122_0025741 | |||
| 3736 | Ga0496122_0029962 | |||
| 3737 | Ga0496122_0058371 | |||
| 3738 | Ga0496122_0146357 | |||
| 3739 | Ga0496123_0000057 | |||
| 3740 | Ga0496123_0002872 | |||
| 3741 | Ga0496123_0055606 | |||
| 3742 | Ga0496124_0043856 | |||
| 3743 | Ga0496124_0127138 | |||
| 3744 | Ga0496124_0157093 | |||
| 3745 | Ga0496125_0001605 | |||
| 3746 | Ga0496125_0009940 | |||
| 3747 | Ga0496125_0011221 | |||
| 3748 | Ga0496125_0045201 | |||
| 3749 | Ga0496125_0048499 | |||
| 3750 | Ga0496125_0055066 | |||
| 3751 | Ga0496125_0111121 | |||
| 3752 | Ga0496126_0148492 | |||
| 3753 | Ga0496126_0330767 | |||
| 3754 | Ga0495678_023009 | |||
| 3755 | Ga0495682_0036496 | |||
| 3756 | Ga0501031_0098741 | |||
| 3757 | Ga0501032_0016838 | |||
| 3758 | Ga0501033_0000318 | |||
| 3759 | Ga0501033_0008248 | |||
| 3760 | Ga0501033_0035836 | |||
| 3761 | Ga0501033_0042576 | |||
| 3762 | Ga0501034_0000067 | |||
| 3763 | Ga0501034_0000423 | |||
| 3764 | Ga0501034_0000516 | |||
| 3765 | Ga0501034_0012327 | |||
| 3766 | Ga0501034_0026019 | |||
| 3767 | Ga0501034_0137086 | |||
| 3768 | Ga0501034_0144539 | |||
| 3769 | Ga0501036_0049064 | |||
| 3770 | Ga0501036_0105363 | |||
| 3771 | Ga0501036_0236317 | |||
| 3772 | Ga0501036_0475565 | |||
| 3773 | Ga0501037_0000136 | |||
| 3774 | Ga0501038_0035538 | |||
| 3775 | Ga0501038_0070876 | |||
| 3776 | Ga0501039_0078580 | |||
| 3777 | Ga0501039_0344861 | |||
| 3778 | Ga0501040_0000097 | |||
| 3779 | Ga0501040_0007189 | |||
| 3780 | Ga0501040_0013223 | |||
| 3781 | Ga0501040_0060122 | |||
| 3782 | Ga0501040_0222903 | |||
| 3783 | Ga0501041_0002429 | |||
| 3784 | Ga0501041_0004393 | |||
| 3785 | Ga0501041_0011279 | |||
| 3786 | Ga0501041_0105269 | |||
| 3787 | Ga0501042_0000054 | |||
| 3788 | Ga0501042_0001617 | |||
| 3789 | Ga0501042_0087488 | |||
| 3790 | Ga0501042_0089192 | |||
| 3791 | Ga0501042_0114618 | |||
| 3792 | Ga0501043_0000006 | |||
| 3793 | Ga0501043_0037239 | |||
| 3794 | Ga0501043_0076715 | |||
| 3795 | Ga0501043_0503752 | |||
| 3796 | Ga0501046_0000221 | |||
| 3797 | Ga0501046_0046978 | |||
| 3798 | Ga0501046_0080662 | |||
| 3799 | Ga0501047_0005589 | |||
| 3800 | Ga0501047_0014025 | |||
| 3801 | Ga0501047_0055700 | |||
| 3802 | Ga0501047_0129283 | |||
| 3803 | Ga0501047_0198610 | |||
| 3804 | Ga0501047_0456691 | |||
| 3805 | Ga0501048_0023635 | |||
| 3806 | Ga0501048_0224488 | |||
| 3807 | Ga0501067_0012440 | |||
| 3808 | Ga0501067_0288806 | |||
| 3809 | Ga0501068_0028661 | |||
| 3810 | Ga0501068_0038398 | |||
| 3811 | Ga0501069_0000024 | |||
| 3812 | Ga0501069_0008395 | |||
| 3813 | Ga0501069_0037849 | |||
| 3814 | Ga0501069_0074531 | |||
| 3815 | Ga0501070_0000093 | |||
| 3816 | Ga0501070_0001707 | |||
| 3817 | Ga0501070_0003776 | |||
