F496459

General Info

Members Datasets Scaffolds Average Seq Length
2143 688 4287 88

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_14154_c1|nmdc:mga09592_14154_c1_3867_4157
Length 96
Sequence LKLERRDVDSAQVFTFGQQGLYLLLMVAAPLLLTVLAVGLVVSIFQAATQIHEATLSFVPKIVAAVAVLAVAGPWMLTTLVEYLQRTLQAIPTVVG

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
21 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
149 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
150 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
151 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
152 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
153 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
154 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
155 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
156 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
157 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
158 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
171 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
175 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
176 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
177 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
181 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
267 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
276 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
282 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
285 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
286 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
287 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
288 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
289 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
290 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
291 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
292 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
293 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
294 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
295 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
296 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
297 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
298 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
299 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
300 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
301 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
302 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
303 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
310 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
311 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
312 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
313 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
314 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
315 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
316 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
317 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
318 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
319 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
320 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
321 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
322 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
323 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
324 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
325 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
326 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
327 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
328 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
329 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
330 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
331 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
332 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
333 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
334 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
335 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
336 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
343 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
344 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
345 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
346 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
347 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
348 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
349 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
350 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
351 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
352 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
353 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
354 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
355 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
356 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
357 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
358 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
359 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
360 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
361 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
362 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
363 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
364 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
365 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
366 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
367 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
368 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
369 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
370 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
371 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
372 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
373 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
374 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
375 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
376 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
377 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
378 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
379 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
380 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
381 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
382 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
383 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
384 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
385 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
386 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
387 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
388 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
389 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
390 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
391 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
392 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
393 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
394 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
395 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
396 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
397 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
398 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
399 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
400 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
401 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
402 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
403 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
404 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
405 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
406 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
407 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
408 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
409 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
410 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
411 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
412 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
413 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
414 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
415 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
416 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
417 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
418 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
419 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
420 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
421 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
422 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
423 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
424 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
425 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
426 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
427 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
428 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
429 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
430 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
431 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
432 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
433 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
434 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
435 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
436 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
437 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
438 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
439 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
440 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
441 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
442 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
443 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
444 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
445 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
446 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
447 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
448 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
449 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
450 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
451 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
452 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
453 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
454 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
455 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
456 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
457 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
458 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
459 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
460 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
461 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
462 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
463 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
