F496451

General Info

Members Datasets Scaffolds Average Seq Length
2141 1355 1239 898

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100003756|Ga0070665_10000375613
Length 1000
Sequence MVGEPFERGDALQLGLARSSVCIGGGPSRVRGDPGSAAATPRQLDHKHEAPATCRRPSACNVRGMSDNSFDARAKLRVGDRELDIFRLDALQSAYDVARLPFSLKVLLENLLRTEGNGSVTKKDIEALATWDAKALPSKEIAFTPARVVMQDFTGVPAIVDLAAMRDAMADLGGDASRINPLVPAELVIDHSVQVDAFGTKAAFGFNAEKEYERNRERYEFLRWGQDAFDNFAVVPPETGIVHQVNLEYLGRVVFVNDADGVAYPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQPMSMLIPQVIGFQLHGELPEGATATDLVLTVTELLREKGVVGKFVEFYGHGLSNLPLADRATIGNMSPEFGSTCAIFPIDAETLRYLLFSGRPQEQVDLVEAYAKEQGLWHDETSEDPTFSDTLELDLGDVVPSLAGPKRPQDRVALNVAHEEFREALTDYVSEEDEVAEEEDGALTFPASDPVEGQAPGNGGDGHPEPRTDHDHVALAERPSHRVPVTLGDGTETELXXXXVVIAAITSCTNTSNPSVMLGAGLLARNAVAKGLTSKPWVKTSLAPGSKVVTEYYERAGLTESLEALGFNLVGYGCTTCIGNSGPLPEEISAKVQEEDLAVVAVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAGSMDADIVNQPLGQDGDGNDVYLRDIWPSEKEIAETIESAVQSDMFRKSYGEVFEGDERWTGLEVPTGDRFAWADDSTYVRLPPYFEGMPDEPTEVTDIEGARVLARLGDSVTTDHISPAGSIKKDSPAGRYLQEHGVEVSDFNSYGSRRGNHEVMMRGTFANIRLRNQLAPGTEGGVTKYLGDGSGDEMSIYDAAMKYAEEETPLVVLAGKDYGSGSSRDWAAKGTQLLGVRAVIAESFERIHRSNLVGMGVLPIMFPEGESVESLGLTGEEEFTITGLAQPLNKGELPTEVQVKAGDTEFTARVRIDTPKEADYFRHGGILPYVLRQLRAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
23 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
24 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
25 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
26 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
27 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
28 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
29 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
30 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
31 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
32 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
33 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
34 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
35 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
36 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
37 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
38 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
39 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
40 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
41 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
42 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
43 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
44 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
45 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
46 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
47 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
48 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
49 2516143018 Ensifer sp. BR816 Isolate Nodule
50 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
51 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
52 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
53 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
54 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
55 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
56 2519899620 Rhizobium sp. Pop5 Isolate Nodule
57 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
58 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
59 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
60 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
61 2527291627 Frankia casuarinae Thr Isolate Nodule
62 2527291629 Frankia sp. BMG5.23 Isolate Nodule
63 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
64 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
65 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
66 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
67 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
68 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
69 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
70 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
71 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
72 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
73 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
74 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
75 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
76 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
77 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
78 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
79 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
80 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
81 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
82 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
83 2576861822 Frankia sp. CeD Isolate Nodule
84 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
85 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
86 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
87 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
88 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
89 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
90 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
91 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
92 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
93 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
94 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
95 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
96 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
97 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
98 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
99 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
100 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
101 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
102 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
103 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
104 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
105 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
106 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
107 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
108 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
109 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
110 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
111 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
112 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
113 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
114 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
115 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
116 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
117 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
118 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
119 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
120 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
121 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
122 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
123 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
124 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
125 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
126 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
127 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
128 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
129 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
130 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
131 2619618881 Frankia sp. ACN1ag Isolate Unclassified
132 2619619003 Frankia sp. CpI1-P Isolate Nodule
133 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
134 2626541554 Frankia sp. AvcI.1 Isolate Nodule
135 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
136 2643221557 Ensifer sp. Root558 Isolate Unclassified
137 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
138 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
139 2643221568 Rhizobium sp. Root564 Isolate Unclassified
140 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
141 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
142 2643221582 Rhizobium sp. Root651 Isolate Unclassified
143 2643221599 Rhizobium sp. Root708 Isolate Unclassified
144 2643221607 Rhizobium sp. Root73 Isolate Unclassified
145 2643221610 Ensifer sp. Root74 Isolate Unclassified
146 2643221618 Ensifer sp. Root231 Isolate Unclassified
147 2643221626 Ensifer sp. Root31 Isolate Unclassified
148 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
149 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
150 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
151 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
152 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
153 2643221655 Ensifer sp. Root1252 Isolate Unclassified
154 2643221659 Ensifer sp. Root127 Isolate Unclassified
155 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
156 2643221668 Ensifer sp. Root423 Isolate Unclassified
157 2643221675 Ensifer sp. Root1298 Isolate Unclassified
158 2643221680 Ensifer sp. Root1312 Isolate Unclassified
159 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
160 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
161 2643221688 Rhizobium sp. Root482 Isolate Unclassified
162 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
163 2643221693 Rhizobium sp. Root491 Isolate Unclassified
164 2643221698 Ensifer sp. Root142 Isolate Unclassified
165 2643221712 Ensifer sp. Root258 Isolate Unclassified
166 2643221718 Rhizobium sp. Root268 Isolate Unclassified
167 2643221719 Rhizobium sp. Root274 Isolate Unclassified
168 2643221723 Ensifer sp. Root278 Isolate Unclassified
169 2643221726 Ensifer sp. Root954 Isolate Unclassified
170 2643221733 Bosea sp. Root381 Isolate Unclassified
171 2643221734 Bosea sp. Root670 Isolate Unclassified
172 2643221736 Bosea sp. Root483D1 Isolate Unclassified
173 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
174 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
175 2684623036 Frankia sp. CgIM4 Isolate Nodule
176 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
177 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
178 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
179 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
180 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
181 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
182 2710264753 Frankia sp. KB5 Isolate Nodule
183 2718217882 Rhizobium sp. N741 Isolate Nodule
184 2718217927 Rhizobium sp. N324 Isolate Nodule
185 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
186 2718218009 Rhizobium sp. N561 Isolate Nodule
187 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
188 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
189 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
190 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
191 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
192 2718218363 Rhizobium sp. N113 Isolate Nodule
193 2718218365 Rhizobium sp. N731 Isolate Nodule
194 2718218366 Rhizobium sp. N621 Isolate Nodule
195 2718218423 Rhizobium sp. N941 Isolate Nodule
196 2721755514 Rhizobium sp. N6212 Isolate Nodule
197 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
198 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
199 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
200 2721755809 Rhizobium sp. N541 Isolate Nodule
201 2721755810 Rhizobium sp. N871 Isolate Nodule
202 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
203 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
204 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
205 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
206 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
207 2728369365 Rhizobium sp. N1341 Isolate Nodule
208 2728369397 Rhizobium sp. N1314 Isolate Nodule
209 2734482264 Dyella sp. AD052 Isolate Unclassified
210 2738541293 Rhizobium sp. GV031 Isolate Unclassified
211 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
212 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
213 2738543009 Luteibacter sp. OK325 Isolate Unclassified
214 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
215 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
216 2751185800 Brucella pituitosa AA2 Isolate Unclassified
217 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
218 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
219 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
220 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
221 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
222 2773857924 Frankia sp. CgIS1 Isolate Nodule
223 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
224 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
225 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
226 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
227 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
228 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
229 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
230 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
231 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
232 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
233 2791355256 Rhizobium sp. M10 Isolate Nodule
234 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
235 2791355260 Rhizobium sp. L9 Isolate Nodule
236 2791355261 Rhizobium sp. J15 Isolate Nodule
237 2791355262 Rhizobium sp. M1 Isolate Nodule
238 2791355263 Rhizobium chutanense C5 Isolate Nodule
239 2791355264 Rhizobium sp. S9 Isolate Nodule
240 2791355265 Rhizobium sp. H4 Isolate Nodule
241 2791355266 Rhizobium sp. L43 Isolate Nodule
242 2791355267 Rhizobium sp. L18 Isolate Nodule
243 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
244 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
245 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
246 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
247 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
248 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
249 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
250 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
251 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
252 2802429633 Rhizobium anhuiense J3 Isolate Nodule
253 2802429634 Rhizobium anhuiense S10 Isolate Nodule
254 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
255 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
256 2802429637 Rhizobium anhuiense C15 Isolate Nodule
257 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
258 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
259 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
260 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
261 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
262 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
263 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
264 2818991467 Bosea vestrisii 3192 Isolate Unclassified
265 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
266 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
267 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
268 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
269 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
270 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
271 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
272 2838048938 Rhizobium pisi 27/80 Isolate Nodule
273 2838061910 Rhizobium phaseoli L15 Isolate Nodule
274 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
275 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
276 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
277 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
278 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
279 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
280 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
281 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
282 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
283 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
284 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
285 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
286 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
287 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
288 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
289 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
290 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
291 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
292 2841760612 Bosea sp. Tri-49 Isolate Nodule
293 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
294 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
295 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
296 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
297 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
298 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
299 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
300 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
301 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
302 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
303 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
304 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
305 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
306 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
307 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
308 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
309 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
310 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
311 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
312 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
313 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
314 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
315 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
316 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
317 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
318 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
319 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
320 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
321 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
322 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
323 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
324 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
325 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
326 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
327 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
328 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
329 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
330 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
331 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
332 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
333 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
334 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
335 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
336 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
337 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
338 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
339 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
340 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
341 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
342 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
343 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
344 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
345 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
346 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
347 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
348 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
349 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
350 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
351 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
352 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
353 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
354 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
355 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
356 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
357 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
358 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
359 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
360 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
361 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
362 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
363 2844104063 Bosea sp. Tri-39 Isolate Nodule
364 2844163670 Ensifer sp. 1H6 Isolate Unclassified
365 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
366 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
367 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
368 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
369 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
370 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
371 2851182111 Bosea sp. Tri-44 Isolate Nodule
372 2851246043 Bosea sp. Tri-54 Isolate Nodule
373 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
374 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
375 2854911287 Brucella lupini LUP21 Isolate Unclassified
376 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
377 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
378 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
379 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
380 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
381 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
382 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
383 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
384 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
385 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
386 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
387 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
388 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
389 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
390 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
391 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
392 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
393 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
394 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
395 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
396 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
397 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
398 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
399 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
400 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
401 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
402 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
403 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
404 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
405 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
406 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
407 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
408 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
409 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
410 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
411 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
412 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
413 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
414 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
415 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
416 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
417 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
418 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
419 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
420 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
421 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
422 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
423 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
424 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
425 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
426 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
427 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
428 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
429 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
430 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
431 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
432 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
433 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
434 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
435 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
436 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
437 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
438 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
439 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
440 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
441 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
442 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
443 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
444 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
445 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
446 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
447 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
448 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
449 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
450 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
451 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
452 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
453 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
454 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
455 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
456 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
457 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
458 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
459 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
460 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
461 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
462 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
463 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
464 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
465 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
466 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
467 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
468 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
469 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
470 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
471 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
472 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
473 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
474 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
475 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
476 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
477 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
478 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
479 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
480 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
481 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
482 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
483 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
484 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
485 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
486 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
487 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
488 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
489 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
490 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
491 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
492 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
493 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
494 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
495 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
496 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
497 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
498 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
499 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
500 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
501 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
502 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
503 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
504 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
505 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
506 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
507 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
508 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
509 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
510 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
511 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
512 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
513 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
514 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
515 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
516 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
517 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
518 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
519 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
520 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
521 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
522 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
523 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
524 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
525 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
526 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
527 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
528 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
529 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
530 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
531 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
532 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
533 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
534 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
535 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
536 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
537 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
538 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
539 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
540 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
541 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
542 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
543 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
544 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
545 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
546 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
547 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
548 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
549 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
550 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
551 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
552 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
553 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
554 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
555 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
556 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
557 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
558 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
559 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
560 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
561 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
562 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
563 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
564 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
565 2933599457 Rhizobium phaseoli M3 Isolate Nodule
566 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
567 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
568 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
569 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
570 2936381700 Rhizobium chutanense C16 Isolate Unclassified
571 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
572 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
573 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
574 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
575 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
576 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
577 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
578 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
579 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
580 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
581 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
582 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
583 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
584 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
585 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
586 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
587 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
588 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
589 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
590 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
591 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
592 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
593 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
594 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
595 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
596 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
597 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
598 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
599 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
600 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
601 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
602 2941471342 Luteibacter sp. 621 Isolate Unclassified
603 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
604 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
605 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
606 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
607 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
608 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
609 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
610 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
611 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
612 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
613 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
614 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
615 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
616 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
617 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
618 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
619 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
620 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
621 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
622 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
623 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