| 3818 | Ga0501070_0004270 | |||
| 3819 | Ga0501070_0142156 | |||
| 3820 | Ga0501070_0163546 | |||
| 3821 | Ga0501071_0014312 | |||
| 3822 | Ga0501071_0037623 | |||
| 3823 | Ga0501071_0043546 | |||
| 3824 | Ga0501072_0005845 | |||
| 3825 | Ga0501072_0023240 | |||
| 3826 | Ga0501073_0011759 | |||
| 3827 | Ga0501073_0016103 | |||
| 3828 | Ga0501073_0045453 | |||
| 3829 | Ga0501074_0001523 | |||
| 3830 | Ga0501074_0004672 | |||
| 3831 | Ga0501074_0007470 | |||
| 3832 | Ga0501075_0007289 | |||
| 3833 | Ga0501075_0009385 | |||
| 3834 | Ga0501075_0100865 | |||
| 3835 | Ga0501075_0291105 | |||
| 3836 | Ga0501076_0002094 | |||
| 3837 | Ga0501076_0004801 | |||
| 3838 | Ga0501076_0056115 | |||
| 3839 | Ga0501077_0004048 | |||
| 3840 | Ga0501077_0013437 | |||
| 3841 | Ga0501077_0015498 | |||
| 3842 | Ga0501249_002446 | |||
| 3843 | Ga0501079_0000054 | |||
| 3844 | Ga0501079_0002815 | |||
| 3845 | Ga0501079_0022471 | |||
| 3846 | Ga0501080_0001346 | |||
| 3847 | Ga0501080_0011055 | |||
| 3848 | Ga0501080_0038346 | |||
| 3849 | Ga0501080_0048499 | |||
| 3850 | Ga0501080_0167951 | |||
| 3851 | Ga0501080_0232814 | |||
| 3852 | Ga0501080_0342006 | |||
| 3853 | Ga0501080_0375523 | |||
| 3854 | Ga0501081_0001342 | |||
| 3855 | Ga0501081_0025641 | |||
| 3856 | Ga0501081_0058602 | |||
| 3857 | Ga0501083_0000097 | |||
| 3858 | Ga0501083_0008220 | |||
| 3859 | Ga0501083_0023124 | |||
| 3860 | Ga0501262_000184 | |||
| 3861 | Ga0501035_0000068 | |||
| 3862 | Ga0501035_0001129 | |||
| 3863 | Ga0501035_0006366 | |||
| 3864 | Ga0501035_0008638 | |||
| 3865 | Ga0501035_0015071 | |||
| 3866 | Ga0501035_0047639 | |||
| 3867 | Ga0501035_0112108 | |||
| 3868 | Ga0501035_0122409 | |||
| 3869 | Ga0501044_0000084 | |||
| 3870 | Ga0501044_0000096 | |||
| 3871 | Ga0501044_0015238 | |||
| 3872 | Ga0501044_0016109 | |||
| 3873 | Ga0501044_0017784 | |||
| 3874 | Ga0501044_0078478 | |||
| 3875 | Ga0501044_0114010 | |||
| 3876 | Ga0501044_0615659 | |||
| 3877 | Ga0501045_0000766 | |||
| 3878 | Ga0501045_0028180 | |||
| 3879 | Ga0501045_0031830 | |||
| 3880 | Ga0501045_0090040 | |||
| 3881 | nmdc:mga03683_11_c1 | |||
| 3882 | nmdc:mga03683_29395_c1 | |||
| 3883 | nmdc:mga03683_44378_c1 | |||
| 3884 | nmdc:mga03n38_18256_c1 | |||
| 3885 | nmdc:mga03n38_1_c1 | |||
| 3886 | nmdc:mga03n38_22503_c1 | |||
| 3887 | nmdc:mga00v17_1_c1 | |||
| 3888 | nmdc:mga00v17_2288_c1 | |||
| 3889 | nmdc:mga00v17_48740_c1 | |||
| 3890 | nmdc:mga0yw44_10209_c1 | |||
| 3891 | nmdc:mga0yw44_61_c1 | |||
| 3892 | nmdc:mga0k408_1033_c1 | |||
| 3893 | nmdc:mga0k408_41530_c1 | |||
| 3894 | nmdc:mga06z11_50492_c1 | |||
| 3895 | nmdc:mga06z11_6052_c1 | |||
| 3896 | nmdc:mga06z11_800_c1 | |||
| 3897 | nmdc:mga04h51_245_c1 | |||
| 3898 | nmdc:mga07m45_408_c1 | |||