464 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
465 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
466 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
467 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
468 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
469 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
470 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
471 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
472 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
473 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
474 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
475 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
476 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
477 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
478 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
479 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
480 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
481 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
482 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
483 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
484 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
485 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
486 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
487 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
488 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
489 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
490 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
491 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
492 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
493 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
494 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
495 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
496 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
497 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
498 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
499 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
500 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
501 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
502 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
503 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
504 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
505 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
506 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
507 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
508 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
509 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
510 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
511 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
512 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
513 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
514 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
515 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
516 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
517 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
518 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
519 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
520 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
521 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
522 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
523 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
524 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
525 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
526 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
530 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
531 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
532 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
533 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
540 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
543 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
544 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
545 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
546 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
547 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
548 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
549 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
550 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
551 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
552 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
553 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
554 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
555 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
556 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
557 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
558 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
559 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
560 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
561 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
562 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
563 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
564 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
565 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
566 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
567 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
568 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
569 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
570 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
571 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
572 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
575 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
576 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
577 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
578 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
579 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
580 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
581 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
582 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
583 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
584 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
585 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
586 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
587 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
588 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
589 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
590 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
591 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
592 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
593 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
594 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
595 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
596 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
597 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
598 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
599 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
600 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
601 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
602 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
603 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
604 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
605 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
606 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
607 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
608 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
609 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
610 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
611 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
612 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
613 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
614 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
615 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
616 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
617 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
618 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
619 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
620 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
621 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
622 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
623 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
624 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
625 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
626 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
627 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
628 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
629 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
630 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
631 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
632 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
633 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
634 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
635 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
636 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
637 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
638 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
639 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
640 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
641 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
642 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
643 2643221585 Pelomonas sp. Root662 Isolate Unclassified
644 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
645 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
646 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
647 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
648 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
649 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
650 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
651 2643221656 Pelomonas sp. Root405 Isolate Unclassified
652 2643221660 Methylibium sp. Root1272 Isolate Unclassified
653 2643221683 Variovorax sp. Root473 Isolate Unclassified
654 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
655 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
656 2738541277 Variovorax sp. GV051 Isolate Unclassified
657 2738541307 Variovorax sp. GV008 Isolate Unclassified
658 2738541337 Pelomonas sp. BT06 Isolate Unclassified
659 2738543013 Variovorax sp. BT01 Isolate Unclassified
660 2738543019 Variovorax sp. GV040 Isolate Unclassified
661 2818991446 Variovorax sp. 1180 Isolate Unclassified
662 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
663 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
664 2842677519 Variovorax sp. R-72495 Isolate Unclassified
665 2842733646 Variovorax sp. R-72446 Isolate Unclassified
666 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
667 2885198086 Variovorax sp. 679 Isolate Unclassified
668 2885211737 Variovorax sp. 553 Isolate Unclassified