624 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
625 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
626 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
627 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
628 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
629 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
630 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
631 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
632 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
633 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
634 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
635 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
636 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
637 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
638 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
639 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
640 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
641 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
642 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
643 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
644 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
645 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
646 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
647 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
648 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
649 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
650 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
651 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
652 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
653 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
654 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
655 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
656 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
657 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
658 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
659 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
660 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
661 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
662 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
663 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
664 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
665 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
666 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
667 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
668 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
669 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
670 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
671 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
672 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
673 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
674 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
675 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
676 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
677 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
678 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
679 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
680 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
681 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
682 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
683 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
684 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
685 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
686 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
687 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
688 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
689 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
690 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
691 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
692 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
693 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
694 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
695 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
696 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
697 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
698 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
699 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
700 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
701 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
702 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
703 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
704 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
705 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
706 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
707 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
708 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
709 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
710 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
711 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
712 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
713 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
714 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
715 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
716 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
717 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
718 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
719 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
720 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
721 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
722 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
723 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
724 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
725 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
726 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
727 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
728 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
729 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
730 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
731 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
732 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
733 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
734 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
735 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
736 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
737 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
738 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
739 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
740 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
741 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
742 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
743 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
744 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
745 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
746 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
747 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
748 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
749 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
750 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
751 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
752 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
753 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
754 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
755 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
756 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
757 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
758 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
759 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
760 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
761 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
762 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
763 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
764 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
765 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
766 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
767 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
768 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
769 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
770 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
771 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
772 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
773 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
774 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
775 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
776 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
777 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
778 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
779 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
780 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
781 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
782 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
783 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
784 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
785 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
786 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
787 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
788 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
789 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
790 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
791 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
792 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
793 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
794 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
795 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
796 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
797 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
798 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
799 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
800 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
801 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
802 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
803 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
804 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
805 2996887358 Rhizobium sp. R711 Isolate Nodule
806 2996893221 Rhizobium sp. R635 Isolate Nodule
807 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
808 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
809 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
810 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
811 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
812 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
813 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
814 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
815 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
816 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
817 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
818 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
819 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
820 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
821 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
822 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
823 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
824 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
825 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
826 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
827 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
828 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
829 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
830 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
831 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
832 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
833 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
834 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
835 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
836 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
837 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
838 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
839 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
840 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
841 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
842 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
843 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
844 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
845 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
846 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
847 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
848 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
849 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
850 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
851 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
852 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
853 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
854 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
855 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
856 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
857 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
858 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
859 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
860 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
861 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
862 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
863 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
864 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
865 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
866 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
867 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
868 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
869 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
870 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
871 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
872 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
873 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
874 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
875 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
876 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
877 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
878 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
879 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
880 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
881 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
882 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
883 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
884 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
885 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
886 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
887 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
888 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
889 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
890 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
891 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
892 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
893 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
894 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
895 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
896 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
897 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
898 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
899 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
900 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
901 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
902 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
903 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
904 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
905 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
906 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
907 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
908 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
909 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
910 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
911 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
912 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
913 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
914 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
915 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
916 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
917 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
918 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
919 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
920 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
921 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
922 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
923 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
924 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
925 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
926 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
927 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
928 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
929 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
930 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
931 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
932 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
933 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
934 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
935 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
936 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
937 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
938 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
939 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
940 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
941 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
942 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
943 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
944 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
945 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
946 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
947 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
948 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
949 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
950 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
951 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
952 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
953 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
954 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
955 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
956 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
957 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
958 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
959 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
960 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
961 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
962 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
963 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
964 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
965 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
966 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
967 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
968 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
969 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
970 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
971 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
972 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
973 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
974 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
975 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
976 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
977 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
978 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
979 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
980 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
981 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
982 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
983 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
984 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
985 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
986 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
987 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
988 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
989 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
990 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
991 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
992 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
993 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
994 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
995 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
996 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
997 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
998 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
999 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
1000 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1001 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
1002 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
1003 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
1004 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
1005 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
1006 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
1007 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
1008 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
1009 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
1010 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
1011 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
1012 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
1013 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1014 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1015 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1016 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1017 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1018 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1019 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
1020 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
1021 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1022 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1023 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1024 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1025 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1026 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1027 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1028 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1029 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1030 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1031 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1032 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1033 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1034 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
1035 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1036 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1037 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1038 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1039 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1040 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1041 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1042 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1043 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1044 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1045 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
1046 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1047 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1048 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1049 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1050 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1051 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
1052 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1053 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1054 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1055 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1056 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1057 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1058 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1059 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
1060 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1061 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1062 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1063 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1064 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
1065 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1066 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1067 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
1068 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
1069 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1070 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
1071 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
1072 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
1073 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
1074 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
1075 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
1076 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
1077 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
1078 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
1079 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
1080 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
1081 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
1082 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
1083 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
1084 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
1085 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
1086 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
1087 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
1088 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
1089 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
1090 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
1091 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
1092 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1093 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1094 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
1095 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
1096 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
1097 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
1098 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
1099 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
1100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
1101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
1102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
1103 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
1104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
1105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
1106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
1107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
1108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
1109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
1110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
1111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
1112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
1113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
1114 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
1115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
1116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
1117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
1118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
1119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
1120 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
1121 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
1122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
1123 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1124 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
1125 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
1126 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1127 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
1129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
1130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
1131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
1132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
1133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
1134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
1135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
1136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1147 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
1148 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
1149 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
1150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
1151 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
1152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
1155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
1156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
1157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
1162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
1171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
1172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
1174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
1183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
1255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
1265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
1272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1281 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1284 637000116 Frankia casuarinae CcI3 Isolate Nodule
1285 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1286 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1287 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1288 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
1289 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1290 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1291 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1292 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1293 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1294 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1295 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1296 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1297 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1298 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1299 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1300 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1301 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1302 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1303 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1304 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1305 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1306 8005258706 Rhizobium sp. R693 Isolate Nodule
1307 8005275841 Rhizobium sp. N4311 Isolate Nodule
1308 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1309 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1310 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1311 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1312 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1313 8005321885 Rhizobium sp. R72 Isolate Nodule
1314 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1315 8005382845 Rhizobium sp. R634 Isolate Nodule
1316 8005395548 Rhizobium sp. R339 Isolate Nodule
1317 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1318 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1319 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1320 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1321 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1322 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1323 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1324 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1325 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1326 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1327 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1328 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1329 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1330 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1331 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1332 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1333 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1334 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1335 8018176218 Rhizobium sp. N122 Isolate Nodule
1336 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1337 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1338 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1339 8024501048 Rhizobium sp. H4 Isolate Nodule
1340 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1341 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1342 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
1343 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1344 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1345 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
1346 8054920844 Frankia tisae Agncl-8 Isolate Nodule
1347 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
1348 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
1349 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1350 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1351 8056382006 Rhizobium croatiense 13T Isolate Nodule
1352 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1353 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1354 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1355 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.26
Metatranscriptomes 0.65
Isolates 42.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 7.15
Nodule 30.41
Rhizoplane 2.2
Rhizosphere 47.41
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000887 3300000549 Bacteria 4652
2 JGI24741J21665_1001410 3300001915 Bacteria 6894
3 JGI24740J21852_10000013 3300001979 Bacteria 62177
4 JGI24740J21852_10000081 3300001979 Bacteria 32518
5 JGI24738J21930_10002398 3300002075 Bacteria 4920
6 JGI25155J39150_1000010 3300002704 Bacteria 207717
7 JGI25156J39149_1000102 3300002705 Bacteria 62463
8 JGI25156J39149_1005416 3300002705 Bacteria 3686
9 JGI25162J39368_1001052 3300002737 Bacteria 16925
10 JGI25162J39368_1001061 3300002737 Bacteria 16807
11 JGI25162J39368_1001699 3300002737 Bacteria 10722