| 3899 | nmdc:mga07m45_4403_c2 | |||
| 3900 | nmdc:mga07m45_447_c1 | |||
| 3901 | nmdc:mga07m45_49601_c1 | |||
| 3902 | nmdc:mga07m45_59826_c1 | |||
| 3903 | nmdc:mga07m45_73_c1 | |||
| 3904 | nmdc:mga05p37_19161_c1 | |||
| 3905 | nmdc:mga05p37_246876_c1 | |||
| 3906 | nmdc:mga05p37_251472_c1 | |||
| 3907 | nmdc:mga05p37_3855_c1 | |||
| 3908 | nmdc:mga05p37_38812_c1 | |||
| 3909 | nmdc:mga05p37_45113_c1 | |||
| 3910 | nmdc:mga05p37_51739_c1 | |||
| 3911 | nmdc:mga05p37_6370_c1 | |||
| 3912 | nmdc:mga05p37_877695_c1 | |||
| 3913 | nmdc:mga09592_1525_c1 | |||
| 3914 | nmdc:mga09592_44489_c1 | |||
| 3915 | nmdc:mga09592_797_c1 | |||
| 3916 | nmdc:mga0qj67_130126_c1 | |||
| 3917 | nmdc:mga0qj67_1874_c1 | |||
| 3918 | nmdc:mga0qj67_201182_c1 | |||
| 3919 | nmdc:mga0qj67_232546_c1 | |||
| 3920 | nmdc:mga0qj67_379714_c1 | |||
| 3921 | nmdc:mga06r32_148638_c1 | |||
| 3922 | nmdc:mga06r32_1637_c1 | |||
| 3923 | nmdc:mga06r32_200246_c1 | |||
| 3924 | nmdc:mga06r32_2962_c1 | |||
| 3925 | nmdc:mga06r32_30241_c1 | |||
| 3926 | nmdc:mga06r32_543_c1 | |||
| 3927 | nmdc:mga06r32_61287_c1 | |||
| 3928 | nmdc:mga06r32_62871_c1 | |||
| 3929 | nmdc:mga06r32_639325_c1 | |||
| 3930 | nmdc:mga06r32_759070_c1 | |||
| 3931 | nmdc:mga08y16_1196_c1 | |||
| 3932 | nmdc:mga08y16_176140_c1 | |||
| 3933 | nmdc:mga08y16_268513_c1 | |||
| 3934 | nmdc:mga08y16_282920_c1 | |||
| 3935 | nmdc:mga08y16_287910_c1 | |||
| 3936 | nmdc:mga08y16_326820_c1 | |||
| 3937 | nmdc:mga08y16_349639_c1 | |||
| 3938 | nmdc:mga08y16_35524_c1 | |||
| 3939 | nmdc:mga08y16_6264_c1 | |||
| 3940 | nmdc:mga08y16_6269_c1 | |||
| 3941 | nmdc:mga08y16_95139_c1 | |||
| 3942 | nmdc:mga0n895_103852_c1 | |||
| 3943 | nmdc:mga0n895_10962_c1 | |||
| 3944 | nmdc:mga0n895_2213_c1 | |||
| 3945 | nmdc:mga0n895_2422_c1 | |||
| 3946 | nmdc:mga0n895_480965_c1 | |||
| 3947 | nmdc:mga0n895_54879_c1 | |||
| 3948 | nmdc:mga0n895_668_c1 | |||
| 3949 | nmdc:mga0n895_90961_c1 | |||
| 3950 | nmdc:mga0rr50_148687_c1 | |||
| 3951 | nmdc:mga0rr50_2496_c1 | |||
| 3952 | nmdc:mga0rr50_331294_c1 | |||
| 3953 | nmdc:mga0rr50_43903_c1 | |||
| 3954 | nmdc:mga08x19_288458_c1 | |||
| 3955 | nmdc:mga08x19_3746_c1 | |||
| 3956 | nmdc:mga08x19_52786_c1 | |||
| 3957 | nmdc:mga08x19_550_c1 | |||
| 3958 | nmdc:mga08x19_55517_c1 | |||
| 3959 | nmdc:mga08x19_6928_c1 | |||
| 3960 | nmdc:mga08x19_98851_c1 | |||
| 3961 | nmdc:mga0a205_10565_c1 | |||
| 3962 | nmdc:mga0a205_16908_c1 | |||
| 3963 | nmdc:mga0a205_211454_c1 | |||
| 3964 | nmdc:mga0a205_26496_c1 | |||
| 3965 | nmdc:mga0a205_32349_c1 | |||
| 3966 | nmdc:mga0a205_34820_c1 | |||
| 3967 | nmdc:mga0a205_584_c1 | |||
| 3968 | nmdc:mga0a205_68159_c1 | |||
| 3969 | nmdc:mga0a205_7303_c1 | |||
| 3970 | nmdc:mga0a205_89630_c1 | |||
| 3971 | nmdc:mga0a205_9995_c1 | |||