669 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
670 2899924645 Variovorax sp. 369 Isolate Unclassified
671 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
672 2904456579 Variovorax sp. 2002 Isolate Unclassified
673 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
674 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
675 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
676 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
677 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
678 2928037797 Variovorax sp. 1126 Isolate Unclassified
679 2928044640 Variovorax sp. 1128 Isolate Unclassified
680 2928051484 Variovorax sp. 1133 Isolate Unclassified
681 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
682 2928070936 Variovorax gossypii 1167 Isolate Unclassified
683 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
684 2929520902 Variovorax beijingensis 502 Isolate Unclassified
685 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
686 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
687 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
688 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.61
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.19
Nodule 0.23
Rhizoplane 3.78
Rhizosphere 74.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_14154_c1 3300050508 Bacteria 6507
2 SwRhRL2b_contig_93844 2162886007 Bacteria 809
3 JGI24746J21847_1025597 3300001977 Bacteria 816
4 JGI24740J21852_10030620 3300001979 Bacteria 1748
5 JGI24740J21852_10061013 3300001979 Bacteria 1040
6 JGI24739J22299_10016035 3300001989 Bacteria 2717
7 JGI24739J22299_10125477 3300001989 Bacteria 765
8 JGI24735J21928_10247644 3300002067 Bacteria 519
9 JGI24750J21931_1076289 3300002070 Bacteria 553
10 JGI25158J39367_1004622 3300002739 Bacteria 2059
11 JGI25158J39367_1015083 3300002739 Bacteria 992
12 JGI25152J39213_1006440 3300002773 Bacteria 3204
13 JGI25150J39212_1000713 3300002774 Bacteria 11919
14 JGI25159J45721_1007232 3300002987 Bacteria 3204
15 JGI25159J45721_1009555 3300002987 Bacteria 2549
16 JGI25151J46595_10016692 3300003187 Bacteria 3204
17 JGI25153J46596_10004412 3300003215 Bacteria 7594
18 JGI25153J46596_10011494 3300003215 Bacteria 3905
19 JGI25153J46596_10012754 3300003215 Bacteria 3601
20 JGI25153J46596_10014829 3300003215 Bacteria 3215
21 JGI25153J46596_10028238 3300003215 Bacteria 1950
22 rootH1_10029168 3300003316 Bacteria 1401
23 rootH1_10056955 3300003316 Bacteria 3500
24 rootH2_10190564 3300003320 Bacteria 1403
25 rootL2_10040047 3300003322 Bacteria 3883
26 rootL2_10046934 3300003322 Bacteria 6020
27 rootL2_10150001 3300003322 Bacteria 2623
28 rootH1_10038325 3300003323 Bacteria 4703
29 rootH1_10042098 3300003323 Bacteria 5137
30 rootH1_10068314 3300003316 Bacteria 3199
31 rootH1_10068314 3300003323 Bacteria 2671
32 JGI26128J50194_1000847 3300003347 Bacteria 1832
33 JGI25160J50197_1011152 3300003354 Bacteria 3204
34 JGI25160J50197_1013627 3300003354 Bacteria 2761
35 JGI26145J50221_1025494 3300003371 Bacteria 588
36 JGI25161J50226_1003238 3300003374 Bacteria 3808
37 JGI25161J50226_1008435 3300003374 Bacteria 1588
38 Ga0006562J51391_1125153 3300003578 Bacteria 3430
39 Ga0006562J51391_1125156 3300003578 Bacteria 970
40 Ga0055532_1025643 3300003758 Bacteria 580
41 Ga0055535_1001434 3300003761 Bacteria 12127
42 Ga0055542_1000127 3300003762 Bacteria 100078
43 Ga0055526_1002532 3300003771 Bacteria 12277
44 Ga0055526_1014660 3300003771 Bacteria 3204
45 Ga0055526_1014781 3300003771 Bacteria 3183
46 Ga0055537_1005895 3300003773 Bacteria 3204
47 Ga0055537_1005952 3300003773 Bacteria 3179
48 Ga0055524_1000207 3300003775 Bacteria 63213
49 Ga0055524_1012781 3300003775 Bacteria 3204
50 Ga0055524_1015362 3300003775 Bacteria 2795
51 Ga0055536_1000530 3300003781 Bacteria 26325
52 Ga0055536_1001748 3300003781 Bacteria 12822
53 Ga0055536_1038022 3300003781 Bacteria 1171
54 Ga0055534_1003750 3300003784 Bacteria 4681
55 Ga0055534_1005868 3300003784 Bacteria 3204
56 Ga0055534_1015344 3300003784 Bacteria 1405
57 Ga0055528_1007039 3300003790 Bacteria 5027
58 Ga0055528_1013037 3300003790 Bacteria 3180
59 Ga0055528_1063074 3300003790 Bacteria 693
60 Ga0055528_1081495 3300003790 Bacteria 567
61 Ga0055530_10000464 3300003791 Bacteria 35595
62 Ga0055530_10020044 3300003791 Bacteria 2009
63 Ga0055530_10057447 3300003791 Bacteria 879
64 Ga0055530_10122084 3300003791 Bacteria 504
65 Ga0055540_1000011 3300003792 Bacteria 282927
66 Ga0055540_1000603 3300003792 Bacteria 25833
67 Ga0055540_1002445 3300003792 Bacteria 9798
68 Ga0055540_1002836 3300003792 Bacteria 8832
69 Ga0055540_1020072 3300003792 Bacteria 1780
70 Ga0055531_10001607 3300003794 Bacteria 16412
71 Ga0055531_10001895 3300003794 Bacteria 14645
72 Ga0055531_10011526 3300003794 Bacteria 4250
73 Ga0055543_1000771 3300004625 Bacteria 15959
74 Ga0055543_1003491 3300004625 Bacteria 4611
75 Ga0065165_1001786 3300005262 Bacteria 21245
76 Ga0065165_1003619 3300005262 Bacteria 10607
77 Ga0065165_1010543 3300005262 Bacteria 3973
78 Ga0065714_10276998 3300005288 Bacteria 729
79 Ga0065714_10299280 3300005288 Bacteria 682
80 Ga0065704_10100495 3300005289 Bacteria 2271
81 Ga0065704_10153191 3300005289 Bacteria 1412
82 Ga0065704_10178466 3300005289 Bacteria 1250
83 Ga0065704_10251990 3300005289 Bacteria 987
84 Ga0065704_10776945 3300005289 Bacteria 526
85 Ga0065712_10045136 3300005290 Bacteria 751
86 Ga0065712_10054430 3300005290 Bacteria 689
87 Ga0065715_10145513 3300005293 Bacteria 1794
88 Ga0065715_10245821 3300005293 Bacteria 1184
89 Ga0070658_10897051 3300005327 Bacteria 771
90 Ga0070676_10001849 3300005328 Bacteria 10793
91 Ga0070676_10019835 3300005328 Bacteria 3745
92 Ga0070676_10083237 3300005328 Bacteria 1946
93 Ga0070676_10099580 3300005328 Bacteria 1793
94 Ga0070676_10380340 3300005328 Bacteria 977
95 Ga0070676_10420234 3300005328 Bacteria 934
96 Ga0070676_10617389 3300005328 Bacteria 784
97 Ga0070676_10841459 3300005328 Bacteria 680
98 Ga0070676_11502463 3300005328 Bacteria 519
99 Ga0070683_100032863 3300005329 Bacteria 4728
100 Ga0070683_100713614 3300005329 Bacteria 960
101 Ga0070683_100935908 3300005329 Bacteria 831
102 Ga0070690_100006214 3300005330 Bacteria 6773
103 Ga0070670_100013010 3300005331 Bacteria 7128
104 Ga0070670_100037154 3300005331 Bacteria 4190
105 Ga0070670_100095571 3300005331 Bacteria 2556
106 Ga0070670_100199248 3300005331 Bacteria 1739
107 Ga0070670_100465496 3300005331 Bacteria 1121
108 Ga0070670_100545083 3300005331 Bacteria 1034
109 Ga0070670_100594711 3300005331 Bacteria 990
110 Ga0070670_100678357 3300005331 Bacteria 926
111 Ga0070670_100738722 3300005331 Bacteria 886
112 Ga0070670_100947184 3300005331 Bacteria 782
113 Ga0070670_101263339 3300005331 Bacteria 675
114 Ga0070670_101497598 3300005331 Bacteria 619
115 Ga0070670_101693075 3300005331 Bacteria 582
116 Ga0070677_10017835 3300005333 Bacteria 2547
117 Ga0070677_10033687 3300005333 Bacteria 1974
118 Ga0070677_10071030 3300005333 Bacteria 1465
119 Ga0070677_10108197 3300005333 Bacteria 1237
120 Ga0070677_10146861 3300005333 Bacteria 1093
121 Ga0070677_10241124 3300005333 Bacteria 892
122 Ga0070677_10241125 3300005333 Bacteria 892
123 Ga0070677_10481215 3300005333 Bacteria 670
124 Ga0068869_100014166 3300005334 Bacteria 5322
125 Ga0068869_100036584 3300005334 Bacteria 3486
126 Ga0068869_100067518 3300005334 Bacteria 2638
127 Ga0068869_100095143 3300005334 Bacteria 2247
128 Ga0068869_100347984 3300005334 Bacteria 1207
129 Ga0068869_100378568 3300005334 Bacteria 1159
130 Ga0068869_100447250 3300005334 Bacteria 1070
131 Ga0068869_100666018 3300005334 Bacteria 885
132 Ga0068869_101160634 3300005334 Bacteria 677
133 Ga0070666_10020373 3300005335 Bacteria 4286
134 Ga0070666_10071419 3300005335 Bacteria 2362
135 Ga0070666_10332138 3300005335 Bacteria 1086
136 Ga0070666_10689634 3300005335 Bacteria 749
137 Ga0070666_10735042 3300005335 Bacteria 725
138 Ga0070666_11311054 3300005335 Bacteria 540
139 Ga0070666_11338559 3300005335 Bacteria 535
140 Ga0070666_11453302 3300005335 Bacteria 512
141 Ga0070680_100012570 3300005336 Bacteria 6581
142 Ga0070680_100121871 3300005336 Bacteria 2177
143 Ga0070680_100130032 3300005336 Bacteria 2106
144 Ga0070680_101068157 3300005336 Bacteria 698
145 Ga0068868_100003711 3300005338 Bacteria 10664
146 Ga0068868_100052781 3300005338 Bacteria 3200
147 Ga0068868_100058644 3300005338 Bacteria 3043
148 Ga0068868_100059788 3300005338 Bacteria 3015
149 Ga0068868_100140028 3300005338 Bacteria 1985
150 Ga0068868_100205867 3300005338 Bacteria 1642
151 Ga0068868_100233241 3300005338 Bacteria 1544
152 Ga0068868_100322318 3300005338 Bacteria 1317
153 Ga0068868_100362665 3300005338 Bacteria 1243
154 Ga0068868_100982060 3300005338 Bacteria 771
155 Ga0068868_101411987 3300005338 Bacteria 649
156 Ga0068868_102317947 3300005338 Bacteria 512
157 Ga0068868_102431744 3300005338 Bacteria 500
158 Ga0070660_100002224 3300005339 Bacteria 13368
159 Ga0070660_101270341 3300005339 Bacteria 625
160 Ga0070660_101583083 3300005339 Bacteria 557
161 Ga0070660_101863067 3300005339 Bacteria 513
162 Ga0070689_100021223 3300005340 Bacteria 4830
163 Ga0070689_101343224 3300005340 Bacteria 645
164 Ga0070691_10522081 3300005341 Bacteria 690
165 Ga0070687_100038494 3300005343 Bacteria 2397
166 Ga0070687_100496478 3300005343 Bacteria 821
167 Ga0070687_100518213 3300005343 Bacteria 806
168 Ga0070687_101353116 3300005343 Bacteria 530
169 Ga0070687_101443009 3300005343 Bacteria 516
170 Ga0070661_100005152 3300005344 Bacteria 9001
171 Ga0070661_100042215 3300005344 Bacteria 3328
172 Ga0070661_100219593 3300005344 Bacteria 1458
173 Ga0070661_100597918 3300005344 Bacteria 892
174 Ga0070661_100783587 3300005344 Bacteria 781
175 Ga0070668_100013101 3300005347 Bacteria 6179
176 Ga0070668_100130926 3300005347 Bacteria 2013
177 Ga0070668_100246169 3300005347 Bacteria 1482
178 Ga0070668_100467784 3300005347 Bacteria 1087
179 Ga0070668_100583008 3300005347 Bacteria 976
180 Ga0070668_100617705 3300005347 Bacteria 950
181 Ga0070669_100015642 3300005353 Bacteria 5410
182 Ga0070669_100071256 3300005353 Bacteria 2571
183 Ga0070669_100097794 3300005353 Bacteria 2210
184 Ga0070669_100160545 3300005353 Bacteria 1746
185 Ga0070669_100426231 3300005353 Bacteria 1089
186 Ga0070669_100704995 3300005353 Bacteria 852
187 Ga0070669_101135656 3300005353 Bacteria 674
188 Ga0070669_101481984 3300005353 Bacteria 590
189 Ga0070669_101570594 3300005353 Bacteria 572
190 Ga0070675_100000250 3300005354 Bacteria 34971
191 Ga0070675_100003213 3300005354 Bacteria 12380
192 Ga0070675_100011215 3300005354 Bacteria 7015
193 Ga0070675_100012571 3300005354 Bacteria 6636
194 Ga0070675_100018746 3300005354 Bacteria 5508
195 Ga0070675_100025359 3300005354 Bacteria 4754
196 Ga0070675_100114393 3300005354 Bacteria 2286
197 Ga0070675_100171767 3300005354 Bacteria 1870
198 Ga0070675_100207755 3300005354 Bacteria 1701
199 Ga0070675_100326159 3300005354 Bacteria 1357
200 Ga0070675_100419443 3300005354 Bacteria 1196
201 Ga0070675_100571434 3300005354 Bacteria 1024
202 Ga0070675_101423761 3300005354 Bacteria 639
203 Ga0070675_101469976 3300005354 Bacteria 628
204 Ga0070675_101820912 3300005354 Bacteria 561
205 Ga0070671_100006682 3300005355 Bacteria 9222