12 JGI25154J39366_1000184 3300002738 Bacteria 48243
13 JGI25158J39367_1000061 3300002739 Bacteria 24434
14 JGI25158J39367_1001103 3300002739 Bacteria 4903
15 JGI25157J39369_1000009 3300002741 Bacteria 207868
16 JGI25157J39369_1001209 3300002741 Bacteria 10758
17 JGI25157J39369_1003070 3300002741 Bacteria 3612
18 JGI25164J39214_1000832 3300002772 Bacteria 10715
19 JGI25152J39213_1001961 3300002773 Bacteria 8159
20 JGI25152J39213_1003057 3300002773 Bacteria 5884
21 JGI25150J39212_1000037 3300002774 Bacteria 88885
22 JGI25159J45721_1000017 3300002987 Bacteria 136127
23 JGI25159J45721_1000623 3300002987 Bacteria 15724
24 JGI25159J45721_1002330 3300002987 Bacteria 7276
25 JGI25159J45721_1003781 3300002987 Bacteria 5223
26 JGI25159J45721_1007745 3300002987 Bacteria 3039
27 JGI25151J46595_10000220 3300003187 Bacteria 67327
28 JGI25151J46595_10000264 3300003187 Bacteria 60338
29 JGI25151J46595_10002253 3300003187 Bacteria 11846
30 JGI25151J46595_10003647 3300003187 Bacteria 8401
31 JGI25151J46595_10004132 3300003187 Bacteria 7764
32 JGI25406J46586_10001883 3300003203 Bacteria 9864
33 JGI25406J46586_10002413 3300003203 Bacteria 8830
34 JGI25165J46597_1000052 3300003214 Bacteria 236064
35 JGI25165J46597_1001126 3300003214 Bacteria 16807
36 JGI25165J46597_1001618 3300003214 Bacteria 10726
37 JGI25160J50197_1000027 3300003354 Bacteria 182809
38 JGI25160J50197_1000235 3300003354 Bacteria 43030
39 JGI25160J50197_1003116 3300003354 Bacteria 7546
40 JGI25407J50210_10001538 3300003373 Bacteria 5254
41 JGI25161J50226_1000137 3300003374 Bacteria 50627
42 JGI25161J50226_1000175 3300003374 Bacteria 43039
43 JGI25161J50226_1000533 3300003374 Bacteria 16369
44 Ga0006562J51391_1004873 3300003578 Bacteria 3000
45 Ga0006562J51391_1010770 3300003578 Bacteria 2870
46 Ga0006562J51391_1012664 3300003578 Bacteria 2853
47 Ga0006562J51391_1055027 3300003578 Bacteria 3054
48 Ga0006562J51391_1106068 3300003578 Bacteria 11360
49 Ga0055538_1000403 3300003751 Bacteria 17196
50 Ga0055538_1000432 3300003751 Bacteria 16151
51 Ga0055542_1000859 3300003762 Bacteria 21282
52 Ga0055526_1000443 3300003771 Bacteria 32967
53 Ga0055526_1000897 3300003771 Bacteria 22154
54 Ga0055526_1001473 3300003771 Bacteria 16693
55 Ga0055524_1000328 3300003775 Bacteria 44226
56 Ga0055524_1007837 3300003775 Bacteria 4496
57 Ga0055536_1001323 3300003781 Bacteria 15170
58 Ga0055536_1011262 3300003781 Bacteria 3448
59 Ga0055540_1001660 3300003792 Bacteria 12897
60 Ga0055531_10002987 3300003794 Bacteria 10990
61 Ga0058692_1006048 3300003856 Bacteria 3374
62 Ga0058692_1007052 3300003856 Bacteria 3019
63 Ga0055543_1000030 3300004625 Bacteria 130849
64 Ga0055543_1000226 3300004625 Bacteria 44983
65 Ga0055543_1000433 3300004625 Bacteria 25933
66 Ga0065165_1000122 3300005262 Bacteria 132524
67 Ga0065165_1000497 3300005262 Bacteria 60783
68 Ga0065165_1000540 3300005262 Bacteria 57331
69 Ga0065165_1001345 3300005262 Bacteria 27210
70 Ga0065165_1003519 3300005262 Bacteria 10867
71 Ga0065704_10071233 3300005289 Bacteria 12352
72 Ga0065707_10083199 3300005295 Bacteria 10049
73 Ga0070658_10007861 3300005327 Bacteria 8591
74 Ga0070676_10024117 3300005328 Bacteria 3424
75 Ga0070683_100000323 3300005329 Bacteria 32997
76 Ga0070683_100008481 3300005329 Bacteria 8730
77 Ga0070683_100012461 3300005329 Bacteria 7390
78 Ga0070683_100022976 3300005329 Bacteria 5576
79 Ga0070683_100033041 3300005329 Bacteria 4714
80 Ga0070683_100055214 3300005329 Bacteria 3685
81 Ga0070683_100090647 3300005329 Bacteria 2870
82 Ga0070690_100002816 3300005330 Bacteria 9388
83 Ga0070670_100000116 3300005331 Bacteria 74586
84 Ga0070670_100001076 3300005331 Bacteria 21704
85 Ga0070670_100016229 3300005331 Bacteria 6394
86 Ga0070670_100023328 3300005331 Bacteria 5326
87 Ga0070677_10000831 3300005333 Bacteria 10135
88 Ga0068869_100000148 3300005334 Bacteria 34570
89 Ga0068869_100003115 3300005334 Bacteria 10112
90 Ga0070666_10000800 3300005335 Bacteria 19098
91 Ga0070666_10001504 3300005335 Bacteria 14157
92 Ga0070680_100000209 3300005336 Bacteria 38470
93 Ga0070680_100000436 3300005336 Bacteria 28412
94 Ga0070680_100001769 3300005336 Bacteria 15860
95 Ga0070680_100010223 3300005336 Bacteria 7234
96 Ga0070680_100028429 3300005336 Bacteria 4485
97 Ga0070682_100005790 3300005337 Bacteria 6899
98 Ga0068868_100006108 3300005338 Bacteria 8510
99 Ga0070660_100010870 3300005339 Bacteria 6442
100 Ga0070691_10000494 3300005341 Bacteria 14822
101 Ga0070691_10000588 3300005341 Bacteria 13927
102 Ga0070691_10002533 3300005341 Bacteria 8138
103 Ga0070691_10005655 3300005341 Bacteria 5700
104 Ga0070661_100002125 3300005344 Bacteria 13659
105 Ga0070661_100009937 3300005344 Bacteria 6601
106 Ga0070668_100003225 3300005347 Bacteria 12022
107 Ga0070668_100003666 3300005347 Bacteria 11331
108 Ga0070668_100009150 3300005347 Bacteria 7350
109 Ga0070674_100000287 3300005356 Bacteria 24709
110 Ga0070674_100003148 3300005356 Bacteria 9197
111 Ga0070674_100017333 3300005356 Bacteria 4528
112 Ga0070674_100022285 3300005356 Bacteria 4083
113 Ga0070674_100032568 3300005356 Bacteria 3462
114 Ga0070673_100004934 3300005364 Bacteria 8498
115 Ga0070673_100005639 3300005364 Bacteria 8035
116 Ga0070659_100001308 3300005366 Bacteria 18050
117 Ga0070659_100003280 3300005366 Bacteria 11516
118 Ga0070659_100018282 3300005366 Bacteria 5289
119 Ga0070667_100000351 3300005367 Bacteria 51098
120 Ga0070667_100001860 3300005367 Bacteria 18752
121 Ga0070667_100011688 3300005367 Bacteria 7256
122 Ga0070709_10001621 3300005434 Bacteria 12161
123 Ga0070714_100000243 3300005435 Bacteria 42598
124 Ga0070714_100001173 3300005435 Bacteria 18879
125 Ga0070714_100001301 3300005435 Bacteria 18068
126 Ga0070714_100003528 3300005435 Bacteria 11683
127 Ga0070714_100006546 3300005435 Bacteria 9007
128 Ga0070714_100021927 3300005435 Bacteria 5230
129 Ga0070713_100000587 3300005436 Bacteria 23095
130 Ga0070713_100011716 3300005436 Bacteria 6399
131 Ga0070701_10010583 3300005438 Bacteria 4086
132 Ga0070705_100001663 3300005440 Bacteria 11636
133 Ga0070705_100010491 3300005440 Bacteria 4639
134 Ga0070694_100015394 3300005444 Bacteria 4804
135 Ga0070694_100021804 3300005444 Bacteria 4098
136 Ga0070694_100035632 3300005444 Bacteria 3291
137 Ga0070663_100000103 3300005455 Bacteria 39106
138 Ga0070663_100023208 3300005455 Bacteria 4156
139 Ga0070678_100008486 3300005456 Bacteria 6155
140 Ga0070662_100002795 3300005457 Bacteria 10810
141 Ga0070662_100002880 3300005457 Bacteria 10676
142 Ga0070662_100003968 3300005457 Bacteria 9274
143 Ga0070662_100021142 3300005457 Bacteria 4441
144 Ga0070681_10000397 3300005458 Bacteria 35263
145 Ga0070681_10002096 3300005458 Bacteria 18121
146 Ga0070681_10007106 3300005458 Bacteria 10901
147 Ga0070681_10010394 3300005458 Bacteria 9193
148 Ga0070681_10016442 3300005458 Bacteria 7387
149 Ga0070681_10067484 3300005458 Bacteria 3544
150 Ga0068867_100001176 3300005459 Bacteria 17923
151 Ga0068867_100003305 3300005459 Bacteria 11359
152 Ga0070706_100007006 3300005467 Bacteria 10629
153 Ga0070707_100006104 3300005468 Bacteria 11237
154 Ga0070707_100017495 3300005468 Bacteria 6740
155 Ga0070698_100000173 3300005471 Bacteria 60217
156 Ga0070698_100017971 3300005471 Bacteria 7447
157 Ga0070698_100053874 3300005471 Bacteria 4086
158 Ga0070679_100000412 3300005530 Bacteria 36448
159 Ga0070679_100007407 3300005530 Bacteria 10257
160 Ga0070679_100009439 3300005530 Bacteria 9229
161 Ga0070679_100015100 3300005530 Bacteria 7422
162 Ga0070679_100016959 3300005530 Bacteria 7039
163 Ga0070684_100000750 3300005535 Bacteria 22478
164 Ga0070684_100001725 3300005535 Bacteria 15917
165 Ga0070684_100024728 3300005535 Bacteria 5040
166 Ga0070684_100041620 3300005535 Bacteria 3962
167 Ga0070684_100041939 3300005535 Bacteria 3948
168 Ga0070697_100001444 3300005536 Bacteria 18066
169 Ga0070697_100015804 3300005536 Bacteria 5929
170 Ga0070697_100044879 3300005536 Bacteria 3580
171 Ga0068853_100014905 3300005539 Bacteria 6385
172 Ga0070672_100001189 3300005543 Bacteria 15897
173 Ga0070672_100005592 3300005543 Bacteria 8356
174 Ga0070672_100037438 3300005543 Bacteria 3701
175 Ga0070672_100052713 3300005543 Bacteria 3177
176 Ga0070695_100012402 3300005545 Bacteria 5113
177 Ga0070696_100001761 3300005546 Bacteria 14205
178 Ga0070696_100002205 3300005546 Bacteria 12839
179 Ga0070696_100003409 3300005546 Bacteria 10599
180 Ga0070696_100010884 3300005546 Bacteria 6096
181 Ga0070696_100018715 3300005546 Bacteria 4685
182 Ga0070693_100004654 3300005547 Bacteria 6517
183 Ga0070665_100000130 3300005548 Bacteria 141805
184 Ga0070665_100002801 3300005548 Bacteria 18901
185 Ga0070665_100002927 3300005548 Bacteria 18440
186 Ga0070665_100003756 3300005548 Bacteria 16075
187 Ga0070665_100004011 3300005548 Bacteria 15524
188 Ga0070665_100008086 3300005548 Bacteria 10646
189 Ga0070665_100020034 3300005548 Bacteria 6716
190 Ga0070665_100032718 3300005548 Bacteria 5232
191 Ga0070665_100046240 3300005548 Bacteria 4372
192 Ga0070665_100055999 3300005548 Bacteria 3954
193 Ga0068855_100009487 3300005563 Bacteria 11752
194 Ga0068855_100012441 3300005563 Bacteria 10277
195 Ga0068855_100013527 3300005563 Bacteria 9840
196 Ga0068855_100014573 3300005563 Bacteria 9470
197 Ga0068855_100027089 3300005563 Bacteria 6857
198 Ga0068855_100030004 3300005563 Bacteria 6504
199 Ga0068855_100037955 3300005563 Bacteria 5725
200 Ga0068855_100073146 3300005563 Bacteria 3983
201 Ga0070664_100001558 3300005564 Bacteria 18316
202 Ga0070664_100019612 3300005564 Bacteria 5564
203 Ga0068857_100001597 3300005577 Bacteria 18191
204 Ga0068857_100001874 3300005577 Bacteria 16919
205 Ga0068857_100002165 3300005577 Bacteria 15966
206 Ga0068857_100003576 3300005577 Bacteria 13001
207 Ga0068857_100031925 3300005577 Bacteria 4654
208 Ga0068854_100001349 3300005578 Bacteria 14800
209 Ga0068856_100005255 3300005614 Bacteria 12768
210 Ga0068856_100032077 3300005614 Bacteria 5142
211 Ga0068856_100076372 3300005614 Bacteria 3319
212 Ga0070702_100001501 3300005615 Bacteria 9584
213 Ga0070702_100008999 3300005615 Bacteria 4865
214 Ga0068852_100012423 3300005616 Bacteria 6467
215 Ga0068852_100072117 3300005616 Bacteria 3034
216 Ga0068859_100000005 3300005617 Bacteria 430800
217 Ga0068859_100002283 3300005617 Bacteria 19469
218 Ga0068859_100009927 3300005617 Bacteria 9605
219 Ga0068859_100011441 3300005617 Bacteria 8919
220 Ga0068864_100000582 3300005618 Bacteria 31068
221 Ga0068864_100002888 3300005618 Bacteria 14197
222 Ga0068866_10000284 3300005718 Bacteria 24229
223 Ga0068861_100000476 3300005719 Bacteria 23317
224 Ga0068861_100004777 3300005719 Bacteria 9108
225 Ga0068861_100015134 3300005719 Bacteria 5429
226 Ga0068851_10014366 3300005834 Bacteria 3759
227 Ga0068863_100003225 3300005841 Bacteria 16160
228 Ga0068863_100006208 3300005841 Bacteria 11725
229 Ga0068863_100039862 3300005841 Bacteria 4467
230 Ga0068863_100060859 3300005841 Bacteria 3570
231 Ga0068858_100003238 3300005842 Bacteria 16237
232 Ga0068858_100009375 3300005842 Bacteria 9340
233 Ga0068858_100035491 3300005842 Bacteria 4625
234 Ga0068860_100034676 3300005843 Bacteria 4841
235 Ga0068860_100038317 3300005843 Bacteria 4585
236 Ga0068862_100000987 3300005844 Bacteria 27217
237 Ga0068862_100007477 3300005844 Bacteria 9056
238 Ga0068862_100008341 3300005844 Bacteria 8576
239 Ga0081455_10000016 3300005937 Bacteria 176679
240 Ga0081455_10003780 3300005937 Bacteria 17286
241 Ga0081538_10000003 3300005981 Bacteria 211728
242 Ga0081538_10000018 3300005981 Bacteria 143542
243 Ga0081538_10000048 3300005981 Bacteria 111909
244 Ga0081538_10000127 3300005981 Bacteria 77655
245 Ga0081538_10000491 3300005981 Bacteria 44144
246 Ga0081538_10000680 3300005981 Bacteria 37368
247 Ga0081538_10001148 3300005981 Bacteria 27996
248 Ga0081538_10002495 3300005981 Bacteria 17936
249 Ga0081538_10003769 3300005981 Bacteria 14195
250 Ga0081538_10003881 3300005981 Bacteria 13960
251 Ga0081538_10004680 3300005981 Bacteria 12540
252 Ga0081538_10007657 3300005981 Bacteria 9309
253 Ga0081538_10016273 3300005981 Bacteria 5712
254 Ga0081538_10032210 3300005981 Bacteria 3519
255 Ga0081540_1006630 3300005983 Bacteria 8390
256 Ga0081539_10000246 3300005985 Bacteria 127353
257 Ga0081539_10004714 3300005985 Bacteria 14767
258 Ga0081539_10008372 3300005985 Bacteria 9034
259 Ga0081539_10009881 3300005985 Bacteria 7869
260 Ga0081539_10023099 3300005985 Bacteria 4085
261 Ga0070717_10000028 3300006028 Bacteria 144976
262 Ga0070717_10005524 3300006028 Bacteria 9221
263 Ga0070717_10017724 3300006028 Bacteria 5546
264 Ga0075365_10005124 3300006038 Bacteria 7035
265 Ga0075368_10005744 3300006042 Bacteria 4289
266 Ga0075364_10000026 3300006051 Bacteria 51217
267 Ga0075364_10004000 3300006051 Bacteria 8464
268 Ga0075364_10009354 3300006051 Bacteria 5874
269 Ga0070712_100000005 3300006175 Bacteria 177449
270 Ga0075367_10023529 3300006178 Bacteria 3467
271 Ga0097621_100010398 3300006237 Bacteria 6809
272 Ga0097621_100010944 3300006237 Bacteria 6661
273 Ga0068871_100003786 3300006358 Bacteria 10417
274 Ga0068871_100009483 3300006358 Bacteria 7057
275 Ga0075428_100014440 3300006844 Bacteria 8772
276 Ga0075430_100000211 3300006846 Bacteria 39886
277 Ga0075430_100001471 3300006846 Bacteria 19180
278 Ga0075430_100021679 3300006846 Bacteria 5460
279 Ga0075430_100046918 3300006846 Bacteria 3648
280 Ga0075430_100051131 3300006846 Bacteria 3483
281 Ga0075431_100002039 3300006847 Bacteria 19298
282 Ga0075431_100013496 3300006847 Bacteria 8251
283 Ga0075431_100014430 3300006847 Bacteria 7992
284 Ga0075431_100021260 3300006847 Bacteria 6632
285 Ga0075433_10002169 3300006852 Bacteria 14863
286 Ga0075434_100007374 3300006871 Bacteria 10181
287 Ga0075434_100013310 3300006871 Bacteria 7824
288 Ga0075429_100001833 3300006880 Bacteria 17584
289 Ga0075429_100003307 3300006880 Bacteria 13727
290 Ga0075429_100006446 3300006880 Bacteria 10160
291 Ga0075429_100055270 3300006880 Bacteria 3454
292 Ga0068865_100006931 3300006881 Bacteria 6949
293 Ga0075436_100020529 3300006914 Bacteria 4534
294 Ga0097620_100000005 3300006931 Bacteria 430800
295 Ga0097620_100002283 3300006931 Bacteria 19469
296 Ga0097620_100009927 3300006931 Bacteria 9605
297 Ga0097620_100011440 3300006931 Bacteria 8919
298 Ga0079104_1000195 3300006946 Bacteria 85244
299 Ga0099826_10000958 3300006948 Bacteria 16050
300 Ga0099794_10003427 3300007265 Bacteria 6048
301 Ga0099795_10000027 3300007788 Bacteria 42524
302 Ga0105250_10015711 3300009092 Bacteria 3099
303 Ga0105240_10000013 3300009093 Bacteria 483458
304 Ga0105240_10002246 3300009093 Bacteria 31374
305 Ga0105240_10002574 3300009093 Bacteria 29072
306 Ga0105240_10004538 3300009093 Bacteria 21093
307 Ga0105240_10032037 3300009093 Bacteria 6807
308 Ga0105240_10085818 3300009093 Bacteria 3856
309 Ga0111539_10004402 3300009094 Bacteria 18415
310 Ga0111539_10006383 3300009094 Bacteria 15207
311 Ga0111539_10017497 3300009094 Bacteria 8874
312 Ga0111539_10106762 3300009094 Bacteria 3285
313 Ga0105245_10004857 3300009098 Bacteria 11838
314 Ga0105245_10009960 3300009098 Bacteria 8278
315 Ga0105245_10024426 3300009098 Bacteria 5307
316 Ga0105245_10048858 3300009098 Bacteria 3786
317 Ga0105245_10088461 3300009098 Bacteria 2845
318 Ga0105247_10000188 3300009101 Bacteria 60322
319 Ga0114129_10002340 3300009147 Bacteria 26307
320 Ga0114129_10015266 3300009147 Bacteria 10931
321 Ga0114129_10034762 3300009147 Bacteria 7120
322 Ga0114129_10038225 3300009147 Bacteria 6772
323 Ga0114129_10057410 3300009147 Bacteria 5447
324 Ga0114129_10082386 3300009147 Bacteria 4470
325 Ga0114129_10108351 3300009147 Bacteria 3835
326 Ga0105243_10005164 3300009148 Bacteria 10226
327 Ga0105243_10028193 3300009148 Bacteria 4309
328 Ga0105241_10001852 3300009174 Bacteria 16037
329 Ga0105241_10015185 3300009174 Bacteria 5640
330 Ga0105242_10002487 3300009176 Bacteria 14442
331 Ga0105242_10011378 3300009176 Bacteria 6840
332 Ga0105242_10019516 3300009176 Bacteria 5313
333 Ga0105242_10026240 3300009176 Bacteria 4617
334 Ga0105248_10000148 3300009177 Bacteria 81603
335 Ga0105248_10001635 3300009177 Bacteria 24908
336 Ga0105248_10006609 3300009177 Bacteria 12706
337 Ga0105248_10007720 3300009177 Bacteria 11816
338 Ga0105248_10024434 3300009177 Bacteria 6717
339 Ga0105248_10046868 3300009177 Bacteria 4846
340 Ga0105237_10000250 3300009545 Bacteria 76317
341 Ga0105237_10001581 3300009545 Bacteria 29638
342 Ga0105237_10002649 3300009545 Bacteria 22006
343 Ga0105237_10012810 3300009545 Bacteria 8820
344 Ga0105237_10016801 3300009545 Bacteria 7597
345 Ga0105237_10019782 3300009545 Bacteria 6951
346 Ga0105238_10000394 3300009551 Bacteria 46531
347 Ga0105238_10001717 3300009551 Bacteria 22083
348 Ga0105238_10003680 3300009551 Bacteria 15278
349 Ga0105238_10008064 3300009551 Bacteria 10532
350 Ga0105238_10014002 3300009551 Bacteria 8110
351 Ga0105238_10036503 3300009551 Bacteria 4996
352 Ga0105249_10000774 3300009553 Bacteria 28630
353 Ga0105249_10000932 3300009553 Bacteria 25858
354 Ga0105249_10001612 3300009553 Bacteria 19749
355 Ga0105249_10043019 3300009553 Bacteria 4109
356 Ga0105249_10046414 3300009553 Bacteria 3953
357 Ga0123341_1000009 3300009765 Bacteria 122597
358 Ga0123341_1023081 3300009765 Bacteria 5142
359 Ga0123342_1009724 3300009766 Bacteria 11342
360 Ga0099796_10000022 3300010159 Bacteria 39465
361 Ga0105239_10000820 3300010375 Bacteria 44190
362 Ga0105239_10002006 3300010375 Bacteria 26437
363 Ga0105239_10005447 3300010375 Bacteria 14933
364 Ga0105239_10045963 3300010375 Bacteria 4784
365 Ga0105239_10049384 3300010375 Bacteria 4614
366 Ga0105246_10001663 3300011119 Bacteria 13246
367 Ga0105246_10018795 3300011119 Bacteria 4406
368 Ga0157371_10000108 3300013102 Bacteria 126288
369 Ga0157370_10001616 3300013104 Bacteria 27853
370 Ga0157370_10002495 3300013104 Bacteria 22179
371 Ga0157370_10004611 3300013104 Bacteria 15759
372 Ga0157370_10004961 3300013104 Bacteria 15062
373 Ga0157370_10007986 3300013104 Bacteria 11466
374 Ga0157370_10023162 3300013104 Bacteria 6171
375 Ga0157370_10035815 3300013104 Bacteria 4820
376 Ga0157370_10072280 3300013104 Bacteria 3255
377 Ga0157369_10004030 3300013105 Bacteria 17413
378 Ga0157369_10008723 3300013105 Bacteria 11617
379 Ga0157369_10010700 3300013105 Bacteria 10440
380 Ga0157369_10012128 3300013105 Bacteria 9784
381 Ga0171463_1004 3300013249 Bacteria 437207
382 Ga0171462_1039 3300013250 Bacteria 76960
383 Ga0157374_10002948 3300013296 Bacteria 14252
384 Ga0157374_10011766 3300013296 Bacteria 7592
385 Ga0157378_10002817 3300013297 Bacteria 15508
386 Ga0157378_10015958 3300013297 Bacteria 6578
387 Ga0157378_10033646 3300013297 Bacteria 4533
388 Ga0157378_10034926 3300013297 Bacteria 4445
389 Ga0163162_10008969 3300013306 Bacteria 9725
390 Ga0163162_10017318 3300013306 Bacteria 7050
391 Ga0157372_10001622 3300013307 Bacteria 24395
392 Ga0157372_10018496 3300013307 Bacteria 7491
393 Ga0157372_10031672 3300013307 Bacteria 5790
394 Ga0157372_10045278 3300013307 Bacteria 4880
395 Ga0157372_10046914 3300013307 Bacteria 4797
396 Ga0157375_10035280 3300013308 Bacteria 4772
397 Ga0163163_10008694 3300014325 Bacteria 9031
398 Ga0163163_10058358 3300014325 Bacteria 3815
399 Ga0182008_10001957 3300014497 Bacteria 13234
400 Ga0157379_10001139 3300014968 Bacteria 21775
401 Ga0157379_10031526 3300014968 Bacteria 4722
402 Ga0157379_10057145 3300014968 Bacteria 3487
403 Ga0157376_10004307 3300014969 Bacteria 9887
404 Ga0183369_1008 3300015685 Bacteria 346514
405 Ga0183363_1019 3300015690 Bacteria 61083
406 Ga0206353_10761908 3300020082 Bacteria 5623
407 Ga0154015_1549552 3300020610 Bacteria 5567
408 Ga0214544_1000288 3300021320 Bacteria 85073
409 Ga0214542_1000008 3300021321 Bacteria 278895
410 Ga0214542_1018989 3300021321 Bacteria 5596
411 Ga0214543_1000015 3300021327 Bacteria 305679
412 Ga0214543_1000031 3300021327 Bacteria 206436
413 Ga0213874_10000562 3300021377 Bacteria 7424
414 Ga0213876_10000116 3300021384 Bacteria 86507
415 Ga0213876_10017093 3300021384 Bacteria 3831
416 Ga0213876_10018135 3300021384 Bacteria 3715
417 Ga0213875_10000001 3300021388 Bacteria 2793540
418 Ga0213875_10000156 3300021388 Bacteria 72058
419 Ga0213875_10008600 3300021388 Bacteria 5215
420 Ga0228711_1000004 3300022739 Bacteria 250146
421 Ga0228710_1000002 3300022740 Bacteria 287279
422 Ga0209435_100009 3300025206 Bacteria 476614
423 Ga0209436_100018 3300025208 Bacteria 113499
424 Ga0209784_100084 3300025224 Bacteria 125995
425 Ga0209784_100096 3300025224 Bacteria 106927
426 Ga0209566_100082 3300025225 Bacteria 155379
427 Ga0209147_100045 3300025229 Bacteria 299264
428 Ga0207427_100170 3300025231 Bacteria 72532
429 Ga0209437_100057 3300025233 Bacteria 362922
430 Ga0209437_100107 3300025233 Bacteria 218656
431 Ga0209437_100246 3300025233 Bacteria 87486
432 Ga0209437_100875 3300025233 Bacteria 12280
433 Ga0207425_1000034 3300025245 Bacteria 227886
434 Ga0209646_1000018 3300025246 Bacteria 476716
435 Ga0209026_1000032 3300025250 Bacteria 322378
436 Ga0209026_1000068 3300025250 Bacteria 207601
437 Ga0209026_1000213 3300025250 Bacteria 80756
438 Ga0209026_1000234 3300025250 Bacteria 74634
439 Ga0209677_100199 3300025253 Bacteria 48030
440 Ga0209148_1000111 3300025254 Bacteria 198095
441 Ga0209759_1000007 3300025256 Bacteria 476614
442 Ga0209759_1000142 3300025256 Bacteria 124090
443 Ga0209759_1001409 3300025256 Bacteria 13726
444 Ga0209129_1000118 3300025258 Bacteria 139972
445 Ga0209129_1000253 3300025258 Bacteria 55709
446 Ga0209129_1000971 3300025258 Bacteria 17232
447 Ga0209233_1000072 3300025261 Bacteria 363074
448 Ga0209233_1000118 3300025261 Bacteria 236172
449 Ga0209233_1000134 3300025261 Bacteria 202535
450 Ga0209233_1000215 3300025261 Bacteria 108939
451 Ga0209233_1000479 3300025261 Bacteria 24402
452 Ga0209455_1000223 3300025272 Bacteria 77481
453 Ga0209455_1001020 3300025272 Bacteria 14026
454 Ga0209673_1000033 3300025273 Bacteria 335369
455 Ga0209673_1000052 3300025273 Bacteria 279795
456 Ga0209673_1001533 3300025273 Bacteria 21036
457 Ga0209130_1000009 3300025284 Bacteria 498952
458 Ga0209130_1000027 3300025284 Bacteria 327700
459 Ga0209130_1000132 3300025284 Bacteria 119765
460 Ga0209130_1000168 3300025284 Bacteria 95196
461 Ga0209130_1000930 3300025284 Bacteria 23436
462 Ga0209130_1003576 3300025284 Bacteria 6503
463 Ga0209676_1000406 3300025292 Bacteria 77603
464 Ga0209025_1000042 3300025294 Bacteria 370577
465 Ga0209025_1000101 3300025294 Bacteria 228507
466 Ga0209025_1000241 3300025294 Bacteria 128329
467 Ga0209025_1000357 3300025294 Bacteria 98040
468 Ga0209025_1000487 3300025294 Bacteria 76541
469 Ga0209025_1000533 3300025294 Bacteria 72404
470 Ga0209025_1000700 3300025294 Bacteria 57239
471 Ga0209025_1002217 3300025294 Bacteria 21448
472 Ga0209025_1003035 3300025294 Bacteria 16560
473 Ga0209025_1016684 3300025294 Bacteria 4306
474 Ga0209025_1024985 3300025294 Bacteria 3060
475 Ga0209564_1000580 3300025295 Bacteria 58002
476 Ga0209564_1000782 3300025295 Bacteria 44138
477 Ga0209564_1000790 3300025295 Bacteria 43638
478 Ga0209564_1000919 3300025295 Bacteria 38399
479 Ga0209564_1005381 3300025295 Bacteria 7336
480 Ga0209758_1000415 3300025297 Bacteria 72404
481 Ga0209758_1000570 3300025297 Bacteria 57866
482 Ga0209758_1001085 3300025297 Bacteria 35309
483 Ga0209758_1001086 3300025297 Bacteria 35300
484 Ga0209758_1002520 3300025297 Bacteria 18534
485 Ga0209758_1002827 3300025297 Bacteria 16891
486 Ga0209050_1000572 3300025298 Bacteria 59716
487 Ga0209050_1004422 3300025298 Bacteria 9506
488 Ga0209050_1004558 3300025298 Bacteria 9300
489 Ga0209256_1000504 3300025299 Bacteria 57416
490 Ga0209256_1000510 3300025299 Bacteria 57080
491 Ga0209256_1000695 3300025299 Bacteria 44756
492 Ga0209256_1002945 3300025299 Bacteria 12778
493 Ga0209256_1003766 3300025299 Bacteria 10227
494 Ga0207426_1000041 3300025302 Bacteria 433536
495 Ga0207426_1000072 3300025302 Bacteria 327700
496 Ga0207426_1000246 3300025302 Bacteria 119765
497 Ga0207426_1000348 3300025302 Bacteria 85294
498 Ga0207426_1003830 3300025302 Bacteria 7773
499 Ga0209051_1000917 3300025303 Bacteria 29277
500 Ga0209051_1001068 3300025303 Bacteria 25445
501 Ga0209051_1002464 3300025303 Bacteria 13243
502 Ga0209051_1002527 3300025303 Bacteria 12957
503 Ga0209051_1010028 3300025303 Bacteria 4823
504 Ga0209257_1000292 3300025304 Bacteria 110440
505 Ga0209257_1001566 3300025304 Bacteria 26435
506 Ga0209257_1003532 3300025304 Bacteria 13296
507 Ga0207697_10001988 3300025315 Bacteria 10854
508 Ga0207656_10008746 3300025321 Bacteria 3741
509 Ga0207696_1001283 3300025711 Bacteria 14014
510 Ga0207655_1001425 3300025728 Bacteria 22172
511 Ga0207655_1015226 3300025728 Bacteria 4289
512 Ga0207682_10002063 3300025893 Bacteria 9100
513 Ga0207642_10000749 3300025899 Bacteria 10040
514 Ga0207710_10000038 3300025900 Bacteria 241794
515 Ga0207688_10003260 3300025901 Bacteria 8866
516 Ga0207647_10000006 3300025904 Bacteria 214791
517 Ga0207647_10000229 3300025904 Bacteria 46400
518 Ga0207699_10000255 3300025906 Bacteria 29509
519 Ga0207645_10002660 3300025907 Bacteria 13903
520 Ga0207645_10003963 3300025907 Bacteria 11052
521 Ga0207645_10006477 3300025907 Bacteria 8398
522 Ga0207645_10007867 3300025907 Bacteria 7496
523 Ga0207643_10004801 3300025908 Bacteria 7242
524 Ga0207643_10016884 3300025908 Bacteria 3982
525 Ga0207705_10000128 3300025909 Bacteria 83519
526 Ga0207705_10001177 3300025909 Bacteria 21250
527 Ga0207705_10004699 3300025909 Bacteria 10296
528 Ga0207705_10060304 3300025909 Bacteria 2740
529 Ga0207654_10000580 3300025911 Bacteria 20678
530 Ga0207654_10004828 3300025911 Bacteria 6821
531 Ga0207707_10000665 3300025912 Bacteria 34141
532 Ga0207707_10001756 3300025912 Bacteria 19911
533 Ga0207707_10003724 3300025912 Bacteria 13498
534 Ga0207707_10013611 3300025912 Bacteria 7093
535 Ga0207707_10018309 3300025912 Bacteria 6105
536 Ga0207707_10030980 3300025912 Bacteria 4678
537 Ga0207695_10000044 3300025913 Bacteria 440819
538 Ga0207695_10000869 3300025913 Bacteria 55012
539 Ga0207695_10001451 3300025913 Bacteria 39681
540 Ga0207695_10001748 3300025913 Bacteria 34501
541 Ga0207695_10002682 3300025913 Bacteria 25984
542 Ga0207695_10004451 3300025913 Bacteria 19092
543 Ga0207695_10005366 3300025913 Bacteria 17039
544 Ga0207695_10010414 3300025913 Bacteria 11376
545 Ga0207695_10047319 3300025913 Bacteria 4553
546 Ga0207671_10000116 3300025914 Bacteria 122775
547 Ga0207671_10000400 3300025914 Bacteria 60604
548 Ga0207671_10000919 3300025914 Bacteria 37041
549 Ga0207671_10002269 3300025914 Bacteria 20795
550 Ga0207671_10045094 3300025914 Bacteria 3260
551 Ga0207693_10000023 3300025915 Bacteria 127876
552 Ga0207693_10028986 3300025915 Bacteria 4375
553 Ga0207660_10000002 3300025917 Bacteria 883566
554 Ga0207660_10001455 3300025917 Bacteria 15902
555 Ga0207660_10003171 3300025917 Bacteria 10754
556 Ga0207660_10004455 3300025917 Bacteria 9128
557 Ga0207660_10006743 3300025917 Bacteria 7434
558 Ga0207660_10020884 3300025917 Bacteria 4400
559 Ga0207660_10027840 3300025917 Bacteria 3861
560 Ga0207662_10021907 3300025918 Bacteria 3658
561 Ga0207657_10010361 3300025919 Bacteria 9302
562 Ga0207649_10000493 3300025920 Bacteria 28027
563 Ga0207649_10003099 3300025920 Bacteria 9122
564 Ga0207649_10026336 3300025920 Bacteria 3401
565 Ga0207652_10000030 3300025921 Bacteria 144884
566 Ga0207652_10000820 3300025921 Bacteria 29635
567 Ga0207652_10000846 3300025921 Bacteria 29174
568 Ga0207652_10001343 3300025921 Bacteria 21834
569 Ga0207652_10019396 3300025921 Bacteria 5592
570 Ga0207652_10039491 3300025921 Bacteria 4005
571 Ga0207652_10061613 3300025921 Bacteria 3240
572 Ga0207646_10002616 3300025922 Bacteria 21157
573 Ga0207646_10023627 3300025922 Bacteria 5644
574 Ga0207646_10027350 3300025922 Bacteria 5202
575 Ga0207681_10006427 3300025923 Bacteria 7216
576 Ga0207694_10000760 3300025924 Bacteria 28941
577 Ga0207694_10013575 3300025924 Bacteria 6138
578 Ga0207694_10022907 3300025924 Bacteria 4739
579 Ga0207650_10000691 3300025925 Bacteria 26420
580 Ga0207650_10006127 3300025925 Bacteria 8192
581 Ga0207650_10031218 3300025925 Bacteria 3845
582 Ga0207687_10001059 3300025927 Bacteria 18663
583 Ga0207687_10010476 3300025927 Bacteria 6054
584 Ga0207687_10030129 3300025927 Bacteria 3656
585 Ga0207700_10001683 3300025928 Bacteria 12556
586 Ga0207700_10003188 3300025928 Bacteria 9478
587 Ga0207664_10000013 3300025929 Bacteria 260716
588 Ga0207664_10000126 3300025929 Bacteria 66358
589 Ga0207664_10000745 3300025929 Bacteria 22147
590 Ga0207664_10002348 3300025929 Bacteria 12508
591 Ga0207664_10002368 3300025929 Bacteria 12454
592 Ga0207664_10015676 3300025929 Bacteria 5510
593 Ga0207664_10025897 3300025929 Bacteria 4426
594 Ga0207690_10000064 3300025932 Bacteria 95169
595 Ga0207690_10000266 3300025932 Bacteria 37573
596 Ga0207690_10001014 3300025932 Bacteria 17947
597 Ga0207690_10003495 3300025932 Bacteria 9370
598 Ga0207690_10003698 3300025932 Bacteria 9103
599 Ga0207690_10004956 3300025932 Bacteria 7858
600 Ga0207706_10000038 3300025933 Bacteria 132725
601 Ga0207706_10000372 3300025933 Bacteria 48684
602 Ga0207706_10000947 3300025933 Bacteria 29655
603 Ga0207706_10004365 3300025933 Bacteria 13292
604 Ga0207706_10028377 3300025933 Bacteria 4998
605 Ga0207706_10031114 3300025933 Bacteria 4756
606 Ga0207686_10000413 3300025934 Bacteria 29614
607 Ga0207686_10002577 3300025934 Bacteria 9858
608 Ga0207686_10030618 3300025934 Bacteria 3188
609 Ga0207670_10003425 3300025936 Bacteria 8417
610 Ga0207670_10013993 3300025936 Bacteria 4749
611 Ga0207669_10000936 3300025937 Bacteria 12334
612 Ga0207669_10032819 3300025937 Bacteria 2921
613 Ga0207704_10002024 3300025938 Bacteria 9084
614 Ga0207704_10027588 3300025938 Bacteria 3136
615 Ga0207691_10000311 3300025940 Bacteria 48455
616 Ga0207691_10000503 3300025940 Bacteria 38887
617 Ga0207691_10000880 3300025940 Bacteria 29853
618 Ga0207691_10002557 3300025940 Bacteria 17780
619 Ga0207691_10003484 3300025940 Bacteria 15315
620 Ga0207691_10020766 3300025940 Bacteria 6209
621 Ga0207711_10001348 3300025941 Bacteria 23183
622 Ga0207711_10001473 3300025941 Bacteria 21947
623 Ga0207711_10003853 3300025941 Bacteria 12909
624 Ga0207711_10007665 3300025941 Bacteria 9025
625 Ga0207689_10000063 3300025942 Bacteria 84295
626 Ga0207689_10001851 3300025942 Bacteria 20017
627 Ga0207689_10002037 3300025942 Bacteria 19083
628 Ga0207689_10002365 3300025942 Bacteria 17613
629 Ga0207689_10027790 3300025942 Bacteria 4733
630 Ga0207661_10001455 3300025944 Bacteria 15998
631 Ga0207661_10003194 3300025944 Bacteria 11354
632 Ga0207661_10014398 3300025944 Bacteria 5797
633 Ga0207661_10045864 3300025944 Bacteria 3463
634 Ga0207679_10001302 3300025945 Bacteria 15774
635 Ga0207679_10001489 3300025945 Bacteria 14667
636 Ga0207679_10004437 3300025945 Bacteria 8741
637 Ga0207679_10045364 3300025945 Bacteria 3178
638 Ga0207667_10000634 3300025949 Bacteria 45497
639 Ga0207667_10000818 3300025949 Bacteria 40208
640 Ga0207667_10007862 3300025949 Bacteria 12737
641 Ga0207667_10010025 3300025949 Bacteria 11109
642 Ga0207667_10014724 3300025949 Bacteria 8900
643 Ga0207667_10016791 3300025949 Bacteria 8258
644 Ga0207667_10025842 3300025949 Bacteria 6424
645 Ga0207667_10045112 3300025949 Bacteria 4669
646 Ga0207667_10057149 3300025949 Bacteria 4096
647 Ga0207651_10011154 3300025960 Bacteria 5017
648 Ga0207651_10017714 3300025960 Bacteria 4215
649 Ga0207712_10000609 3300025961 Bacteria 28411
650 Ga0207712_10001613 3300025961 Bacteria 15189
651 Ga0207668_10013603 3300025972 Bacteria 5018
652 Ga0207640_10001171 3300025981 Bacteria 14382
653 Ga0207640_10002602 3300025981 Bacteria 9672
654 Ga0207640_10003841 3300025981 Bacteria 8106
655 Ga0207640_10012785 3300025981 Bacteria 4793
656 Ga0207658_10000098 3300025986 Bacteria 96611
657 Ga0207658_10007780 3300025986 Bacteria 7301
658 Ga0207703_10000555 3300026035 Bacteria 38310
659 Ga0207703_10001507 3300026035 Bacteria 21251
660 Ga0207703_10012078 3300026035 Bacteria 6728
661 Ga0207703_10021939 3300026035 Bacteria 5001
662 Ga0207639_10010598 3300026041 Bacteria 6386
663 Ga0207678_10010970 3300026067 Bacteria 7959
664 Ga0207678_10014897 3300026067 Bacteria 6838
665 Ga0207708_10001554 3300026075 Bacteria 17141
666 Ga0207708_10006769 3300026075 Bacteria 8481
667 Ga0207708_10024153 3300026075 Bacteria 4596
668 Ga0207702_10000741 3300026078 Bacteria 34842
669 Ga0207641_10000727 3300026088 Bacteria 35345
670 Ga0207641_10006032 3300026088 Bacteria 10269
671 Ga0207641_10021026 3300026088 Bacteria 5365
672 Ga0207648_10000036 3300026089 Bacteria 122209
673 Ga0207648_10000591 3300026089 Bacteria 40761
674 Ga0207648_10006138 3300026089 Bacteria 11979
675 Ga0207648_10010217 3300026089 Bacteria 8928
676 Ga0207648_10015646 3300026089 Bacteria 6967
677 Ga0207676_10000947 3300026095 Bacteria 22389
678 Ga0207676_10004561 3300026095 Bacteria 9810
679 Ga0207676_10005344 3300026095 Bacteria 9096
680 Ga0207676_10006829 3300026095 Bacteria 8084
681 Ga0207676_10018930 3300026095 Bacteria 5014
682 Ga0207676_10055750 3300026095 Bacteria 3105
683 Ga0207674_10000737 3300026116 Bacteria 42799
684 Ga0207674_10000925 3300026116 Bacteria 38185
685 Ga0207674_10001999 3300026116 Bacteria 25859
686 Ga0207674_10003217 3300026116 Bacteria 20116
687 Ga0207674_10004655 3300026116 Bacteria 16467
688 Ga0207674_10005139 3300026116 Bacteria 15610
689 Ga0207674_10006586 3300026116 Bacteria 13652
690 Ga0207674_10012183 3300026116 Bacteria 9623
691 Ga0207674_10027688 3300026116 Bacteria 5991
692 Ga0207675_100000107 3300026118 Bacteria 66968
693 Ga0207675_100000753 3300026118 Bacteria 32263
694 Ga0207675_100002932 3300026118 Bacteria 16776
695 Ga0207675_100002950 3300026118 Bacteria 16726
696 Ga0207675_100013966 3300026118 Bacteria 7487
697 Ga0207675_100030665 3300026118 Bacteria 5008
698 Ga0207675_100046794 3300026118 Bacteria 4042
699 Ga0207683_10008399 3300026121 Bacteria 8835
700 Ga0207683_10014109 3300026121 Bacteria 6809
701 Ga0207683_10031347 3300026121 Bacteria 4613
702 Ga0207698_10001254 3300026142 Bacteria 14828
703 Ga0209281_1000028 3300027111 Bacteria 440027
704 Ga0209281_1000030 3300027111 Bacteria 425931
705 Ga0209281_1000144 3300027111 Bacteria 172471
706 Ga0209371_1000037 3300027312 Bacteria 367074
707 Ga0209179_1000023 3300027512 Bacteria 39721
708 Ga0209282_1000004 3300027666 Bacteria 425931
709 Ga0209971_1000715 3300027682 Bacteria 8543
710 Ga0209998_10000818 3300027717 Bacteria 8037
711 Ga0209813_10002746 3300027866 Bacteria 4060
712 Ga0207428_10006041 3300027907 Bacteria 11192
713 Ga0265354_1000782 3300028016 Bacteria 5184
714 Ga0268266_10000136 3300028379 Bacteria 141853
715 Ga0268266_10002229 3300028379 Bacteria 21173
716 Ga0268266_10006277 3300028379 Bacteria 10907
717 Ga0268266_10008708 3300028379 Bacteria 8991
718 Ga0268265_10002151 3300028380 Bacteria 15254
719 Ga0268265_10014016 3300028380 Bacteria 5460
720 Ga0268264_10001157 3300028381 Bacteria 25707
721 Ga0268264_10015015 3300028381 Bacteria 6354
722 Ga0265326_10000282 3300028558 Bacteria 23309
723 Ga0265319_1000065 3300028563 Bacteria 85273
724 Ga0265319_1009838 3300028563 Bacteria 4035
725 Ga0265322_10000891 3300028654 Bacteria 10585
726 Ga0265322_10001006 3300028654 Bacteria 9795
727 Ga0265336_10000001 3300028666 Bacteria 916179
728 Ga0307517_10024065 3300028786 Bacteria 7529
729 Ga0307515_10001330 3300028794 Bacteria 55993
730 Ga0307515_10002474 3300028794 Bacteria 40172
731 Ga0307515_10011336 3300028794 Bacteria 16921
732 Ga0307515_10020925 3300028794 Bacteria 11627
733 Ga0307515_10040955 3300028794 Bacteria 7305
734 Ga0265338_10000004 3300028800 Bacteria 644793
735 Ga0265338_10000290 3300028800 Bacteria 90378
736 Ga0265338_10009310 3300028800 Bacteria 11737
737 Ga0265338_10010523 3300028800 Bacteria 10820
738 Ga0265338_10011054 3300028800 Bacteria 10473
739 Ga0265338_10013652 3300028800 Bacteria 9147
740 Ga0265338_10028104 3300028800 Bacteria 5620
741 Ga0265338_10035168 3300028800 Bacteria 4823