| 3972 | nmdc:mga0sz30_121302_c1 | |||
| 3973 | nmdc:mga0sz30_26045_c1 | |||
| 3974 | nmdc:mga0sz30_5_c1 | |||
| 3975 | nmdc:mga0sz30_89117_c1 | |||
| 3976 | Ga0495601_0108249 | |||
| 3977 | Ga0495612_0003957 | |||
| 3978 | Ga0500610_0000402 | |||
| 3979 | Ga0495595_0000244 | |||
| 3980 | Ga0495595_0038397 | |||
| 3981 | Ga0495619_0006093 | |||
| 3982 | Ga0495619_0061218 | |||
| 3983 | Ga0500578_0047317 | |||
| 3984 | Ga0500643_010551 | |||
| 3985 | Ga0500644_0003444 | |||
| 3986 | Ga0500646_0029413 | |||
| 3987 | Ga0500651_0000164 | |||
| 3988 | Ga0500651_0089158 | |||
| 3989 | Ga0500566_0005587 | |||
| 3990 | Ga0500641_0020853 | |||
| 3991 | Ga0500641_0049599 | |||
| 3992 | Ga0500650_0029685 | |||
| 3993 | Ga0500556_0000004 | |||
| 3994 | Ga0500557_003445 | |||
| 3995 | Ga0500560_001919 | |||
| 3996 | Ga0500569_016797 | |||
| 3997 | Ga0500571_045129 | |||
| 3998 | Ga0500572_000095 | |||
| 3999 | Ga0500572_001864 | |||
| 4000 | Ga0500594_0004273 | |||
| 4001 | Ga0500595_013922 | |||
| 4002 | Ga0500607_000307 | |||
| 4003 | Ga0500607_025574 | |||
| 4004 | Ga0500608_001229 | |||
| 4005 | Ga0500608_003410 | |||
| 4006 | Ga0500608_075018 | |||
| 4007 | Ga0500618_001780 | |||
| 4008 | Ga0500642_0000186 | |||
| 4009 | Ga0500642_0012991 | |||
| 4010 | Ga0500658_0000132 | |||
| 4011 | Ga0500658_0003190 | |||
| 4012 | Ga0500658_0070848 | |||
| 4013 | Ga0500559_0000067 | |||
| 4014 | Ga0500559_0000298 | |||
| 4015 | Ga0500559_0021198 | |||
| 4016 | Ga0500561_0000180 | |||
| 4017 | Ga0500568_0000269 | |||
| 4018 | Ga0500568_0000447 | |||
| 4019 | Ga0500568_0001151 | |||
| 4020 | Ga0500568_0001430 | |||
| 4021 | Ga0500568_0007916 | |||
| 4022 | Ga0500574_000961 | |||
| 4023 | Ga0500577_0064643 | |||
| 4024 | Ga0500586_004477 | |||
| 4025 | Ga0500590_135140 | |||
| 4026 | Ga0500604_0053435 | |||
| 4027 | Ga0500616_0000014 | |||
| 4028 | Ga0500616_0000931 | |||
| 4029 | Ga0500616_0042090 | |||
| 4030 | Ga0500616_0150462 | |||
| 4031 | Ga0500622_0000513 | |||
| 4032 | Ga0500622_0002182 | |||
| 4033 | Ga0500624_006778 | |||
| 4034 | Ga0500633_0067692 | |||
| 4035 | Ga0500634_0006941 | |||
| 4036 | Ga0500634_0045881 | |||
| 4037 | Ga0500634_0151615 | |||
| 4038 | Ga0500639_019482 | |||
| 4039 | Ga0500636_0000163 | |||
| 4040 | Ga0500636_0020857 | |||
| 4041 | Ga0500645_001533 | |||
| 4042 | Ga0500645_002397 | |||
| 4043 | Ga0500645_016490 | |||
| 4044 | Ga0500645_034041 | |||
| 4045 | Ga0501084_0002533 | |||
| 4046 | Ga0501084_0005314 | |||
| 4047 | Ga0501084_0006726 | |||
| 4048 | Ga0501084_0013576 | |||
| 4049 | Ga0501084_0071275 | |||
| 4050 | Ga0501084_0075593 | |||
| 4051 | Ga0501084_0283140 | |||
| 4052 | Ga0501084_0314889 | |||
| 4053 | Ga0500661_016256 | |||
| 4054 | Ga0590075_028269 | |||