206 Ga0070671_100126528 3300005355 Bacteria 2151
207 Ga0070671_100152385 3300005355 Bacteria 1952
208 Ga0070671_100202994 3300005355 Bacteria 1681
209 Ga0070671_100315170 3300005355 Bacteria 1333
210 Ga0070671_100440500 3300005355 Bacteria 1117
211 Ga0070671_100656227 3300005355 Bacteria 908
212 Ga0070671_101156220 3300005355 Bacteria 680
213 Ga0070671_101169761 3300005355 Bacteria 676
214 Ga0070671_101200285 3300005355 Bacteria 668
215 Ga0070671_101970988 3300005355 Bacteria 520
216 Ga0070671_102000250 3300005355 Bacteria 516
217 Ga0070674_100002846 3300005356 Bacteria 9563
218 Ga0070674_100029632 3300005356 Bacteria 3608
219 Ga0070674_100038484 3300005356 Bacteria 3223
220 Ga0070674_100233224 3300005356 Bacteria 1437
221 Ga0070674_100792281 3300005356 Bacteria 818
222 Ga0070674_101416738 3300005356 Bacteria 623
223 Ga0070674_101536814 3300005356 Bacteria 599
224 Ga0070674_101616631 3300005356 Bacteria 585
225 Ga0070674_101700792 3300005356 Bacteria 570
226 Ga0070673_100027009 3300005364 Bacteria 4249
227 Ga0070673_100073056 3300005364 Bacteria 2760
228 Ga0070673_100102804 3300005364 Bacteria 2356
229 Ga0070673_100164539 3300005364 Bacteria 1889
230 Ga0070673_100260429 3300005364 Bacteria 1515
231 Ga0070673_100274931 3300005364 Bacteria 1475
232 Ga0070673_100329470 3300005364 Bacteria 1350
233 Ga0070673_100490950 3300005364 Bacteria 1109
234 Ga0070673_100768445 3300005364 Bacteria 888
235 Ga0070673_101126854 3300005364 Bacteria 733
236 Ga0070688_100004925 3300005365 Bacteria 6988
237 Ga0070688_100578414 3300005365 Bacteria 857
238 Ga0070688_100648628 3300005365 Bacteria 813
239 Ga0070688_101656546 3300005365 Bacteria 523
240 Ga0070659_100008671 3300005366 Bacteria 7436
241 Ga0070659_100011205 3300005366 Bacteria 6625
242 Ga0070659_100051316 3300005366 Bacteria 3243
243 Ga0070659_100510243 3300005366 Bacteria 1026
244 Ga0070659_100710562 3300005366 Bacteria 869
245 Ga0070659_100882452 3300005366 Bacteria 781
246 Ga0070659_101020976 3300005366 Bacteria 726
247 Ga0070659_101026845 3300005366 Bacteria 724
248 Ga0070659_101090530 3300005366 Bacteria 703
249 Ga0070667_100039183 3300005367 Bacteria 3971
250 Ga0070667_100257230 3300005367 Bacteria 1562
251 Ga0070667_100334063 3300005367 Bacteria 1370
252 Ga0070667_100334570 3300005367 Bacteria 1369
253 Ga0070667_100354680 3300005367 Bacteria 1328
254 Ga0070667_100533371 3300005367 Bacteria 1078
255 Ga0070667_100958035 3300005367 Bacteria 798
256 Ga0070667_100989473 3300005367 Bacteria 784
257 Ga0070667_101176329 3300005367 Bacteria 718
258 Ga0070667_101205557 3300005367 Bacteria 708
259 Ga0070667_101609601 3300005367 Bacteria 610
260 Ga0070667_101677350 3300005367 Bacteria 598
261 Ga0070667_102151080 3300005367 Bacteria 526
262 Ga0070703_10571995 3300005406 Bacteria 518
263 Ga0070709_10084240 3300005434 Bacteria 2082
264 Ga0070714_100003247 3300005435 Bacteria 12099
265 Ga0070713_100255447 3300005436 Bacteria 1600
266 Ga0070713_102202206 3300005436 Bacteria 534
267 Ga0070710_10151357 3300005437 Bacteria 1431
268 Ga0070710_10918525 3300005437 Bacteria 633
269 Ga0070701_10500696 3300005438 Bacteria 789
270 Ga0070701_10595090 3300005438 Bacteria 732
271 Ga0070711_100892482 3300005439 Bacteria 758
272 Ga0070705_100393727 3300005440 Bacteria 1024
273 Ga0070700_101212675 3300005441 Bacteria 630
274 Ga0070708_100063831 3300005445 Bacteria 3298
275 Ga0070708_101003617 3300005445 Bacteria 783
276 Ga0070663_100003281 3300005455 Bacteria 9317
277 Ga0070663_100196930 3300005455 Bacteria 1570
278 Ga0070663_100290568 3300005455 Bacteria 1305
279 Ga0070663_100316389 3300005455 Bacteria 1254
280 Ga0070663_100974126 3300005455 Bacteria 736
281 Ga0070663_101134196 3300005455 Bacteria 685
282 Ga0070663_101300241 3300005455 Bacteria 641
283 Ga0070663_101584809 3300005455 Bacteria 584
284 Ga0070663_101716594 3300005455 Bacteria 562
285 Ga0070678_100053998 3300005456 Bacteria 2925
286 Ga0070678_100060240 3300005456 Bacteria 2793
287 Ga0070678_100074682 3300005456 Bacteria 2549
288 Ga0070678_100080841 3300005456 Bacteria 2462
289 Ga0070678_100086444 3300005456 Bacteria 2392
290 Ga0070678_100093252 3300005456 Bacteria 2315
291 Ga0070678_100097628 3300005456 Bacteria 2269
292 Ga0070678_100226044 3300005456 Bacteria 1558
293 Ga0070678_100417015 3300005456 Bacteria 1169
294 Ga0070678_100435618 3300005456 Bacteria 1145
295 Ga0070678_100736692 3300005456 Bacteria 890
296 Ga0070678_100964237 3300005456 Bacteria 782
297 Ga0070678_100974049 3300005456 Bacteria 778
298 Ga0070678_101332825 3300005456 Bacteria 669
299 Ga0070678_101701187 3300005456 Bacteria 594
300 Ga0070678_101707733 3300005456 Bacteria 592
301 Ga0070678_101961243 3300005456 Bacteria 553
302 Ga0070678_102104866 3300005456 Bacteria 535
303 Ga0070662_100013275 3300005457 Bacteria 5479
304 Ga0070662_100043528 3300005457 Bacteria 3213
305 Ga0070662_100052894 3300005457 Bacteria 2938
306 Ga0070662_100127998 3300005457 Bacteria 1954
307 Ga0070662_100262606 3300005457 Bacteria 1391
308 Ga0070662_100287034 3300005457 Bacteria 1333
309 Ga0070662_100418097 3300005457 Bacteria 1109
310 Ga0070662_100576707 3300005457 Bacteria 945
311 Ga0070662_100596614 3300005457 Bacteria 929
312 Ga0070662_100598633 3300005457 Bacteria 927
313 Ga0070662_100896512 3300005457 Bacteria 756
314 Ga0070662_101444633 3300005457 Bacteria 593
315 Ga0070662_101616173 3300005457 Bacteria 559
316 Ga0070662_101678461 3300005457 Bacteria 548
317 Ga0070681_10170120 3300005458 Bacteria 2101
318 Ga0070681_10265946 3300005458 Bacteria 1626
319 Ga0068867_100000329 3300005459 Bacteria 31296
320 Ga0068867_100001932 3300005459 Bacteria 14439
321 Ga0068867_100020667 3300005459 Bacteria 4691
322 Ga0068867_100056082 3300005459 Bacteria 2914
323 Ga0068867_100102861 3300005459 Bacteria 2184
324 Ga0068867_100115742 3300005459 Bacteria 2065
325 Ga0068867_100178615 3300005459 Bacteria 1686
326 Ga0068867_100248108 3300005459 Bacteria 1447
327 Ga0068867_100422376 3300005459 Bacteria 1129
328 Ga0068867_100548975 3300005459 Bacteria 1001
329 Ga0068867_100623126 3300005459 Bacteria 943
330 Ga0068867_100691947 3300005459 Bacteria 899
331 Ga0068867_100944551 3300005459 Bacteria 778
332 Ga0068867_101049289 3300005459 Bacteria 741
333 Ga0068867_101129962 3300005459 Bacteria 716
334 Ga0070685_10693949 3300005466 Bacteria 742
335 Ga0070685_10833306 3300005466 Bacteria 682
336 Ga0070685_11177346 3300005466 Bacteria 582
337 Ga0070685_11588165 3300005466 Bacteria 506
338 Ga0070706_100004486 3300005467 Bacteria 13456
339 Ga0070706_100096620 3300005467 Bacteria 2743
340 Ga0070707_100355610 3300005468 Bacteria 1422
341 Ga0070698_100138790 3300005471 Bacteria 2384
342 Ga0070699_101436279 3300005518 Bacteria 633
343 Ga0070679_100043614 3300005530 Bacteria 4466
344 Ga0070679_100212093 3300005530 Bacteria 1900
345 Ga0070679_100241396 3300005530 Bacteria 1764
346 Ga0070679_100475313 3300005530 Bacteria 1194
347 Ga0070679_101126452 3300005530 Bacteria 730
348 Ga0070684_100181994 3300005535 Bacteria 1911
349 Ga0070684_100202985 3300005535 Bacteria 1806
350 Ga0070684_100775796 3300005535 Bacteria 895
351 Ga0070684_102145738 3300005535 Bacteria 527
352 Ga0068853_100004811 3300005539 Bacteria 10499
353 Ga0068853_100007795 3300005539 Bacteria 8588
354 Ga0068853_100010420 3300005539 Bacteria 7521
355 Ga0068853_100105575 3300005539 Bacteria 2496
356 Ga0068853_100160997 3300005539 Bacteria 2025
357 Ga0068853_100281317 3300005539 Bacteria 1534
358 Ga0068853_100490057 3300005539 Bacteria 1159
359 Ga0068853_100522230 3300005539 Bacteria 1122
360 Ga0070672_100001451 3300005543 Bacteria 14681
361 Ga0070672_100015547 3300005543 Bacteria 5423
362 Ga0070672_100021276 3300005543 Bacteria 4744
363 Ga0070672_100027777 3300005543 Bacteria 4224
364 Ga0070672_100030773 3300005543 Bacteria 4036
365 Ga0070672_100033709 3300005543 Bacteria 3880
366 Ga0070672_100042276 3300005543 Bacteria 3508
367 Ga0070672_100135479 3300005543 Bacteria 2028
368 Ga0070672_100318781 3300005543 Bacteria 1321
369 Ga0070672_100332166 3300005543 Bacteria 1293
370 Ga0070672_100412143 3300005543 Bacteria 1159
371 Ga0070672_100572100 3300005543 Bacteria 982
372 Ga0070672_101391110 3300005543 Bacteria 627
373 Ga0070695_100085874 3300005545 Bacteria 2090
374 Ga0070693_100026317 3300005547 Bacteria 3140
375 Ga0070693_100629876 3300005547 Bacteria 778
376 Ga0070665_100543803 3300005548 Bacteria 1173
377 Ga0070665_100790261 3300005548 Bacteria 962
378 Ga0070665_100853711 3300005548 Bacteria 923
379 Ga0070665_101205973 3300005548 Bacteria 767
380 Ga0070665_102467209 3300005548 Bacteria 522
381 Ga0068855_100015899 3300005563 Bacteria 9053
382 Ga0068855_100019544 3300005563 Bacteria 8138
383 Ga0068855_100399137 3300005563 Bacteria 1507
384 Ga0068855_100409839 3300005563 Bacteria 1484
385 Ga0068855_100546779 3300005563 Bacteria 1254
386 Ga0070664_100001831 3300005564 Bacteria 17028
387 Ga0070664_100040136 3300005564 Bacteria 3945
388 Ga0070664_100148636 3300005564 Bacteria 2067
389 Ga0070664_100230636 3300005564 Bacteria 1659
390 Ga0070664_100262430 3300005564 Bacteria 1554
391 Ga0070664_100285705 3300005564 Bacteria 1488
392 Ga0070664_100512445 3300005564 Bacteria 1106
393 Ga0070664_100832791 3300005564 Bacteria 863
394 Ga0070664_101046865 3300005564 Bacteria 768
395 Ga0070664_101047334 3300005564 Bacteria 767
396 Ga0070664_101638866 3300005564 Bacteria 609
397 Ga0070664_102223047 3300005564 Bacteria 520
398 Ga0068857_100001323 3300005577 Bacteria 19468
399 Ga0068857_100188666 3300005577 Bacteria 1877
400 Ga0068857_100220281 3300005577 Bacteria 1733
401 Ga0068857_100804946 3300005577 Bacteria 897
402 Ga0068857_100923447 3300005577 Bacteria 838
403 Ga0068857_101427885 3300005577 Bacteria 673
404 Ga0068857_102188780 3300005577 Bacteria 543
405 Ga0068854_100014719 3300005578 Bacteria 5162
406 Ga0068854_100499034 3300005578 Bacteria 1025
407 Ga0068854_100691507 3300005578 Bacteria 879
408 Ga0068854_100801982 3300005578 Bacteria 821
409 Ga0068856_100012520 3300005614 Bacteria 8213
410 Ga0068856_100234744 3300005614 Bacteria 1849
411 Ga0068856_100588995 3300005614 Bacteria 1133
412 Ga0070702_100330559 3300005615 Bacteria 1066
413 Ga0070702_100390308 3300005615 Bacteria 992
414 Ga0070702_100970483 3300005615 Bacteria 670
415 Ga0070702_101678808 3300005615 Bacteria 527
416 Ga0068852_100003059 3300005616 Bacteria 11640
417 Ga0068852_100003215 3300005616 Bacteria 11409
418 Ga0068852_100005883 3300005616 Bacteria 8816
419 Ga0068852_100060508 3300005616 Bacteria 3287
420 Ga0068852_100063413 3300005616 Bacteria 3218
421 Ga0068852_100081438 3300005616 Bacteria 2873
422 Ga0068852_100085851 3300005616 Bacteria 2804
423 Ga0068852_100281484 3300005616 Bacteria 1603
424 Ga0068852_100289797 3300005616 Bacteria 1581
425 Ga0068852_100338183 3300005616 Bacteria 1466
426 Ga0068852_100429912 3300005616 Bacteria 1304
427 Ga0068852_100496905 3300005616 Bacteria 1214
428 Ga0068852_100623488 3300005616 Bacteria 1084
429 Ga0068852_100877640 3300005616 Bacteria 913
430 Ga0068852_100944013 3300005616 Bacteria 880
431 Ga0068852_101778848 3300005616 Bacteria 639
432 Ga0068852_101993761 3300005616 Bacteria 603
433 Ga0068852_102203231 3300005616 Bacteria 572
434 Ga0068852_102555406 3300005616 Bacteria 530