742 Ga0268256_1000039 3300030500 Bacteria 354969
743 Ga0307511_10002440 3300030521 Bacteria 19449
744 Ga0265770_1000029 3300030878 Bacteria 14245
745 Ga0265760_10000319 3300031090 Bacteria 13341
746 Ga0265340_10000002 3300031247 Bacteria 711693
747 Ga0265339_10027210 3300031249 Bacteria 3267
748 Ga0265327_10000481 3300031251 Bacteria 70259
749 Ga0265327_10004783 3300031251 Bacteria 11786
750 Ga0265327_10009687 3300031251 Bacteria 6906
751 Ga0265327_10015223 3300031251 Bacteria 4981
752 Ga0307513_10000463 3300031456 Bacteria 58389
753 Ga0307513_10019269 3300031456 Bacteria 8126
754 Ga0307513_10021619 3300031456 Bacteria 7590
755 Ga0307513_10033220 3300031456 Bacteria 5802
756 Ga0307513_10039117 3300031456 Bacteria 5260
757 Ga0307509_10000781 3300031507 Bacteria 54552
758 Ga0307509_10003479 3300031507 Bacteria 23829
759 Ga0307509_10013106 3300031507 Bacteria 9843
760 Ga0307509_10047843 3300031507 Bacteria 4598
761 Ga0307408_100011982 3300031548 Bacteria 5739
762 Ga0307408_100023928 3300031548 Bacteria 4165
763 Ga0265313_10006173 3300031595 Bacteria 8592
764 Ga0307508_10039631 3300031616 Bacteria 4231
765 Ga0316575_10000169 3300031665 Bacteria 16697
766 Ga0316579_10000066 3300031691 Bacteria 26093
767 Ga0316579_10002014 3300031691 Bacteria 7607
768 Ga0316579_10002528 3300031691 Bacteria 6913
769 Ga0316579_10006284 3300031691 Bacteria 4838
770 Ga0265314_10001088 3300031711 Bacteria 31424
771 Ga0265314_10002284 3300031711 Bacteria 19844
772 Ga0265314_10012213 3300031711 Bacteria 7030
773 Ga0265314_10015947 3300031711 Bacteria 5949
774 Ga0316576_10000101 3300031727 Bacteria 31298
775 Ga0316576_10000256 3300031727 Bacteria 23138
776 Ga0316576_10000873 3300031727 Bacteria 15295
777 Ga0316576_10002676 3300031727 Bacteria 10181
778 Ga0316576_10003358 3300031727 Bacteria 9361
779 Ga0316576_10003752 3300031727 Bacteria 8970
780 Ga0316576_10005983 3300031727 Bacteria 7516
781 Ga0316576_10010572 3300031727 Bacteria 6004
782 Ga0316576_10015935 3300031727 Bacteria 5061
783 Ga0316576_10039824 3300031727 Bacteria 3375
784 Ga0316578_10000577 3300031728 Bacteria 12699
785 Ga0316578_10003534 3300031728 Bacteria 7179
786 Ga0316578_10005767 3300031728 Bacteria 6043
787 Ga0316578_10006786 3300031728 Bacteria 5680
788 Ga0316578_10021233 3300031728 Bacteria 3601
789 Ga0316578_10027847 3300031728 Bacteria 3196
790 Ga0307516_10000338 3300031730 Bacteria 61339
791 Ga0307516_10002711 3300031730 Bacteria 23336
792 Ga0316577_10000265 3300031733 Bacteria 18558
793 Ga0316577_10001229 3300031733 Bacteria 11918
794 Ga0316577_10002235 3300031733 Bacteria 9514
795 Ga0316577_10005218 3300031733 Bacteria 6794
796 Ga0316577_10013837 3300031733 Bacteria 4422
797 Ga0316577_10019248 3300031733 Bacteria 3776
798 Ga0316577_10029790 3300031733 Bacteria 3046
799 Ga0307413_10019038 3300031824 Bacteria 3617
800 Ga0307410_10002347 3300031852 Bacteria 9115
801 Ga0307410_10016393 3300031852 Bacteria 4419
802 Ga0307410_10019204 3300031852 Bacteria 4152
803 Ga0307406_10000615 3300031901 Bacteria 20362
804 Ga0307406_10012732 3300031901 Bacteria 4800
805 Ga0307406_10013394 3300031901 Bacteria 4698
806 Ga0307407_10001682 3300031903 Bacteria 8201
807 Ga0307412_10000831 3300031911 Bacteria 17770
808 Ga0307412_10001007 3300031911 Bacteria 16106
809 Ga0315914_1000001 3300031967 Bacteria 416633
810 Ga0307409_100001793 3300031995 Bacteria 10850
811 Ga0307409_100023341 3300031995 Bacteria 4284
812 Ga0307409_100025323 3300031995 Bacteria 4159
813 Ga0307416_100006067 3300032002 Bacteria 7526
814 Ga0307416_100010224 3300032002 Bacteria 6187
815 Ga0307416_100020269 3300032002 Bacteria 4740
816 Ga0307416_100030055 3300032002 Bacteria 4071
817 Ga0307416_100056846 3300032002 Bacteria 3161
818 Ga0307414_10022551 3300032004 Bacteria 3974
819 Ga0307411_10004134 3300032005 Bacteria 6891
820 Ga0307415_100004348 3300032126 Bacteria 7339
821 Ga0316583_10000244 3300032133 Bacteria 14783
822 Ga0316583_10000294 3300032133 Bacteria 13986
823 Ga0316583_10004600 3300032133 Bacteria 4919
824 Ga0316583_10004687 3300032133 Bacteria 4880
825 Ga0316583_10007780 3300032133 Bacteria 3864
826 Ga0316585_10000045 3300032137 Bacteria 19293
827 Ga0316585_10000216 3300032137 Bacteria 11961
828 Ga0316580_10000002 3300032139 Bacteria 46952
829 Ga0316580_10000019 3300032139 Bacteria 24882
830 Ga0316580_10000052 3300032139 Bacteria 18421
831 Ga0316580_10001009 3300032139 Bacteria 7035
832 Ga0316580_10002978 3300032139 Bacteria 4754
833 Ga0316580_10003214 3300032139 Bacteria 4622
834 Ga0316593_10004418 3300032168 Bacteria 3608
835 Ga0315913_1000004 3300033430 Bacteria 192741
836 Ga0315915_1000002 3300033464 Bacteria 425854
837 Ga0316587_1000253 3300033529 Bacteria 4821
838 Ga0316596_1000300 3300033541 Bacteria 7857
839 Ga0316596_1002115 3300033541 Bacteria 4193
840 Ga0373949_0000235 3300035090 Bacteria 20751
841 Ga0373936_0000007 3300035113 Bacteria 290641
842 Ga0373936_0010310 3300035113 Bacteria 3527
843 Ga0373954_0024056 3300035118 Bacteria 2775
844 Ga0373961_0002038 3300035241 Bacteria 5409
845 Ga0316574_0000424 3300035398 Bacteria 16777
846 Ga0316574_0002699 3300035398 Bacteria 8976
847 Ga0316574_0007147 3300035398 Bacteria 6102
848 Ga0316574_0027546 3300035398 Bacteria 3423
849 Ga0373935_0047602 3300035692 Bacteria 2712
850 Ga0373935_0059477 3300035692 Bacteria 2442
851 Ga0373927_0010318 3300035695 Bacteria 6237
852 Ga0373933_0008302 3300035724 Bacteria 5670
853 Ga0373933_0022555 3300035724 Bacteria 3586
854 Ga0373947_0012727 3300035725 Bacteria 4824
855 Ga0373937_0001348 3300036401 Bacteria 20532
856 Ga0373937_0006139 3300036401 Bacteria 10346
857 Ga0373937_0010758 3300036401 Bacteria 8006
858 Ga0373937_0018600 3300036401 Bacteria 6206
859 Ga0373937_0048612 3300036401 Bacteria 3883
860 Ga0316582_0000425 3300036647 Bacteria 15480
861 Ga0316582_0003488 3300036647 Bacteria 7720
862 Ga0316582_0003746 3300036647 Bacteria 7532
863 Ga0316582_0015074 3300036647 Bacteria 4406
864 Ga0316582_0034124 3300036647 Bacteria 3131
865 Ga0316584_0000582 3300036712 Bacteria 19743
866 Ga0316584_0003931 3300036712 Bacteria 9766
867 Ga0316584_0008905 3300036712 Bacteria 6940
868 Ga0316584_0012042 3300036712 Bacteria 6092
869 Ga0316584_0029151 3300036712 Bacteria 4074
870 Ga0373925_0001892 3300037068 Bacteria 17386
871 Ga0373925_0004023 3300037068 Bacteria 11180
872 Ga0395899_0000058 3300037312 Bacteria 213049
873 Ga0395899_0011114 3300037312 Bacteria 6897
874 Ga0395899_0021109 3300037312 Bacteria 4938
875 Ga0395900_0000033 3300037418 Bacteria 260271
876 Ga0395900_0000056 3300037418 Bacteria 213077
877 Ga0395900_0004721 3300037418 Bacteria 14372
878 Ga0395900_0021038 3300037418 Bacteria 6667
879 Ga0395900_0021377 3300037418 Bacteria 6615
880 Ga0395898_0000114 3300037466 Bacteria 213068
881 Ga0395898_0013500 3300037466 Bacteria 8410
882 Ga0395898_0017303 3300037466 Bacteria 7364
883 Ga0395898_0058652 3300037466 Bacteria 3747
884 Ga0395905_0000053 3300037471 Bacteria 213077
885 Ga0395905_0000173 3300037471 Bacteria 105060
886 Ga0395905_0001780 3300037471 Bacteria 24999
887 Ga0395905_0020565 3300037471 Bacteria 6250
888 Ga0395905_0023517 3300037471 Bacteria 5821
889 Ga0395905_0028816 3300037471 Bacteria 5232
890 Ga0436364_0211656 3300037853 Bacteria 7889
891 Ga0436364_0273345 3300037853 Bacteria 2794207
892 Ga0436364_0645242 3300037853 Bacteria 5608
893 Ga0436364_1085834 3300037853 Bacteria 4353
894 Ga0436364_1369139 3300037853 Bacteria 52035
895 Ga0436364_1375186 3300037853 Bacteria 86866
896 Ga0395901_0000037 3300038443 Bacteria 213059
897 Ga0395901_0005720 3300038443 Bacteria 12589
898 Ga0395901_0007971 3300038443 Bacteria 10690
899 Ga0395901_0010797 3300038443 Bacteria 9255
900 Ga0395901_0012482 3300038443 Bacteria 8621
901 Ga0395901_0029492 3300038443 Bacteria 5650
902 Ga0395901_0031927 3300038443 Bacteria 5431
903 Ga0395901_0063017 3300038443 Bacteria 3858
904 Ga0400484_37546 3300038725 Bacteria 16651
905 Ga0400485_18202 3300038735 Bacteria 23921
906 Ga0400486_07668 3300038742 Bacteria 12381
907 Ga0400489_48198 3300039093 Bacteria 23607
908 Ga0400487_01716 3300039110 Bacteria 41836
909 Ga0436365_0004038 3300039437 Bacteria 26265
910 Ga0436365_0379030 3300039437 Bacteria 13964
911 Ga0436365_0822443 3300039437 Bacteria 5577
912 Ga0436365_1001279 3300039437 Bacteria 29327
913 Ga0436365_1062197 3300039437 Bacteria 5189
914 Ga0436365_1226135 3300039437 Bacteria 85915
915 Ga0436363_0374921 3300039450 Bacteria 16205
916 Ga0436362_0398428 3300039453 Bacteria 10634
917 Ga0451577_0000001 3300042876 Bacteria 2461803
918 Ga0451577_0000507 3300042876 Bacteria 65437
919 Ga0451577_0010389 3300042876 Bacteria 8904
920 Ga0451577_0027450 3300042876 Bacteria 5153
921 Ga0466969_0000530 3300044656 Bacteria 21010
922 Ga0453683_0003721 3300044673 Bacteria 11134
923 Ga0453683_0012596 3300044673 Bacteria 5540
924 Ga0453683_0027379 3300044673 Bacteria 3618
925 Ga0466966_0003160 3300044684 Bacteria 10840
926 Ga0466966_0035953 3300044684 Bacteria 3199
927 Ga0466963_0000372 3300044694 Bacteria 20412
928 Ga0466963_0002910 3300044694 Bacteria 9670
929 Ga0466963_0004950 3300044694 Bacteria 7770
930 Ga0466963_0007533 3300044694 Bacteria 6493
931 Ga0466963_0016202 3300044694 Bacteria 4632
932 Ga0466963_0025428 3300044694 Bacteria 3776
933 Ga0466963_0033460 3300044694 Bacteria 3337
934 Ga0453684_0000012 3300044712 Bacteria 1062512
935 Ga0453684_0000162 3300044712 Bacteria 298154
936 Ga0453684_0000745 3300044712 Bacteria 113673
937 Ga0453684_0009317 3300044712 Bacteria 17227
938 Ga0453684_0022142 3300044712 Bacteria 9450
939 Ga0453684_0022787 3300044712 Bacteria 9273
940 Ga0453684_0025830 3300044712 Bacteria 8511
941 Ga0466971_0005304 3300044719 Bacteria 5589
942 Ga0466960_0018189 3300044901 Bacteria 3076
943 Ga0466959_0000040 3300045049 Bacteria 101109
944 Ga0466959_0005673 3300045049 Bacteria 8586
945 Ga0466959_0024896 3300045049 Bacteria 4433
946 Ga0466959_0025694 3300045049 Bacteria 4367
947 Ga0451576_0000187 3300045051 Bacteria 155783
948 Ga0451576_0001194 3300045051 Bacteria 46438
949 Ga0451576_0002267 3300045051 Bacteria 29352
950 Ga0451576_0008309 3300045051 Bacteria 12203
951 Ga0451576_0008438 3300045051 Bacteria 12096
952 Ga0451576_0027811 3300045051 Bacteria 6069
953 Ga0466958_0002447 3300045836 Bacteria 9318
954 Ga0466958_0002550 3300045836 Bacteria 9188
955 Ga0466967_0001153 3300045976 Bacteria 14777
956 Ga0466967_0004204 3300045976 Bacteria 9648
957 Ga0466967_0007313 3300045976 Bacteria 7951
958 Ga0466967_0022454 3300045976 Bacteria 5149
959 Ga0466967_0081634 3300045976 Bacteria 2921
960 Ga0495638_0000063 3300046460 Bacteria 185733
961 Ga0495651_0004397 3300046462 Bacteria 10792
962 Ga0495653_0000582 3300046463 Bacteria 28064
963 Ga0495580_0000771 3300046472 Bacteria 27575
964 Ga0495580_0004890 3300046472 Bacteria 11203
965 Ga0495580_0031156 3300046472 Bacteria 3857
966 Ga0495582_0007296 3300046473 Bacteria 6123
967 Ga0495582_0012834 3300046473 Bacteria 4617
968 Ga0495606_0005457 3300046507 Bacteria 12173
969 Ga0495608_0004409 3300046511 Bacteria 10082
970 Ga0495610_0010782 3300046512 Bacteria 5647
971 Ga0495618_0000137 3300046514 Bacteria 52421
972 Ga0495628_0018612 3300046516 Bacteria 5750
973 Ga0495630_0000280 3300046517 Bacteria 41276
974 Ga0495630_0006594 3300046517 Bacteria 8272
975 Ga0495630_0007431 3300046517 Bacteria 7831
976 Ga0495643_0020322 3300046522 Bacteria 3829
977 Ga0495652_0012961 3300046529 Bacteria 7514
978 Ga0495586_0004877 3300046535 Bacteria 7176
979 Ga0495587_0005525 3300046536 Bacteria 8249
980 Ga0495645_0000022 3300046543 Bacteria 137019
981 Ga0495645_0013938 3300046543 Bacteria 5698
982 Ga0495645_0015578 3300046543 Bacteria 5408
983 Ga0495633_0001326 3300046558 Bacteria 19437
984 Ga0495667_0001394 3300046559 Bacteria 15925
985 Ga0495667_0014652 3300046559 Bacteria 5297
986 Ga0495667_0025617 3300046559 Bacteria 3974
987 Ga0495657_0000041 3300046675 Bacteria 115251
988 Ga0495657_0022698 3300046675 Bacteria 4490
989 Ga0495658_0000608 3300046683 Bacteria 19601
990 Ga0495658_0005250 3300046683 Bacteria 6377
991 Ga0495649_0016037 3300046694 Bacteria 4253
992 Ga0495604_0000900 3300047317 Bacteria 24728
993 Ga0495604_0008409 3300047317 Bacteria 8155
994 Ga0495636_0011093 3300047318 Bacteria 3565
995 Ga0495674_0023069 3300047319 Bacteria 5735
996 Ga0495672_0039647 3300047320 Bacteria 2863
997 Ga0495676_0037075 3300047321 Bacteria 4064
998 Ga0495680_0024132 3300047322 Bacteria 5046
999 Ga0495684_0002534 3300047471 Bacteria 14556
1000 Ga0495684_0011360 3300047471 Bacteria 6876
1001 Ga0495684_0040499 3300047471 Bacteria 3571
1002 Ga0495684_0045340 3300047471 Bacteria 3365
1003 Ga0495684_0077082 3300047471 Bacteria 2531
1004 Ga0495686_0000085 3300047472 Bacteria 198128
1005 Ga0495602_0002809 3300048088 Bacteria 17821
1006 Ga0495602_0006756 3300048088 Bacteria 12043
1007 Ga0495602_0034395 3300048088 Bacteria 4741
1008 Ga0496100_0000749 3300048903 Bacteria 15499
1009 Ga0496100_0006846 3300048903 Bacteria 6245
1010 Ga0496100_0016995 3300048903 Bacteria 4283
1011 Ga0496101_0005221 3300048904 Bacteria 8264
1012 Ga0496101_0009141 3300048904 Bacteria 6504
1013 Ga0496102_0002927 3300048905 Bacteria 14484
1014 Ga0496102_0006371 3300048905 Bacteria 10060
1015 Ga0496104_0000033 3300048907 Bacteria 189758
1016 Ga0496104_0008828 3300048907 Bacteria 8962
1017 Ga0496104_0032776 3300048907 Bacteria 4836
1018 Ga0496105_0036992 3300048908 Bacteria 4021
1019 Ga0496106_0009497 3300048909 Bacteria 7189
1020 Ga0496106_0010026 3300048909 Bacteria 6999
1021 Ga0496106_0023580 3300048909 Bacteria 4570
1022 Ga0496107_0002056 3300048910 Bacteria 12869
1023 Ga0496107_0038195 3300048910 Bacteria 3446
1024 Ga0496108_0005174 3300048911 Bacteria 10543
1025 Ga0496109_0001558 3300048912 Bacteria 19097
1026 Ga0496109_0004574 3300048912 Bacteria 11546
1027 Ga0496109_0016941 3300048912 Bacteria 6378
1028 Ga0496110_0000046 3300048913 Bacteria 60653
1029 Ga0496110_0001781 3300048913 Bacteria 15870
1030 Ga0496110_0024755 3300048913 Bacteria 5121
1031 Ga0496112_0000007 3300048915 Bacteria 338850
1032 Ga0496112_0000295 3300048915 Bacteria 32306
1033 Ga0496112_0001855 3300048915 Bacteria 16627
1034 Ga0496112_0077158 3300048915 Bacteria 3295
1035 Ga0496113_0003033 3300048916 Bacteria 9941
1036 Ga0496113_0007804 3300048916 Bacteria 6915
1037 Ga0496114_0002882 3300048917 Bacteria 13180
1038 Ga0496114_0045252 3300048917 Bacteria 3655
1039 Ga0496115_0000053 3300048918 Bacteria 106425
1040 Ga0496115_0004169 3300048918 Bacteria 10438
1041 Ga0496115_0012887 3300048918 Bacteria 6305
1042 Ga0496116_0000057 3300048919 Bacteria 281652
1043 Ga0496117_0000031 3300048920 Bacteria 381048
1044 Ga0496117_0002097 3300048920 Bacteria 26238
1045 Ga0496117_0008209 3300048920 Bacteria 9959
1046 Ga0496118_0000828 3300048921 Bacteria 49163
1047 Ga0496118_0002291 3300048921 Bacteria 26051
1048 Ga0496118_0017604 3300048921 Bacteria 6493
1049 Ga0496119_0000574 3300048922 Bacteria 49580
1050 Ga0496119_0008248 3300048922 Bacteria 9203
1051 Ga0496119_0011551 3300048922 Bacteria 7292
1052 Ga0496119_0019252 3300048922 Bacteria 5038
1053 Ga0496120_0000643 3300048923 Bacteria 51596
1054 Ga0496120_0001024 3300048923 Bacteria 37351
1055 Ga0496120_0021829 3300048923 Bacteria 4037
1056 Ga0496121_0000034 3300048924 Bacteria 377095
1057 Ga0496121_0000129 3300048924 Bacteria 168148
1058 Ga0496121_0002642 3300048924 Bacteria 26954
1059 Ga0496122_0000023 3300048925 Bacteria 381035
1060 Ga0496122_0000074 3300048925 Bacteria 219900
1061 Ga0496122_0000286 3300048925 Bacteria 112940
1062 Ga0496122_0000734 3300048925 Bacteria 64135
1063 Ga0496122_0000830 3300048925 Bacteria 58620
1064 Ga0496122_0013743 3300048925 Bacteria 7894
1065 Ga0496123_0000027 3300048926 Bacteria 306773
1066 Ga0496123_0000062 3300048926 Bacteria 219882
1067 Ga0496123_0002408 3300048926 Bacteria 23357
1068 Ga0496123_0007630 3300048926 Bacteria 10125
1069 Ga0496124_0000128 3300048927 Bacteria 157194
1070 Ga0496124_0000174 3300048927 Bacteria 129228
1071 Ga0496124_0002248 3300048927 Bacteria 25664
1072 Ga0496124_0005858 3300048927 Bacteria 13630
1073 Ga0496124_0011409 3300048927 Bacteria 8883
1074 Ga0496125_0000030 3300048928 Bacteria 375023
1075 Ga0496125_0000093 3300048928 Bacteria 210896
1076 Ga0496125_0005997 3300048928 Bacteria 13299
1077 Ga0496125_0008659 3300048928 Bacteria 10606
1078 Ga0496125_0014528 3300048928 Bacteria 7665
1079 Ga0496125_0037180 3300048928 Bacteria 4235
1080 Ga0496126_0000630 3300048929 Bacteria 65941
1081 Ga0496126_0002917 3300048929 Bacteria 22239
1082 Ga0496126_0005711 3300048929 Bacteria 14100
1083 Ga0501031_0007395 3300049568 Bacteria 7154
1084 Ga0501031_0013643 3300049568 Bacteria 5296
1085 Ga0501032_0000006 3300049569 Bacteria 261727
1086 Ga0501032_0000194 3300049569 Bacteria 50457
1087 Ga0501032_0007442 3300049569 Bacteria 7995
1088 Ga0501032_0007888 3300049569 Bacteria 7755
1089 Ga0501033_0000039 3300049570 Bacteria 142732
1090 Ga0501033_0000077 3300049570 Bacteria 92696
1091 Ga0501033_0003212 3300049570 Bacteria 13531
1092 Ga0501033_0024459 3300049570 Bacteria 4556
1093 Ga0501034_0000023 3300049571 Bacteria 263892
1094 Ga0501034_0000030 3300049571 Bacteria 248180
1095 Ga0501034_0003977 3300049571 Bacteria 16610
1096 Ga0501034_0006378 3300049571 Bacteria 12704
1097 Ga0501034_0007546 3300049571 Bacteria 11569
1098 Ga0501036_0000003 3300049572 Bacteria 261545
1099 Ga0501036_0068255 3300049572 Bacteria 3008
1100 Ga0501037_0000003 3300049573 Bacteria 261548
1101 Ga0501037_0002875 3300049573 Bacteria 12486
1102 Ga0501037_0007579 3300049573 Bacteria 7949
1103 Ga0501037_0020395 3300049573 Bacteria 4893
1104 Ga0501037_0022418 3300049573 Bacteria 4671
1105 Ga0501038_0000004 3300049574 Bacteria 261289
1106 Ga0501038_0000040 3300049574 Bacteria 121177
1107 Ga0501038_0001572 3300049574 Bacteria 21145
1108 Ga0501038_0064037 3300049574 Bacteria 3136
1109 Ga0501039_0000008 3300049575 Bacteria 274778
1110 Ga0501039_0000089 3300049575 Bacteria 68136
1111 Ga0501039_0006760 3300049575 Bacteria 8728
1112 Ga0501043_0000019 3300049579 Bacteria 155347
1113 Ga0501043_0000042 3300049579 Bacteria 116080
1114 Ga0501043_0000177 3300049579 Bacteria 56981
1115 Ga0501043_0007371 3300049579 Bacteria 8728
1116 Ga0501046_0016381 3300049580 Bacteria 6211
1117 Ga0501047_0008795 3300049581 Bacteria 9526
1118 Ga0501047_0015662 3300049581 Bacteria 7226
1119 Ga0501047_0025858 3300049581 Bacteria 5645
1120 Ga0501047_0064222 3300049581 Bacteria 3541
1121 Ga0501048_0002808 3300049582 Bacteria 13290
1122 Ga0501048_0033215 3300049582 Bacteria 3729
1123 Ga0501067_0013901 3300049583 Bacteria 4457
1124 Ga0501068_0008324 3300049584 Bacteria 5767
1125 Ga0501069_0000001 3300049585 Bacteria 289100
1126 Ga0501070_0000105 3300049586 Bacteria 73931
1127 Ga0501070_0000824 3300049586 Bacteria 28140
1128 Ga0501070_0001957 3300049586 Bacteria 18177
1129 Ga0501070_0002317 3300049586 Bacteria 16703
1130 Ga0501070_0002736 3300049586 Bacteria 15392
1131 Ga0501070_0014381 3300049586 Bacteria 6658
1132 Ga0501070_0017720 3300049586 Bacteria 5980
1133 Ga0501070_0023099 3300049586 Bacteria 5208
1134 Ga0501070_0031465 3300049586 Bacteria 4446
1135 Ga0501071_0022139 3300049587 Bacteria 4429
1136 Ga0501071_0023578 3300049587 Bacteria 4298
1137 Ga0501072_0007913 3300049588 Bacteria 8070
1138 Ga0501073_0003926 3300049589 Bacteria 11158
1139 Ga0501073_0033843 3300049589 Bacteria 3637
1140 Ga0501074_0000516 3300049590 Bacteria 23722
1141 Ga0501074_0001654 3300049590 Bacteria 15132
1142 Ga0501074_0006547 3300049590 Bacteria 8416
1143 Ga0501074_0006822 3300049590 Bacteria 8250
1144 Ga0501074_0043751 3300049590 Bacteria 3241
1145 Ga0501075_0013007 3300049591 Bacteria 5931
1146 Ga0501075_0038926 3300049591 Bacteria 3557
1147 Ga0501076_0007681 3300049592 Bacteria 7853
1148 Ga0501076_0023093 3300049592 Bacteria 4789
1149 Ga0501079_0002067 3300049741 Bacteria 14394
1150 Ga0501080_0000964 3300049742 Bacteria 23502
1151 Ga0501080_0002743 3300049742 Bacteria 15460
1152 Ga0501080_0006672 3300049742 Bacteria 10387
1153 Ga0501080_0008593 3300049742 Bacteria 9265
1154 Ga0501080_0008675 3300049742 Bacteria 9231
1155 Ga0501080_0008862 3300049742 Bacteria 9145
1156 Ga0501080_0010368 3300049742 Bacteria 8523
1157 Ga0501080_0032594 3300049742 Bacteria 4860
1158 Ga0501080_0032747 3300049742 Bacteria 4849
1159 Ga0501080_0076978 3300049742 Bacteria 3102
1160 Ga0501083_0009841 3300049744 Bacteria 6747
1161 Ga0501035_0000037 3300049822 Bacteria 160921
1162 Ga0501035_0000042 3300049822 Bacteria 152455
1163 Ga0501035_0000112 3300049822 Bacteria 99138
1164 Ga0501035_0000897 3300049822 Bacteria 31484
1165 Ga0501035_0003788 3300049822 Bacteria 14408
1166 Ga0501035_0005174 3300049822 Bacteria 12335
1167 Ga0501035_0013401 3300049822 Bacteria 7568
1168 Ga0501044_0000008 3300049823 Bacteria 274778
1169 Ga0501044_0000018 3300049823 Bacteria 225885
1170 Ga0501044_0005319 3300049823 Bacteria 14319
1171 Ga0501044_0020300 3300049823 Bacteria 7091
1172 Ga0501044_0066972 3300049823 Bacteria 3660
1173 Ga0501045_0003035 3300049824 Bacteria 11480
1174 Ga0501045_0011093 3300049824 Bacteria 6316
1175 Ga0501045_0012568 3300049824 Bacteria 5962
1176 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
1177 nmdc:mga00v17_25726_c1 3300050491 Bacteria 3424
1178 nmdc:mga0yw44_886_c1 3300050492 Bacteria 11269
1179 nmdc:mga0k408_15675_c1 3300050493 Bacteria 4195
1180 nmdc:mga05p37_119137_c1 3300050507 Bacteria 3243
1181 nmdc:mga05p37_12340_c1 3300050507 Bacteria 10206
1182 nmdc:mga05p37_2830_c1 3300050507 Bacteria 20178
1183 nmdc:mga05p37_61339_c1 3300050507 Bacteria 4629
1184 nmdc:mga05p37_7507_c1 3300050507 Bacteria 12855
1185 nmdc:mga05p37_848_c1 3300050507 Bacteria 34369
1186 nmdc:mga05p37_8763_c1 3300050507 Bacteria 11950
1187 nmdc:mga09592_1992_c1 3300050508 Bacteria 16484
1188 nmdc:mga09592_3189_c1 3300050508 Bacteria 13302
1189 nmdc:mga0qj67_1266_c1 3300050509 Bacteria 17723
1190 nmdc:mga0qj67_15771_c1 3300050509 Bacteria 3672
1191 nmdc:mga0qj67_9925_c1 3300050509 Bacteria 7100
1192 nmdc:mga06r32_10259_c1 3300050510 Bacteria 8452
1193 nmdc:mga06r32_176_c1 3300050510 Bacteria 49909
1194 nmdc:mga06r32_30269_c1 3300050510 Bacteria 5080
1195 nmdc:mga06r32_5995_c1 3300050510 Bacteria 10933
1196 nmdc:mga08y16_10853_c1 3300050511 Bacteria 9565
1197 nmdc:mga08y16_35328_c1 3300050511 Bacteria 5248
1198 nmdc:mga08y16_41453_c1 3300050511 Bacteria 4823
1199 nmdc:mga08y16_5565_c1 3300050511 Bacteria 13194
1200 nmdc:mga08y16_72760_c1 3300050511 Bacteria 3582
1201 nmdc:mga0n895_13448_c1 3300050512 Bacteria 7384
1202 nmdc:mga0rr50_6115_c1 3300050513 Bacteria 7282
1203 nmdc:mga08x19_5709_c1 3300050514 Bacteria 7352
1204 nmdc:mga0a205_4918_c1 3300050515 Bacteria 11429
1205 nmdc:mga0a205_5739_c2 3300050515 Bacteria 10578
1206 nmdc:mga0a205_64987_c1 3300050515 Bacteria 3525
1207 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
1208 Ga0495601_0000769 3300053077 Bacteria 17282
1209 Ga0495601_0002711 3300053077 Bacteria 10052
1210 Ga0495601_0034974 3300053077 Bacteria 3135
1211 Ga0495612_0000117 3300053078 Bacteria 33431
1212 Ga0495612_0000791 3300053078 Bacteria 12868
1213 Ga0495595_0003965 3300053084 Bacteria 5916
1214 Ga0500643_008547 3300053087 Bacteria 4017
1215 Ga0500583_0004240 3300053092 Bacteria 4643
1216 Ga0500566_0002381 3300053094 Bacteria 11125
1217 Ga0500556_0000820 3300053104 Bacteria 17959
1218 Ga0500556_0001863 3300053104 Bacteria 7597
1219 Ga0500595_000441 3300053119 Bacteria 25944
1220 Ga0500614_000023 3300053123 Bacteria 36107
1221 Ga0500658_0000309 3300053134 Bacteria 21891
1222 Ga0500573_0000334 3300053140 Bacteria 19960
1223 Ga0500588_0000621 3300053146 Bacteria 5860
1224 Ga0500616_0003092 3300053153 Bacteria 13061
1225 Ga0500616_0004571 3300053153 Bacteria 9797
1226 Ga0500616_0013222 3300053153 Bacteria 4803
1227 Ga0500622_0000763 3300053156 Bacteria 28106
1228 Ga0500622_0002673 3300053156 Bacteria 12640
1229 Ga0500634_0005040 3300053161 Bacteria 6218
1230 Ga0500636_0000040 3300053177 Bacteria 69881
1231 Ga0501084_0007320 3300054114 Bacteria 9091
1232 Ga0501084_0013673 3300054114 Bacteria 6718
1233 Ga0590075_003564 3300059424 Bacteria 3692
1234 Ga0587072_000182 3300059643 Bacteria 5539
1235 Ga0501082_0047503 3300060353 Bacteria 3699
1236 Ga0501082_0067394 3300060353 Bacteria 3082
1237 Ga0530510_0002874 3300061734 Bacteria 11838
1238 Ga0530510_0007957 3300061734 Bacteria 7397
1239 Ga0530510_0011707 3300061734 Bacteria 6157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0037075 Ga0495676_0037075_11_2257 699
2 3300025909 Ga0207705_10060304 Ga0207705_100603041 706
3 3300045976 Ga0466967_0081634 Ga0466967_0081634_23_2221 717
4 3300061734 Ga0530510_0011707 Ga0530510_0011707_3796_6138 717
5 3300047471 Ga0495684_0077082 Ga0495684_0077082_31_2259 731
6 3300035692 Ga0373935_0047602 Ga0373935_0047602_375_2702 745
7 iso_pu_bacteria 3004289098 3004296883 756
8 3300046559 Ga0495667_0014652 Ga0495667_0014652_17_2356 762
9 iso_pu_bacteria 2857367948 2857371781 771
10 3300035692 Ga0373935_0059477 Ga0373935_0059477_27_2408 772
11 3300048927 Ga0496124_0011409 Ga0496124_0011409_17_2392 772
12 iso_pu_bacteria 2987645492 2987649111 777
13 3300047471 Ga0495684_0040499 Ga0495684_0040499_23_2572 783
14 3300047320 Ga0495672_0039647 Ga0495672_0039647_303_2849 789
15 3300048907 Ga0496104_0008828 Ga0496104_0008828_6419_8929 800
16 3300005535 Ga0070684_100041620 Ga0070684_1000416201 807
17 3300009551 Ga0105238_10036503 Ga0105238_100365035 807
18 3300013105 Ga0157369_10010700 Ga0157369_1001070010 807
19 iso_pu_bacteria 2885334103 2885340426 811
20 3300005444 Ga0070694_100035632 Ga0070694_1000356321 816
21 3300026118 Ga0207675_100002932 Ga0207675_1000029325 816
22 3300039437 Ga0436365_0379030 Ga0436365_0379030_1950_4511 817
23 3300044694 Ga0466963_0007533 Ga0466963_0007533_532_3105 819
24 3300045976 Ga0466967_0004204 Ga0466967_0004204_4368_6941 819
25 3300006871 Ga0075434_100013310 Ga0075434_1000133102 826
26 3300049583 Ga0501067_0013901 Ga0501067_0013901_1818_4391 826
27 3300050513 nmdc:mga0rr50_6115_c1 nmdc:mga0rr50_6115_c1_47_2620 826
28 3300035241 Ga0373961_0002038 Ga0373961_0002038_746_3499 828
29 iso_pu_bacteria 2961127735 2961128633 829
30 3300046472 Ga0495580_0004890 Ga0495580_0004890_1502_4096 833
31 3300046683 Ga0495658_0000608 Ga0495658_0000608_9857_12451 833
32 3300049822 Ga0501035_0005174 Ga0501035_0005174_4277_6838 833
33 3300025907 Ga0207645_10007867 Ga0207645_100078673 835
34 3300005331 Ga0070670_100001076 Ga0070670_10000107611 836
35 3300005334 Ga0068869_100000148 Ga0068869_10000014812 836
36 3300005364 Ga0070673_100004934 Ga0070673_1000049344 836
37 3300005367 Ga0070667_100001860 Ga0070667_1000018607 836
38 3300005459 Ga0068867_100003305 Ga0068867_1000033056 836
39 3300005563 Ga0068855_100030004 Ga0068855_1000300042 836
40 3300005617 Ga0068859_100011441 Ga0068859_1000114414 836
41 3300005618 Ga0068864_100002888 Ga0068864_1000028885 836
42 3300005841 Ga0068863_100006208 Ga0068863_1000062086 836
43 3300005842 Ga0068858_100003238 Ga0068858_10000323810 836
44 3300005843 Ga0068860_100034676 Ga0068860_1000346762 836
45 3300005844 Ga0068862_100007477 Ga0068862_1000074772 836
46 3300006931 Ga0097620_100011440 Ga0097620_1000114404 836
47 3300009177 Ga0105248_10006609 Ga0105248_100066098 836
48 3300013297 Ga0157378_10015958 Ga0157378_100159582 836
49 3300014968 Ga0157379_10001139 Ga0157379_100011397 836
50 3300025923 Ga0207681_10006427 Ga0207681_100064273 836
51 3300025925 Ga0207650_10006127 Ga0207650_100061274 836
52 3300025941 Ga0207711_10007665 Ga0207711_100076655 836
53 3300025942 Ga0207689_10000063 Ga0207689_1000006313 836
54 3300025960 Ga0207651_10011154 Ga0207651_100111543 836
55 3300025986 Ga0207658_10007780 Ga0207658_100077803 836
56 3300026035 Ga0207703_10000555 Ga0207703_1000055520 836
57 3300026088 Ga0207641_10006032 Ga0207641_100060323 836
58 3300026089 Ga0207648_10006138 Ga0207648_100061384 836
59 3300026095 Ga0207676_10006829 Ga0207676_100068291 836
60 3300026116 Ga0207674_10006586 Ga0207674_100065865 836
61 3300028380 Ga0268265_10014016 Ga0268265_100140162 836
62 3300028381 Ga0268264_10001157 Ga0268264_100011579 836
63 3300013307 Ga0157372_10046914 Ga0157372_100469146 844
64 3300025915 Ga0207693_10028986 Ga0207693_100289863 844
65 3300044694 Ga0466963_0033460 Ga0466963_0033460_90_2663 844
66 3300048905 Ga0496102_0006371 Ga0496102_0006371_1638_4211 844
67 3300048909 Ga0496106_0023580 Ga0496106_0023580_240_2813 844
68 3300048910 Ga0496107_0038195 Ga0496107_0038195_664_3237 844
69 3300048911 Ga0496108_0005174 Ga0496108_0005174_1919_4492 844
70 3300048912 Ga0496109_0001558 Ga0496109_0001558_3192_5765 844
71 3300048917 Ga0496114_0045252 Ga0496114_0045252_286_2859 844
72 3300048918 Ga0496115_0004169 Ga0496115_0004169_330_2903 844
73 3300005563 Ga0068855_100037955 Ga0068855_1000379555 845
74 3300009093 Ga0105240_10032037 Ga0105240_100320375 845
75 3300025912 Ga0207707_10013611 Ga0207707_100136112 845
76 3300025917 Ga0207660_10027840 Ga0207660_100278402 845
77 3300025921 Ga0207652_10039491 Ga0207652_100394912 845
78 3300025949 Ga0207667_10014724 Ga0207667_100147244 845
79 3300049569 Ga0501032_0007888 Ga0501032_0007888_628_3453 847
80 3300049573 Ga0501037_0002875 Ga0501037_0002875_3605_6430 847
81 iso_pu_bacteria 2818991448 2819611228 849
82 iso_pu_bacteria 8005645114 8005646937 849
83 iso_pu_bacteria 8005682033 8005688086 849
84 3300005440 Ga0070705_100010491 Ga0070705_1000104912 850
85 3300031728 Ga0316578_10005767 Ga0316578_100057672 851
86 3300031733 Ga0316577_10000265 Ga0316577_1000026516 851
87 3300036712 Ga0316584_0008905 Ga0316584_0008905_962_3748 851
88 3300048925 Ga0496122_0000830 Ga0496122_0000830_13382_16060 851
89 iso_pu_bacteria 2938014810 2938019746 851
90 3300028563 Ga0265319_1009838 Ga0265319_10098382 852
91 iso_pu_bacteria 2881147464 2881148503 852
92 3300005536 Ga0070697_100044879 Ga0070697_1000448792 853
93 3300025922 Ga0207646_10023627 Ga0207646_100236272 853
94 3300028800 Ga0265338_10009310 Ga0265338_100093106 853
95 3300031711 Ga0265314_10015947 Ga0265314_100159472 853
96 3300047471 Ga0495684_0011360 Ga0495684_0011360_47_2647 853
97 3300037312 Ga0395899_0021109 Ga0395899_0021109_2103_4859 854
98 3300037466 Ga0395898_0017303 Ga0395898_0017303_3276_6032 854
99 3300026095 Ga0207676_10055750 Ga0207676_100557501 855
100 3300031727 Ga0316576_10003358 Ga0316576_100033583 855
101 3300039453 Ga0436362_0398428 Ga0436362_0398428_2765_5506 855
102 iso_pu_bacteria 2510917022 2511133856 855
103 iso_pu_bacteria 2510917028 2511183980 855
104 iso_pu_bacteria 2513237103 2513711332 855
105 iso_pu_bacteria 2513237138 2513867462 855
106 iso_pu_bacteria 2513237144 2513912360 855
107 iso_pu_bacteria 2513237162 2514019383 855
108 iso_pu_bacteria 2515154113 2515635389 855
109 iso_pu_bacteria 2515154114 2515643203 855
110 iso_pu_bacteria 2515154116 2515657667 855
111 iso_pu_bacteria 2524023209 2524458449 855
112 iso_pu_bacteria 2582581294 2585201756 855
113 iso_pu_bacteria 2582581307 2585271644 855
114 iso_pu_bacteria 2582581308 2585280706 855
115 iso_pu_bacteria 2582581315 2585326491 855
116 iso_pu_bacteria 2582581867 2585399730 855
117 iso_pu_bacteria 2585427527 2585531640 855
118 iso_pu_bacteria 2585427528 2585540760 855
119 iso_pu_bacteria 2585427530 2585551413 855
120 iso_pu_bacteria 2585427531 2585563116 855
121 iso_pu_bacteria 2585427590 2585820817 855
122 iso_pu_bacteria 2585427593 2585839030 855
123 iso_pu_bacteria 2615840626 2616306749 855
124 iso_pu_bacteria 2617270742 2617383268 855
125 iso_pu_bacteria 2643221634 2644194842 855
126 iso_pu_bacteria 2643221643 2644240522 855
127 iso_pu_bacteria 2718217882 2719182945 855
128 iso_pu_bacteria 2718217997 2719667290 855
129 iso_pu_bacteria 2718218009 2719733662 855
130 iso_pu_bacteria 2718218199 2720493710 855
131 iso_pu_bacteria 2718218232 2720615163 855
132 iso_pu_bacteria 2718218233 2720621958 855
133 iso_pu_bacteria 2718218235 2720633308 855
134 iso_pu_bacteria 2718218269 2720777006 855
135 iso_pu_bacteria 2718218363 2721149057 855
136 iso_pu_bacteria 2718218365 2721160455 855
137 iso_pu_bacteria 2718218366 2721165870 855
138 iso_pu_bacteria 2721755514 2722842040 855
139 iso_pu_bacteria 2721755556 2723028604 855
140 iso_pu_bacteria 2721755684 2723562208 855
141 iso_pu_bacteria 2721755685 2723568911 855
142 iso_pu_bacteria 2721755810 2724046418 855
143 iso_pu_bacteria 2721755819 2724091613 855
144 iso_pu_bacteria 2721755822 2724106176 855
145 iso_pu_bacteria 2721755823 2724111982 855
146 iso_pu_bacteria 2724679232 2725947519 855
147 iso_pu_bacteria 2728369352 2730109540 855
148 iso_pu_bacteria 2728369365 2730166180 855
149 iso_pu_bacteria 2728369397 2730300087 855
150 iso_pu_bacteria 2738541333 2739037257 855
151 iso_pu_bacteria 2775507266 2778173735 855
152 iso_pu_bacteria 2791355256 2793295646 855
153 iso_pu_bacteria 2791355262 2793332219 855
154 iso_pu_bacteria 2791355263 2793338794 855
155 iso_pu_bacteria 2791355265 2793353879 855
156 iso_pu_bacteria 2791355266 2793359414 855
157 iso_pu_bacteria 2802429633 2806047348 855
158 iso_pu_bacteria 2802429634 2806054203 855
159 iso_pu_bacteria 2802429635 2806060213 855
160 iso_pu_bacteria 2802429636 2806068824 855
161 iso_pu_bacteria 2802429637 2806076430 855
162 iso_pu_bacteria 2818991453 2819638843 855
163 iso_pu_bacteria 2842462802 2842467915 855
164 iso_pu_bacteria 2818991461 2819687027 856
165 3300025315 Ga0207697_10001988 Ga0207697_100019887 857
166 3300025908 Ga0207643_10016884 Ga0207643_100168842 857
167 3300026075 Ga0207708_10006769 Ga0207708_100067693 857
168 3300026118 Ga0207675_100030665 Ga0207675_1000306652 857
169 3300025934 Ga0207686_10030618 Ga0207686_100306182 858
170 3300031251 Ga0265327_10004783 Ga0265327_100047833 858
171 3300031665 Ga0316575_10000169 Ga0316575_100001694 858
172 3300031727 Ga0316576_10002676 Ga0316576_100026762 858
173 3300031733 Ga0316577_10005218 Ga0316577_100052183 858
174 3300032133 Ga0316583_10000294 Ga0316583_100002942 858
175 3300032139 Ga0316580_10000019 Ga0316580_1000001912 858
176 3300033529 Ga0316587_1000253 Ga0316587_10002531 858
177 3300035398 Ga0316574_0002699 Ga0316574_0002699_4113_6776 858
178 3300036647 Ga0316582_0003746 Ga0316582_0003746_3372_6035 858
179 3300001979 JGI24740J21852_10000013 JGI24740J21852_1000001356 859
180 3300002704 JGI25155J39150_1000010 JGI25155J39150_100001013 859
181 3300002705 JGI25156J39149_1000102 JGI25156J39149_100010212 859
182 3300002737 JGI25162J39368_1001052 JGI25162J39368_100105217 859
183 3300002737 JGI25162J39368_1001061 JGI25162J39368_10010611 859
184 3300002738 JGI25154J39366_1000184 JGI25154J39366_100018456 859
185 3300002741 JGI25157J39369_1000009 JGI25157J39369_100000912 859
186 3300002987 JGI25159J45721_1000623 JGI25159J45721_10006231 859
187 3300003187 JGI25151J46595_10002253 JGI25151J46595_1000225312 859
188 3300003214 JGI25165J46597_1001126 JGI25165J46597_100112618 859
189 3300003354 JGI25160J50197_1000235 JGI25160J50197_10002351 859
190 3300003354 JGI25160J50197_1003116 JGI25160J50197_10031166 859
191 3300003374 JGI25161J50226_1000175 JGI25161J50226_10001751 859
192 3300004625 Ga0055543_1000226 Ga0055543_10002264 859
193 3300005262 Ga0065165_1001345 Ga0065165_10013452 859
194 3300005329 Ga0070683_100008481 Ga0070683_1000084813 859
195 3300005331 Ga0070670_100000116 Ga0070670_10000011618 859
196 3300005841 Ga0068863_100060859 Ga0068863_1000608592 859
197 3300009093 Ga0105240_10000013 Ga0105240_10000013197 859
198 3300009545 Ga0105237_10012810 Ga0105237_100128102 859
199 3300009765 Ga0123341_1023081 Ga0123341_10230811 859
200 3300009766 Ga0123342_1009724 Ga0123342_10097247 859
201 3300010375 Ga0105239_10000820 Ga0105239_1000082011 859
202 3300013104 Ga0157370_10002495 Ga0157370_100024951 859
203 3300013105 Ga0157369_10008723 Ga0157369_100087232 859
204 3300013296 Ga0157374_10011766 Ga0157374_100117662 859
205 3300013308 Ga0157375_10035280 Ga0157375_100352802 859
206 3300025206 Ga0209435_100009 Ga0209435_100009269 859
207 3300025233 Ga0209437_100057 Ga0209437_100057198 859