| 4055 | Ga0501082_0000389 | |||
| 4056 | Ga0501082_0001815 | |||
| 4057 | Ga0501082_0023411 | |||
| 4058 | Ga0501082_0117115 | |||
| 4059 | Ga0501082_0352999 | |||
| 4060 | Ga0530510_0005953 | |||
| 4061 | Ga0530510_0019782 | |||
| 4062 | Ga0530510_0080989 | |||
| 4063 | 2508732941 | |||
| 4064 | 2509128038 | |||
| 4065 | 2511243175 | |||
| 4066 | 2511391037 | |||
| 4067 | 2512032988 | |||
| 4068 | 2513228370 | |||
| 4069 | 2513556031 | |||
| 4070 | 2513952711 | |||
| 4071 | 2514002663 | |||
| 4072 | 2514590722 | |||
| 4073 | 2519457298 | |||
| 4074 | 2523104543 | |||
| 4075 | 2523106040 | |||
| 4076 | 2523107591 | |||
| 4077 | 2527078479 | |||
| 4078 | 2548500060 | |||
| 4079 | 2585232900 | |||
| 4080 | 2585292160 | |||
| 4081 | 2585399502 | |||
| 4082 | 2585542906 | |||
| 4083 | 2585841152 | |||
| 4084 | 2599622949 | |||
| 4085 | 2599671428 | |||
| 4086 | 2599679535 | |||
| 4087 | 2599691551 | |||
| 4088 | 2599738762 | |||
| 4089 | 2599747628 | |||
| 4090 | 2600209512 | |||
| 4091 | 2600814246 | |||
| 4092 | 2603859617 | |||
| 4093 | 2643743489 | |||
| 4094 | 2643993734 | |||
| 4095 | 2644162769 | |||
| 4096 | 2644325076 | |||
| 4097 | 2644400196 | |||
| 4098 | 2644467629 | |||
| 4099 | 2644743511 | |||
| 4100 | 2676745571 | |||
| 4101 | 2738718800 | |||
| 4102 | 2738723560 | |||
| 4103 | 2738886625 | |||
| 4104 | 2738945094 | |||
| 4105 | 2739252279 | |||
| 4106 | 2739280818 | |||
| 4107 | 2739284291 | |||
| 4108 | 2739612164 | |||
| 4109 | 2739612371 | |||
| 4110 | 2770198869 | |||
| 4111 | 2774870336 | |||
| 4112 | 2776272904 | |||
| 4113 | 2776282253 | |||
| 4114 | 2792839293 | |||
| 4115 | 2817259499 | |||
| 4116 | 2817277168 | |||
| 4117 | 2817454082 | |||
| 4118 | 2819602258 | |||
| 4119 | 2819613960 | |||
| 4120 | 2819634715 | |||
| 4121 | 2821450646 | |||
| 4122 | 2831265780 | |||
| 4123 | 2838056494 | |||
| 4124 | 2838127293 | |||
| 4125 | 2840770330 | |||
| 4126 | 2841764523 | |||
| 4127 | 2841915672 | |||
| 4128 | 2841920874 | |||
| 4129 | 2841987393 | |||
| 4130 | 2842681769 | |||
| 4131 | 2842694737 | |||
| 4132 | 2842736211 | |||
| 4133 | 2842748047 | |||
| 4134 | 2842874239 | |||
| 4135 | 2844108029 | |||
| 4136 | 2844537839 | |||
| 4137 | 2851187961 | |||
| 4138 | 2851250135 | |||
| 4139 | 2857528976 | |||
| 4140 | 2863425403 | |||
| 4141 | 2870069642 | |||
| 4142 | 2881103105 | |||
| 4143 | 2881103565 | |||
| 4144 | 2885196124 | |||
| 4145 | 2885203364 | |||
| 4146 | 2885217286 | |||
| 4147 | 2893070433 | |||
| 4148 | 2894772696 | |||
| 4149 | 2897808291 | |||
| 4150 | 2897809074 | |||
| 4151 | 2899930537 | |||
| 4152 | 2900636813 | |||
| 4153 | 2900643336 | |||
| 4154 | 2901307418 | |||
| 4155 | 2904454891 | |||
| 4156 | 2904456328 | |||
| 4157 | 2904462837 | |||