435 Ga0068859_100024423 3300005617 Bacteria 6063
436 Ga0068859_100030871 3300005617 Bacteria 5377
437 Ga0068859_100205505 3300005617 Bacteria 2054
438 Ga0068859_100420551 3300005617 Bacteria 1433
439 Ga0068864_100003978 3300005618 Bacteria 12169
440 Ga0068864_100026806 3300005618 Bacteria 4860
441 Ga0068864_100070862 3300005618 Bacteria 3034
442 Ga0068864_100074432 3300005618 Bacteria 2963
443 Ga0068864_100186642 3300005618 Bacteria 1898
444 Ga0068864_100507830 3300005618 Bacteria 1161
445 Ga0068864_100959443 3300005618 Bacteria 846
446 Ga0068864_102179872 3300005618 Bacteria 560
447 Ga0068864_102491605 3300005618 Bacteria 523
448 Ga0068866_10010148 3300005718 Bacteria 4027
449 Ga0068866_10092812 3300005718 Bacteria 1648
450 Ga0068866_10246875 3300005718 Bacteria 1090
451 Ga0068866_10624189 3300005718 Bacteria 731
452 Ga0068861_100007969 3300005719 Bacteria 7292
453 Ga0068861_100050459 3300005719 Bacteria 3155
454 Ga0068861_100252792 3300005719 Bacteria 1505
455 Ga0068861_100566595 3300005719 Bacteria 1037
456 Ga0068861_100754860 3300005719 Bacteria 909
457 Ga0068861_101024062 3300005719 Bacteria 789
458 Ga0068861_101437731 3300005719 Bacteria 675
459 Ga0068861_102366491 3300005719 Bacteria 534
460 Ga0068851_10010993 3300005834 Bacteria 4236
461 Ga0068851_10013080 3300005834 Bacteria 3924
462 Ga0068851_10049026 3300005834 Bacteria 2141
463 Ga0068851_10061522 3300005834 Bacteria 1924
464 Ga0068851_10110219 3300005834 Bacteria 1468
465 Ga0068851_10232097 3300005834 Bacteria 1041
466 Ga0068851_10365005 3300005834 Bacteria 843
467 Ga0068851_10403524 3300005834 Bacteria 804
468 Ga0068851_10871972 3300005834 Bacteria 562
469 Ga0068870_10184872 3300005840 Bacteria 1254
470 Ga0068870_10286484 3300005840 Bacteria 1035
471 Ga0068870_10433751 3300005840 Bacteria 862
472 Ga0068863_100019694 3300005841 Bacteria 6454
473 Ga0068863_100076202 3300005841 Bacteria 3173
474 Ga0068863_100160408 3300005841 Bacteria 2154
475 Ga0068863_100294731 3300005841 Bacteria 1573
476 Ga0068863_100352912 3300005841 Bacteria 1432
477 Ga0068863_100587577 3300005841 Bacteria 1101
478 Ga0068863_102685320 3300005841 Bacteria 507
479 Ga0068858_100001515 3300005842 Bacteria 23851
480 Ga0068858_100001818 3300005842 Bacteria 21717
481 Ga0068858_100003704 3300005842 Bacteria 15140
482 Ga0068860_100001009 3300005843 Bacteria 31175
483 Ga0068860_100003030 3300005843 Bacteria 17343
484 Ga0068860_100057253 3300005843 Bacteria 3705
485 Ga0068860_100249680 3300005843 Bacteria 1727
486 Ga0068860_100730483 3300005843 Bacteria 1001
487 Ga0068860_102665865 3300005843 Bacteria 519
488 Ga0068862_100036617 3300005844 Bacteria 4159
489 Ga0068862_100243673 3300005844 Bacteria 1636
490 Ga0068862_101222035 3300005844 Bacteria 751
491 Ga0070717_10994756 3300006028 Bacteria 764
492 Ga0075365_10270767 3300006038 Bacteria 1194
493 Ga0075368_10069600 3300006042 Bacteria 1419
494 Ga0075363_100009238 3300006048 Bacteria 4630
495 Ga0075363_100131110 3300006048 Bacteria 1406
496 Ga0075363_100157455 3300006048 Bacteria 1285
497 Ga0075363_100301776 3300006048 Bacteria 929
498 Ga0075364_10002974 3300006051 Bacteria 9569
499 Ga0075364_10121068 3300006051 Bacteria 1751
500 Ga0075364_10187923 3300006051 Bacteria 1399
501 Ga0070715_10214039 3300006163 Bacteria 987
502 Ga0070716_100205061 3300006173 Bacteria 1313
503 Ga0070716_100776094 3300006173 Bacteria 740
504 Ga0070712_101297678 3300006175 Bacteria 634
505 Ga0075362_10010715 3300006177 Bacteria 3588
506 Ga0075362_10021615 3300006177 Bacteria 2703
507 Ga0075362_10064250 3300006177 Bacteria 1665
508 Ga0075362_10162263 3300006177 Bacteria 1077
509 Ga0075362_10173547 3300006177 Bacteria 1042
510 Ga0075362_10190963 3300006177 Bacteria 995
511 Ga0075362_10409447 3300006177 Bacteria 685
512 Ga0075362_10434037 3300006177 Bacteria 666
513 Ga0075362_10500658 3300006177 Bacteria 621
514 Ga0075362_10516424 3300006177 Bacteria 612
515 Ga0075362_10672741 3300006177 Bacteria 539
516 Ga0075367_10015588 3300006178 Bacteria 4137
517 Ga0075367_10033387 3300006178 Bacteria 2965
518 Ga0075367_10056015 3300006178 Bacteria 2341
519 Ga0075367_10078408 3300006178 Bacteria 1995
520 Ga0075367_10389942 3300006178 Bacteria 880
521 Ga0075369_10007815 3300006186 Bacteria 4091
522 Ga0075369_10013367 3300006186 Bacteria 3258
523 Ga0075369_10104184 3300006186 Bacteria 1275
524 Ga0075369_10408093 3300006186 Bacteria 641
525 Ga0075366_10025896 3300006195 Bacteria 3431
526 Ga0075366_10046947 3300006195 Bacteria 2559
527 Ga0075366_10058370 3300006195 Bacteria 2292
528 Ga0075366_10083646 3300006195 Bacteria 1907
529 Ga0075366_10124788 3300006195 Bacteria 1552
530 Ga0075366_10179318 3300006195 Bacteria 1286
531 Ga0075366_10251270 3300006195 Bacteria 1078
532 Ga0075366_10317687 3300006195 Bacteria 954
533 Ga0075366_10371893 3300006195 Bacteria 878
534 Ga0075366_10479410 3300006195 Bacteria 768
535 Ga0075366_10485219 3300006195 Bacteria 764
536 Ga0075366_10577374 3300006195 Bacteria 696
537 Ga0075366_10638500 3300006195 Bacteria 660
538 Ga0075366_10859577 3300006195 Bacteria 565
539 Ga0075366_10944258 3300006195 Bacteria 538
540 Ga0097621_100016134 3300006237 Bacteria 5640
541 Ga0097621_100056447 3300006237 Bacteria 3208
542 Ga0097621_100096593 3300006237 Bacteria 2479
543 Ga0097621_100104372 3300006237 Bacteria 2388
544 Ga0097621_100406286 3300006237 Bacteria 1220
545 Ga0097621_100566255 3300006237 Bacteria 1035
546 Ga0097621_101293660 3300006237 Bacteria 688
547 Ga0097621_101392461 3300006237 Bacteria 664
548 Ga0075370_10000524 3300006353 Bacteria 14643
549 Ga0075370_10002753 3300006353 Bacteria 8237
550 Ga0075370_10010292 3300006353 Bacteria 4886
551 Ga0075370_10014590 3300006353 Bacteria 4194
552 Ga0075370_10024961 3300006353 Bacteria 3304
553 Ga0075370_10054018 3300006353 Bacteria 2280
554 Ga0075370_10104776 3300006353 Bacteria 1639
555 Ga0075370_10130104 3300006353 Bacteria 1468
556 Ga0075370_10137636 3300006353 Bacteria 1427
557 Ga0075370_10182783 3300006353 Bacteria 1234
558 Ga0075370_10194837 3300006353 Bacteria 1195
559 Ga0075370_10198370 3300006353 Bacteria 1183
560 Ga0075370_10321799 3300006353 Bacteria 921
561 Ga0075370_10440707 3300006353 Bacteria 783
562 Ga0075370_10479758 3300006353 Bacteria 749
563 Ga0075370_10505437 3300006353 Bacteria 729
564 Ga0075370_10511414 3300006353 Bacteria 725
565 Ga0075370_10656904 3300006353 Bacteria 636
566 Ga0075370_10795353 3300006353 Bacteria 576
567 Ga0068871_100083637 3300006358 Bacteria 2647
568 Ga0068871_100163910 3300006358 Bacteria 1902
569 Ga0068871_100183476 3300006358 Bacteria 1799
570 Ga0068871_100321654 3300006358 Bacteria 1362
571 Ga0068871_100518079 3300006358 Bacteria 1076
572 Ga0068871_100886165 3300006358 Bacteria 826
573 Ga0068871_100890569 3300006358 Bacteria 824
574 Ga0068871_101112981 3300006358 Bacteria 739
575 Ga0068871_101214269 3300006358 Bacteria 707
576 Ga0068871_101446739 3300006358 Bacteria 648
577 Ga0068871_101757230 3300006358 Bacteria 589
578 Ga0075428_100529609 3300006844 Bacteria 1260
579 Ga0075428_101653622 3300006844 Bacteria 669
580 Ga0075430_100023009 3300006846 Bacteria 5300
581 Ga0075434_100130115 3300006871 Bacteria 2535
582 Ga0075429_100008966 3300006880 Bacteria 8689
583 Ga0068865_100091831 3300006881 Bacteria 2204
584 Ga0068865_100097410 3300006881 Bacteria 2147
585 Ga0068865_100112935 3300006881 Bacteria 2007
586 Ga0068865_100367678 3300006881 Bacteria 1169
587 Ga0068865_100546026 3300006881 Bacteria 972
588 Ga0097620_100024424 3300006931 Bacteria 6063
589 Ga0097620_100030873 3300006931 Bacteria 5377
590 Ga0097620_100205485 3300006931 Bacteria 2054
591 Ga0097620_100420551 3300006931 Bacteria 1433
592 Ga0079104_1000040 3300006946 Bacteria 187962
593 Ga0079104_1044093 3300006946 Bacteria 1024
594 Ga0099826_10238378 3300006948 Bacteria 967
595 Ga0105251_10343262 3300009011 Bacteria 681
596 Ga0105244_10026422 3300009036 Bacteria 3142
597 Ga0105244_10480951 3300009036 Bacteria 571
598 Ga0105240_10002903 3300009093 Bacteria 27043
599 Ga0105240_10030212 3300009093 Bacteria 7045
600 Ga0105240_10039246 3300009093 Bacteria 6065
601 Ga0105240_10183372 3300009093 Bacteria 2468
602 Ga0105240_10221428 3300009093 Bacteria 2204
603 Ga0105240_10721263 3300009093 Bacteria 1086
604 Ga0111539_10492911 3300009094 Bacteria 1427
605 Ga0111539_10542458 3300009094 Bacteria 1355
606 Ga0111539_10867708 3300009094 Bacteria 1050
607 Ga0105245_10008631 3300009098 Bacteria 8888
608 Ga0105245_10049840 3300009098 Bacteria 3751
609 Ga0105245_10061364 3300009098 Bacteria 3388
610 Ga0105245_10293445 3300009098 Bacteria 1593
611 Ga0105245_11520681 3300009098 Bacteria 720
612 Ga0105245_12155683 3300009098 Bacteria 611
613 Ga0105247_10237932 3300009101 Bacteria 1239
614 Ga0105247_10253737 3300009101 Bacteria 1203
615 Ga0105247_10947597 3300009101 Bacteria 668
616 Ga0114129_10023973 3300009147 Bacteria 8647
617 Ga0114129_10267738 3300009147 Bacteria 2287
618 Ga0105243_10000197 3300009148 Bacteria 70941
619 Ga0105243_10008438 3300009148 Bacteria 7910
620 Ga0105243_10013128 3300009148 Bacteria 6260
621 Ga0105243_10083870 3300009148 Bacteria 2608
622 Ga0105243_10312678 3300009148 Bacteria 1428
623 Ga0105243_10475551 3300009148 Bacteria 1178
624 Ga0105243_11079602 3300009148 Bacteria 810
625 Ga0105243_11459518 3300009148 Bacteria 706
626 Ga0105243_12658700 3300009148 Bacteria 540
627 Ga0105241_10086637 3300009174 Bacteria 2463
628 Ga0105241_10191455 3300009174 Bacteria 1703
629 Ga0105241_10669885 3300009174 Bacteria 944
630 Ga0105241_11599311 3300009174 Bacteria 630
631 Ga0105241_11902796 3300009174 Bacteria 583
632 Ga0105242_10058974 3300009176 Bacteria 3148
633 Ga0105242_10282573 3300009176 Bacteria 1508
634 Ga0105242_10339727 3300009176 Bacteria 1383
635 Ga0105242_11759390 3300009176 Bacteria 657
636 Ga0105242_12123191 3300009176 Bacteria 606
637 Ga0105248_10013699 3300009177 Bacteria 8926
638 Ga0105248_10031936 3300009177 Bacteria 5884
639 Ga0105248_10285735 3300009177 Bacteria 1857
640 Ga0105248_10446577 3300009177 Bacteria 1457
641 Ga0105248_10459956 3300009177 Bacteria 1434
642 Ga0105248_10754462 3300009177 Bacteria 1098
643 Ga0105248_10989899 3300009177 Bacteria 950
644 Ga0105248_11718831 3300009177 Bacteria 711
645 Ga0105248_11948689 3300009177 Bacteria 667
646 Ga0105237_10000605 3300009545 Bacteria 50037
647 Ga0105237_10014977 3300009545 Bacteria 8082
648 Ga0105237_10021204 3300009545 Bacteria 6682
649 Ga0105237_10024647 3300009545 Bacteria 6153
650 Ga0105237_10035003 3300009545 Bacteria 5082
651 Ga0105237_10073055 3300009545 Bacteria 3423
652 Ga0105237_10452160 3300009545 Bacteria 1290
653 Ga0105238_10001575 3300009551 Bacteria 22864
654 Ga0105238_10028942 3300009551 Bacteria 5642
655 Ga0105238_10307061 3300009551 Bacteria 1571
656 Ga0105238_10378039 3300009551 Bacteria 1407
657 Ga0105238_10393781 3300009551 Bacteria 1378
658 Ga0105238_10483868 3300009551 Bacteria 1237
659 Ga0105238_10898267 3300009551 Bacteria 904
660 Ga0105249_10138150 3300009553 Bacteria 2334
661 Ga0105249_10394623 3300009553 Bacteria 1413
662 Ga0105249_10755732 3300009553 Bacteria 1034
663 Ga0105249_10957132 3300009553 Bacteria 924
664 Ga0105249_10978956 3300009553 Bacteria 914
665 Ga0105249_12241215 3300009553 Bacteria 619