208 3300025233 Ga0209437_100107 Ga0209437_100107167 859
209 3300025246 Ga0209646_1000018 Ga0209646_1000018269 859
210 3300025250 Ga0209026_1000068 Ga0209026_100006813 859
211 3300025253 Ga0209677_100199 Ga0209677_1001996 859
212 3300025256 Ga0209759_1000007 Ga0209759_1000007269 859
213 3300025261 Ga0209233_1000072 Ga0209233_10000721 859
214 3300025261 Ga0209233_1000134 Ga0209233_1000134198 859
215 3300025261 Ga0209233_1000479 Ga0209233_10004791 859
216 3300025273 Ga0209673_1000052 Ga0209673_1000052135 859
217 3300025284 Ga0209130_1000132 Ga0209130_10001324 859
218 3300025294 Ga0209025_1003035 Ga0209025_10030351 859
219 3300025295 Ga0209564_1005381 Ga0209564_10053814 859
220 3300025297 Ga0209758_1002827 Ga0209758_100282717 859
221 3300025302 Ga0207426_1000246 Ga0207426_10002464 859
222 3300025302 Ga0207426_1000348 Ga0207426_100034839 859
223 3300025302 Ga0207426_1003830 Ga0207426_10038306 859
224 3300025303 Ga0209051_1010028 Ga0209051_10100282 859
225 3300025913 Ga0207695_10000044 Ga0207695_10000044154 859
226 3300025914 Ga0207671_10000400 Ga0207671_1000040021 859
227 3300025925 Ga0207650_10031218 Ga0207650_100312182 859
228 3300025960 Ga0207651_10017714 Ga0207651_100177142 859
229 3300026095 Ga0207676_10004561 Ga0207676_100045614 859
230 3300026121 Ga0207683_10031347 Ga0207683_100313473 859
231 3300031711 Ga0265314_10002284 Ga0265314_100022844 859
232 3300035118 Ga0373954_0024056 Ga0373954_0024056_106_2724 859
233 3300036401 Ga0373937_0006139 Ga0373937_0006139_92_2713 859
234 3300036401 Ga0373937_0010758 Ga0373937_0010758_3441_6062 859
235 3300037471 Ga0395905_0001780 Ga0395905_0001780_7307_9952 859
236 3300037471 Ga0395905_0020565 Ga0395905_0020565_1397_4042 859
237 3300046516 Ga0495628_0018612 Ga0495628_0018612_26_2644 859
238 3300046536 Ga0495587_0005525 Ga0495587_0005525_2069_4690 859
239 3300046543 Ga0495645_0015578 Ga0495645_0015578_153_2771 859
240 3300046559 Ga0495667_0025617 Ga0495667_0025617_379_3000 859
241 3300048088 Ga0495602_0002809 Ga0495602_0002809_13262_15883 859
242 3300048920 Ga0496117_0002097 Ga0496117_0002097_11021_13666 859
243 3300048921 Ga0496118_0002291 Ga0496118_0002291_11125_13770 859
244 iso_pu_bacteria 2887630918 2887632051 859
245 3300009551 Ga0105238_10001717 Ga0105238_1000171710 860
246 3300025927 Ga0207687_10001059 Ga0207687_100010596 860
247 3300005336 Ga0070680_100000436 Ga0070680_10000043621 861
248 3300005530 Ga0070679_100016959 Ga0070679_1000169595 861
249 3300005563 Ga0068855_100014573 Ga0068855_1000145736 861
250 3300005937 Ga0081455_10000016 Ga0081455_1000001667 861
251 3300013307 Ga0157372_10018496 Ga0157372_100184964 861
252 3300025917 Ga0207660_10000002 Ga0207660_1000000294 861
253 3300049581 Ga0501047_0025858 Ga0501047_0025858_1914_4547 861
254 3300053092 Ga0500583_0004240 Ga0500583_0004240_1281_3974 861
255 3300053146 Ga0500588_0000621 Ga0500588_0000621_2790_5483 861
256 iso_pu_bacteria 8054357960 8054360374 861
257 3300005329 Ga0070683_100022976 Ga0070683_1000229762 862
258 3300005548 Ga0070665_100000130 Ga0070665_10000013046 862
259 3300009093 Ga0105240_10004538 Ga0105240_1000453823 862
260 3300025913 Ga0207695_10010414 Ga0207695_100104143 862
261 3300028379 Ga0268266_10000136 Ga0268266_1000013672 862
262 3300030521 Ga0307511_10002440 Ga0307511_1000244010 862
263 3300045051 Ga0451576_0000187 Ga0451576_0000187_48045_50963 862
264 3300046472 Ga0495580_0000771 Ga0495580_0000771_19520_22150 862
265 3300046472 Ga0495580_0031156 Ga0495580_0031156_1143_3773 862
266 3300046473 Ga0495582_0007296 Ga0495582_0007296_56_2689 862
267 3300047471 Ga0495684_0002534 Ga0495684_0002534_9907_12537 862
268 3300048088 Ga0495602_0034395 Ga0495602_0034395_403_3033 862
269 3300005471 Ga0070698_100053874 Ga0070698_1000538742 863
270 3300005535 Ga0070684_100024728 Ga0070684_1000247282 863
271 3300006175 Ga0070712_100000005 Ga0070712_10000000573 863
272 3300009098 Ga0105245_10088461 Ga0105245_100884612 863
273 3300009176 Ga0105242_10011378 Ga0105242_100113782 863
274 3300009551 Ga0105238_10000394 Ga0105238_1000039430 863
275 3300009551 Ga0105238_10014002 Ga0105238_100140022 863
276 3300010375 Ga0105239_10049384 Ga0105239_100493842 863
277 3300013297 Ga0157378_10033646 Ga0157378_100336462 863
278 3300014325 Ga0163163_10058358 Ga0163163_100583582 863
279 3300025913 Ga0207695_10002682 Ga0207695_100026828 863
280 3300025915 Ga0207693_10000023 Ga0207693_10000023101 863
281 3300025924 Ga0207694_10000760 Ga0207694_1000076011 863
282 3300025924 Ga0207694_10013575 Ga0207694_100135754 863
283 3300026116 Ga0207674_10001999 Ga0207674_100019999 863
284 3300026118 Ga0207675_100013966 Ga0207675_1000139662 863
285 3300048915 Ga0496112_0000007 Ga0496112_0000007_235268_237988 863
286 iso_pu_bacteria 2871435913 2871439936 863
287 3300003578 Ga0006562J51391_1012664 Ga0006562J51391_10126641 864
288 3300009092 Ga0105250_10015711 Ga0105250_100157111 864
289 3300009174 Ga0105241_10001852 Ga0105241_100018529 864
290 3300025284 Ga0209130_1003576 Ga0209130_10035766 864
291 3300025294 Ga0209025_1000101 Ga0209025_100010163 864
292 3300025711 Ga0207696_1001283 Ga0207696_100128315 864
293 3300032139 Ga0316580_10001009 Ga0316580_100010096 864
294 3300035398 Ga0316574_0027546 Ga0316574_0027546_632_3304 864
295 3300045976 Ga0466967_0007313 Ga0466967_0007313_2618_5341 864
296 3300005444 Ga0070694_100021804 Ga0070694_1000218042 865
297 3300009545 Ga0105237_10019782 Ga0105237_100197823 865
298 3300031595 Ga0265313_10006173 Ga0265313_100061733 865
299 3300039437 Ga0436365_0004038 Ga0436365_0004038_17988_20801 865
300 3300048915 Ga0496112_0000295 Ga0496112_0000295_27054_29954 865
301 3300049570 Ga0501033_0024459 Ga0501033_0024459_1710_4388 865
302 3300049591 Ga0501075_0038926 Ga0501075_0038926_868_3513 865
303 3300005341 Ga0070691_10002533 Ga0070691_100025334 866
304 3300006051 Ga0075364_10004000 Ga0075364_100040001 866
305 3300006852 Ga0075433_10002169 Ga0075433_100021694 866
306 3300006880 Ga0075429_100055270 Ga0075429_1000552702 866
307 3300009147 Ga0114129_10015266 Ga0114129_100152663 866
308 3300037418 Ga0395900_0004721 Ga0395900_0004721_8583_11372 866
309 3300044673 Ga0453683_0027379 Ga0453683_0027379_767_3424 866
310 3300050491 nmdc:mga00v17_25726_c1 nmdc:mga00v17_25726_c1_629_3388 866
311 3300050515 nmdc:mga0a205_64987_c1 nmdc:mga0a205_64987_c1_64_2817 866
312 iso_pu_bacteria 2788500588 2791213774 866
313 iso_pu_bacteria 2818991451 2819629413 866
314 iso_pu_bacteria 2904606771 2904607484 866
315 iso_pu_bacteria 2924718760 2924722459 866
316 iso_pu_bacteria 2939593269 2939594098 866
317 iso_pu_bacteria 8055531788 8055534675 866
318 3300044712 Ga0453684_0000162 Ga0453684_0000162_143359_146067 867
319 3300049582 Ga0501048_0033215 Ga0501048_0033215_314_3136 867
320 3300049587 Ga0501071_0023578 Ga0501071_0023578_941_3763 867
321 3300049591 Ga0501075_0013007 Ga0501075_0013007_2663_5485 867
322 3300049742 Ga0501080_0008862 Ga0501080_0008862_6293_9115 867
323 iso_pu_bacteria 2970510686 2970517304 867
324 3300006847 Ga0075431_100014430 Ga0075431_1000144303 868
325 3300031728 Ga0316578_10027847 Ga0316578_100278472 868
326 3300036401 Ga0373937_0048612 Ga0373937_0048612_551_3355 868
327 3300046462 Ga0495651_0004397 Ga0495651_0004397_7834_10638 868
328 3300046511 Ga0495608_0004409 Ga0495608_0004409_2702_5506 868
329 3300046529 Ga0495652_0012961 Ga0495652_0012961_1161_3965 868
330 3300046559 Ga0495667_0001394 Ga0495667_0001394_11532_14336 868
331 3300046675 Ga0495657_0022698 Ga0495657_0022698_539_3343 868
332 3300047317 Ga0495604_0008409 Ga0495604_0008409_4016_6820 868
333 3300047322 Ga0495680_0024132 Ga0495680_0024132_1330_4134 868
334 3300048915 Ga0496112_0001855 Ga0496112_0001855_8606_11398 868
335 3300048916 Ga0496113_0007804 Ga0496113_0007804_1312_4104 868
336 3300050507 nmdc:mga05p37_7507_c1 nmdc:mga05p37_7507_c1_293_2983 868
337 3300053084 Ga0495595_0003965 Ga0495595_0003965_2445_5249 868
338 3300006880 Ga0075429_100003307 Ga0075429_10000330711 869
339 3300011119 Ga0105246_10018795 Ga0105246_100187951 869
340 3300025728 Ga0207655_1001425 Ga0207655_100142516 869
341 3300035724 Ga0373933_0022555 Ga0373933_0022555_856_3555 869
342 3300036401 Ga0373937_0001348 Ga0373937_0001348_15551_18250 869
343 3300044712 Ga0453684_0025830 Ga0453684_0025830_61_2754 869
344 3300045051 Ga0451576_0008438 Ga0451576_0008438_6195_8888 869
345 3300049581 Ga0501047_0015662 Ga0501047_0015662_3707_6400 869
346 3300050507 nmdc:mga05p37_12340_c1 nmdc:mga05p37_12340_c1_6187_8880 869
347 3300050508 nmdc:mga09592_1992_c1 nmdc:mga09592_1992_c1_11392_14085 869
348 3300050515 nmdc:mga0a205_4918_c1 nmdc:mga0a205_4918_c1_3509_6166 869
349 iso_pu_bacteria 2511231027 2511391838 869
350 iso_pu_bacteria 2643221574 2643884371 869
351 iso_pu_bacteria 2643221733 2644731030 869
352 iso_pu_bacteria 2643221734 2644734692 869
353 iso_pu_bacteria 2643221736 2644746420 869
354 iso_pu_bacteria 2751185800 2753358436 869
355 iso_pu_bacteria 2758568016 2758640666 869
356 iso_pu_bacteria 2765235802 2765465726 869
357 iso_pu_bacteria 2767802442 2770198318 869
358 iso_pu_bacteria 2775506902 2776269566 869
359 iso_pu_bacteria 2775506904 2776282497 869
360 iso_pu_bacteria 2818991467 2819722190 869
361 iso_pu_bacteria 2839993093 2839993370 869
362 iso_pu_bacteria 2840764183 2840766373 869
363 iso_pu_bacteria 2841760612 2841765067 869
364 iso_pu_bacteria 2841911363 2841912553 869
365 iso_pu_bacteria 2841917233 2841918308 869
366 iso_pu_bacteria 2842871566 2842873991 869
367 iso_pu_bacteria 2844104063 2844105576 869
368 iso_pu_bacteria 2851182111 2851183849 869
369 iso_pu_bacteria 2851246043 2851249591 869
370 iso_pu_bacteria 2854911287 2854913963 869
371 iso_pu_bacteria 2894652903 2894653760 869
372 iso_pu_bacteria 2904578770 2904579981 869
373 iso_pu_bacteria 2915650412 2915650819 869
374 iso_pu_bacteria 2917699015 2917703104 869
375 iso_pu_bacteria 2917699015 2917704946 869
376 iso_pu_bacteria 2919119836 2919120347 869
377 iso_pu_bacteria 2928521798 2928522775 869
378 iso_pu_bacteria 2941485952 2941488120 869
379 iso_pu_bacteria 2954011201 2954013858 869
380 iso_pu_bacteria 3002141150 3002141699 869
381 iso_pu_bacteria 8057529695 8057532904 869
382 3300003187 JGI25151J46595_10003647 JGI25151J46595_100036473 870
383 3300003751 Ga0055538_1000403 Ga0055538_100040318 870
384 3300003781 Ga0055536_1011262 Ga0055536_10112621 870
385 3300005467 Ga0070706_100007006 Ga0070706_1000070069 870
386 3300006880 Ga0075429_100006446 Ga0075429_1000064468 870
387 3300009093 Ga0105240_10002246 Ga0105240_1000224617 870
388 3300009098 Ga0105245_10004857 Ga0105245_100048577 870
389 3300009147 Ga0114129_10082386 Ga0114129_100823862 870
390 3300013307 Ga0157372_10031672 Ga0157372_100316724 870
391 3300025224 Ga0209784_100096 Ga0209784_1000963 870
392 3300025913 Ga0207695_10001451 Ga0207695_1000145131 870
393 3300026088 Ga0207641_10000727 Ga0207641_1000072725 870
394 3300026116 Ga0207674_10004655 Ga0207674_100046553 870
395 3300031727 Ga0316576_10015935 Ga0316576_100159351 870
396 3300031728 Ga0316578_10003534 Ga0316578_100035343 870
397 3300033541 Ga0316596_1002115 Ga0316596_10021151 870
398 3300035398 Ga0316574_0007147 Ga0316574_0007147_1680_4337 870
399 3300045051 Ga0451576_0008309 Ga0451576_0008309_5104_7827 870
400 3300046514 Ga0495618_0000137 Ga0495618_0000137_44989_47856 870
401 3300048904 Ga0496101_0005221 Ga0496101_0005221_1199_4021 870
402 3300048905 Ga0496102_0002927 Ga0496102_0002927_4907_7777 870
403 3300048909 Ga0496106_0010026 Ga0496106_0010026_1189_4059 870
404 3300049581 Ga0501047_0064222 Ga0501047_0064222_593_3268 870
405 3300050507 nmdc:mga05p37_119137_c1 nmdc:mga05p37_119137_c1_286_3150 870
406 iso_pu_bacteria 2503198000 2503199010 870
407 iso_pu_bacteria 2508501122 2509109579 870
408 iso_pu_bacteria 2508501127 2509143161 870
409 iso_pu_bacteria 2509276018 2509372832 870
410 iso_pu_bacteria 2509276019 2509378097 870
411 iso_pu_bacteria 2509276021 2509389429 870
412 iso_pu_bacteria 2509276022 2509393898 870
413 iso_pu_bacteria 2509276033 2509446174 870
414 iso_pu_bacteria 2510065019 2510135228 870
415 iso_pu_bacteria 2510065057 2510305472 870
416 iso_pu_bacteria 2510065059 2510318364 870
417 iso_pu_bacteria 2510461076 2510896683 870
418 iso_pu_bacteria 2510917030 2511194584 870
419 iso_pu_bacteria 2511231052 2511498484 870
420 iso_pu_bacteria 2512047086 2512534625 870
421 iso_pu_bacteria 2512875016 2512933589 870
422 iso_pu_bacteria 2512875026 2512973567 870
423 iso_pu_bacteria 2513237084 2513571612 870
424 iso_pu_bacteria 2513237085 2513578646 870
425 iso_pu_bacteria 2513237086 2513583646 870
426 iso_pu_bacteria 2513237088 2513596811 870
427 iso_pu_bacteria 2513237089 2513601914 870
428 iso_pu_bacteria 2513237090 2513613939 870
429 iso_pu_bacteria 2513237091 2513615719 870
430 iso_pu_bacteria 2513237093 2513630169 870
431 iso_pu_bacteria 2513237140 2513884986 870
432 iso_pu_bacteria 2513237143 2513905196 870
433 iso_pu_bacteria 2513237146 2513928455 870
434 iso_pu_bacteria 2513237156 2513988045 870
435 iso_pu_bacteria 2513237160 2514003486 870
436 iso_pu_bacteria 2515075009 2515114386 870
437 iso_pu_bacteria 2515154107 2515611057 870
438 iso_pu_bacteria 2515154134 2515741570 870
439 iso_pu_bacteria 2516143018 2516205567 870
440 iso_pu_bacteria 2516653046 2516894764 870
441 iso_pu_bacteria 2516653077 2517038036 870
442 iso_pu_bacteria 2516653085 2517078300 870
443 iso_pu_bacteria 2517093000 2517097059 870
444 iso_pu_bacteria 2517287029 2517408557 870
445 iso_pu_bacteria 2517487022 2517571429 870
446 iso_pu_bacteria 2519899620 2520379685 870
447 iso_pu_bacteria 2523231067 2523467835 870
448 iso_pu_bacteria 2524023207 2524450425 870
449 iso_pu_bacteria 2524614857 2526061041 870
450 iso_pu_bacteria 2529292951 2530647369 870
451 iso_pu_bacteria 2534681796 2535519003 870
452 iso_pu_bacteria 2551306084 2551676618 870
453 iso_pu_bacteria 2551306084 2551680242 870
454 iso_pu_bacteria 2551306085 2551685072 870
455 iso_pu_bacteria 2551306086 2551694471 870
456 iso_pu_bacteria 2551306087 2551697737 870
457 iso_pu_bacteria 2551306089 2551708348 870
458 iso_pu_bacteria 2551306090 2551717600 870
459 iso_pu_bacteria 2551306091 2551731603 870
460 iso_pu_bacteria 2551306092 2551736187 870
461 iso_pu_bacteria 2551306093 2551746086 870
462 iso_pu_bacteria 2558860100 2558867402 870
463 iso_pu_bacteria 2582581283 2585166702 870
464 iso_pu_bacteria 2582581298 2585223905 870
465 iso_pu_bacteria 2582581299 2585228759 870
466 iso_pu_bacteria 2582581304 2585257366 870
467 iso_pu_bacteria 2582581306 2585266958 870
468 iso_pu_bacteria 2582581316 2585334167 870
469 iso_pu_bacteria 2582581865 2585387999 870
470 iso_pu_bacteria 2582581866 2585396642 870
471 iso_pu_bacteria 2585427526 2585526063 870
472 iso_pu_bacteria 2585427529 2585549128 870
473 iso_pu_bacteria 2585427594 2585844872 870
474 iso_pu_bacteria 2585427608 2585902834 870
475 iso_pu_bacteria 2585427609 2585907334 870
476 iso_pu_bacteria 2585428125 2587982672 870
477 iso_pu_bacteria 2588253730 2588519666 870
478 iso_pu_bacteria 2597489875 2597811965 870
479 iso_pu_bacteria 2599185156 2599335119 870
480 iso_pu_bacteria 2599185170 2599420167 870
481 iso_pu_bacteria 2599185301 2599936947 870
482 iso_pu_bacteria 2599185352 2600193355 870
483 iso_pu_bacteria 2615840698 2616557595 870
484 iso_pu_bacteria 2643221557 2643808053 870
485 iso_pu_bacteria 2643221564 2643836994 870
486 iso_pu_bacteria 2643221599 2644002452 870
487 iso_pu_bacteria 2643221607 2644052242 870
488 iso_pu_bacteria 2643221610 2644068758 870
489 iso_pu_bacteria 2643221618 2644110164 870
490 iso_pu_bacteria 2643221626 2644150440 870
491 iso_pu_bacteria 2643221636 2644201375 870
492 iso_pu_bacteria 2643221637 2644209484 870
493 iso_pu_bacteria 2643221655 2644313044 870
494 iso_pu_bacteria 2643221659 2644336592 870
495 iso_pu_bacteria 2643221663 2644351505 870
496 iso_pu_bacteria 2643221668 2644379487 870
497 iso_pu_bacteria 2643221675 2644419828 870
498 iso_pu_bacteria 2643221680 2644453185 870
499 iso_pu_bacteria 2643221686 2644484520 870
500 iso_pu_bacteria 2643221688 2644493098 870
501 iso_pu_bacteria 2643221689 2644499306 870
502 iso_pu_bacteria 2643221698 2644546239 870
503 iso_pu_bacteria 2643221712 2644618774 870
504 iso_pu_bacteria 2643221718 2644653012 870
505 iso_pu_bacteria 2643221723 2644677081 870
506 iso_pu_bacteria 2643221726 2644688787 870
507 iso_pu_bacteria 2667528174 2671113491 870
508 iso_pu_bacteria 2687453392 2688596284 870
509 iso_pu_bacteria 2690316117 2692319946 870
510 iso_pu_bacteria 2693429784 2694638309 870
511 iso_pu_bacteria 2718217927 2719387658 870
512 iso_pu_bacteria 2718218423 2721401292 870
513 iso_pu_bacteria 2721755809 2724040106 870
514 iso_pu_bacteria 2738541293 2738805592 870
515 iso_pu_bacteria 2739367875 2740062505 870
516 iso_pu_bacteria 2765235942 2766064286 870
517 iso_pu_bacteria 2791355082 2792582244 870
518 iso_pu_bacteria 2791355091 2792621908 870
519 iso_pu_bacteria 2791355092 2792628835 870
520 iso_pu_bacteria 2791355253 2793281003 870
521 iso_pu_bacteria 2791355259 2793313397 870
522 iso_pu_bacteria 2791355267 2793365886 870
523 iso_pu_bacteria 2802428858 2802717204 870
524 iso_pu_bacteria 2802428859 2802724807 870
525 iso_pu_bacteria 2802428860 2802729558 870
526 iso_pu_bacteria 2802428861 2802736904 870
527 iso_pu_bacteria 2802428862 2802743309 870
528 iso_pu_bacteria 2802428863 2802749565 870
529 iso_pu_bacteria 2802429605 2805926197 870
530 iso_pu_bacteria 2802429606 2805933923 870
531 iso_pu_bacteria 2838016132 2838018351 870
532 iso_pu_bacteria 2838022645 2838024034 870
533 iso_pu_bacteria 2838029111 2838030917 870
534 iso_pu_bacteria 2838035591 2838040373 870
535 iso_pu_bacteria 2838042994 2838047821 870
536 iso_pu_bacteria 2838048938 2838050787 870
537 iso_pu_bacteria 2838061910 2838062553 870
538 iso_pu_bacteria 2838068647 2838072104 870
539 iso_pu_bacteria 2838074704 2838078169 870
540 iso_pu_bacteria 2838661181 2838667787 870
541 iso_pu_bacteria 2838668709 2838672145 870
542 iso_pu_bacteria 2838680041 2838683897 870
543 iso_pu_bacteria 2838686498 2838690263 870
544 iso_pu_bacteria 2838694306 2838698425 870
545 iso_pu_bacteria 2838701080 2838704985 870
546 iso_pu_bacteria 2838707686 2838711540 870
547 iso_pu_bacteria 2838729681 2838732038 870
548 iso_pu_bacteria 2838742623 2838744934 870
549 iso_pu_bacteria 2841851746 2841855992 870
550 iso_pu_bacteria 2841864319 2841867778 870
551 iso_pu_bacteria 2842077413 2842081341 870
552 iso_pu_bacteria 2842110456 2842116874 870
553 iso_pu_bacteria 2842118031 2842121882 870
554 iso_pu_bacteria 2842146304 2842148779 870
555 iso_pu_bacteria 2842156927 2842161162 870
556 iso_pu_bacteria 2842163707 2842166674 870
557 iso_pu_bacteria 2842180545 2842184778 870
558 iso_pu_bacteria 2842192696 2842194901 870
559 iso_pu_bacteria 2842198810 2842201627 870
560 iso_pu_bacteria 2842205361 2842207401 870
561 iso_pu_bacteria 2842217011 2842221760 870
562 iso_pu_bacteria 2842229732 2842232360 870
563 iso_pu_bacteria 2842237096 2842240896 870
564 iso_pu_bacteria 2842243621 2842246776 870
565 iso_pu_bacteria 2842250916 2842254666 870
566 iso_pu_bacteria 2842257432 2842261123 870
567 iso_pu_bacteria 2842264693 2842269619 870
568 iso_pu_bacteria 2842271015 2842274283 870
569 iso_pu_bacteria 2842278818 2842280888 870
570 iso_pu_bacteria 2842285085 2842288499 870
571 iso_pu_bacteria 2842291075 2842294998 870
572 iso_pu_bacteria 2842298080 2842300294 870
573 iso_pu_bacteria 2842304105 2842305874 870
574 iso_pu_bacteria 2842311132 2842311391 870
575 iso_pu_bacteria 2842317721 2842321092 870
576 iso_pu_bacteria 2842341865 2842346602 870
577 iso_pu_bacteria 2842357229 2842361188 870
578 iso_pu_bacteria 2842363717 2842366291 870
579 iso_pu_bacteria 2842370503 2842374984 870
580 iso_pu_bacteria 2842377471 2842381397 870
581 iso_pu_bacteria 2842384541 2842388467 870
582 iso_pu_bacteria 2842395702 2842395963 870
583 iso_pu_bacteria 2842402390 2842406155 870
584 iso_pu_bacteria 2842409023 2842412740 870
585 iso_pu_bacteria 2842415677 2842419381 870
586 iso_pu_bacteria 2842422224 2842425736 870
587 iso_pu_bacteria 2842428310 2842433619 870
588 iso_pu_bacteria 2842434925 2842439947 870
589 iso_pu_bacteria 2842441272 2842446576 870
590 iso_pu_bacteria 2842447887 2842448800 870
591 iso_pu_bacteria 2842469257 2842474556 870
592 iso_pu_bacteria 2842475841 2842477649 870
593 iso_pu_bacteria 2842482326 2842484954 870
594 iso_pu_bacteria 2842489311 2842491145 870
595 iso_pu_bacteria 2842495871 2842498482 870
596 iso_pu_bacteria 2842502639 2842504478 870
597 iso_pu_bacteria 2842509118 2842511726 870
598 iso_pu_bacteria 2842521101 2842524503 870
599 iso_pu_bacteria 2842922631 2842926309 870
600 iso_pu_bacteria 2844009547 2844011113 870
601 iso_pu_bacteria 2844163670 2844166253 870
602 iso_pu_bacteria 2844454524 2844457038 870
603 iso_pu_bacteria 2847417321 2847420830 870
604 iso_pu_bacteria 2847670302 2847673738 870
605 iso_pu_bacteria 2847686936 2847690222 870
606 iso_pu_bacteria 2848992105 2848995656 870
607 iso_pu_bacteria 2850079185 2850082641 870
608 iso_pu_bacteria 2852387548 2852391679 870
609 iso_pu_bacteria 2855825444 2855827392 870
610 iso_pu_bacteria 2855839649 2855842770 870
611 iso_pu_bacteria 2855872281 2855878193 870
612 iso_pu_bacteria 2856320880 2856327157 870
613 iso_pu_bacteria 2856328259 2856329774 870
614 iso_pu_bacteria 2856334872 2856336578 870
615 iso_pu_bacteria 2856342000 2856343505 870
616 iso_pu_bacteria 2856349417 2856349680 870
617 iso_pu_bacteria 2856364286 2856365090 870
618 iso_pu_bacteria 2857349434 2857353233 870
619 iso_pu_bacteria 2857516855 2857519554 870
620 iso_pu_bacteria 2858800743 2858802108 870
621 iso_pu_bacteria 2869162929 2869168886 870
622 iso_pu_bacteria 2869169390 2869176120 870
623 iso_pu_bacteria 2869234852 2869239303 870
624 iso_pu_bacteria 2869249662 2869251997 870
625 iso_pu_bacteria 2869256925 2869258521 870
626 iso_pu_bacteria 2869264136 2869268777 870
627 iso_pu_bacteria 2869271264 2869273728 870
628 iso_pu_bacteria 2869278585 2869279612 870
629 iso_pu_bacteria 2869285874 2869286286 870
630 iso_pu_bacteria 2871429161 2871430255 870
631 iso_pu_bacteria 2871444079 2871445060 870
632 iso_pu_bacteria 2871451962 2871458700 870
633 iso_pu_bacteria 2871459585 2871464854 870
634 iso_pu_bacteria 2871481445 2871482656 870
635 iso_pu_bacteria 2871488783 2871494974 870
636 iso_pu_bacteria 2871495908 2871500147 870
637 iso_pu_bacteria 2874102143 2874103211 870
638 iso_pu_bacteria 2874123672 2874130068 870
639 iso_pu_bacteria 2874139085 2874139396 870
640 iso_pu_bacteria 2874146452 2874146672 870
641 iso_pu_bacteria 2874155637 2874155746 870
642 iso_pu_bacteria 2874162495 2874167817 870
643 iso_pu_bacteria 2876363079 2876364157 870
644 iso_pu_bacteria 2876377896 2876385592 870
645 iso_pu_bacteria 2876386047 2876386998 870
646 iso_pu_bacteria 2876392853 2876399203 870
647 iso_pu_bacteria 2876399893 2876402422 870
648 iso_pu_bacteria 2876406927 2876409266 870
649 iso_pu_bacteria 2876413966 2876414075 870
650 iso_pu_bacteria 2878730984 2878736151 870
651 iso_pu_bacteria 2878738818 2878742139 870
652 iso_pu_bacteria 2878745973 2878746451 870
653 iso_pu_bacteria 2878753008 2878760099 870
654 iso_pu_bacteria 2878760144 2878764269 870
655 iso_pu_bacteria 2878767105 2878771339 870
656 iso_pu_bacteria 2878774303 2878775992 870
657 iso_pu_bacteria 2878781027 2878787383 870
658 iso_pu_bacteria 2881155292 2881159587 870
659 iso_pu_bacteria 2881161766 2881165300 870
660 iso_pu_bacteria 2881845957 2881848734 870
661 iso_pu_bacteria 2881853255 2881859323 870
662 iso_pu_bacteria 2881861095 2881863450 870
663 iso_pu_bacteria 2882912400 2882917427 870
664 iso_pu_bacteria 2885305155 2885307150 870
665 iso_pu_bacteria 2885312484 2885313841 870
666 iso_pu_bacteria 2885318864 2885321449 870
667 iso_pu_bacteria 2885326080 2885329072 870
668 iso_pu_bacteria 2885342637 2885344623 870
669 iso_pu_bacteria 2885350715 2885352182 870
670 iso_pu_bacteria 2888337043 2888343693 870
671 iso_pu_bacteria 2888343758 2888344662 870
672 iso_pu_bacteria 2888350351 2888353503 870
673 iso_pu_bacteria 2889016732 2889019702 870
674 iso_pu_bacteria 2896384573 2896390198 870
675 iso_pu_bacteria 2903448605 2903453739 870
676 iso_pu_bacteria 2903492973 2903494333 870
677 iso_pu_bacteria 2903492973 2903499840 870
678 iso_pu_bacteria 2903513507 2903514685 870
679 iso_pu_bacteria 2903521522 2903525683 870
680 iso_pu_bacteria 2903528002 2903532770 870
681 iso_pu_bacteria 2903540706 2903544962 870
682 iso_pu_bacteria 2904659560 2904665730 870
683 iso_pu_bacteria 2906308376 2906308852 870
684 iso_pu_bacteria 2906321335 2906322132 870
685 iso_pu_bacteria 2906328253 2906333918 870
686 iso_pu_bacteria 2906354277 2906357581 870
687 iso_pu_bacteria 2906363423 2906363423 870
688 iso_pu_bacteria 2906386501 2906390914 870
689 iso_pu_bacteria 2906393657 2906397298 870
690 iso_pu_bacteria 2906401398 2906408081 870
691 iso_pu_bacteria 2906408224 2906408449 870
692 iso_pu_bacteria 2913295892 2913300186 870
693 iso_pu_bacteria 2915980308 2915982417 870
694 iso_pu_bacteria 2915986958 2915992780 870
695 iso_pu_bacteria 2915993759 2915999331 870
696 iso_pu_bacteria 2916000859 2916002827 870
697 iso_pu_bacteria 2916007675 2916010598 870
698 iso_pu_bacteria 2916014648 2916018150 870
699 iso_pu_bacteria 2916021584 2916023826 870
700 iso_pu_bacteria 2916028427 2916034392 870
701 iso_pu_bacteria 2916035215 2916040393 870
702 iso_pu_bacteria 2916041962 2916045065 870
703 iso_pu_bacteria 2916048683 2916050749 870
704 iso_pu_bacteria 2916055098 2916056756 870
705 iso_pu_bacteria 2916061851 2916065003 870
706 iso_pu_bacteria 2916076590 2916077740 870
707 iso_pu_bacteria 2919100787 2919105367 870
708 iso_pu_bacteria 2919408235 2919411052 870
709 iso_pu_bacteria 2920760137 2920760325 870
710 iso_pu_bacteria 2920822456 2920825944 870
711 iso_pu_bacteria 2921201388 2921205447 870
712 iso_pu_bacteria 2921208531 2921215115 870
713 iso_pu_bacteria 2921237296 2921239813 870
714 iso_pu_bacteria 2921244191 2921249034 870
715 iso_pu_bacteria 2921250672 2921252927 870
716 iso_pu_bacteria 2921257292 2921259009 870
717 iso_pu_bacteria 2921263974 2921266343 870
718 iso_pu_bacteria 2921282425 2921286998 870
719 iso_pu_bacteria 2921289301 2921296115 870
720 iso_pu_bacteria 2921296804 2921303394 870
721 iso_pu_bacteria 2922130491 2922135799 870
722 iso_pu_bacteria 2922151315 2922158458 870
723 iso_pu_bacteria 2922158528 2922165395 870
724 iso_pu_bacteria 2922172374 2922176075 870
725 iso_pu_bacteria 2923556063 2923559509 870
726 iso_pu_bacteria 2924144063 2924149543 870
727 iso_pu_bacteria 2924150972 2924153116 870
728 iso_pu_bacteria 2924158325 2924163234 870
729 iso_pu_bacteria 2924165586 2924169670 870
730 iso_pu_bacteria 2924172951 2924174203 870
731 iso_pu_bacteria 2924179722 2924181852 870
732 iso_pu_bacteria 2924186466 2924187847 870
733 iso_pu_bacteria 2924193448 2924193589 870
734 iso_pu_bacteria 2924200457 2924201773 870
735 iso_pu_bacteria 2924207177 2924210310 870
736 iso_pu_bacteria 2924214083 2924219302 870
737 iso_pu_bacteria 2924221636 2924225851 870
738 iso_pu_bacteria 2924228884 2924235315 870
739 iso_pu_bacteria 2924726620 2924728353 870
740 iso_pu_bacteria 2924733363 2924737287 870
741 iso_pu_bacteria 2924741084 2924747614 870
742 iso_pu_bacteria 2924754689 2924760596 870
743 iso_pu_bacteria 2924762789 2924768601 870
744 iso_pu_bacteria 2924776078 2924779823 870
745 iso_pu_bacteria 2924784321 2924790902 870
746 iso_pu_bacteria 2933016740 2933017007 870
747 iso_pu_bacteria 2933570622 2933572379 870
748 iso_pu_bacteria 2933586486 2933593122 870
749 iso_pu_bacteria 2933599457 2933603042 870
750 iso_pu_bacteria 2935894831 2935897924 870
751 iso_pu_bacteria 2935901341 2935903654 870
752 iso_pu_bacteria 2936367885 2936369869 870
753 iso_pu_bacteria 2936375103 2936379055 870
754 iso_pu_bacteria 2936381700 2936381970 870
755 iso_pu_bacteria 2936996657 2936998957 870
756 iso_pu_bacteria 2937002841 2937006620 870
757 iso_pu_bacteria 2937009748 2937015566 870
758 iso_pu_bacteria 2937016420 2937017825 870
759 iso_pu_bacteria 2937023124 2937026026 870
760 iso_pu_bacteria 2937029754 2937031847 870
761 iso_pu_bacteria 2937036028 2937036222 870
762 iso_pu_bacteria 2937042894 2937046028 870
763 iso_pu_bacteria 2937049772 2937051004 870
764 iso_pu_bacteria 2937056579 2937060062 870
765 iso_pu_bacteria 2937063883 2937065127 870
766 iso_pu_bacteria 2937071275 2937077396 870
767 iso_pu_bacteria 2937078374 2937082058 870
768 iso_pu_bacteria 2937084907 2937089996 870
769 iso_pu_bacteria 2937091812 2937098085 870
770 iso_pu_bacteria 2937098957 2937101275 870
771 iso_pu_bacteria 2937106411 2937109128 870
772 iso_pu_bacteria 2937113482 2937115998 870
773 iso_pu_bacteria 2937119839 2937120140 870
774 iso_pu_bacteria 2937126314 2937127735 870
775 iso_pu_bacteria 2937813078 2937822191 870
776 iso_pu_bacteria 2937822353 2937823873 870
777 iso_pu_bacteria 2937848649 2937851686 870
778 iso_pu_bacteria 2937868953 2937874184 870
779 iso_pu_bacteria 2937877337 2937880589 870
780 iso_pu_bacteria 2937891427 2937894375 870
781 iso_pu_bacteria 2937994558 2937998807 870
782 iso_pu_bacteria 2941499720 2941501365 870
783 iso_pu_bacteria 2957375807 2957381817 870
784 iso_pu_bacteria 2957388812 2957395299 870
785 iso_pu_bacteria 2957395598 2957400792 870
786 iso_pu_bacteria 2957408893 2957411816 870
787 iso_pu_bacteria 2957415311 2957416711 870
788 iso_pu_bacteria 2957422303 2957428726 870
789 iso_pu_bacteria 2957430029 2957432019 870
790 iso_pu_bacteria 2957437181 2957442076 870
791 iso_pu_bacteria 2957443900 2957450299 870
792 iso_pu_bacteria 2957450854 2957451361 870
793 iso_pu_bacteria 2957457609 2957460896 870
794 iso_pu_bacteria 2957464669 2957470928 870
795 iso_pu_bacteria 2957471148 2957474160 870
796 iso_pu_bacteria 2957478035 2957479364 870
797 iso_pu_bacteria 2957484790 2957489732 870
798 iso_pu_bacteria 2957491536 2957494539 870
799 iso_pu_bacteria 2957498199 2957504933 870
800 iso_pu_bacteria 2957505466 2957512217 870
801 iso_pu_bacteria 2958034702 2958035190 870
802 iso_pu_bacteria 2958041894 2958044222 870
803 iso_pu_bacteria 2958084443 2958087722 870
804 iso_pu_bacteria 2958092219 2958099881 870
805 iso_pu_bacteria 2958100919 2958102813 870
806 iso_pu_bacteria 2958108152 2958115099 870
807 iso_pu_bacteria 2958115193 2958120394 870
808 iso_pu_bacteria 2958122699 2958130215 870
809 iso_pu_bacteria 2958130278 2958130685 870
810 iso_pu_bacteria 2958137437 2958142057 870
811 iso_pu_bacteria 2958165035 2958169282 870
812 iso_pu_bacteria 2958172287 2958177308 870
813 iso_pu_bacteria 2958179912 2958180024 870
814 iso_pu_bacteria 2960584000 2960585368 870
815 iso_pu_bacteria 2960591022 2960592246 870
816 iso_pu_bacteria 2960597568 2960598001 870
817 iso_pu_bacteria 2960603979 2960609774 870
818 iso_pu_bacteria 2960610863 2960613287 870
819 iso_pu_bacteria 2960617483 2960618310 870
820 iso_pu_bacteria 2960624210 2960628487 870
821 iso_pu_bacteria 2960631154 2960633802 870
822 iso_pu_bacteria 2960637947 2960643785 870
823 iso_pu_bacteria 2960645483 2960647563 870
824 iso_pu_bacteria 2960652885 2960659392 870
825 iso_pu_bacteria 2960660292 2960666837 870
826 iso_pu_bacteria 2960667422 2960673186 870
827 iso_pu_bacteria 2960674078 2960674612 870
828 iso_pu_bacteria 2960680706 2960682353 870
829 iso_pu_bacteria 2960687367 2960691594 870
830 iso_pu_bacteria 2960693952 2960698221 870
831 iso_pu_bacteria 2961077736 2961077851 870
832 iso_pu_bacteria 2961114664 2961121073 870
833 iso_pu_bacteria 2961163497 2961167744 870
834 iso_pu_bacteria 2961170736 2961177368 870
835 iso_pu_bacteria 2961183825 2961185085 870
836 iso_pu_bacteria 2963644680 2963645615 870
837 iso_pu_bacteria 2964607997 2964609513 870
838 iso_pu_bacteria 2964615318 2964619366 870
839 iso_pu_bacteria 2964621998 2964627101 870
840 iso_pu_bacteria 2964628898 2964633241 870
841 iso_pu_bacteria 2964636051 2964641602 870
842 iso_pu_bacteria 2964643177 2964648844 870
843 iso_pu_bacteria 2964649959 2964656292 870
844 iso_pu_bacteria 2964656573 2964659597 870
845 iso_pu_bacteria 2964678106 2964681254 870
846 iso_pu_bacteria 2964685014 2964686134 870
847 iso_pu_bacteria 2964691889 2964695039 870
848 iso_pu_bacteria 2964698721 2964702439 870
849 iso_pu_bacteria 2964705432 2964705922 870
850 iso_pu_bacteria 2964712639 2964712764 870
851 iso_pu_bacteria 2964719344 2964726701 870
852 iso_pu_bacteria 2965018300 2965022563 870
853 iso_pu_bacteria 2965025482 2965026681 870
854 iso_pu_bacteria 2965040258 2965040524 870
855 iso_pu_bacteria 2965047637 2965047918 870
856 iso_pu_bacteria 2965062239 2965065079 870
857 iso_pu_bacteria 2965089291 2965093547 870
858 iso_pu_bacteria 2965119406 2965121105 870
859 iso_pu_bacteria 2967664464 2967670613 870
860 iso_pu_bacteria 2967671571 2967678279 870
861 iso_pu_bacteria 2967678726 2967681720 870
862 iso_pu_bacteria 2967686174 2967690237 870
863 iso_pu_bacteria 2967693043 2967699296 870
864 iso_pu_bacteria 2967699805 2967705974 870
865 iso_pu_bacteria 2967706974 2967713298 870
866 iso_pu_bacteria 2967714385 2967718985 870
867 iso_pu_bacteria 2967721400 2967723896 870
868 iso_pu_bacteria 2967728569 2967730836 870
869 iso_pu_bacteria 2967735183 2967738360 870
870 iso_pu_bacteria 2967742019 2967748313 870
871 iso_pu_bacteria 2967748971 2967753955 870
872 iso_pu_bacteria 2967755722 2967761915 870
873 iso_pu_bacteria 2967769361 2967775604 870
874 iso_pu_bacteria 2967775926 2967776596 870
875 iso_pu_bacteria 2967996073 2968002473 870
876 iso_pu_bacteria 2968003550 2968009704 870
877 iso_pu_bacteria 2968016561 2968023610 870
878 iso_pu_bacteria 2968083720 2968085049 870
879 iso_pu_bacteria 2968091066 2968093505 870
880 iso_pu_bacteria 2968097103 2968100223 870
881 iso_pu_bacteria 2968110612 2968117223 870
882 iso_pu_bacteria 2968117919 2968122361 870
883 iso_pu_bacteria 2968128360 2968129628 870
884 iso_pu_bacteria 2968138860 2968144748 870
885 iso_pu_bacteria 2968171901 2968176145 870
886 iso_pu_bacteria 2970019648 2970023628 870
887 iso_pu_bacteria 2970026789 2970029548 870
888 iso_pu_bacteria 2970033650 2970034499 870
889 iso_pu_bacteria 2970040964 2970044915 870
890 iso_pu_bacteria 2970047711 2970052444 870
891 iso_pu_bacteria 2970054988 2970058940 870
892 iso_pu_bacteria 2970061556 2970062041 870
893 iso_pu_bacteria 2970068827 2970070221 870
894 iso_pu_bacteria 2970076120 2970082671 870
895 iso_pu_bacteria 2970082768 2970086267 870
896 iso_pu_bacteria 2970088815 2970092847 870
897 iso_pu_bacteria 2970095765 2970096724 870
898 iso_pu_bacteria 2970102677 2970105366 870
899 iso_pu_bacteria 2970109326 2970112981 870
900 iso_pu_bacteria 2970116247 2970116835 870
901 iso_pu_bacteria 2970122695 2970128919 870
902 iso_pu_bacteria 2970129317 2970133625 870
903 iso_pu_bacteria 2970136068 2970140961 870
904 iso_pu_bacteria 2970143518 2970143591 870
905 iso_pu_bacteria 2970149975 2970152924 870
906 iso_pu_bacteria 2970156795 2970158004 870
907 iso_pu_bacteria 2970164137 2970170858 870
908 iso_pu_bacteria 2970170962 2970174731 870
909 iso_pu_bacteria 2970177841 2970178123 870
910 iso_pu_bacteria 2970184632 2970187347 870
911 iso_pu_bacteria 2970191845 2970192211 870
912 iso_pu_bacteria 2970469710 2970476192 870
913 iso_pu_bacteria 2970489779 2970493793 870
914 iso_pu_bacteria 2970503327 2970510042 870
915 iso_pu_bacteria 2970524798 2970526391 870
916 iso_pu_bacteria 2970547951 2970551945 870
917 iso_pu_bacteria 2970554993 2970559113 870
918 iso_pu_bacteria 2970593180 2970594212 870
919 iso_pu_bacteria 2970619444 2970621890 870
920 iso_pu_bacteria 2977516862 2977520042 870
921 iso_pu_bacteria 2977523885 2977525536 870
922 iso_pu_bacteria 2977530762 2977535071 870
923 iso_pu_bacteria 2977544691 2977550616 870
924 iso_pu_bacteria 2977551784 2977553192 870
925 iso_pu_bacteria 2977558990 2977562166 870
926 iso_pu_bacteria 2977565890 2977571207 870
927 iso_pu_bacteria 2977572785 2977573730 870
928 iso_pu_bacteria 2977579622 2977582931 870
929 iso_pu_bacteria 2977821940 2977828620 870