| 4158 | 2904480485 | |||
| 4159 | 2904542273 | |||
| 4160 | 2904543368 | |||
| 4161 | 2904546890 | |||
| 4162 | 2904570149 | |||
| 4163 | 2904577319 | |||
| 4164 | 2904582528 | |||
| 4165 | 2913309720 | |||
| 4166 | 2919076375 | |||
| 4167 | 2919463988 | |||
| 4168 | 2928039651 | |||
| 4169 | 2928044744 | |||
| 4170 | 2928052544 | |||
| 4171 | 2928064793 | |||
| 4172 | 2928074739 | |||
| 4173 | 2928077669 | |||
| 4174 | 2928087125 | |||
| 4175 | 2928115318 | |||
| 4176 | 2928163718 | |||
| 4177 | 2928170531 | |||
| 4178 | 2928175852 | |||
| 4179 | 2928525028 | |||
| 4180 | 2928541492 | |||
| 4181 | 2929160601 | |||
| 4182 | 2929164362 | |||
| 4183 | 2929167558 | |||
| 4184 | 2929524412 | |||
| 4185 | 2929525113 | |||
| 4186 | 2937844861 | |||
| 4187 | 2945910938 | |||
| 4188 | 2945976513 | |||
| 4189 | 2945986824 | |||
| 4190 | 2954011359 | |||
| 4191 | 2954771537 | |||
| 4192 | 2981992008 | |||
| 4193 | 2981995757 | |||
| 4194 | 2990711666 | |||
| 4195 | 3002145543 | |||
| 4196 | 3005411712 | |||
| 4197 | 3005450327 | |||
| 4198 | 639785226 | |||
| 4199 | 642416026 | |||
| 4200 | 8018848089 | |||
| 4201 | 8020810289 | |||
| 4202 | 8020939189 | |||
| 4203 | 8020948520 | |||
| 4204 | 8020956247 | |||
| 4205 | 8021127048 | |||
| 4206 | 8039101471 | |||
| 4207 | 8040169595 | |||
| 4208 | 8040174628 | |||
| 4209 | 8054002373 | |||
| 4210 | 8054006769 | |||
| 4211 | 8054007356 | |||
| 4212 | 8054008292 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5468 | 2 | 281 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5419 | 7 | 280 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5122 | 2 | 281 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.4958 | 7 | 280 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4901 | 7 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9167 | 8 | 278 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8795 | 8 | 278 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7952 | 10 | 280 | 1.10.3470.10 |
| af_P23200_41_325_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7944 | 11 | 277 | 1.10.3470.10 |
| af_P37772_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7913 | 9 | 280 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W6ZU73-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9887 | 2 | 290 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A2G8MC90-F1-model_v4 | deleted | 0.9885 | 2 | 290 |
|
| AF-B8IBR7-F1-model_v4 | Inner-membrane translocator | 0.9875 | 2 | 290 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1I3LPG1-F1-model_v4 | Branched-chain amino acid transport system permease protein | 0.986 | 2 | 290 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1P9YAH5-F1-model_v4 | deleted | 0.986 | 2 | 290 |
|