666 Ga0105239_10000328 3300010375 Bacteria 70165
667 Ga0105239_10026320 3300010375 Bacteria 6401
668 Ga0105239_10031452 3300010375 Bacteria 5836
669 Ga0105239_10114097 3300010375 Bacteria 2997
670 Ga0105239_11237406 3300010375 Bacteria 861
671 Ga0105246_10153471 3300011119 Bacteria 1746
672 Ga0105246_10439382 3300011119 Bacteria 1094
673 Ga0105246_10458010 3300011119 Bacteria 1073
674 Ga0105246_10616419 3300011119 Bacteria 940
675 Ga0105246_11820562 3300011119 Bacteria 582
676 Ga0105246_12419946 3300011119 Bacteria 515
677 Ga0157317_1005765 3300012475 Bacteria 846
678 Ga0157328_1027883 3300012478 Bacteria 518
679 Ga0157337_1031094 3300012483 Bacteria 547
680 Ga0157325_1015900 3300012485 Bacteria 620
681 Ga0157329_1014777 3300012491 Bacteria 667
682 Ga0157323_1004876 3300012495 Bacteria 877
683 Ga0157314_1005685 3300012500 Bacteria 954
684 Ga0157315_1034929 3300012508 Bacteria 610
685 Ga0157316_1005909 3300012510 Bacteria 985
686 Ga0157327_1046621 3300012512 Bacteria 602
687 Ga0157338_1059789 3300012515 Bacteria 569
688 Ga0157373_10009706 3300013100 Bacteria 7104
689 Ga0157373_10020413 3300013100 Bacteria 4815
690 Ga0157373_10213609 3300013100 Bacteria 1360
691 Ga0157373_10329462 3300013100 Bacteria 1087
692 Ga0157373_10371991 3300013100 Bacteria 1021
693 Ga0157373_11023067 3300013100 Bacteria 617
694 Ga0157373_11092864 3300013100 Bacteria 598
695 Ga0157371_10034557 3300013102 Bacteria 3626
696 Ga0157371_10094994 3300013102 Bacteria 2113
697 Ga0157371_10095280 3300013102 Bacteria 2109
698 Ga0157371_10907224 3300013102 Bacteria 668
699 Ga0157371_11150079 3300013102 Bacteria 597
700 Ga0157371_11595439 3300013102 Bacteria 511
701 Ga0157370_10026238 3300013104 Bacteria 5756
702 Ga0157370_10233816 3300013104 Bacteria 1701
703 Ga0157370_10653068 3300013104 Bacteria 961
704 Ga0157370_11467787 3300013104 Bacteria 613
705 Ga0157370_11660903 3300013104 Bacteria 574
706 Ga0157370_11811047 3300013104 Bacteria 548
707 Ga0157370_12092579 3300013104 Bacteria 507
708 Ga0157369_10014064 3300013105 Bacteria 9040
709 Ga0157369_10014312 3300013105 Bacteria 8961
710 Ga0157369_10298892 3300013105 Bacteria 1675
711 Ga0157369_10957638 3300013105 Bacteria 877
712 Ga0157374_10007375 3300013296 Bacteria 9379
713 Ga0157374_10047442 3300013296 Bacteria 3983
714 Ga0157374_10074924 3300013296 Bacteria 3197
715 Ga0157374_10202503 3300013296 Bacteria 1944
716 Ga0157374_10765796 3300013296 Bacteria 980
717 Ga0157374_10994380 3300013296 Bacteria 858
718 Ga0157374_11476736 3300013296 Bacteria 703
719 Ga0157374_12492433 3300013296 Bacteria 545
720 Ga0157378_10113037 3300013297 Bacteria 2492
721 Ga0157378_10138443 3300013297 Bacteria 2259
722 Ga0157378_10754387 3300013297 Bacteria 996
723 Ga0157378_11027931 3300013297 Bacteria 859
724 Ga0157378_11150283 3300013297 Bacteria 814
725 Ga0157378_11505132 3300013297 Bacteria 718
726 Ga0163162_10023275 3300013306 Bacteria 6113
727 Ga0163162_10060967 3300013306 Bacteria 3810
728 Ga0163162_10080866 3300013306 Bacteria 3319
729 Ga0163162_10128822 3300013306 Bacteria 2638
730 Ga0163162_10218886 3300013306 Bacteria 2034
731 Ga0163162_10696994 3300013306 Bacteria 1137
732 Ga0163162_10816582 3300013306 Bacteria 1049
733 Ga0163162_11052362 3300013306 Bacteria 921
734 Ga0163162_11054926 3300013306 Bacteria 920
735 Ga0163162_11324107 3300013306 Bacteria 819
736 Ga0163162_11989478 3300013306 Bacteria 666
737 Ga0163162_12242593 3300013306 Bacteria 627
738 Ga0163162_12253968 3300013306 Bacteria 625
739 Ga0163162_12395248 3300013306 Bacteria 607
740 Ga0157372_10005958 3300013307 Bacteria 12960
741 Ga0157372_10010263 3300013307 Bacteria 9948
742 Ga0157372_10059208 3300013307 Bacteria 4283
743 Ga0157372_10502453 3300013307 Bacteria 1414
744 Ga0157372_10507343 3300013307 Bacteria 1406
745 Ga0157372_11772534 3300013307 Bacteria 710
746 Ga0157372_11943755 3300013307 Bacteria 676
747 Ga0157375_10024076 3300013308 Bacteria 5629
748 Ga0157375_10044133 3300013308 Bacteria 4328
749 Ga0157375_10165940 3300013308 Bacteria 2353
750 Ga0157375_10220885 3300013308 Bacteria 2053
751 Ga0157375_10543308 3300013308 Bacteria 1324
752 Ga0157375_11008528 3300013308 Bacteria 972
753 Ga0157375_11096261 3300013308 Bacteria 932
754 Ga0157375_11410600 3300013308 Bacteria 821
755 Ga0157375_11918122 3300013308 Bacteria 703
756 Ga0157375_12704414 3300013308 Bacteria 593
757 Ga0157375_12882360 3300013308 Bacteria 575
758 Ga0157375_13344920 3300013308 Bacteria 534
759 Ga0163163_10220374 3300014325 Bacteria 1946
760 Ga0163163_10251732 3300014325 Bacteria 1817
761 Ga0163163_10394057 3300014325 Bacteria 1443
762 Ga0163163_10527368 3300014325 Bacteria 1243
763 Ga0163163_10767023 3300014325 Bacteria 1028
764 Ga0163163_10998768 3300014325 Bacteria 900
765 Ga0163163_11021015 3300014325 Bacteria 890
766 Ga0163163_11230600 3300014325 Bacteria 811
767 Ga0163163_11713957 3300014325 Bacteria 689
768 Ga0163163_12521296 3300014325 Bacteria 572
769 Ga0157380_10360353 3300014326 Bacteria 1364
770 Ga0157380_10607993 3300014326 Bacteria 1083
771 Ga0157380_10854464 3300014326 Bacteria 932
772 Ga0157380_11008816 3300014326 Bacteria 866
773 Ga0157380_11107608 3300014326 Bacteria 831
774 Ga0157380_11265346 3300014326 Bacteria 784
775 Ga0157380_11730149 3300014326 Bacteria 683
776 Ga0157380_12519827 3300014326 Bacteria 580
777 Ga0157380_12697823 3300014326 Bacteria 563
778 Ga0157380_13486133 3300014326 Bacteria 504
779 Ga0182008_10020420 3300014497 Bacteria 3411
780 Ga0182008_10096215 3300014497 Bacteria 1461
781 Ga0182008_10136468 3300014497 Bacteria 1225
782 Ga0182008_10383655 3300014497 Bacteria 751
783 Ga0157377_10000170 3300014745 Bacteria 38897
784 Ga0157377_10043830 3300014745 Bacteria 2492
785 Ga0157377_10165085 3300014745 Bacteria 1380
786 Ga0157377_10461045 3300014745 Bacteria 880
787 Ga0157379_10006124 3300014968 Bacteria 10355
788 Ga0157379_10018100 3300014968 Bacteria 6208
789 Ga0157379_10039682 3300014968 Bacteria 4201
790 Ga0157379_10082445 3300014968 Bacteria 2882
791 Ga0157379_10724686 3300014968 Bacteria 935
792 Ga0157379_11528669 3300014968 Bacteria 650
793 Ga0157376_10029275 3300014969 Bacteria 4387
794 Ga0157376_10128576 3300014969 Bacteria 2257
795 Ga0157376_10328604 3300014969 Bacteria 1456
796 Ga0157376_10334767 3300014969 Bacteria 1443
797 Ga0157376_10537979 3300014969 Bacteria 1154
798 Ga0157376_10998736 3300014969 Bacteria 859
799 Ga0157376_11986897 3300014969 Bacteria 619
800 Ga0157376_12879482 3300014969 Bacteria 521
801 Ga0157376_12881165 3300014969 Bacteria 521
802 Ga0182006_1051132 3300015261 Bacteria 1590
803 Ga0182006_1121441 3300015261 Bacteria 907
804 Ga0182006_1179085 3300015261 Bacteria 707
805 Ga0182006_1273992 3300015261 Bacteria 553
806 Ga0182007_10002567 3300015262 Bacteria 8943
807 Ga0182005_1017803 3300015265 Bacteria 1966
808 Ga0182005_1033460 3300015265 Bacteria 1398
809 Ga0182005_1120196 3300015265 Bacteria 747
810 Ga0183362_10001 3300015683 Bacteria 2046624
811 Ga0163161_10017494 3300017792 Bacteria 5016
812 Ga0163161_10144969 3300017792 Bacteria 1800
813 Ga0163161_10255007 3300017792 Bacteria 1368
814 Ga0163161_10325350 3300017792 Bacteria 1216
815 Ga0163161_10401696 3300017792 Bacteria 1099
816 Ga0163161_10443080 3300017792 Bacteria 1048
817 Ga0163161_10999557 3300017792 Bacteria 714
818 Ga0163161_11013310 3300017792 Bacteria 709
819 Ga0163161_11119543 3300017792 Bacteria 677
820 Ga0163161_11681147 3300017792 Bacteria 562
821 Ga0163161_11761836 3300017792 Bacteria 550
822 Ga0206353_11880330 3300020082 Bacteria 609
823 Ga0213876_10076899 3300021384 Bacteria 1763
824 Ga0213876_10358837 3300021384 Bacteria 775
825 Ga0209436_102722 3300025208 Bacteria 5093
826 Ga0209436_113640 3300025208 Bacteria 1320
827 Ga0209672_102060 3300025228 Bacteria 5470
828 Ga0209147_101677 3300025229 Bacteria 7269
829 Ga0209258_100078 3300025242 Bacteria 263996
830 Ga0207425_1000726 3300025245 Bacteria 17525
831 Ga0207425_1000881 3300025245 Bacteria 14608
832 Ga0207425_1002203 3300025245 Bacteria 7090
833 Ga0209148_1000086 3300025254 Bacteria 263996
834 Ga0209129_1000027 3300025258 Bacteria 409587
835 Ga0209129_1000054 3300025258 Bacteria 261997
836 Ga0209565_1000317 3300025263 Bacteria 44071
837 Ga0209565_1001263 3300025263 Bacteria 11754
838 Ga0209565_1015434 3300025263 Bacteria 1723
839 Ga0207666_1004468 3300025271 Bacteria 1758
840 Ga0209673_1000168 3300025273 Bacteria 135126
841 Ga0209673_1000355 3300025273 Bacteria 83197
842 Ga0209673_1005247 3300025273 Bacteria 6592
843 Ga0209673_1038095 3300025273 Bacteria 1404
844 Ga0209130_1000206 3300025284 Bacteria 79198
845 Ga0209130_1001172 3300025284 Bacteria 18829
846 Ga0209130_1035061 3300025284 Bacteria 1005
847 Ga0207673_1007194 3300025290 Bacteria 1391
848 Ga0207673_1042741 3300025290 Bacteria 637
849 Ga0209675_1000388 3300025291 Bacteria 36674
850 Ga0209675_1002561 3300025291 Bacteria 9228
851 Ga0209675_1004338 3300025291 Bacteria 6351
852 Ga0209675_1013516 3300025291 Bacteria 2545
853 Ga0209676_1000103 3300025292 Bacteria 226908
854 Ga0209676_1000290 3300025292 Bacteria 103000
855 Ga0209676_1005377 3300025292 Bacteria 6722
856 Ga0209025_1000201 3300025294 Bacteria 145890
857 Ga0209025_1019038 3300025294 Bacteria 3842
858 Ga0209564_1000014 3300025295 Bacteria 621501
859 Ga0209564_1000289 3300025295 Bacteria 101976
860 Ga0209564_1000408 3300025295 Bacteria 76528
861 Ga0209758_1000034 3300025297 Bacteria 467637
862 Ga0209758_1000193 3300025297 Bacteria 134744
863 Ga0209758_1000208 3300025297 Bacteria 128596
864 Ga0209758_1005547 3300025297 Bacteria 9627
865 Ga0209050_1000012 3300025298 Bacteria 813717
866 Ga0209050_1000416 3300025298 Bacteria 78976
867 Ga0209050_1001233 3300025298 Bacteria 29602
868 Ga0209050_1005046 3300025298 Bacteria 8546
869 Ga0209050_1008921 3300025298 Bacteria 5239
870 Ga0209050_1052859 3300025298 Bacteria 1014
871 Ga0209256_1000066 3300025299 Bacteria 247534
872 Ga0209256_1000092 3300025299 Bacteria 210547
873 Ga0209256_1001887 3300025299 Bacteria 19263
874 Ga0209256_1022736 3300025299 Bacteria 1891
875 Ga0209256_1036914 3300025299 Bacteria 1278
876 Ga0207426_1000067 3300025302 Bacteria 342108
877 Ga0207426_1000266 3300025302 Bacteria 109895
878 Ga0209051_1000019 3300025303 Bacteria 511268
879 Ga0209051_1000020 3300025303 Bacteria 508628
880 Ga0209051_1000141 3300025303 Bacteria 135837
881 Ga0209051_1000235 3300025303 Bacteria 92799
882 Ga0209051_1007019 3300025303 Bacteria 6238
883 Ga0209051_1054597 3300025303 Bacteria 1302
884 Ga0209257_1000024 3300025304 Bacteria 726068
885 Ga0209257_1000085 3300025304 Bacteria 291117
886 Ga0209257_1002015 3300025304 Bacteria 21717
887 Ga0209257_1014801 3300025304 Bacteria 3312
888 Ga0209257_1028057 3300025304 Bacteria 1860
889 Ga0209257_1110720 3300025304 Bacteria 655
890 Ga0207697_10046050 3300025315 Bacteria 1796
891 Ga0207697_10146000 3300025315 Bacteria 1028
892 Ga0207697_10350704 3300025315 Bacteria 655
893 Ga0207697_10418582 3300025315 Bacteria 595
894 Ga0207656_10019106 3300025321 Bacteria 2708
895 Ga0207656_10054086 3300025321 Bacteria 1744
896 Ga0207656_10071784 3300025321 Bacteria 1540
897 Ga0207656_10078424 3300025321 Bacteria 1480
898 Ga0207656_10093435 3300025321 Bacteria 1369
899 Ga0207656_10302931 3300025321 Bacteria 791