930 iso_pu_bacteria 2977828996 2977832601 870
931 iso_pu_bacteria 2977843712 2977844312 870
932 iso_pu_bacteria 2977851361 2977854343 870
933 iso_pu_bacteria 2977858184 2977862084 870
934 iso_pu_bacteria 2977864932 2977865665 870
935 iso_pu_bacteria 2977872689 2977874343 870
936 iso_pu_bacteria 2977898635 2977904910 870
937 iso_pu_bacteria 2977915119 2977915683 870
938 iso_pu_bacteria 2977922695 2977929542 870
939 iso_pu_bacteria 2977935797 2977938958 870
940 iso_pu_bacteria 2977942078 2977942435 870
941 iso_pu_bacteria 2977950692 2977953544 870
942 iso_pu_bacteria 2977957713 2977964937 870
943 iso_pu_bacteria 2977971508 2977978370 870
944 iso_pu_bacteria 2979710463 2979712952 870
945 iso_pu_bacteria 2979764755 2979767620 870
946 iso_pu_bacteria 2979772303 2979776826 870
947 iso_pu_bacteria 2979779861 2979784495 870
948 iso_pu_bacteria 2979793036 2979798295 870
949 iso_pu_bacteria 2979808191 2979814918 870
950 iso_pu_bacteria 2987636660 2987641825 870
951 iso_pu_bacteria 2987652177 2987657885 870
952 iso_pu_bacteria 2987659509 2987663751 870
953 iso_pu_bacteria 2987666974 2987673330 870
954 iso_pu_bacteria 2996310559 2996315200 870
955 iso_pu_bacteria 2996348954 2996354776 870
956 iso_pu_bacteria 2996386984 2996389818 870
957 iso_pu_bacteria 2996887358 2996890221 870
958 iso_pu_bacteria 3004188549 3004192808 870
959 iso_pu_bacteria 3004195979 3004200081 870
960 iso_pu_bacteria 3004203850 3004209363 870
961 iso_pu_bacteria 3004211236 3004218396 870
962 iso_pu_bacteria 3004218560 3004219507 870
963 iso_pu_bacteria 3004232784 3004233718 870
964 iso_pu_bacteria 3004239961 3004243462 870
965 iso_pu_bacteria 3004248173 3004252162 870
966 iso_pu_bacteria 3004268573 3004269430 870
967 iso_pu_bacteria 3004275668 3004281424 870
968 iso_pu_bacteria 3004334049 3004336976 870
969 iso_pu_bacteria 3005409236 3005415778 870
970 iso_pu_bacteria 3005416602 3005421637 870
971 iso_pu_bacteria 3005445848 3005449640 870
972 iso_pu_bacteria 3005452660 3005455923 870
973 iso_pu_bacteria 637000159 637076697 870
974 iso_pu_bacteria 639633055 639650413 870
975 iso_pu_bacteria 643692032 643827425 870
976 iso_pu_bacteria 648276728 648737208 870
977 iso_pu_bacteria 649633066 649870838 870
978 iso_pu_bacteria 8003992118 8003995350 870
979 iso_pu_bacteria 8003999396 8004003091 870
980 iso_pu_bacteria 8004300914 8004301658 870
981 iso_pu_bacteria 8004312739 8004316225 870
982 iso_pu_bacteria 8004374579 8004381597 870
983 iso_pu_bacteria 8004387939 8004388688 870
984 iso_pu_bacteria 8004445564 8004448268 870
985 iso_pu_bacteria 8004640170 8004646528 870
986 iso_pu_bacteria 8004703790 8004706449 870
987 iso_pu_bacteria 8004714634 8004715108 870
988 iso_pu_bacteria 8004727605 8004729359 870
989 iso_pu_bacteria 8005258706 8005262405 870
990 iso_pu_bacteria 8005275841 8005282413 870
991 iso_pu_bacteria 8005282627 8005286768 870
992 iso_pu_bacteria 8005289223 8005295064 870
993 iso_pu_bacteria 8005307578 8005313679 870
994 iso_pu_bacteria 8005314921 8005319658 870
995 iso_pu_bacteria 8005321885 8005324748 870
996 iso_pu_bacteria 8005376324 8005381587 870
997 iso_pu_bacteria 8005430974 8005431086 870
998 iso_pu_bacteria 8005460587 8005465077 870
999 iso_pu_bacteria 8005484373 8005490281 870
1000 iso_pu_bacteria 8005497431 8005497654 870
1001 iso_pu_bacteria 8005542996 8005546652 870
1002 iso_pu_bacteria 8005556819 8005561152 870
1003 iso_pu_bacteria 8005563573 8005565777 870
1004 iso_pu_bacteria 8005570704 8005571824 870
1005 iso_pu_bacteria 8005619151 8005623388 870
1006 iso_pu_bacteria 8005626139 8005631032 870
1007 iso_pu_bacteria 8005668836 8005669059 870
1008 iso_pu_bacteria 8005695170 8005695714 870
1009 iso_pu_bacteria 8018163183 8018165110 870
1010 iso_pu_bacteria 8018176218 8018177131 870
1011 iso_pu_bacteria 8023680758 8023686518 870
1012 iso_pu_bacteria 8024479707 8024484351 870
1013 iso_pu_bacteria 8024486573 8024490831 870
1014 iso_pu_bacteria 8024501048 8024502344 870
1015 iso_pu_bacteria 8046767195 8046767212 870
1016 iso_pu_bacteria 8049293176 8049296299 870
1017 iso_pu_bacteria 8055617313 8055618212 870
1018 iso_pu_bacteria 8056375014 8056380395 870
1019 iso_pu_bacteria 8056382006 8056385226 870
1020 iso_pu_bacteria 8057575449 8057581598 870
1021 iso_pu_bacteria 8057874678 8057879268 870
1022 3300005335 Ga0070666_10001504 Ga0070666_100015043 871
1023 3300005434 Ga0070709_10001621 Ga0070709_100016213 871
1024 3300005436 Ga0070713_100000587 Ga0070713_10000058716 871
1025 3300005455 Ga0070663_100023208 Ga0070663_1000232082 871
1026 3300005458 Ga0070681_10010394 Ga0070681_100103942 871
1027 3300005458 Ga0070681_10067484 Ga0070681_100674842 871
1028 3300005546 Ga0070696_100001761 Ga0070696_10000176112 871
1029 3300005548 Ga0070665_100032718 Ga0070665_1000327183 871
1030 3300005577 Ga0068857_100002165 Ga0068857_1000021656 871
1031 3300005842 Ga0068858_100009375 Ga0068858_1000093759 871
1032 3300005843 Ga0068860_100038317 Ga0068860_1000383173 871
1033 3300005981 Ga0081538_10004680 Ga0081538_100046805 871
1034 3300005981 Ga0081538_10007657 Ga0081538_100076575 871
1035 3300006237 Ga0097621_100010944 Ga0097621_1000109443 871
1036 3300006358 Ga0068871_100003786 Ga0068871_1000037863 871
1037 3300006358 Ga0068871_100009483 Ga0068871_1000094832 871
1038 3300006881 Ga0068865_100006931 Ga0068865_1000069315 871
1039 3300009093 Ga0105240_10002574 Ga0105240_1000257416 871
1040 3300009093 Ga0105240_10085818 Ga0105240_100858182 871
1041 3300009174 Ga0105241_10015185 Ga0105241_100151852 871
1042 3300009176 Ga0105242_10019516 Ga0105242_100195162 871
1043 3300009177 Ga0105248_10024434 Ga0105248_100244342 871
1044 3300009177 Ga0105248_10046868 Ga0105248_100468681 871
1045 3300009545 Ga0105237_10000250 Ga0105237_1000025062 871
1046 3300009545 Ga0105237_10016801 Ga0105237_100168012 871
1047 3300009551 Ga0105238_10008064 Ga0105238_100080648 871
1048 3300010375 Ga0105239_10005447 Ga0105239_100054478 871
1049 3300013104 Ga0157370_10007986 Ga0157370_100079862 871
1050 3300013105 Ga0157369_10004030 Ga0157369_1000403015 871
1051 3300013296 Ga0157374_10002948 Ga0157374_100029487 871
1052 3300013306 Ga0163162_10008969 Ga0163162_1000896911 871
1053 3300013306 Ga0163162_10017318 Ga0163162_100173185 871
1054 3300013307 Ga0157372_10045278 Ga0157372_100452783 871
1055 3300014325 Ga0163163_10008694 Ga0163163_100086943 871
1056 3300014969 Ga0157376_10004307 Ga0157376_100043077 871
1057 3300025250 Ga0209026_1000234 Ga0209026_100023413 871
1058 3300025256 Ga0209759_1001409 Ga0209759_100140910 871
1059 3300025272 Ga0209455_1001020 Ga0209455_10010205 871
1060 3300025906 Ga0207699_10000255 Ga0207699_1000025520 871
1061 3300025911 Ga0207654_10004828 Ga0207654_100048285 871
1062 3300025913 Ga0207695_10000869 Ga0207695_1000086939 871
1063 3300025913 Ga0207695_10047319 Ga0207695_100473193 871
1064 3300025914 Ga0207671_10000116 Ga0207671_1000011645 871
1065 3300025919 Ga0207657_10010361 Ga0207657_100103614 871
1066 3300025928 Ga0207700_10003188 Ga0207700_100031882 871
1067 3300025981 Ga0207640_10002602 Ga0207640_100026022 871
1068 3300026035 Ga0207703_10001507 Ga0207703_1000150716 871
1069 3300026035 Ga0207703_10012078 Ga0207703_100120785 871
1070 3300026067 Ga0207678_10010970 Ga0207678_100109708 871
1071 3300026089 Ga0207648_10010217 Ga0207648_100102172 871
1072 3300026116 Ga0207674_10005139 Ga0207674_1000513910 871
1073 3300028381 Ga0268264_10015015 Ga0268264_100150153 871
1074 3300028800 Ga0265338_10011054 Ga0265338_100110544 871
1075 3300031251 Ga0265327_10009687 Ga0265327_100096873 871
1076 3300031711 Ga0265314_10001088 Ga0265314_1000108828 871
1077 3300035695 Ga0373927_0010318 Ga0373927_0010318_1817_4495 871
1078 3300035724 Ga0373933_0008302 Ga0373933_0008302_770_3448 871
1079 3300035725 Ga0373947_0012727 Ga0373947_0012727_106_2784 871
1080 3300042876 Ga0451577_0010389 Ga0451577_0010389_785_3526 871
1081 3300044712 Ga0453684_0000012 Ga0453684_0000012_98431_101172 871
1082 3300049822 Ga0501035_0000042 Ga0501035_0000042_70887_73586 871
1083 iso_pu_bacteria 2510461069 2510843331 871
1084 iso_pu_bacteria 2510917026 2511169784 871
1085 iso_pu_bacteria 2537561587 2537873837 871
1086 iso_pu_bacteria 2554235003 2554248849 871
1087 iso_pu_bacteria 2558860242 2559295937 871
1088 iso_pu_bacteria 2585427633 2585997761 871
1089 iso_pu_bacteria 2585427634 2586002345 871
1090 iso_pu_bacteria 2599185210 2599603272 871
1091 iso_pu_bacteria 2599185236 2599720315 871
1092 iso_pu_bacteria 2600254933 2600373254 871
1093 iso_pu_bacteria 2600255279 2601610823 871
1094 iso_pu_bacteria 2600255308 2601747597 871
1095 iso_pu_bacteria 2643221568 2643855061 871
1096 iso_pu_bacteria 2643221582 2643921462 871
1097 iso_pu_bacteria 2643221653 2644299822 871
1098 iso_pu_bacteria 2643221693 2644521515 871
1099 iso_pu_bacteria 2643221719 2644658049 871
1100 iso_pu_bacteria 2657244999 2657682406 871
1101 iso_pu_bacteria 2693429783 2694631636 871
1102 iso_pu_bacteria 2738541317 2738947074 871
1103 iso_pu_bacteria 2775507049 2776915615 871
1104 iso_pu_bacteria 2802429268 2804753701 871
1105 iso_pu_bacteria 2808606387 2808988239 871
1106 iso_pu_bacteria 2818991272 2819244608 871
1107 iso_pu_bacteria 2818991439 2819560947 871
1108 iso_pu_bacteria 2821123053 2821128708 871
1109 iso_pu_bacteria 2838675328 2838678690 871
1110 iso_pu_bacteria 2838714209 2838718221 871
1111 iso_pu_bacteria 2838719591 2838722987 871
1112 iso_pu_bacteria 2838724970 2838728288 871
1113 iso_pu_bacteria 2838736955 2838741725 871
1114 iso_pu_bacteria 2841840854 2841845441 871
1115 iso_pu_bacteria 2841846520 2841850543 871
1116 iso_pu_bacteria 2841859092 2841863205 871
1117 iso_pu_bacteria 2842124991 2842128947 871
1118 iso_pu_bacteria 2842130223 2842133582 871
1119 iso_pu_bacteria 2842140634 2842145144 871
1120 iso_pu_bacteria 2842152218 2842155506 871
1121 iso_pu_bacteria 2842170452 2842174537 871
1122 iso_pu_bacteria 2842175837 2842179196 871
1123 iso_pu_bacteria 2842187318 2842190645 871
1124 iso_pu_bacteria 2842211629 2842215031 871
1125 iso_pu_bacteria 2842224351 2842227752 871
1126 iso_pu_bacteria 2842515876 2842520057 871
1127 iso_pu_bacteria 2854896431 2854897107 871
1128 iso_pu_bacteria 2854916844 2854919464 871
1129 iso_pu_bacteria 2857531043 2857534139 871
1130 iso_pu_bacteria 2889790730 2889793091 871
1131 iso_pu_bacteria 2889914905 2889917338 871
1132 iso_pu_bacteria 2891373044 2891377924 871
1133 iso_pu_bacteria 2899792073 2899795305 871
1134 iso_pu_bacteria 2899803654 2899808058 871
1135 iso_pu_bacteria 2899845264 2899849285 871
1136 iso_pu_bacteria 2913308742 2913312097 871
1137 iso_pu_bacteria 2919114240 2919118521 871
1138 iso_pu_bacteria 2919166419 2919170605 871
1139 iso_pu_bacteria 2919171160 2919175807 871
1140 iso_pu_bacteria 2926754445 2926755051 871
1141 iso_pu_bacteria 2926760298 2926762210 871
1142 iso_pu_bacteria 2929138655 2929141852 871
1143 iso_pu_bacteria 2929138655 2929143822 871
1144 iso_pu_bacteria 2933006813 2933010644 871
1145 iso_pu_bacteria 2933011516 2933015684 871
1146 iso_pu_bacteria 2933594066 2933597576 871
1147 iso_pu_bacteria 2979089926 2979092520 871
1148 iso_pu_bacteria 2979095461 2979100089 871
1149 iso_pu_bacteria 2979100975 2979104491 871
1150 iso_pu_bacteria 2984509177 2984513714 871
1151 iso_pu_bacteria 2984518228 2984522708 871
1152 iso_pu_bacteria 2984537506 2984542014 871
1153 iso_pu_bacteria 2984601300 2984601444 871
1154 iso_pu_bacteria 2989349275 2989354961 871
1155 iso_pu_bacteria 2989771324 2989771618 871
1156 iso_pu_bacteria 2989776772 2989780136 871
1157 iso_pu_bacteria 3003930520 3003931026 871
1158 iso_pu_bacteria 650716007 650741150 871
1159 iso_pu_bacteria 8003570095 8003573790 871
1160 iso_pu_bacteria 8005246636 8005249277 871
1161 iso_pu_bacteria 8054460903 8054463816 871
1162 iso_pu_bacteria 8054558443 8054561778 871
1163 iso_pu_bacteria 8056875544 8056878241 871
1164 3300003578 Ga0006562J51391_1004873 Ga0006562J51391_10048731 872
1165 3300003578 Ga0006562J51391_1010770 Ga0006562J51391_10107701 872
1166 3300005539 Ga0068853_100014905 Ga0068853_1000149054 872
1167 3300005981 Ga0081538_10000127 Ga0081538_1000012735 872
1168 3300014968 Ga0157379_10031526 Ga0157379_100315264 872
1169 3300026041 Ga0207639_10010598 Ga0207639_100105982 872
1170 3300028654 Ga0265322_10000891 Ga0265322_1000089111 872
1171 3300028800 Ga0265338_10000290 Ga0265338_1000029032 872
1172 3300028800 Ga0265338_10035168 Ga0265338_100351682 872
1173 3300031691 Ga0316579_10000066 Ga0316579_1000006615 872
1174 3300031727 Ga0316576_10000101 Ga0316576_1000010114 872
1175 3300031727 Ga0316576_10000256 Ga0316576_100002566 872
1176 3300031727 Ga0316576_10005983 Ga0316576_100059833 872
1177 3300031727 Ga0316576_10039824 Ga0316576_100398242 872
1178 3300031728 Ga0316578_10000577 Ga0316578_100005774 872
1179 3300031728 Ga0316578_10021233 Ga0316578_100212332 872
1180 3300031730 Ga0307516_10000338 Ga0307516_100003384 872
1181 3300031733 Ga0316577_10001229 Ga0316577_100012299 872
1182 3300031733 Ga0316577_10002235 Ga0316577_100022353 872
1183 3300032133 Ga0316583_10000244 Ga0316583_100002442 872
1184 3300032137 Ga0316585_10000045 Ga0316585_100000458 872
1185 3300032137 Ga0316585_10000216 Ga0316585_100002164 872
1186 3300032139 Ga0316580_10000002 Ga0316580_1000000235 872
1187 3300032139 Ga0316580_10000052 Ga0316580_100000524 872
1188 3300032168 Ga0316593_10004418 Ga0316593_100044182 872
1189 3300033541 Ga0316596_1000300 Ga0316596_10003006 872
1190 3300035398 Ga0316574_0000424 Ga0316574_0000424_6074_8734 872
1191 3300036647 Ga0316582_0000425 Ga0316582_0000425_6747_9407 872
1192 3300036712 Ga0316584_0000582 Ga0316584_0000582_6016_8781 872
1193 3300036712 Ga0316584_0003931 Ga0316584_0003931_807_3467 872
1194 3300036712 Ga0316584_0029151 Ga0316584_0029151_229_2925 872
1195 3300037471 Ga0395905_0000173 Ga0395905_0000173_62354_65059 872
1196 3300038725 Ga0400484_37546 Ga0400484_37546_9231_11927 872
1197 3300044656 Ga0466969_0000530 Ga0466969_0000530_2089_4791 872
1198 3300044719 Ga0466971_0005304 Ga0466971_0005304_706_3408 872
1199 3300045049 Ga0466959_0000040 Ga0466959_0000040_37815_40517 872
1200 3300045051 Ga0451576_0002267 Ga0451576_0002267_14332_17058 872
1201 3300048912 Ga0496109_0016941 Ga0496109_0016941_1218_4076 872
1202 3300048916 Ga0496113_0003033 Ga0496113_0003033_2658_5516 872
1203 3300048922 Ga0496119_0011551 Ga0496119_0011551_3025_5712 872
1204 3300049568 Ga0501031_0013643 Ga0501031_0013643_23_2800 872
1205 3300049580 Ga0501046_0016381 Ga0501046_0016381_625_3402 872
1206 3300049742 Ga0501080_0032747 Ga0501080_0032747_696_3473 872
1207 3300049824 Ga0501045_0011093 Ga0501045_0011093_1699_4476 872
1208 3300060353 Ga0501082_0047503 Ga0501082_0047503_545_3322 872
1209 iso_pu_bacteria 2857465823 2857472254 872
1210 3300002705 JGI25156J39149_1005416 JGI25156J39149_10054162 873
1211 3300002739 JGI25158J39367_1000061 JGI25158J39367_10000611 873
1212 3300002739 JGI25158J39367_1001103 JGI25158J39367_10011032 873
1213 3300002741 JGI25157J39369_1003070 JGI25157J39369_10030702 873
1214 3300002773 JGI25152J39213_1001961 JGI25152J39213_10019618 873
1215 3300002773 JGI25152J39213_1003057 JGI25152J39213_10030572 873
1216 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003721 873
1217 3300002987 JGI25159J45721_1000017 JGI25159J45721_100001787 873
1218 3300002987 JGI25159J45721_1002330 JGI25159J45721_10023304 873
1219 3300002987 JGI25159J45721_1003781 JGI25159J45721_10037811 873
1220 3300002987 JGI25159J45721_1007745 JGI25159J45721_10077452 873
1221 3300003187 JGI25151J46595_10000220 JGI25151J46595_1000022054 873
1222 3300003187 JGI25151J46595_10000264 JGI25151J46595_1000026445 873
1223 3300003187 JGI25151J46595_10004132 JGI25151J46595_100041324 873
1224 3300003214 JGI25165J46597_1000052 JGI25165J46597_1000052193 873
1225 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002797 873
1226 3300003374 JGI25161J50226_1000137 JGI25161J50226_10001371 873
1227 3300003374 JGI25161J50226_1000533 JGI25161J50226_10005332 873
1228 3300003578 Ga0006562J51391_1055027 Ga0006562J51391_10550272 873
1229 3300003578 Ga0006562J51391_1106068 Ga0006562J51391_11060684 873
1230 3300003762 Ga0055542_1000859 Ga0055542_100085919 873
1231 3300003771 Ga0055526_1000443 Ga0055526_100044329 873
1232 3300003771 Ga0055526_1000897 Ga0055526_100089716 873
1233 3300003771 Ga0055526_1001473 Ga0055526_10014737 873
1234 3300003775 Ga0055524_1000328 Ga0055524_10003281 873
1235 3300003775 Ga0055524_1007837 Ga0055524_10078372 873
1236 3300003781 Ga0055536_1001323 Ga0055536_100132310 873
1237 3300003792 Ga0055540_1001660 Ga0055540_100166014 873
1238 3300004625 Ga0055543_1000030 Ga0055543_1000030105 873
1239 3300004625 Ga0055543_1000433 Ga0055543_100043326 873
1240 3300005262 Ga0065165_1000122 Ga0065165_100012287 873
1241 3300005262 Ga0065165_1000497 Ga0065165_100049744 873
1242 3300005262 Ga0065165_1000540 Ga0065165_10005409 873
1243 3300005548 Ga0070665_100020034 Ga0070665_1000200346 873
1244 3300006051 Ga0075364_10009354 Ga0075364_100093543 873
1245 3300009765 Ga0123341_1000009 Ga0123341_100000981 873
1246 3300013105 Ga0157369_10012128 Ga0157369_100121286 873
1247 3300013249 Ga0171463_1004 Ga0171463_1004207 873
1248 3300013250 Ga0171462_1039 Ga0171462_103932 873
1249 3300015690 Ga0183363_1019 Ga0183363_101926 873
1250 3300021320 Ga0214544_1000288 Ga0214544_100028865 873
1251 3300021321 Ga0214542_1000008 Ga0214542_100000883 873
1252 3300021321 Ga0214542_1018989 Ga0214542_10189894 873
1253 3300021327 Ga0214543_1000015 Ga0214543_100001582 873
1254 3300021327 Ga0214543_1000031 Ga0214543_100003114 873
1255 3300022739 Ga0228711_1000004 Ga0228711_1000004113 873
1256 3300022740 Ga0228710_1000002 Ga0228710_100000261 873
1257 3300025208 Ga0209436_100018 Ga0209436_1000188 873
1258 3300025245 Ga0207425_1000034 Ga0207425_100003421 873
1259 3300025250 Ga0209026_1000032 Ga0209026_100003275 873
1260 3300025254 Ga0209148_1000111 Ga0209148_1000111184 873
1261 3300025256 Ga0209759_1000142 Ga0209759_1000142122 873
1262 3300025258 Ga0209129_1000118 Ga0209129_100011837 873
1263 3300025258 Ga0209129_1000253 Ga0209129_100025321 873
1264 3300025258 Ga0209129_1000971 Ga0209129_10009719 873
1265 3300025261 Ga0209233_1000118 Ga0209233_100011872 873
1266 3300025272 Ga0209455_1000223 Ga0209455_100022367 873
1267 3300025273 Ga0209673_1000033 Ga0209673_1000033253 873
1268 3300025273 Ga0209673_1001533 Ga0209673_10015333 873
1269 3300025284 Ga0209130_1000009 Ga0209130_1000009284 873
1270 3300025284 Ga0209130_1000027 Ga0209130_1000027232 873
1271 3300025284 Ga0209130_1000168 Ga0209130_100016847 873
1272 3300025284 Ga0209130_1000930 Ga0209130_10009309 873
1273 3300025292 Ga0209676_1000406 Ga0209676_10004067 873
1274 3300025294 Ga0209025_1000241 Ga0209025_10002415 873
1275 3300025294 Ga0209025_1000357 Ga0209025_100035785 873
1276 3300025294 Ga0209025_1000533 Ga0209025_100053356 873
1277 3300025294 Ga0209025_1000700 Ga0209025_100070039 873
1278 3300025294 Ga0209025_1002217 Ga0209025_100221711 873
1279 3300025294 Ga0209025_1016684 Ga0209025_10166843 873
1280 3300025294 Ga0209025_1024985 Ga0209025_10249851 873
1281 3300025295 Ga0209564_1000580 Ga0209564_100058018 873
1282 3300025295 Ga0209564_1000782 Ga0209564_100078234 873
1283 3300025295 Ga0209564_1000790 Ga0209564_100079018 873
1284 3300025295 Ga0209564_1000919 Ga0209564_10009193 873
1285 3300025297 Ga0209758_1000415 Ga0209758_100041556 873
1286 3300025297 Ga0209758_1001085 Ga0209758_100108522 873
1287 3300025297 Ga0209758_1001086 Ga0209758_100108621 873
1288 3300025297 Ga0209758_1002520 Ga0209758_10025207 873
1289 3300025298 Ga0209050_1000572 Ga0209050_100057223 873
1290 3300025298 Ga0209050_1004422 Ga0209050_10044229 873
1291 3300025299 Ga0209256_1000504 Ga0209256_100050418 873
1292 3300025299 Ga0209256_1000510 Ga0209256_100051060 873
1293 3300025299 Ga0209256_1000695 Ga0209256_100069519 873
1294 3300025299 Ga0209256_1002945 Ga0209256_100294513 873
1295 3300025299 Ga0209256_1003766 Ga0209256_10037665 873
1296 3300025302 Ga0207426_1000041 Ga0207426_1000041222 873
1297 3300025302 Ga0207426_1000072 Ga0207426_100007284 873
1298 3300025303 Ga0209051_1001068 Ga0209051_100106817 873
1299 3300025303 Ga0209051_1002527 Ga0209051_10025271 873
1300 3300025304 Ga0209257_1003532 Ga0209257_10035328 873
1301 3300025925 Ga0207650_10000691 Ga0207650_1000069119 873
1302 3300027111 Ga0209281_1000030 Ga0209281_1000030198 873
1303 3300027111 Ga0209281_1000144 Ga0209281_1000144140 873
1304 3300027666 Ga0209282_1000004 Ga0209282_1000004198 873
1305 3300028794 Ga0307515_10001330 Ga0307515_1000133017 873
1306 3300028794 Ga0307515_10002474 Ga0307515_100024741 873
1307 3300028794 Ga0307515_10040955 Ga0307515_100409552 873
1308 3300031456 Ga0307513_10000463 Ga0307513_100004632 873
1309 3300031691 Ga0316579_10002528 Ga0316579_100025282 873
1310 3300031911 Ga0307412_10000831 Ga0307412_100008312 873
1311 3300031967 Ga0315914_1000001 Ga0315914_1000001185 873
1312 3300032004 Ga0307414_10022551 Ga0307414_100225511 873
1313 3300033430 Ga0315913_1000004 Ga0315913_1000004115 873
1314 3300033464 Ga0315915_1000002 Ga0315915_1000002199 873
1315 3300036647 Ga0316582_0034124 Ga0316582_0034124_57_2720 873
1316 3300037068 Ga0373925_0004023 Ga0373925_0004023_3561_6251 873
1317 3300037312 Ga0395899_0000058 Ga0395899_0000058_205585_208287 873
1318 3300037418 Ga0395900_0000056 Ga0395900_0000056_205613_208315 873
1319 3300037466 Ga0395898_0000114 Ga0395898_0000114_205604_208306 873
1320 3300037471 Ga0395905_0000053 Ga0395905_0000053_4763_7465 873
1321 3300037471 Ga0395905_0028816 Ga0395905_0028816_1058_3748 873
1322 3300038443 Ga0395901_0000037 Ga0395901_0000037_205613_208315 873
1323 3300046463 Ga0495653_0000582 Ga0495653_0000582_20260_23121 873
1324 3300046473 Ga0495582_0012834 Ga0495582_0012834_200_2983 873
1325 3300046512 Ga0495610_0010782 Ga0495610_0010782_2618_5308 873
1326 3300046517 Ga0495630_0007431 Ga0495630_0007431_1165_3948 873
1327 3300046522 Ga0495643_0020322 Ga0495643_0020322_14_2704 873
1328 3300046535 Ga0495586_0004877 Ga0495586_0004877_2432_5215 873
1329 3300046558 Ga0495633_0001326 Ga0495633_0001326_5226_7952 873
1330 3300046683 Ga0495658_0005250 Ga0495658_0005250_3427_6210 873
1331 3300047319 Ga0495674_0023069 Ga0495674_0023069_1151_3934 873
1332 3300047471 Ga0495684_0045340 Ga0495684_0045340_402_3185 873
1333 3300048928 Ga0496125_0005997 Ga0496125_0005997_10355_13081 873
1334 3300049568 Ga0501031_0007395 Ga0501031_0007395_546_3248 873
1335 3300049569 Ga0501032_0000006 Ga0501032_0000006_191135_193837 873
1336 3300049569 Ga0501032_0000194 Ga0501032_0000194_46588_49290 873
1337 3300049569 Ga0501032_0007442 Ga0501032_0007442_3907_6609 873
1338 3300049570 Ga0501033_0000039 Ga0501033_0000039_67891_70593 873
1339 3300049570 Ga0501033_0000077 Ga0501033_0000077_81182_83884 873
1340 3300049570 Ga0501033_0003212 Ga0501033_0003212_4076_6778 873
1341 3300049571 Ga0501034_0000023 Ga0501034_0000023_148258_150960 873
1342 3300049571 Ga0501034_0000030 Ga0501034_0000030_41293_43995 873
1343 3300049571 Ga0501034_0007546 Ga0501034_0007546_4145_6847 873
1344 3300049572 Ga0501036_0000003 Ga0501036_0000003_67891_70593 873
1345 3300049572 Ga0501036_0068255 Ga0501036_0068255_32_2734 873
1346 3300049573 Ga0501037_0000003 Ga0501037_0000003_67891_70593 873
1347 3300049573 Ga0501037_0020395 Ga0501037_0020395_805_3507 873
1348 3300049574 Ga0501038_0000004 Ga0501038_0000004_67891_70593 873
1349 3300049574 Ga0501038_0000040 Ga0501038_0000040_112933_115635 873
1350 3300049574 Ga0501038_0064037 Ga0501038_0064037_32_2734 873
1351 3300049575 Ga0501039_0000008 Ga0501039_0000008_67891_70593 873
1352 3300049575 Ga0501039_0000089 Ga0501039_0000089_18863_21565 873
1353 3300049575 Ga0501039_0006760 Ga0501039_0006760_2120_4822 873
1354 3300049579 Ga0501043_0000019 Ga0501043_0000019_49886_52588 873
1355 3300049579 Ga0501043_0000042 Ga0501043_0000042_96998_99874 873
1356 3300049579 Ga0501043_0000177 Ga0501043_0000177_21591_24293 873
1357 3300049579 Ga0501043_0007371 Ga0501043_0007371_3907_6609 873
1358 3300049581 Ga0501047_0008795 Ga0501047_0008795_2918_5620 873
1359 3300049582 Ga0501048_0002808 Ga0501048_0002808_7610_10312 873
1360 3300049585 Ga0501069_0000001 Ga0501069_0000001_151635_154511 873
1361 3300049586 Ga0501070_0000824 Ga0501070_0000824_23784_26474 873
1362 3300049586 Ga0501070_0002317 Ga0501070_0002317_4466_7156 873
1363 3300049742 Ga0501080_0000964 Ga0501080_0000964_13287_16163 873
1364 3300049742 Ga0501080_0002743 Ga0501080_0002743_7442_10144 873
1365 3300049822 Ga0501035_0000037 Ga0501035_0000037_144919_147795 873
1366 3300049822 Ga0501035_0000112 Ga0501035_0000112_28546_31248 873
1367 3300049822 Ga0501035_0000897 Ga0501035_0000897_21991_24681 873
1368 3300049822 Ga0501035_0003788 Ga0501035_0003788_4076_6778 873
1369 3300049823 Ga0501044_0000008 Ga0501044_0000008_67891_70593 873
1370 3300049823 Ga0501044_0000018 Ga0501044_0000018_77398_80274 873
1371 3300049823 Ga0501044_0005319 Ga0501044_0005319_7611_10313 873
1372 3300053077 Ga0495601_0034974 Ga0495601_0034974_99_2957 873
1373 3300053134 Ga0500658_0000309 Ga0500658_0000309_13800_16490 873
1374 3300053153 Ga0500616_0013222 Ga0500616_0013222_745_3435 873
1375 iso_pu_bacteria 2513237159 2513998469 873
1376 iso_pu_bacteria 2600255286 2601641592 873
1377 iso_pu_bacteria 2615840624 2616296333 873
1378 iso_pu_bacteria 2643221543 2643739653 873
1379 iso_pu_bacteria 2687453341 2688392707 873
1380 iso_pu_bacteria 2751185821 2753462450 873
1381 iso_pu_bacteria 2791355094 2792639979 873
1382 iso_pu_bacteria 2791355260 2793320693 873
1383 iso_pu_bacteria 2791355261 2793327265 873
1384 iso_pu_bacteria 2791355264 2793346582 873
1385 iso_pu_bacteria 2821111986 2821118112 873
1386 iso_pu_bacteria 2857604169 2857607871 873
1387 iso_pu_bacteria 2864733723 2864738507 873
1388 iso_pu_bacteria 2885526491 2885528499 873
1389 iso_pu_bacteria 2889042446 2889043209 873
1390 iso_pu_bacteria 2904162308 2904168416 873
1391 iso_pu_bacteria 2904490793 2904496796 873
1392 iso_pu_bacteria 2909399089 2909401139 873
1393 iso_pu_bacteria 2919160200 2919166070 873
1394 iso_pu_bacteria 2931384279 2931386669 873
1395 iso_pu_bacteria 2939679117 2939684910 873
1396 iso_pu_bacteria 2945991243 2945994723 873
1397 iso_pu_bacteria 2946053406 2946057518 873
1398 iso_pu_bacteria 2957382221 2957384593 873
1399 iso_pu_bacteria 2957402308 2957404438 873
1400 iso_pu_bacteria 2964663802 2964664959 873
1401 iso_pu_bacteria 2977537788 2977544574 873
1402 iso_pu_bacteria 2996336353 2996339464 873
1403 iso_pu_bacteria 2996893221 2996895261 873
1404 iso_pu_bacteria 641228493 641335301 873
1405 iso_pu_bacteria 643348555 643391590 873
1406 iso_pu_bacteria 8005301065 8005305943 873
1407 iso_pu_bacteria 8005382845 8005387791 873
1408 iso_pu_bacteria 8005395548 8005400827 873
1409 iso_pu_bacteria 8005688590 8005694358 873
1410 iso_pu_bacteria 8018127388 8018128891 873
1411 3300003794 Ga0055531_10002987 Ga0055531_100029874 874
1412 3300003856 Ga0058692_1006048 Ga0058692_10060482 874
1413 3300003856 Ga0058692_1007052 Ga0058692_10070521 874
1414 3300005262 Ga0065165_1003519 Ga0065165_10035192 874
1415 3300005543 Ga0070672_100005592 Ga0070672_1000055924 874
1416 3300005548 Ga0070665_100004011 Ga0070665_1000040117 874
1417 3300005614 Ga0068856_100032077 Ga0068856_1000320774 874
1418 3300006042 Ga0075368_10005744 Ga0075368_100057443 874
1419 3300006051 Ga0075364_10000026 Ga0075364_1000002625 874
1420 3300006178 Ga0075367_10023529 Ga0075367_100235292 874
1421 3300006946 Ga0079104_1000195 Ga0079104_100019547 874
1422 3300006948 Ga0099826_10000958 Ga0099826_1000095818 874
1423 3300009148 Ga0105243_10005164 Ga0105243_1000516410 874
1424 3300013102 Ga0157371_10000108 Ga0157371_1000010863 874
1425 3300013104 Ga0157370_10004961 Ga0157370_1000496113 874
1426 3300021384 Ga0213876_10000116 Ga0213876_1000011669 874
1427 3300025225 Ga0209566_100082 Ga0209566_10008228 874
1428 3300025294 Ga0209025_1000042 Ga0209025_1000042232 874
1429 3300025294 Ga0209025_1000487 Ga0209025_100048739 874
1430 3300025297 Ga0209758_1000570 Ga0209758_100057051 874
1431 3300025298 Ga0209050_1004558 Ga0209050_10045589 874
1432 3300025303 Ga0209051_1000917 Ga0209051_10009174 874
1433 3300025304 Ga0209257_1000292 Ga0209257_100029289 874
1434 3300025304 Ga0209257_1001566 Ga0209257_10015662 874
1435 3300025913 Ga0207695_10005366 Ga0207695_1000536613 874
1436 3300025940 Ga0207691_10000880 Ga0207691_1000088018 874
1437 3300027111 Ga0209281_1000028 Ga0209281_1000028398 874
1438 3300027111 Ga0209281_1000028 Ga0209281_100002844 874
1439 3300027312 Ga0209371_1000037 Ga0209371_1000037130 874
1440 3300027866 Ga0209813_10002746 Ga0209813_100027462 874
1441 3300028379 Ga0268266_10006277 Ga0268266_1000627710 874
1442 3300028800 Ga0265338_10010523 Ga0265338_100105232 874
1443 3300028800 Ga0265338_10028104 Ga0265338_100281043 874
1444 3300030500 Ga0268256_1000039 Ga0268256_1000039179 874
1445 3300031251 Ga0265327_10000481 Ga0265327_1000048146 874
1446 3300031727 Ga0316576_10010572 Ga0316576_100105722 874
1447 3300031901 Ga0307406_10012732 Ga0307406_100127323 874
1448 3300031901 Ga0307406_10013394 Ga0307406_100133944 874
1449 3300035113 Ga0373936_0010310 Ga0373936_0010310_659_3481 874
1450 3300037068 Ga0373925_0001892 Ga0373925_0001892_7202_10024 874
1451 3300039437 Ga0436365_1226135 Ga0436365_1226135_8994_11684 874
1452 3300046517 Ga0495630_0006594 Ga0495630_0006594_2227_4935 874
1453 3300048919 Ga0496116_0000057 Ga0496116_0000057_236283_238976 874
1454 3300048920 Ga0496117_0000031 Ga0496117_0000031_149881_152574 874
1455 3300048920 Ga0496117_0008209 Ga0496117_0008209_932_3643 874
1456 3300048922 Ga0496119_0000574 Ga0496119_0000574_41327_44038 874
1457 3300048923 Ga0496120_0001024 Ga0496120_0001024_19332_22043 874
1458 3300048924 Ga0496121_0000034 Ga0496121_0000034_234380_237193 874
1459 3300048925 Ga0496122_0000023 Ga0496122_0000023_149881_152574 874
1460 3300048925 Ga0496122_0000074 Ga0496122_0000074_46371_49064 874
1461 3300048925 Ga0496122_0000286 Ga0496122_0000286_4139_6832 874
1462 3300048925 Ga0496122_0013743 Ga0496122_0013743_1951_4662 874
1463 3300048926 Ga0496123_0000027 Ga0496123_0000027_228462_231155 874
1464 3300048926 Ga0496123_0000062 Ga0496123_0000062_46353_49046 874
1465 3300048926 Ga0496123_0007630 Ga0496123_0007630_3974_6667 874
1466 3300048927 Ga0496124_0000128 Ga0496124_0000128_53357_56068 874
1467 3300048927 Ga0496124_0000174 Ga0496124_0000174_9391_12084 874
1468 3300048927 Ga0496124_0002248 Ga0496124_0002248_3842_6535 874
1469 3300048927 Ga0496124_0005858 Ga0496124_0005858_7931_10744 874
1470 3300048928 Ga0496125_0000030 Ga0496125_0000030_137326_140139 874
1471 3300048928 Ga0496125_0000093 Ga0496125_0000093_201208_203901 874
1472 3300048928 Ga0496125_0008659 Ga0496125_0008659_3731_6424 874
1473 3300048928 Ga0496125_0037180 Ga0496125_0037180_104_2797 874
1474 3300048929 Ga0496126_0000630 Ga0496126_0000630_51913_54624 874
1475 3300048929 Ga0496126_0002917 Ga0496126_0002917_18966_21677 874
1476 3300048929 Ga0496126_0005711 Ga0496126_0005711_1040_3733 874
1477 3300049590 Ga0501074_0043751 Ga0501074_0043751_353_3043 874
1478 3300049742 Ga0501080_0032594 Ga0501080_0032594_2068_4758 874
1479 3300049744 Ga0501083_0009841 Ga0501083_0009841_264_2954 874
1480 3300050491 nmdc:mga00v17_151_c1 nmdc:mga00v17_151_c1_28925_31618 874
1481 3300050493 nmdc:mga0k408_15675_c1 nmdc:mga0k408_15675_c1_789_3470 874
1482 3300050516 nmdc:mga0sz30_107_c1 nmdc:mga0sz30_107_c1_11560_14253 874
1483 3300053140 Ga0500573_0000334 Ga0500573_0000334_6139_8877 874
1484 3300053161 Ga0500634_0005040 Ga0500634_0005040_2752_5445 874
1485 3300053177 Ga0500636_0000040 Ga0500636_0000040_10122_12815 874
1486 3300059643 Ga0587072_000182 Ga0587072_000182_2669_5362 874
1487 iso_pu_bacteria 2510917027 2511178639 874
1488 iso_pu_bacteria 2512564013 2512637780 874
1489 iso_pu_bacteria 2548877040 2550900964 874
1490 iso_pu_bacteria 2571042588 2573036841 874
1491 iso_pu_bacteria 2576861424 2578335093 874
1492 iso_pu_bacteria 2579778775 2580930935 874
1493 iso_pu_bacteria 2619619294 2621273188 874
1494 iso_pu_bacteria 2738543031 2739349286 874
1495 iso_pu_bacteria 2857460504 2857463890 874
1496 iso_pu_bacteria 2857465823 2857469631 874
1497 iso_pu_bacteria 2857591370 2857594978 874
1498 iso_pu_bacteria 2881636855 2881638880 874
1499 iso_pu_bacteria 2898907183 2898908518 874
1500 iso_pu_bacteria 2915597211 2915602951 874
1501 iso_pu_bacteria 2915606848 2915611867 874
1502 iso_pu_bacteria 2929183550 2929188011 874
1503 iso_pu_bacteria 2971511577 2971513901 874
1504 iso_pu_bacteria 2978969890 2978972592 874
1505 iso_pu_bacteria 2980176882 2980178839 874
1506 iso_pu_bacteria 2984587000 2984590844 874
1507 iso_pu_bacteria 8005658619 8005660788 874
1508 3300003203 JGI25406J46586_10002413 JGI25406J46586_100024134 875
1509 3300005327 Ga0070658_10007861 Ga0070658_100078614 875
1510 3300005329 Ga0070683_100055214 Ga0070683_1000552142 875
1511 3300005336 Ga0070680_100010223 Ga0070680_1000102231 875
1512 3300005546 Ga0070696_100018715 Ga0070696_1000187153 875
1513 3300005577 Ga0068857_100031925 Ga0068857_1000319253 875
1514 3300005981 Ga0081538_10032210 Ga0081538_100322102 875
1515 3300011119 Ga0105246_10001663 Ga0105246_100016633 875
1516 3300025233 Ga0209437_100875 Ga0209437_10087511 875
1517 3300025728 Ga0207655_1015226 Ga0207655_10152262 875
1518 3300025909 Ga0207705_10004699 Ga0207705_100046994 875
1519 3300025912 Ga0207707_10018309 Ga0207707_100183093 875
1520 3300025917 Ga0207660_10020884 Ga0207660_100208843 875
1521 3300025949 Ga0207667_10025842 Ga0207667_100258423 875
1522 3300025949 Ga0207667_10045112 Ga0207667_100451122 875
1523 3300028558 Ga0265326_10000282 Ga0265326_100002823 875
1524 3300028563 Ga0265319_1000065 Ga0265319_100006570 875
1525 3300028666 Ga0265336_10000001 Ga0265336_10000001387 875
1526 3300028800 Ga0265338_10000004 Ga0265338_10000004495 875
1527 3300028800 Ga0265338_10013652 Ga0265338_100136524 875
1528 3300031247 Ga0265340_10000002 Ga0265340_10000002495 875
1529 3300031249 Ga0265339_10027210 Ga0265339_100272102 875
1530 3300031691 Ga0316579_10006284 Ga0316579_100062842 875
1531 3300031711 Ga0265314_10012213 Ga0265314_100122136 875
1532 3300031728 Ga0316578_10006786 Ga0316578_100067861 875
1533 3300031733 Ga0316577_10019248 Ga0316577_100192482 875
1534 3300032133 Ga0316583_10007780 Ga0316583_100077802 875
1535 3300032139 Ga0316580_10002978 Ga0316580_100029782 875
1536 3300032139 Ga0316580_10003214 Ga0316580_100032142 875
1537 3300036401 Ga0373937_0018600 Ga0373937_0018600_1303_3999 875
1538 3300036647 Ga0316582_0015074 Ga0316582_0015074_927_3596 875
1539 3300036712 Ga0316584_0012042 Ga0316584_0012042_907_3600 875
1540 3300037418 Ga0395900_0021038 Ga0395900_0021038_834_3521 875
1541 3300037853 Ga0436364_0645242 Ga0436364_0645242_2156_4852 875
1542 3300038443 Ga0395901_0005720 Ga0395901_0005720_118_2805 875
1543 3300038443 Ga0395901_0031927 Ga0395901_0031927_1479_4166 875
1544 3300038443 Ga0395901_0063017 Ga0395901_0063017_1128_3815 875
1545 3300044684 Ga0466966_0003160 Ga0466966_0003160_1034_3790 875
1546 3300044694 Ga0466963_0025428 Ga0466963_0025428_449_3139 875
1547 3300045976 Ga0466967_0022454 Ga0466967_0022454_1645_4335 875
1548 3300046543 Ga0495645_0013938 Ga0495645_0013938_358_3051 875
1549 3300048088 Ga0495602_0006756 Ga0495602_0006756_7243_9936 875
1550 3300048922 Ga0496119_0019252 Ga0496119_0019252_1525_4218 875
1551 3300048923 Ga0496120_0021829 Ga0496120_0021829_511_3204 875
1552 3300048928 Ga0496125_0014528 Ga0496125_0014528_243_2957 875
1553 3300049571 Ga0501034_0003977 Ga0501034_0003977_9313_12000 875
1554 3300049584 Ga0501068_0008324 Ga0501068_0008324_2348_5035 875
1555 3300049587 Ga0501071_0022139 Ga0501071_0022139_1227_3908 875
1556 3300049742 Ga0501080_0076978 Ga0501080_0076978_337_3012 875
1557 3300049823 Ga0501044_0020300 Ga0501044_0020300_2626_5346 875
1558 3300053077 Ga0495601_0002711 Ga0495601_0002711_5702_8395 875
1559 3300053078 Ga0495612_0000791 Ga0495612_0000791_2002_4695 875
1560 3300053153 Ga0500616_0004571 Ga0500616_0004571_2522_5209 875
1561 3300061734 Ga0530510_0007957 Ga0530510_0007957_2950_5631 875
1562 3300003751 Ga0055538_1000432 Ga0055538_10004327 876
1563 3300005548 Ga0070665_100055999 Ga0070665_1000559991 876
1564 3300025224 Ga0209784_100084 Ga0209784_10008469 876
1565 3300025229 Ga0209147_100045 Ga0209147_100045222 876
1566 3300025913 Ga0207695_10004451 Ga0207695_100044516 876
1567 3300037853 Ga0436364_1369139 Ga0436364_1369139_22928_25693 876
1568 3300038443 Ga0395901_0012482 Ga0395901_0012482_5458_8136 876
1569 3300005438 Ga0070701_10010583 Ga0070701_100105832 877
1570 3300005530 Ga0070679_100009439 Ga0070679_1000094397 877
1571 3300005615 Ga0070702_100008999 Ga0070702_1000089993 877
1572 3300005617 Ga0068859_100009927 Ga0068859_1000099275 877
1573 3300005719 Ga0068861_100015134 Ga0068861_1000151345 877
1574 3300006847 Ga0075431_100013496 Ga0075431_1000134968 877
1575 3300006931 Ga0097620_100009927 Ga0097620_1000099274 877
1576 3300025936 Ga0207670_10003425 Ga0207670_100034253 877
1577 3300031691 Ga0316579_10002014 Ga0316579_100020146 877
1578 3300031733 Ga0316577_10013837 Ga0316577_100138372 877
1579 3300031733 Ga0316577_10029790 Ga0316577_100297901 877
1580 3300031852 Ga0307410_10019204 Ga0307410_100192041 877
1581 3300031995 Ga0307409_100025323 Ga0307409_1000253232 877
1582 3300032002 Ga0307416_100056846 Ga0307416_1000568462 877
1583 3300032133 Ga0316583_10004600 Ga0316583_100046002 877
1584 3300032133 Ga0316583_10004687 Ga0316583_100046871 877
1585 3300036647 Ga0316582_0003488 Ga0316582_0003488_3586_6333 877
1586 3300038735 Ga0400485_18202 Ga0400485_18202_17694_20438 877
1587 3300038742 Ga0400486_07668 Ga0400486_07668_3482_6226 877
1588 3300039093 Ga0400489_48198 Ga0400489_48198_6994_9738 877
1589 3300039110 Ga0400487_01716 Ga0400487_01716_796_3540 877
1590 3300021377 Ga0213874_10000562 Ga0213874_100005625 878
1591 3300031456 Ga0307513_10021619 Ga0307513_100216192 878
1592 3300037853 Ga0436364_1085834 Ga0436364_1085834_1530_4250 878
1593 3300039450 Ga0436363_0374921 Ga0436363_0374921_3958_6678 878
1594 3300044673 Ga0453683_0003721 Ga0453683_0003721_8217_10919 878
1595 3300044694 Ga0466963_0002910 Ga0466963_0002910_1002_3758 878
1596 3300045836 Ga0466958_0002550 Ga0466958_0002550_763_3519 878
1597 3300049571 Ga0501034_0006378 Ga0501034_0006378_1679_4372 878
1598 3300049586 Ga0501070_0002736 Ga0501070_0002736_863_3586 878
1599 3300049586 Ga0501070_0014381 Ga0501070_0014381_1987_4680 878
1600 3300049590 Ga0501074_0006547 Ga0501074_0006547_4822_7545 878
1601 3300049742 Ga0501080_0008593 Ga0501080_0008593_5167_7890 878
1602 3300053104 Ga0500556_0000820 Ga0500556_0000820_13135_15975 878
1603 3300053153 Ga0500616_0003092 Ga0500616_0003092_5282_8134 878
1604 3300005331 Ga0070670_100016229 Ga0070670_1000162293 879
1605 3300005333 Ga0070677_10000831 Ga0070677_100008316 879
1606 3300005356 Ga0070674_100022285 Ga0070674_1000222852 879
1607 3300005356 Ga0070674_100032568 Ga0070674_1000325682 879
1608 3300005364 Ga0070673_100005639 Ga0070673_1000056394 879
1609 3300005543 Ga0070672_100037438 Ga0070672_1000374382 879
1610 3300005548 Ga0070665_100002927 Ga0070665_10000292712 879
1611 3300005937 Ga0081455_10003780 Ga0081455_100037802 879
1612 3300006871 Ga0075434_100007374 Ga0075434_1000073745 879
1613 3300025893 Ga0207682_10002063 Ga0207682_100020638 879
1614 3300025940 Ga0207691_10002557 Ga0207691_1000255716 879
1615 3300025940 Ga0207691_10003484 Ga0207691_1000348414 879
1616 3300031456 Ga0307513_10019269 Ga0307513_100192696 879
1617 3300031456 Ga0307513_10033220 Ga0307513_100332202 879
1618 3300031548 Ga0307408_100023928 Ga0307408_1000239283 879
1619 3300031852 Ga0307410_10002347 Ga0307410_100023472 879
1620 3300031903 Ga0307407_10001682 Ga0307407_100016825 879
1621 3300031995 Ga0307409_100001793 Ga0307409_1000017939 879
1622 3300032002 Ga0307416_100020269 Ga0307416_1000202692 879
1623 3300032005 Ga0307411_10004134 Ga0307411_100041343 879
1624 3300044712 Ga0453684_0009317 Ga0453684_0009317_11698_14415 879
1625 3300046694 Ga0495649_0016037 Ga0495649_0016037_236_2923 879
1626 3300049573 Ga0501037_0022418 Ga0501037_0022418_244_2997 879
1627 3300049589 Ga0501073_0003926 Ga0501073_0003926_7398_10085 879
1628 3300049742 Ga0501080_0010368 Ga0501080_0010368_477_3164 879
1629 3300050512 nmdc:mga0n895_13448_c1 nmdc:mga0n895_13448_c1_1428_4217 879
1630 3300050515 nmdc:mga0a205_5739_c2 nmdc:mga0a205_5739_c2_4273_7062 879
1631 3300005548 Ga0070665_100008086 Ga0070665_1000080864 880
1632 3300005563 Ga0068855_100013527 Ga0068855_1000135276 880
1633 3300021388 Ga0213875_10000001 Ga0213875_100000011114 880
1634 3300025949 Ga0207667_10010025 Ga0207667_100100255 880
1635 3300028379 Ga0268266_10008708 Ga0268266_100087083 880
1636 3300028794 Ga0307515_10020925 Ga0307515_100209256 880
1637 3300031507 Ga0307509_10013106 Ga0307509_100131063 880
1638 3300031616 Ga0307508_10039631 Ga0307508_100396312 880
1639 3300031730 Ga0307516_10002711 Ga0307516_1000271122 880
1640 3300037853 Ga0436364_0273345 Ga0436364_0273345_1157350_1160094 880
1641 3300042876 Ga0451577_0000001 Ga0451577_0000001_2317526_2320252 880
1642 3300053104 Ga0500556_0001863 Ga0500556_0001863_166_2856 880
1643 iso_pu_bacteria 2687453129 2687577705 880
1644 3300005289 Ga0065704_10071233 Ga0065704_100712332 881
1645 3300005295 Ga0065707_10083199 Ga0065707_100831999 881
1646 3300005328 Ga0070676_10024117 Ga0070676_100241172 881
1647 3300005330 Ga0070690_100002816 Ga0070690_1000028166 881
1648 3300005334 Ga0068869_100003115 Ga0068869_1000031157 881
1649 3300005335 Ga0070666_10000800 Ga0070666_100008002 881
1650 3300005341 Ga0070691_10005655 Ga0070691_100056551 881
1651 3300005347 Ga0070668_100009150 Ga0070668_1000091505 881
1652 3300005356 Ga0070674_100000287 Ga0070674_1000002873 881
1653 3300005356 Ga0070674_100017333 Ga0070674_1000173332 881
1654 3300005367 Ga0070667_100011688 Ga0070667_1000116882 881
1655 3300005435 Ga0070714_100003528 Ga0070714_1000035283 881
1656 3300005440 Ga0070705_100001663 Ga0070705_1000016636 881
1657 3300005444 Ga0070694_100015394 Ga0070694_1000153945 881
1658 3300005456 Ga0070678_100008486 Ga0070678_1000084865 881
1659 3300005457 Ga0070662_100002880 Ga0070662_1000028808 881
1660 3300005457 Ga0070662_100003968 Ga0070662_1000039687 881
1661 3300005459 Ga0068867_100001176 Ga0068867_1000011767 881
1662 3300005535 Ga0070684_100000750 Ga0070684_10000075014 881
1663 3300005543 Ga0070672_100052713 Ga0070672_1000527132 881
1664 3300005545 Ga0070695_100012402 Ga0070695_1000124022 881
1665 3300005547 Ga0070693_100004654 Ga0070693_1000046542 881
1666 3300005548 Ga0070665_100002801 Ga0070665_1000028016 881
1667 3300005578 Ga0068854_100001349 Ga0068854_1000013495 881
1668 3300005615 Ga0070702_100001501 Ga0070702_1000015014 881
1669 3300005617 Ga0068859_100002283 Ga0068859_1000022832 881
1670 3300005718 Ga0068866_10000284 Ga0068866_100002845 881
1671 3300005719 Ga0068861_100000476 Ga0068861_10000047613 881
1672 3300005841 Ga0068863_100003225 Ga0068863_1000032257 881
1673 3300005842 Ga0068858_100035491 Ga0068858_1000354913 881
1674 3300005844 Ga0068862_100000987 Ga0068862_1000009872 881
1675 3300005844 Ga0068862_100008341 Ga0068862_1000083411 881
1676 3300006028 Ga0070717_10017724 Ga0070717_100177243 881
1677 3300006237 Ga0097621_100010398 Ga0097621_1000103985 881
1678 3300006846 Ga0075430_100021679 Ga0075430_1000216794 881
1679 3300006846 Ga0075430_100051131 Ga0075430_1000511311 881
1680 3300006847 Ga0075431_100021260 Ga0075431_1000212605 881
1681 3300006931 Ga0097620_100002283 Ga0097620_1000022832 881
1682 3300007265 Ga0099794_10003427 Ga0099794_100034275 881
1683 3300007788 Ga0099795_10000027 Ga0099795_1000002739 881
1684 3300009094 Ga0111539_10004402 Ga0111539_100044028 881
1685 3300009094 Ga0111539_10017497 Ga0111539_100174975 881
1686 3300009098 Ga0105245_10009960 Ga0105245_100099602 881
1687 3300009098 Ga0105245_10024426 Ga0105245_100244262 881
1688 3300009147 Ga0114129_10002340 Ga0114129_1000234012 881
1689 3300009148 Ga0105243_10028193 Ga0105243_100281934 881
1690 3300009176 Ga0105242_10002487 Ga0105242_1000248710 881
1691 3300009176 Ga0105242_10026240 Ga0105242_100262403 881
1692 3300009545 Ga0105237_10002649 Ga0105237_1000264922 881
1693 3300009553 Ga0105249_10000932 Ga0105249_1000093221 881
1694 3300009553 Ga0105249_10043019 Ga0105249_100430191 881
1695 3300009553 Ga0105249_10046414 Ga0105249_100464141 881
1696 3300010159 Ga0099796_10000022 Ga0099796_1000002212 881
1697 3300010375 Ga0105239_10002006 Ga0105239_1000200620 881
1698 3300013297 Ga0157378_10002817 Ga0157378_100028175 881
1699 3300013297 Ga0157378_10034926 Ga0157378_100349262 881
1700 3300025899 Ga0207642_10000749 Ga0207642_100007493 881
1701 3300025907 Ga0207645_10002660 Ga0207645_1000266010 881
1702 3300025907 Ga0207645_10003963 Ga0207645_1000396310 881
1703 3300025908 Ga0207643_10004801 Ga0207643_100048016 881
1704 3300025914 Ga0207671_10000919 Ga0207671_1000091920 881
1705 3300025918 Ga0207662_10021907 Ga0207662_100219071 881
1706 3300025927 Ga0207687_10010476 Ga0207687_100104763 881
1707 3300025933 Ga0207706_10000038 Ga0207706_100000387 881
1708 3300025933 Ga0207706_10004365 Ga0207706_1000436510 881
1709 3300025933 Ga0207706_10028377 Ga0207706_100283773 881
1710 3300025934 Ga0207686_10000413 Ga0207686_100004138 881
1711 3300025934 Ga0207686_10002577 Ga0207686_1000257710 881
1712 3300025936 Ga0207670_10013993 Ga0207670_100139932 881
1713 3300025937 Ga0207669_10000936 Ga0207669_100009367 881
1714 3300025938 Ga0207704_10002024 Ga0207704_100020247 881
1715 3300025940 Ga0207691_10000503 Ga0207691_1000050310 881
1716 3300025941 Ga0207711_10001473 Ga0207711_1000147313 881
1717 3300025942 Ga0207689_10001851 Ga0207689_1000185111 881
1718 3300025942 Ga0207689_10002365 Ga0207689_100023652 881
1719 3300025942 Ga0207689_10027790 Ga0207689_100277903 881
1720 3300025945 Ga0207679_10001302 Ga0207679_100013026 881
1721 3300025972 Ga0207668_10013603 Ga0207668_100136034 881
1722 3300025981 Ga0207640_10012785 Ga0207640_100127852 881
1723 3300026035 Ga0207703_10021939 Ga0207703_100219393 881
1724 3300026075 Ga0207708_10001554 Ga0207708_1000155410 881
1725 3300026075 Ga0207708_10024153 Ga0207708_100241532 881
1726 3300026089 Ga0207648_10000036 Ga0207648_100000368 881
1727 3300026089 Ga0207648_10000591 Ga0207648_1000059110 881
1728 3300026089 Ga0207648_10015646 Ga0207648_100156465 881
1729 3300026095 Ga0207676_10005344 Ga0207676_100053445 881
1730 3300026116 Ga0207674_10012183 Ga0207674_100121834 881
1731 3300026118 Ga0207675_100000753 Ga0207675_10000075325 881
1732 3300026118 Ga0207675_100002950 Ga0207675_10000295010 881
1733 3300026118 Ga0207675_100046794 Ga0207675_1000467942 881
1734 3300026121 Ga0207683_10008399 Ga0207683_100083995 881
1735 3300026121 Ga0207683_10014109 Ga0207683_100141095 881
1736 3300027512 Ga0209179_1000023 Ga0209179_10000232 881
1737 3300027682 Ga0209971_1000715 Ga0209971_10007152 881
1738 3300027717 Ga0209998_10000818 Ga0209998_100008181 881
1739 3300027907 Ga0207428_10006041 Ga0207428_100060412 881
1740 3300028016 Ga0265354_1000782 Ga0265354_10007822 881
1741 3300028379 Ga0268266_10002229 Ga0268266_100022296 881
1742 3300028380 Ga0268265_10002151 Ga0268265_100021513 881
1743 3300028786 Ga0307517_10024065 Ga0307517_100240655 881
1744 3300028794 Ga0307515_10011336 Ga0307515_100113368 881
1745 3300030878 Ga0265770_1000029 Ga0265770_10000299 881
1746 3300031090 Ga0265760_10000319 Ga0265760_100003196 881
1747 3300031456 Ga0307513_10039117 Ga0307513_100391172 881
1748 3300031507 Ga0307509_10000781 Ga0307509_1000078114 881
1749 3300031507 Ga0307509_10003479 Ga0307509_100034798 881
1750 3300031507 Ga0307509_10047843 Ga0307509_100478433 881
1751 3300035090 Ga0373949_0000235 Ga0373949_0000235_3917_6667 881
1752 3300035113 Ga0373936_0000007 Ga0373936_0000007_37390_40140 881
1753 3300042876 Ga0451577_0027450 Ga0451577_0027450_1175_3868 881
1754 3300044673 Ga0453683_0012596 Ga0453683_0012596_857_3550 881
1755 3300044712 Ga0453684_0022142 Ga0453684_0022142_635_3328 881
1756 3300044712 Ga0453684_0022787 Ga0453684_0022787_2584_5277 881
1757 3300045051 Ga0451576_0027811 Ga0451576_0027811_1084_3777 881
1758 3300045976 Ga0466967_0001153 Ga0466967_0001153_3126_5879 881
1759 3300048903 Ga0496100_0006846 Ga0496100_0006846_827_3676 881
1760 3300048908 Ga0496105_0036992 Ga0496105_0036992_484_3180 881
1761 3300048912 Ga0496109_0004574 Ga0496109_0004574_5840_8689 881
1762 3300048913 Ga0496110_0001781 Ga0496110_0001781_5317_8166 881
1763 3300048921 Ga0496118_0017604 Ga0496118_0017604_1890_4583 881
1764 3300050507 nmdc:mga05p37_848_c1 nmdc:mga05p37_848_c1_28393_31086 881
1765 3300050509 nmdc:mga0qj67_9925_c1 nmdc:mga0qj67_9925_c1_3994_6687 881
1766 3300050510 nmdc:mga06r32_176_c1 nmdc:mga06r32_176_c1_26942_29635 881
1767 3300050510 nmdc:mga06r32_30269_c1 nmdc:mga06r32_30269_c1_600_3293 881
1768 3300050511 nmdc:mga08y16_41453_c1 nmdc:mga08y16_41453_c1_734_3427 881
1769 3300050511 nmdc:mga08y16_5565_c1 nmdc:mga08y16_5565_c1_9288_11981 881
1770 3300053094 Ga0500566_0002381 Ga0500566_0002381_7617_10370 881
1771 3300053119 Ga0500595_000441 Ga0500595_000441_13849_16602 881
1772 3300053123 Ga0500614_000023 Ga0500614_000023_12395_15148 881
1773 3300053156 Ga0500622_0000763 Ga0500622_0000763_1003_3696 881
1774 3300053156 Ga0500622_0002673 Ga0500622_0002673_3602_6295 881
1775 3300005471 Ga0070698_100000173 Ga0070698_10000017334 882
1776 3300005981 Ga0081538_10000048 Ga0081538_1000004891 882
1777 3300005981 Ga0081538_10000680 Ga0081538_1000068016 882
1778 3300031852 Ga0307410_10016393 Ga0307410_100163931 882
1779 3300037312 Ga0395899_0011114 Ga0395899_0011114_2272_5028 882
1780 3300048907 Ga0496104_0032776 Ga0496104_0032776_1798_4647 882
1781 3300048917 Ga0496114_0002882 Ga0496114_0002882_4999_7848 882
1782 3300005339 Ga0070660_100010870 Ga0070660_1000108704 883
1783 3300005435 Ga0070714_100001173 Ga0070714_10000117317 883
1784 3300005457 Ga0070662_100021142 Ga0070662_1000211422 883
1785 3300005563 Ga0068855_100073146 Ga0068855_1000731462 883
1786 3300005577 Ga0068857_100003576 Ga0068857_10000357610 883
1787 3300005618 Ga0068864_100000582 Ga0068864_1000005822 883
1788 3300005981 Ga0081538_10016273 Ga0081538_100162733 883
1789 3300025909 Ga0207705_10001177 Ga0207705_100011774 883
1790 3300025929 Ga0207664_10000126 Ga0207664_1000012653 883
1791 3300025932 Ga0207690_10000266 Ga0207690_1000026611 883
1792 3300025933 Ga0207706_10031114 Ga0207706_100311143 883
1793 3300025949 Ga0207667_10016791 Ga0207667_100167912 883
1794 3300025949 Ga0207667_10057149 Ga0207667_100571492 883
1795 3300026095 Ga0207676_10018930 Ga0207676_100189301 883
1796 3300026116 Ga0207674_10003217 Ga0207674_100032177 883
1797 3300032002 Ga0307416_100030055 Ga0307416_1000300552 883
1798 3300044694 Ga0466963_0000372 Ga0466963_0000372_12013_14811 883
1799 3300045049 Ga0466959_0025694 Ga0466959_0025694_743_3541 883
1800 3300050507 nmdc:mga05p37_61339_c1 nmdc:mga05p37_61339_c1_526_3237 883
1801 3300006028 Ga0070717_10000028 Ga0070717_10000028102 884
1802 3300028654 Ga0265322_10001006 Ga0265322_100010063 884
1803 3300049824 Ga0501045_0003035 Ga0501045_0003035_8596_11445 884
1804 3300009147 Ga0114129_10057410 Ga0114129_100574104 885
1805 3300009147 Ga0114129_10108351 Ga0114129_101083511 885
1806 3300031824 Ga0307413_10019038 Ga0307413_100190382 885
1807 3300048924 Ga0496121_0002642 Ga0496121_0002642_17421_20171 885
1808 3300050507 nmdc:mga05p37_2830_c1 nmdc:mga05p37_2830_c1_815_3604 885
1809 3300050507 nmdc:mga05p37_8763_c1 nmdc:mga05p37_8763_c1_704_3493 885
1810 iso_pu_bacteria 2537561836 2538834595 885
1811 iso_pu_bacteria 2643221562 2643829881 885
1812 iso_pu_bacteria 2895395659 2895399077 885
1813 iso_pu_bacteria 2939611941 2939612206 885
1814 3300002737 JGI25162J39368_1001699 JGI25162J39368_10016993 886
1815 3300002772 JGI25164J39214_1000832 JGI25164J39214_10008323 886
1816 3300003214 JGI25165J46597_1001618 JGI25165J46597_10016183 886
1817 3300005338 Ga0068868_100006108 Ga0068868_1000061087 886
1818 3300005344 Ga0070661_100009937 Ga0070661_1000099374 886
1819 3300005347 Ga0070668_100003666 Ga0070668_10000366611 886
1820 3300005457 Ga0070662_100002795 Ga0070662_1000027957 886
1821 3300005563 Ga0068855_100009487 Ga0068855_1000094872 886
1822 3300005616 Ga0068852_100012423 Ga0068852_1000124231 886
1823 3300005719 Ga0068861_100004777 Ga0068861_1000047777 886
1824 3300005985 Ga0081539_10009881 Ga0081539_100098818 886
1825 3300009177 Ga0105248_10007720 Ga0105248_100077202 886
1826 3300009553 Ga0105249_10000774 Ga0105249_100007748 886
1827 3300013104 Ga0157370_10072280 Ga0157370_100722802 886
1828 3300025231 Ga0207427_100170 Ga0207427_10017045 886
1829 3300025233 Ga0209437_100246 Ga0209437_10024659 886
1830 3300025261 Ga0209233_1000215 Ga0209233_100021579 886
1831 3300025907 Ga0207645_10006477 Ga0207645_100064778 886
1832 3300025920 Ga0207649_10003099 Ga0207649_100030996 886
1833 3300025933 Ga0207706_10000947 Ga0207706_1000094711 886
1834 3300025938 Ga0207704_10027588 Ga0207704_100275881 886
1835 3300025940 Ga0207691_10000311 Ga0207691_1000031120 886
1836 3300025942 Ga0207689_10002037 Ga0207689_100020378 886
1837 3300025945 Ga0207679_10001489 Ga0207679_1000148912 886
1838 3300025961 Ga0207712_10001613 Ga0207712_100016138 886
1839 3300026116 Ga0207674_10000737 Ga0207674_1000073719 886
1840 3300026118 Ga0207675_100000107 Ga0207675_10000010753 886
1841 3300032002 Ga0307416_100006067 Ga0307416_1000060672 886
1842 3300046543 Ga0495645_0000022 Ga0495645_0000022_103814_106651 886
1843 3300049823 Ga0501044_0066972 Ga0501044_0066972_711_3530 886
1844 iso_pu_bacteria 2593339238 2595448388 886
1845 iso_pu_bacteria 2593339239 2595451689 886
1846 iso_pu_bacteria 2842918807 2842921694 886
1847 iso_pu_bacteria 2884338543 2884339945 886
1848 iso_pu_bacteria 2941471342 2941472340 886
1849 iso_pu_bacteria 2953994433 2953997708 886
1850 3300005577 Ga0068857_100001874 Ga0068857_10000187414 887
1851 3300044694 Ga0466963_0004950 Ga0466963_0004950_1216_4014 887
1852 3300044694 Ga0466963_0016202 Ga0466963_0016202_1288_4125 887
1853 3300045049 Ga0466959_0005673 Ga0466959_0005673_2646_5444 887
1854 3300045836 Ga0466958_0002447 Ga0466958_0002447_396_3194 887
1855 3300050511 nmdc:mga08y16_35328_c1 nmdc:mga08y16_35328_c1_621_3401 887
1856 iso_pu_bacteria 2734482264 2735836278 887
1857 iso_pu_bacteria 2738543009 2739227667 887
1858 3300003373 JGI25407J50210_10001538 JGI25407J50210_100015382 888
1859 3300005535 Ga0070684_100041939 Ga0070684_1000419391 888
1860 3300005536 Ga0070697_100001444 Ga0070697_10000144415 888
1861 3300005564 Ga0070664_100001558 Ga0070664_1000015581 888
1862 3300005981 Ga0081538_10000491 Ga0081538_1000049147 888
1863 3300031548 Ga0307408_100011982 Ga0307408_1000119823 888
1864 3300031901 Ga0307406_10000615 Ga0307406_100006158 888
1865 3300053078 Ga0495612_0000117 Ga0495612_0000117_26137_28986 888
1866 3300002741 JGI25157J39369_1001209 JGI25157J39369_10012094 889
1867 3300005347 Ga0070668_100003225 Ga0070668_1000032256 889
1868 3300005366 Ga0070659_100003280 Ga0070659_1000032807 889
1869 3300005435 Ga0070714_100021927 Ga0070714_1000219273 889
1870 3300005468 Ga0070707_100006104 Ga0070707_1000061047 889
1871 3300005468 Ga0070707_100017495 Ga0070707_1000174953 889
1872 3300005563 Ga0068855_100012441 Ga0068855_1000124412 889
1873 3300005985 Ga0081539_10000246 Ga0081539_10000246119 889
1874 3300005985 Ga0081539_10023099 Ga0081539_100230992 889
1875 3300013104 Ga0157370_10004611 Ga0157370_1000461111 889
1876 3300025250 Ga0209026_1000213 Ga0209026_100021354 889
1877 3300025922 Ga0207646_10002616 Ga0207646_1000261610 889
1878 3300025929 Ga0207664_10015676 Ga0207664_100156763 889
1879 3300025932 Ga0207690_10003495 Ga0207690_100034957 889
1880 3300025933 Ga0207706_10000372 Ga0207706_1000037220 889
1881 3300037418 Ga0395900_0000033 Ga0395900_0000033_135332_138070 889
1882 3300038443 Ga0395901_0010797 Ga0395901_0010797_1504_4245 889
1883 3300045051 Ga0451576_0001194 Ga0451576_0001194_17574_20342 889
1884 3300049592 Ga0501076_0023093 Ga0501076_0023093_125_2968 889
1885 iso_pu_bacteria 2643221577 2643894955 889
1886 iso_pu_bacteria 2643221685 2644477113 889
1887 3300002075 JGI24738J21930_10002398 JGI24738J21930_100023982 890
1888 3300005329 Ga0070683_100000323 Ga0070683_10000032326 890
1889 3300005336 Ga0070680_100001769 Ga0070680_10000176911 890
1890 3300005341 Ga0070691_10000588 Ga0070691_100005885 890
1891 3300005356 Ga0070674_100003148 Ga0070674_1000031483 890
1892 3300005458 Ga0070681_10016442 Ga0070681_100164423 890
1893 3300005530 Ga0070679_100007407 Ga0070679_1000074073 890
1894 3300005535 Ga0070684_100001725 Ga0070684_1000017258 890
1895 3300005563 Ga0068855_100027089 Ga0068855_1000270894 890
1896 3300005577 Ga0068857_100001597 Ga0068857_1000015978 890
1897 3300005614 Ga0068856_100005255 Ga0068856_1000052556 890
1898 3300006846 Ga0075430_100046918 Ga0075430_1000469182 890
1899 3300009094 Ga0111539_10006383 Ga0111539_1000638312 890
1900 3300013104 Ga0157370_10001616 Ga0157370_100016167 890
1901 3300013104 Ga0157370_10023162 Ga0157370_100231623 890
1902 3300013307 Ga0157372_10001622 Ga0157372_100016227 890
1903 3300014497 Ga0182008_10001957 Ga0182008_100019578 890
1904 3300025303 Ga0209051_1002464 Ga0209051_100246411 890
1905 3300025904 Ga0207647_10000006 Ga0207647_10000006103 890
1906 3300025912 Ga0207707_10030980 Ga0207707_100309803 890
1907 3300025917 Ga0207660_10003171 Ga0207660_100031716 890
1908 3300025921 Ga0207652_10001343 Ga0207652_1000134317 890
1909 3300025921 Ga0207652_10061613 Ga0207652_100616131 890
1910 3300025928 Ga0207700_10001683 Ga0207700_100016837 890
1911 3300025929 Ga0207664_10025897 Ga0207664_100258971 890
1912 3300025944 Ga0207661_10001455 Ga0207661_100014556 890
1913 3300025945 Ga0207679_10004437 Ga0207679_100044373 890
1914 3300025949 Ga0207667_10007862 Ga0207667_100078627 890
1915 3300026078 Ga0207702_10000741 Ga0207702_1000074131 890
1916 3300026116 Ga0207674_10000925 Ga0207674_1000092535 890
1917 3300031911 Ga0307412_10001007 Ga0307412_1000100715 890
1918 3300044684 Ga0466966_0035953 Ga0466966_0035953_55_2808 890
1919 3300046507 Ga0495606_0005457 Ga0495606_0005457_4089_6833 890
1920 3300047472 Ga0495686_0000085 Ga0495686_0000085_171204_173948 890
1921 3300048913 Ga0496110_0024755 Ga0496110_0024755_2164_4974 890
1922 3300048924 Ga0496121_0000129 Ga0496121_0000129_76920_79664 890
1923 3300050509 nmdc:mga0qj67_15771_c1 nmdc:mga0qj67_15771_c1_144_2936 890
1924 3300050511 nmdc:mga08y16_10853_c1 nmdc:mga08y16_10853_c1_2787_5627 890
1925 3300050511 nmdc:mga08y16_72760_c1 nmdc:mga08y16_72760_c1_635_3475 890
1926 iso_pu_bacteria 2527291627 2528203125 890
1927 iso_pu_bacteria 2527291629 2528215432 890
1928 iso_pu_bacteria 2546825537 2546950691 890
1929 iso_pu_bacteria 2576861822 2579748108 890
1930 iso_pu_bacteria 2579778521 2579857056 890
1931 iso_pu_bacteria 2619618881 2619853966 890
1932 iso_pu_bacteria 2619619003 2620352967 890
1933 iso_pu_bacteria 2626541554 2626638315 890
1934 iso_pu_bacteria 2684623036 2686543933 890
1935 iso_pu_bacteria 2710264753 2710604536 890
1936 iso_pu_bacteria 2773857924 2774866646 890
1937 iso_pu_bacteria 637000116 637878645 890
1938 iso_pu_bacteria 8054913762 8054920208 890
1939 iso_pu_bacteria 8054920844 8054925805 890
1940 iso_pu_bacteria 8055157932 8055162024 890
1941 3300001915 JGI24741J21665_1001410 JGI24741J21665_10014101 891
1942 3300001979 JGI24740J21852_10000081 JGI24740J21852_100000819 891
1943 3300005336 Ga0070680_100000209 Ga0070680_10000020927 891
1944 3300005337 Ga0070682_100005790 Ga0070682_1000057903 891
1945 3300005341 Ga0070691_10000494 Ga0070691_100004946 891
1946 3300005458 Ga0070681_10000397 Ga0070681_1000039722 891
1947 3300005530 Ga0070679_100000412 Ga0070679_10000041213 891
1948 3300005546 Ga0070696_100003409 Ga0070696_10000340910 891
1949 3300005614 Ga0068856_100076372 Ga0068856_1000763721 891
1950 3300005617 Ga0068859_100000005 Ga0068859_100000005255 891
1951 3300005834 Ga0068851_10014366 Ga0068851_100143661 891
1952 3300005841 Ga0068863_100039862 Ga0068863_1000398623 891
1953 3300006914 Ga0075436_100020529 Ga0075436_1000205292 891
1954 3300006931 Ga0097620_100000005 Ga0097620_100000005255 891
1955 3300009094 Ga0111539_10106762 Ga0111539_101067621 891
1956 3300009551 Ga0105238_10003680 Ga0105238_1000368015 891
1957 3300013104 Ga0157370_10035815 Ga0157370_100358154 891
1958 3300020610 Ga0154015_1549552 Ga0154015_15495522 891
1959 3300025321 Ga0207656_10008746 Ga0207656_100087461 891
1960 3300025904 Ga0207647_10000229 Ga0207647_1000022919 891
1961 3300025909 Ga0207705_10000128 Ga0207705_1000012857 891
1962 3300025912 Ga0207707_10000665 Ga0207707_1000066522 891
1963 3300025912 Ga0207707_10001756 Ga0207707_1000175613 891
1964 3300025913 Ga0207695_10001748 Ga0207695_1000174818 891
1965 3300025917 Ga0207660_10001455 Ga0207660_1000145513 891
1966 3300025917 Ga0207660_10006743 Ga0207660_100067434 891
1967 3300025920 Ga0207649_10000493 Ga0207649_1000049318 891
1968 3300025921 Ga0207652_10000030 Ga0207652_1000003014 891
1969 3300025921 Ga0207652_10000820 Ga0207652_1000082015 891
1970 3300025921 Ga0207652_10000846 Ga0207652_1000084615 891
1971 3300025924 Ga0207694_10022907 Ga0207694_100229073 891
1972 3300025932 Ga0207690_10001014 Ga0207690_100010143 891
1973 3300025945 Ga0207679_10045364 Ga0207679_100453642 891
1974 3300025949 Ga0207667_10000634 Ga0207667_1000063427 891
1975 3300025949 Ga0207667_10000818 Ga0207667_1000081816 891
1976 3300025981 Ga0207640_10001171 Ga0207640_100011712 891
1977 3300026088 Ga0207641_10021026 Ga0207641_100210264 891
1978 3300026095 Ga0207676_10000947 Ga0207676_1000094712 891
1979 3300026142 Ga0207698_10001254 Ga0207698_1000125413 891
1980 3300031727 Ga0316576_10003752 Ga0316576_100037522 891
1981 3300037466 Ga0395898_0013500 Ga0395898_0013500_5586_8390 891
1982 3300037466 Ga0395898_0058652 Ga0395898_0058652_817_3633 891
1983 3300038443 Ga0395901_0007971 Ga0395901_0007971_2233_5037 891
1984 3300038443 Ga0395901_0029492 Ga0395901_0029492_226_3042 891
1985 3300047318 Ga0495636_0011093 Ga0495636_0011093_742_3528 891
1986 3300049573 Ga0501037_0007579 Ga0501037_0007579_1764_4517 891
1987 3300049586 Ga0501070_0000105 Ga0501070_0000105_34557_37358 891
1988 3300049586 Ga0501070_0001957 Ga0501070_0001957_14329_17202 891
1989 3300049586 Ga0501070_0017720 Ga0501070_0017720_660_3461 891
1990 3300049586 Ga0501070_0031465 Ga0501070_0031465_457_3228 891
1991 3300049589 Ga0501073_0033843 Ga0501073_0033843_843_3614 891
1992 3300049590 Ga0501074_0000516 Ga0501074_0000516_8820_11573 891
1993 3300049742 Ga0501080_0008675 Ga0501080_0008675_4722_7475 891
1994 3300049822 Ga0501035_0013401 Ga0501035_0013401_579_3452 891
1995 3300059424 Ga0590075_003564 Ga0590075_003564_349_3294 891
1996 3300005366 Ga0070659_100018282 Ga0070659_1000182822 892
1997 3300005367 Ga0070667_100000351 Ga0070667_1000003519 892
1998 3300005435 Ga0070714_100006546 Ga0070714_1000065467 892
1999 3300005455 Ga0070663_100000103 Ga0070663_10000010323 892
2000 3300005458 Ga0070681_10007106 Ga0070681_100071067 892
2001 3300005530 Ga0070679_100015100 Ga0070679_1000151006 892
2002 3300005546 Ga0070696_100002205 Ga0070696_1000022053 892
2003 3300005983 Ga0081540_1006630 Ga0081540_10066307 892
2004 3300006846 Ga0075430_100001471 Ga0075430_1000014719 892
2005 3300006847 Ga0075431_100002039 Ga0075431_1000020399 892
2006 3300006880 Ga0075429_100001833 Ga0075429_1000018339 892
2007 3300009147 Ga0114129_10034762 Ga0114129_100347622 892
2008 3300009177 Ga0105248_10000148 Ga0105248_1000014858 892
2009 3300009545 Ga0105237_10001581 Ga0105237_1000158126 892
2010 3300009553 Ga0105249_10001612 Ga0105249_100016127 892
2011 3300015685 Ga0183369_1008 Ga0183369_100865 892
2012 3300025911 Ga0207654_10000580 Ga0207654_100005809 892
2013 3300025912 Ga0207707_10003724 Ga0207707_100037247 892
2014 3300025914 Ga0207671_10002269 Ga0207671_100022697 892
2015 3300025921 Ga0207652_10019396 Ga0207652_100193963 892
2016 3300025922 Ga0207646_10027350 Ga0207646_100273503 892
2017 3300025929 Ga0207664_10000745 Ga0207664_100007453 892
2018 3300025932 Ga0207690_10003698 Ga0207690_100036983 892
2019 3300025941 Ga0207711_10001348 Ga0207711_1000134812 892
2020 3300025961 Ga0207712_10000609 Ga0207712_1000060921 892
2021 3300025986 Ga0207658_10000098 Ga0207658_1000009827 892
2022 3300032002 Ga0307416_100010224 Ga0307416_1000102243 892
2023 3300042876 Ga0451577_0000507 Ga0451577_0000507_17862_20606 892
2024 3300044712 Ga0453684_0000745 Ga0453684_0000745_78596_81340 892
2025 3300046460 Ga0495638_0000063 Ga0495638_0000063_897_3647 892
2026 3300048921 Ga0496118_0000828 Ga0496118_0000828_19055_21934 892
2027 3300048925 Ga0496122_0000734 Ga0496122_0000734_51656_54472 892
2028 3300048926 Ga0496123_0002408 Ga0496123_0002408_10919_13735 892
2029 3300050508 nmdc:mga09592_3189_c1 nmdc:mga09592_3189_c1_7694_10450 892
2030 3300050510 nmdc:mga06r32_10259_c1 nmdc:mga06r32_10259_c1_1442_4198 892
2031 3300053087 Ga0500643_008547 Ga0500643_008547_1102_3918 892
2032 3300005329 Ga0070683_100012461 Ga0070683_1000124615 893
2033 3300005366 Ga0070659_100001308 Ga0070659_10000130812 893
2034 3300005435 Ga0070714_100000243 Ga0070714_10000024330 893
2035 3300005543 Ga0070672_100001189 Ga0070672_10000118912 893
2036 3300005564 Ga0070664_100019612 Ga0070664_1000196124 893
2037 3300005981 Ga0081538_10001148 Ga0081538_1000114821 893
2038 3300006038 Ga0075365_10005124 Ga0075365_100051245 893
2039 3300006844 Ga0075428_100014440 Ga0075428_1000144403 893
2040 3300009098 Ga0105245_10048858 Ga0105245_100488582 893
2041 3300010375 Ga0105239_10045963 Ga0105239_100459633 893
2042 3300025901 Ga0207688_10003260 Ga0207688_100032605 893
2043 3300025920 Ga0207649_10026336 Ga0207649_100263362 893
2044 3300025927 Ga0207687_10030129 Ga0207687_100301292 893
2045 3300025929 Ga0207664_10000013 Ga0207664_10000013177 893
2046 3300025932 Ga0207690_10004956 Ga0207690_100049565 893
2047 3300025937 Ga0207669_10032819 Ga0207669_100328191 893
2048 3300025944 Ga0207661_10014398 Ga0207661_100143984 893
2049 3300025981 Ga0207640_10003841 Ga0207640_100038413 893
2050 3300026067 Ga0207678_10014897 Ga0207678_100148975 893
2051 3300026116 Ga0207674_10027688 Ga0207674_100276885 893
2052 3300037418 Ga0395900_0021377 Ga0395900_0021377_1055_3937 893
2053 3300037471 Ga0395905_0023517 Ga0395905_0023517_1280_4162 893
2054 3300048909 Ga0496106_0009497 Ga0496106_0009497_1958_4759 893
2055 3300050492 nmdc:mga0yw44_886_c1 nmdc:mga0yw44_886_c1_5218_8019 893
2056 3300050514 nmdc:mga08x19_5709_c1 nmdc:mga08x19_5709_c1_3175_5943 893
2057 3300060353 Ga0501082_0067394 Ga0501082_0067394_29_2767 893
2058 3300005329 Ga0070683_100090647 Ga0070683_1000906471 894
2059 3300005331 Ga0070670_100023328 Ga0070670_1000233283 894
2060 3300005336 Ga0070680_100028429 Ga0070680_1000284293 894
2061 3300005344 Ga0070661_100002125 Ga0070661_10000212513 894
2062 3300005458 Ga0070681_10002096 Ga0070681_100020964 894
2063 3300005536 Ga0070697_100015804 Ga0070697_1000158043 894
2064 3300005546 Ga0070696_100010884 Ga0070696_1000108843 894
2065 3300005981 Ga0081538_10000018 Ga0081538_10000018133 894
2066 3300005981 Ga0081538_10003769 Ga0081538_1000376913 894
2067 3300009101 Ga0105247_10000188 Ga0105247_1000018838 894
2068 3300009177 Ga0105248_10001635 Ga0105248_1000163512 894
2069 3300014968 Ga0157379_10057145 Ga0157379_100571452 894
2070 3300025900 Ga0207710_10000038 Ga0207710_10000038189 894
2071 3300025917 Ga0207660_10004455 Ga0207660_100044558 894
2072 3300025941 Ga0207711_10003853 Ga0207711_100038534 894
2073 3300047317 Ga0495604_0000900 Ga0495604_0000900_19180_22065 894
2074 3300048903 Ga0496100_0000749 Ga0496100_0000749_11304_14165 894
2075 3300048918 Ga0496115_0000053 Ga0496115_0000053_100861_103695 894
2076 3300048922 Ga0496119_0008248 Ga0496119_0008248_6349_9132 894
2077 3300048923 Ga0496120_0000643 Ga0496120_0000643_45197_47980 894
2078 3300005548 Ga0070665_100046240 Ga0070665_1000462402 895
2079 3300006846 Ga0075430_100000211 Ga0075430_10000021126 895
2080 3300009147 Ga0114129_10038225 Ga0114129_100382254 895
2081 3300050509 nmdc:mga0qj67_1266_c1 nmdc:mga0qj67_1266_c1_14797_17526 895
2082 3300050510 nmdc:mga06r32_5995_c1 nmdc:mga06r32_5995_c1_6662_9391 895
2083 3300005471 Ga0070698_100017971 Ga0070698_1000179714 896
2084 3300005329 Ga0070683_100033041 Ga0070683_1000330412 897
2085 3300006028 Ga0070717_10005524 Ga0070717_100055243 897
2086 3300025932 Ga0207690_10000064 Ga0207690_1000006418 897
2087 3300025940 Ga0207691_10020766 Ga0207691_100207662 897
2088 3300025944 Ga0207661_10045864 Ga0207661_100458642 897
2089 3300048907 Ga0496104_0000033 Ga0496104_0000033_144205_147063 897
2090 3300048913 Ga0496110_0000046 Ga0496110_0000046_24309_27167 897
2091 3300049592 Ga0501076_0007681 Ga0501076_0007681_2269_5082 897
2092 3300049741 Ga0501079_0002067 Ga0501079_0002067_210_3023 897
2093 3300049824 Ga0501045_0012568 Ga0501045_0012568_849_3662 897
2094 3300054114 Ga0501084_0007320 Ga0501084_0007320_1959_4772 897
2095 3300061734 Ga0530510_0002874 Ga0530510_0002874_298_3111 897
2096 3300005981 Ga0081538_10003881 Ga0081538_1000388113 898
2097 3300031251 Ga0265327_10015223 Ga0265327_100152232 898
2098 3300049574 Ga0501038_0001572 Ga0501038_0001572_13146_15983 898
2099 3300049590 Ga0501074_0001654 Ga0501074_0001654_196_3033 898
2100 3300054114 Ga0501084_0013673 Ga0501084_0013673_889_3726 898
2101 3300031727 Ga0316576_10000873 Ga0316576_100008732 899
2102 3300044901 Ga0466960_0018189 Ga0466960_0018189_72_2900 899
2103 3300003203 JGI25406J46586_10001883 JGI25406J46586_100018838 900
2104 3300005985 Ga0081539_10004714 Ga0081539_100047144 900
2105 3300005985 Ga0081539_10008372 Ga0081539_100083728 900
2106 3300046517 Ga0495630_0000280 Ga0495630_0000280_23575_26445 900
2107 3300046675 Ga0495657_0000041 Ga0495657_0000041_72609_75479 900
2108 3300005981 Ga0081538_10002495 Ga0081538_1000249514 901
2109 3300021388 Ga0213875_10000156 Ga0213875_1000015647 901
2110 3300025929 Ga0207664_10002348 Ga0207664_100023487 901
2111 3300037853 Ga0436364_1375186 Ga0436364_1375186_43414_46224 901
2112 3300039437 Ga0436365_1001279 Ga0436365_1001279_8597_11383 901
2113 3300005436 Ga0070713_100011716 Ga0070713_1000117163 902
2114 3300005548 Ga0070665_100003756 Ga0070665_10000375613 902
2115 3300031995 Ga0307409_100023341 Ga0307409_1000233411 902
2116 3300032126 Ga0307415_100004348 Ga0307415_1000043482 902
2117 3300045049 Ga0466959_0024896 Ga0466959_0024896_1430_4216 902
2118 3300049586 Ga0501070_0023099 Ga0501070_0023099_770_3577 902
2119 3300049588 Ga0501072_0007913 Ga0501072_0007913_19_2826 902
2120 3300049590 Ga0501074_0006822 Ga0501074_0006822_514_3321 902
2121 3300049742 Ga0501080_0006672 Ga0501080_0006672_3025_5832 902
2122 3300021384 Ga0213876_10017093 Ga0213876_100170933 903
2123 3300021384 Ga0213876_10018135 Ga0213876_100181352 903
2124 3300021388 Ga0213875_10008600 Ga0213875_100086003 903
2125 3300037853 Ga0436364_0211656 Ga0436364_0211656_2371_5172 903
2126 3300039437 Ga0436365_0822443 Ga0436365_0822443_460_3261 903
2127 3300039437 Ga0436365_1062197 Ga0436365_1062197_1872_4658 903
2128 3300048903 Ga0496100_0016995 Ga0496100_0016995_941_3760 903
2129 3300048904 Ga0496101_0009141 Ga0496101_0009141_1375_4194 903
2130 3300048910 Ga0496107_0002056 Ga0496107_0002056_8563_11382 903
2131 3300048918 Ga0496115_0012887 Ga0496115_0012887_1355_4174 903
2132 3300053077 Ga0495601_0000769 Ga0495601_0000769_3889_6741 904
2133 3300005981 Ga0081538_10000003 Ga0081538_10000003127 907
2134 3300005435 Ga0070714_100001301 Ga0070714_1000013014 911
2135 3300025929 Ga0207664_10002368 Ga0207664_100023683 911
2136 3300005616 Ga0068852_100072117 Ga0068852_1000721172 912
2137 3300020082 Ga0206353_10761908 Ga0206353_107619083 912
2138 3300025914 Ga0207671_10045094 Ga0207671_100450942 912
2139 3300025944 Ga0207661_10003194 Ga0207661_100031942 912
2140 3300048915 Ga0496112_0077158 Ga0496112_0077158_457_3255 913
2141 3300000549 LJQas_1000887 LJQas_10008873 920