900 Ga0207656_10410776 3300025321 Bacteria 681
901 Ga0207656_10415708 3300025321 Bacteria 677
902 Ga0207682_10002310 3300025893 Bacteria 8592
903 Ga0207682_10008487 3300025893 Bacteria 4061
904 Ga0207682_10026248 3300025893 Bacteria 2315
905 Ga0207682_10120596 3300025893 Bacteria 1163
906 Ga0207682_10200063 3300025893 Bacteria 918
907 Ga0207682_10397213 3300025893 Bacteria 651
908 Ga0207682_10616884 3300025893 Bacteria 511
909 Ga0207692_10443623 3300025898 Bacteria 816
910 Ga0207642_10006194 3300025899 Bacteria 3963
911 Ga0207642_10008862 3300025899 Bacteria 3476
912 Ga0207642_10210723 3300025899 Bacteria 1079
913 Ga0207710_10236509 3300025900 Bacteria 910
914 Ga0207688_10009912 3300025901 Bacteria 5186
915 Ga0207688_10264029 3300025901 Bacteria 1046
916 Ga0207688_10279028 3300025901 Bacteria 1018
917 Ga0207680_10002216 3300025903 Bacteria 9082
918 Ga0207680_10002264 3300025903 Bacteria 8971
919 Ga0207680_10270354 3300025903 Bacteria 1179
920 Ga0207680_10358265 3300025903 Bacteria 1025
921 Ga0207680_10474754 3300025903 Bacteria 889
922 Ga0207680_10895762 3300025903 Bacteria 636
923 Ga0207680_10945479 3300025903 Bacteria 618
924 Ga0207647_10221382 3300025904 Bacteria 1091
925 Ga0207685_10025303 3300025905 Bacteria 2047
926 Ga0207645_10003401 3300025907 Bacteria 12101
927 Ga0207645_10026486 3300025907 Bacteria 3746
928 Ga0207645_10046517 3300025907 Bacteria 2772
929 Ga0207645_10102536 3300025907 Bacteria 1847
930 Ga0207645_10207117 3300025907 Bacteria 1291
931 Ga0207645_10231411 3300025907 Bacteria 1220
932 Ga0207645_10313915 3300025907 Bacteria 1045
933 Ga0207643_10062542 3300025908 Bacteria 2127
934 Ga0207643_10173555 3300025908 Bacteria 1302
935 Ga0207643_10379750 3300025908 Bacteria 891
936 Ga0207643_10581104 3300025908 Bacteria 720
937 Ga0207643_10883314 3300025908 Bacteria 579
938 Ga0207705_10033984 3300025909 Bacteria 3645
939 Ga0207705_10276873 3300025909 Bacteria 1284
940 Ga0207705_10609256 3300025909 Bacteria 849
941 Ga0207705_10673759 3300025909 Bacteria 804
942 Ga0207705_11448229 3300025909 Bacteria 521
943 Ga0207684_10005949 3300025910 Bacteria 11169
944 Ga0207684_10071919 3300025910 Bacteria 2938
945 Ga0207654_10082391 3300025911 Bacteria 1940
946 Ga0207654_10736192 3300025911 Bacteria 710
947 Ga0207707_10174846 3300025912 Bacteria 1876
948 Ga0207707_10425784 3300025912 Bacteria 1137
949 Ga0207695_10002543 3300025913 Bacteria 26790
950 Ga0207695_10032900 3300025913 Bacteria 5667
951 Ga0207695_10061905 3300025913 Bacteria 3866
952 Ga0207695_10088943 3300025913 Bacteria 3107
953 Ga0207695_10218048 3300025913 Bacteria 1816
954 Ga0207695_10638987 3300025913 Bacteria 945
955 Ga0207671_10006429 3300025914 Bacteria 10462
956 Ga0207671_10010328 3300025914 Bacteria 7713
957 Ga0207671_10022402 3300025914 Bacteria 4778
958 Ga0207671_10035144 3300025914 Bacteria 3721
959 Ga0207671_10499298 3300025914 Bacteria 970
960 Ga0207671_10610822 3300025914 Bacteria 869
961 Ga0207671_10997043 3300025914 Bacteria 660
962 Ga0207660_10141322 3300025917 Bacteria 1841
963 Ga0207660_10458070 3300025917 Bacteria 1032
964 Ga0207662_10052728 3300025918 Bacteria 2421
965 Ga0207662_10434229 3300025918 Bacteria 896
966 Ga0207662_10449027 3300025918 Bacteria 881
967 Ga0207662_11227200 3300025918 Bacteria 533
968 Ga0207657_10002308 3300025919 Bacteria 20679
969 Ga0207657_10015804 3300025919 Bacteria 7296
970 Ga0207657_10224482 3300025919 Bacteria 1504
971 Ga0207657_11352505 3300025919 Bacteria 536
972 Ga0207649_10012057 3300025920 Bacteria 4783
973 Ga0207649_10019732 3300025920 Bacteria 3858
974 Ga0207649_10626611 3300025920 Bacteria 829
975 Ga0207649_10715711 3300025920 Bacteria 777
976 Ga0207652_10081244 3300025921 Bacteria 2835
977 Ga0207652_10197585 3300025921 Bacteria 1810
978 Ga0207652_10446683 3300025921 Bacteria 1166
979 Ga0207646_10033392 3300025922 Bacteria 4656
980 Ga0207681_10000795 3300025923 Bacteria 20798
981 Ga0207681_10017788 3300025923 Bacteria 4469
982 Ga0207681_10084282 3300025923 Bacteria 2252
983 Ga0207681_10084985 3300025923 Bacteria 2244
984 Ga0207681_10098706 3300025923 Bacteria 2101
985 Ga0207681_10527279 3300025923 Bacteria 970
986 Ga0207681_10586239 3300025923 Bacteria 920
987 Ga0207694_10004060 3300025924 Bacteria 11503
988 Ga0207694_10029043 3300025924 Bacteria 4217
989 Ga0207694_10213474 3300025924 Bacteria 1572
990 Ga0207694_10336316 3300025924 Bacteria 1248
991 Ga0207694_10357825 3300025924 Bacteria 1209
992 Ga0207694_10446452 3300025924 Bacteria 1079
993 Ga0207650_10002550 3300025925 Bacteria 12629
994 Ga0207650_10004501 3300025925 Bacteria 9532
995 Ga0207650_10014903 3300025925 Bacteria 5408
996 Ga0207650_10131086 3300025925 Bacteria 1961
997 Ga0207650_10209144 3300025925 Bacteria 1566
998 Ga0207650_10373972 3300025925 Bacteria 1176
999 Ga0207650_10410273 3300025925 Bacteria 1122
1000 Ga0207650_11159414 3300025925 Bacteria 658
1001 Ga0207650_11297563 3300025925 Bacteria 620
1002 Ga0207659_10013398 3300025926 Bacteria 5249
1003 Ga0207659_10020083 3300025926 Bacteria 4408
1004 Ga0207659_10032887 3300025926 Bacteria 3563
1005 Ga0207659_10037282 3300025926 Bacteria 3374
1006 Ga0207659_10201000 3300025926 Bacteria 1592
1007 Ga0207659_10228388 3300025926 Bacteria 1500
1008 Ga0207659_10344347 3300025926 Bacteria 1235
1009 Ga0207659_10657623 3300025926 Bacteria 896
1010 Ga0207659_10917374 3300025926 Bacteria 753
1011 Ga0207659_10982537 3300025926 Bacteria 726
1012 Ga0207659_11119751 3300025926 Bacteria 677
1013 Ga0207687_11076475 3300025927 Bacteria 690
1014 Ga0207687_11099818 3300025927 Bacteria 683
1015 Ga0207664_10025828 3300025929 Bacteria 4431
1016 Ga0207644_10002048 3300025931 Bacteria 13051
1017 Ga0207644_10002949 3300025931 Bacteria 10959
1018 Ga0207644_10348255 3300025931 Bacteria 1202
1019 Ga0207644_10530117 3300025931 Bacteria 973
1020 Ga0207644_11180534 3300025931 Bacteria 643
1021 Ga0207644_11460616 3300025931 Bacteria 574
1022 Ga0207644_11659747 3300025931 Bacteria 536
1023 Ga0207690_10005174 3300025932 Bacteria 7694
1024 Ga0207690_10028785 3300025932 Bacteria 3524
1025 Ga0207690_10219101 3300025932 Bacteria 1455
1026 Ga0207690_11282417 3300025932 Bacteria 612
1027 Ga0207690_11301379 3300025932 Bacteria 607
1028 Ga0207690_11627988 3300025932 Bacteria 539
1029 Ga0207706_10014450 3300025933 Bacteria 7156
1030 Ga0207706_10032604 3300025933 Bacteria 4639
1031 Ga0207706_10208896 3300025933 Bacteria 1711
1032 Ga0207706_10265450 3300025933 Bacteria 1498
1033 Ga0207706_10445308 3300025933 Bacteria 1121
1034 Ga0207706_10474106 3300025933 Bacteria 1082
1035 Ga0207706_10616074 3300025933 Bacteria 931
1036 Ga0207706_10761981 3300025933 Bacteria 824
1037 Ga0207706_10886243 3300025933 Bacteria 754
1038 Ga0207706_11121191 3300025933 Bacteria 657
1039 Ga0207686_10046095 3300025934 Bacteria 2687
1040 Ga0207686_10047390 3300025934 Bacteria 2657
1041 Ga0207686_10131449 3300025934 Bacteria 1717
1042 Ga0207686_10249615 3300025934 Bacteria 1296
1043 Ga0207686_10289968 3300025934 Bacteria 1211
1044 Ga0207709_10000383 3300025935 Bacteria 43985
1045 Ga0207709_10001296 3300025935 Bacteria 17820
1046 Ga0207709_10030033 3300025935 Bacteria 3158
1047 Ga0207709_10858658 3300025935 Bacteria 736
1048 Ga0207709_10929598 3300025935 Bacteria 708
1049 Ga0207709_11292534 3300025935 Bacteria 603
1050 Ga0207670_10030732 3300025936 Bacteria 3433
1051 Ga0207670_10933017 3300025936 Bacteria 728
1052 Ga0207669_10041654 3300025937 Bacteria 2675
1053 Ga0207669_10935431 3300025937 Bacteria 726
1054 Ga0207669_11398536 3300025937 Bacteria 596
1055 Ga0207669_11432381 3300025937 Bacteria 588
1056 Ga0207669_11727593 3300025937 Bacteria 534
1057 Ga0207704_10243329 3300025938 Bacteria 1346
1058 Ga0207704_10330831 3300025938 Bacteria 1179
1059 Ga0207704_10860243 3300025938 Bacteria 760
1060 Ga0207704_11003114 3300025938 Bacteria 706
1061 Ga0207704_11184036 3300025938 Bacteria 651
1062 Ga0207665_10109570 3300025939 Bacteria 1938
1063 Ga0207691_10005390 3300025940 Bacteria 12350
1064 Ga0207691_10007761 3300025940 Bacteria 10333
1065 Ga0207691_10012093 3300025940 Bacteria 8276
1066 Ga0207691_10026402 3300025940 Bacteria 5449
1067 Ga0207691_10057886 3300025940 Bacteria 3526
1068 Ga0207691_10058275 3300025940 Bacteria 3513
1069 Ga0207691_10109518 3300025940 Bacteria 2457
1070 Ga0207691_10131930 3300025940 Bacteria 2206
1071 Ga0207691_10219778 3300025940 Bacteria 1648
1072 Ga0207691_10261767 3300025940 Bacteria 1491
1073 Ga0207691_10418523 3300025940 Bacteria 1142
1074 Ga0207691_10538352 3300025940 Bacteria 991
1075 Ga0207691_10713981 3300025940 Bacteria 845
1076 Ga0207711_10012457 3300025941 Bacteria 7068
1077 Ga0207711_10067509 3300025941 Bacteria 3096
1078 Ga0207711_10126201 3300025941 Bacteria 2289
1079 Ga0207711_10481256 3300025941 Bacteria 1156
1080 Ga0207711_10849956 3300025941 Bacteria 849
1081 Ga0207711_10968069 3300025941 Bacteria 790
1082 Ga0207711_11137038 3300025941 Bacteria 722
1083 Ga0207711_11974308 3300025941 Bacteria 526
1084 Ga0207689_10003512 3300025942 Bacteria 14319
1085 Ga0207689_10004908 3300025942 Bacteria 12049
1086 Ga0207689_10050658 3300025942 Bacteria 3423
1087 Ga0207689_10075589 3300025942 Bacteria 2769
1088 Ga0207689_10102173 3300025942 Bacteria 2355
1089 Ga0207689_10404359 3300025942 Bacteria 1138
1090 Ga0207689_11273389 3300025942 Bacteria 618
1091 Ga0207661_10191726 3300025944 Bacteria 1792
1092 Ga0207679_10004109 3300025945 Bacteria 9035
1093 Ga0207679_10011721 3300025945 Bacteria 5692
1094 Ga0207679_10014481 3300025945 Bacteria 5189
1095 Ga0207679_10053631 3300025945 Bacteria 2964
1096 Ga0207679_10061091 3300025945 Bacteria 2804
1097 Ga0207679_10417878 3300025945 Bacteria 1183
1098 Ga0207679_10613967 3300025945 Bacteria 981
1099 Ga0207679_10749071 3300025945 Bacteria 888
1100 Ga0207679_11674927 3300025945 Bacteria 582
1101 Ga0207667_10002655 3300025949 Bacteria 22096
1102 Ga0207667_10009860 3300025949 Bacteria 11213
1103 Ga0207667_10214430 3300025949 Bacteria 1973
1104 Ga0207667_10586071 3300025949 Bacteria 1125
1105 Ga0207651_10025563 3300025960 Bacteria 3672
1106 Ga0207651_10060152 3300025960 Bacteria 2635
1107 Ga0207651_10093139 3300025960 Bacteria 2212
1108 Ga0207651_10541167 3300025960 Bacteria 1011
1109 Ga0207651_10622978 3300025960 Bacteria 945
1110 Ga0207651_10722735 3300025960 Bacteria 879
1111 Ga0207651_11591610 3300025960 Bacteria 588
1112 Ga0207651_11774164 3300025960 Bacteria 555
1113 Ga0207712_10054882 3300025961 Bacteria 2800
1114 Ga0207712_10598083 3300025961 Bacteria 954
1115 Ga0207712_10600466 3300025961 Bacteria 952
1116 Ga0207712_10939869 3300025961 Bacteria 765
1117 Ga0207668_10017712 3300025972 Bacteria 4469
1118 Ga0207668_10633512 3300025972 Bacteria 934
1119 Ga0207668_10907040 3300025972 Bacteria 784
1120 Ga0207668_11450775 3300025972 Bacteria 619
1121 Ga0207640_10025789 3300025981 Bacteria 3562
1122 Ga0207640_10140289 3300025981 Bacteria 1761
1123 Ga0207640_10229824 3300025981 Bacteria 1426
1124 Ga0207640_10449149 3300025981 Bacteria 1062
1125 Ga0207640_10487586 3300025981 Bacteria 1024
1126 Ga0207640_10500017 3300025981 Bacteria 1012
1127 Ga0207640_10545529 3300025981 Bacteria 973
1128 Ga0207640_10711722 3300025981 Bacteria 862
1129 Ga0207658_10001151 3300025986 Bacteria 21193
1130 Ga0207658_10005593 3300025986 Bacteria 8597