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00330

Aconitase

Aconitase family (aconitate hydratase)

123

668

0.95

PF00694

Aconitase_C

Aconitase C-terminal domain

796

928

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b3y-assembly2.cif.gz_B structure of a monoclinic crystal form of human cytosolic aconitase (irp1) 0.9586 2 916
2b3y-assembly2.cif.gz_B structure of a monoclinic crystal form of human cytosolic aconitase (irp1) 0.9565 2 916
1c97-assembly1.cif.gz_A s642a:isocitrate complex of aconitase 0.8681 23 911
6acn-assembly1.cif.gz_A structure of activated aconitase. formation of the (4fe-4s) cluster in the crystal 0.8561 23 918
1c96-assembly1.cif.gz_A s642a:citrate complex of aconitase 0.8557 23 918
ID Description Score Start End Superfamily
af_Q811J3_205_443_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9808 137 367 3.30.499.10
af_O53166_698_941_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9771 683 915 3.20.19.10
2b3yB02 Alpha Beta;3-Layer(aba) Sandwich;Aconitase; Domain 2;Aconitase, Domain 2 0.9758 243 368 3.40.1060.10
af_A0A0N7KLZ5_21_389_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9717 4 368 3.30.499.10
af_A0A0N7KLZ5_21_389_3.30.499.10 Alpha Beta;2-Layer Sandwich;Aconitase; domain 3;Aconitase, domain 3 0.9587 4 368 3.30.499.10
ID Description Score Start End GO Terms
AF-A0A2S6DIU4-F1-model_v4 deleted 0.9962 452 591
AF-A0A4U9HWQ0-F1-model_v4 Aconitate hydratase 1 (EC 4.2.1.3) 0.9944 505 630 GO:0003994
GO:0046872
GO:0051539
AF-A0A147G9C3-F1-model_v4 deleted 0.9915 87 194
AF-A0A3C1CM21-F1-model_v4 Aconitate hydratase (EC 4.2.1.3) 0.9908 460 587 GO:0046872
GO:0047456
GO:0051536
AF-A0A2S2NYG0-F1-model_v4 Cytoplasmic aconitate hydratase 0.9899 88 323 GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map