1131 Ga0207658_10114940 3300025986 Bacteria 2135
1132 Ga0207658_10146914 3300025986 Bacteria 1916
1133 Ga0207658_10146925 3300025986 Bacteria 1916
1134 Ga0207658_10171038 3300025986 Bacteria 1790
1135 Ga0207658_10360032 3300025986 Bacteria 1269
1136 Ga0207658_10671075 3300025986 Bacteria 935
1137 Ga0207658_10965157 3300025986 Bacteria 777
1138 Ga0207658_11447551 3300025986 Bacteria 628
1139 Ga0207677_10000452 3300026023 Bacteria 27626
1140 Ga0207677_10037654 3300026023 Bacteria 3163
1141 Ga0207677_10381138 3300026023 Bacteria 1190
1142 Ga0207677_10482308 3300026023 Bacteria 1068
1143 Ga0207677_10932485 3300026023 Bacteria 784
1144 Ga0207677_12038880 3300026023 Bacteria 533
1145 Ga0207703_10003262 3300026035 Bacteria 13624
1146 Ga0207703_10007044 3300026035 Bacteria 8945
1147 Ga0207703_10121427 3300026035 Bacteria 2243
1148 Ga0207703_10413074 3300026035 Bacteria 1254
1149 Ga0207639_10005439 3300026041 Bacteria 8600
1150 Ga0207639_10025544 3300026041 Bacteria 4283
1151 Ga0207639_10117049 3300026041 Bacteria 2183
1152 Ga0207639_10190198 3300026041 Bacteria 1753
1153 Ga0207639_10248274 3300026041 Bacteria 1551
1154 Ga0207639_10354566 3300026041 Bacteria 1311
1155 Ga0207639_10634407 3300026041 Bacteria 987
1156 Ga0207639_11608274 3300026041 Bacteria 609
1157 Ga0207639_12256148 3300026041 Bacteria 506
1158 Ga0207678_10002363 3300026067 Bacteria 17106
1159 Ga0207678_10098740 3300026067 Bacteria 2494
1160 Ga0207678_10305127 3300026067 Bacteria 1368
1161 Ga0207678_10831301 3300026067 Bacteria 816
1162 Ga0207678_10968874 3300026067 Bacteria 753
1163 Ga0207678_11193875 3300026067 Bacteria 674
1164 Ga0207708_10064706 3300026075 Bacteria 2794
1165 Ga0207708_10458336 3300026075 Bacteria 1063
1166 Ga0207702_10044080 3300026078 Bacteria 3748
1167 Ga0207702_10182928 3300026078 Bacteria 1931
1168 Ga0207702_10578685 3300026078 Bacteria 1100
1169 Ga0207702_12211938 3300026078 Bacteria 539
1170 Ga0207641_10013179 3300026088 Bacteria 6778
1171 Ga0207641_10026325 3300026088 Bacteria 4799
1172 Ga0207641_10038644 3300026088 Bacteria 3990
1173 Ga0207641_10167453 3300026088 Bacteria 2003
1174 Ga0207641_10429589 3300026088 Bacteria 1273
1175 Ga0207641_10494108 3300026088 Bacteria 1187
1176 Ga0207641_11613931 3300026088 Bacteria 650
1177 Ga0207648_10000748 3300026089 Bacteria 36506
1178 Ga0207648_10004891 3300026089 Bacteria 13654
1179 Ga0207648_10009156 3300026089 Bacteria 9513
1180 Ga0207648_10015290 3300026089 Bacteria 7061
1181 Ga0207648_10018447 3300026089 Bacteria 6317
1182 Ga0207648_10153113 3300026089 Bacteria 2035
1183 Ga0207648_10159491 3300026089 Bacteria 1992
1184 Ga0207648_10308103 3300026089 Bacteria 1421
1185 Ga0207648_10503985 3300026089 Bacteria 1108
1186 Ga0207648_10877779 3300026089 Bacteria 837
1187 Ga0207648_10996400 3300026089 Bacteria 785
1188 Ga0207648_11329572 3300026089 Bacteria 675
1189 Ga0207648_11568146 3300026089 Bacteria 619
1190 Ga0207676_10012508 3300026095 Bacteria 6084
1191 Ga0207676_10042218 3300026095 Bacteria 3506
1192 Ga0207676_10052796 3300026095 Bacteria 3179
1193 Ga0207676_10149898 3300026095 Bacteria 2007
1194 Ga0207676_10163884 3300026095 Bacteria 1929
1195 Ga0207676_10873679 3300026095 Bacteria 880
1196 Ga0207676_12560108 3300026095 Bacteria 507
1197 Ga0207674_10000040 3300026116 Bacteria 130571
1198 Ga0207674_10009428 3300026116 Bacteria 11151
1199 Ga0207674_10078389 3300026116 Bacteria 3309
1200 Ga0207674_10082081 3300026116 Bacteria 3225
1201 Ga0207674_10253170 3300026116 Bacteria 1708
1202 Ga0207674_10773161 3300026116 Bacteria 927
1203 Ga0207674_10871479 3300026116 Bacteria 868
1204 Ga0207674_11484866 3300026116 Bacteria 647
1205 Ga0207674_11607913 3300026116 Bacteria 618
1206 Ga0207675_100003386 3300026118 Bacteria 15580
1207 Ga0207675_100005550 3300026118 Bacteria 12070
1208 Ga0207675_100059119 3300026118 Bacteria 3577
1209 Ga0207675_100100746 3300026118 Bacteria 2721
1210 Ga0207675_100731231 3300026118 Bacteria 1000
1211 Ga0207675_100812892 3300026118 Bacteria 948
1212 Ga0207683_10008569 3300026121 Bacteria 8752
1213 Ga0207683_10037960 3300026121 Bacteria 4195
1214 Ga0207683_10064870 3300026121 Bacteria 3219
1215 Ga0207683_10089863 3300026121 Bacteria 2734
1216 Ga0207683_10116457 3300026121 Bacteria 2396
1217 Ga0207683_10145705 3300026121 Bacteria 2135
1218 Ga0207683_10278749 3300026121 Bacteria 1528
1219 Ga0207683_10307655 3300026121 Bacteria 1450
1220 Ga0207683_10410972 3300026121 Bacteria 1246
1221 Ga0207683_10548197 3300026121 Bacteria 1069
1222 Ga0207683_10574489 3300026121 Bacteria 1043
1223 Ga0207683_10632075 3300026121 Bacteria 991
1224 Ga0207683_11151674 3300026121 Bacteria 719
1225 Ga0207683_12101076 3300026121 Bacteria 513
1226 Ga0207698_10005011 3300026142 Bacteria 8123
1227 Ga0207698_10011131 3300026142 Bacteria 5817
1228 Ga0207698_10115704 3300026142 Bacteria 2258
1229 Ga0207698_10445721 3300026142 Bacteria 1248
1230 Ga0207698_10672177 3300026142 Bacteria 1028
1231 Ga0207698_10688459 3300026142 Bacteria 1016
1232 Ga0207698_10787371 3300026142 Bacteria 952
1233 Ga0207698_10798694 3300026142 Bacteria 946
1234 Ga0207698_10994822 3300026142 Bacteria 849
1235 Ga0207698_11031752 3300026142 Bacteria 834
1236 Ga0207698_11308235 3300026142 Bacteria 740
1237 Ga0207698_11328955 3300026142 Bacteria 734
1238 Ga0207698_12659290 3300026142 Bacteria 509
1239 Ga0207698_12698549 3300026142 Bacteria 505
1240 Ga0209281_1000074 3300027111 Bacteria 267848
1241 Ga0209969_1012477 3300027360 Bacteria 1226
1242 Ga0209981_1004500 3300027378 Bacteria 1831
1243 Ga0209996_1002081 3300027395 Bacteria 2467
1244 Ga0209995_1016563 3300027471 Bacteria 1211
1245 Ga0209995_1064430 3300027471 Bacteria 625
1246 Ga0209968_1000140 3300027526 Bacteria 12794
1247 Ga0209999_1004899 3300027543 Bacteria 2407
1248 Ga0210002_1106826 3300027617 Bacteria 508
1249 Ga0209966_1000388 3300027695 Bacteria 13148
1250 Ga0209813_10061166 3300027866 Bacteria 1202
1251 Ga0209974_10006661 3300027876 Bacteria 4017
1252 Ga0209974_10034713 3300027876 Bacteria 1675
1253 Ga0209974_10284711 3300027876 Bacteria 629
1254 Ga0207428_10621197 3300027907 Bacteria 777
1255 Ga0207428_10876374 3300027907 Bacteria 635
1256 Ga0268266_10037082 3300028379 Bacteria 4153
1257 Ga0268266_11230998 3300028379 Bacteria 724
1258 Ga0268266_11705868 3300028379 Bacteria 605
1259 Ga0268265_10098075 3300028380 Bacteria 2359
1260 Ga0268265_10121264 3300028380 Bacteria 2154
1261 Ga0268265_10914139 3300028380 Bacteria 862
1262 Ga0268264_10003378 3300028381 Bacteria 13783
1263 Ga0268264_10003920 3300028381 Bacteria 12743
1264 Ga0268264_10141634 3300028381 Bacteria 2145
1265 Ga0268264_10672979 3300028381 Bacteria 1026
1266 Ga0268264_11168625 3300028381 Bacteria 779
1267 Ga0268264_11655308 3300028381 Bacteria 650
1268 Ga0268264_12694867 3300028381 Bacteria 501
1269 Ga0265323_10180575 3300028653 Bacteria 668
1270 Ga0307517_10005592 3300028786 Bacteria 18878
1271 Ga0307517_10193402 3300028786 Bacteria 1286
1272 Ga0307517_10222524 3300028786 Bacteria 1145
1273 Ga0307517_10569249 3300028786 Bacteria 563
1274 Ga0307515_10000165 3300028794 Bacteria 162589
1275 Ga0307515_10000232 3300028794 Bacteria 137778
1276 Ga0307515_10000716 3300028794 Bacteria 76332
1277 Ga0307515_10009711 3300028794 Bacteria 18549
1278 Ga0307515_10029175 3300028794 Bacteria 9340
1279 Ga0307515_10069456 3300028794 Bacteria 4815
1280 Ga0307515_10100821 3300028794 Bacteria 3492
1281 Ga0307515_10280252 3300028794 Bacteria 1375
1282 Ga0307515_10524851 3300028794 Bacteria 794
1283 Ga0265324_10000007 3300029957 Bacteria 264024
1284 Ga0307512_10125965 3300030522 Bacteria 1626
1285 Ga0307512_10310690 3300030522 Bacteria 725
1286 Ga0314311_1161279 3300030733 Bacteria 5559
1287 Ga0316179_1013512 3300030734 Bacteria 6580
1288 Ga0316178_1081817 3300030735 Bacteria 4049
1289 Ga0316180_1033826 3300030736 Bacteria 1837
1290 Ga0316183_1096459 3300030742 Bacteria 1261
1291 Ga0316181_1169024 3300030744 Bacteria 4022
1292 Ga0316182_1190268 3300030745 Bacteria 2981
1293 Ga0316182_1435093 3300030745 Bacteria 562
1294 Ga0265328_10004603 3300031239 Bacteria 5974
1295 Ga0265328_10270814 3300031239 Bacteria 652
1296 Ga0265331_10002534 3300031250 Bacteria 12300
1297 Ga0265331_10165768 3300031250 Bacteria 1000
1298 Ga0265327_10000028 3300031251 Bacteria 361066
1299 Ga0265327_10005919 3300031251 Bacteria 9987
1300 Ga0265327_10256515 3300031251 Bacteria 777
1301 Ga0265316_10000181 3300031344 Bacteria 71764
1302 Ga0265316_10040823 3300031344 Bacteria 3718
1303 Ga0265316_10175648 3300031344 Bacteria 1596
1304 Ga0307513_10020857 3300031456 Bacteria 7755
1305 Ga0307513_10198447 3300031456 Bacteria 1850
1306 Ga0307513_10223635 3300031456 Bacteria 1701
1307 Ga0307513_10336433 3300031456 Bacteria 1262
1308 Ga0307513_10382862 3300031456 Bacteria 1146
1309 Ga0307513_10392021 3300031456 Bacteria 1125
1310 Ga0307513_10757889 3300031456 Bacteria 676
1311 Ga0307509_10047896 3300031507 Bacteria 4595
1312 Ga0307509_10070806 3300031507 Bacteria 3640
1313 Ga0307509_10166102 3300031507 Bacteria 2095
1314 Ga0307509_10255000 3300031507 Bacteria 1534
1315 Ga0307509_10258468 3300031507 Bacteria 1519
1316 Ga0307509_10388258 3300031507 Bacteria 1107
1317 Ga0307408_100000160 3300031548 Bacteria 74342
1318 Ga0307408_100034418 3300031548 Bacteria 3549
1319 Ga0307408_100045283 3300031548 Bacteria 3141
1320 Ga0307408_100158236 3300031548 Bacteria 1796
1321 Ga0307408_100166791 3300031548 Bacteria 1755
1322 Ga0307408_100202535 3300031548 Bacteria 1607
1323 Ga0307408_100550048 3300031548 Bacteria 1018
1324 Ga0307408_101009952 3300031548 Bacteria 767
1325 Ga0307408_101237660 3300031548 Bacteria 697
1326 Ga0307408_101609315 3300031548 Bacteria 617
1327 Ga0307408_101710987 3300031548 Bacteria 599
1328 Ga0307408_102394828 3300031548 Bacteria 512
1329 Ga0307508_10000016 3300031616 Bacteria 206976
1330 Ga0307508_10001467 3300031616 Bacteria 26444
1331 Ga0307508_10052609 3300031616 Bacteria 3615
1332 Ga0307508_10538212 3300031616 Bacteria 765
1333 Ga0307508_10576065 3300031616 Bacteria 725
1334 Ga0307514_10037190 3300031649 Bacteria 3862
1335 Ga0307514_10375139 3300031649 Bacteria 742
1336 Ga0307516_10004400 3300031730 Bacteria 17413
1337 Ga0307516_10035476 3300031730 Bacteria 5004
1338 Ga0307516_10058975 3300031730 Bacteria 3734
1339 Ga0307516_10128425 3300031730 Bacteria 2317
1340 Ga0307516_10356786 3300031730 Bacteria 1127
1341 Ga0307516_10363028 3300031730 Bacteria 1112
1342 Ga0307516_10453728 3300031730 Bacteria 938
1343 Ga0307405_10021832 3300031731 Bacteria 3606
1344 Ga0307405_10053071 3300031731 Bacteria 2523
1345 Ga0307405_10058871 3300031731 Bacteria 2419
1346 Ga0307405_10190515 3300031731 Bacteria 1481
1347 Ga0307405_10226137 3300031731 Bacteria 1376
1348 Ga0307405_10260018 3300031731 Bacteria 1296
1349 Ga0307405_10894422 3300031731 Bacteria 750
1350 Ga0307405_10996428 3300031731 Bacteria 715
1351 Ga0307405_11040726 3300031731 Bacteria 700
1352 Ga0307405_11075034 3300031731 Bacteria 690
1353 Ga0307405_11313412 3300031731 Bacteria 630
1354 Ga0307405_11440125 3300031731 Bacteria 603
1355 Ga0307405_11608569 3300031731 Bacteria 573
1356 Ga0307413_10199627 3300031824 Bacteria 1443
1357 Ga0307413_11169348 3300031824 Bacteria 668
1358 Ga0307413_12123964 3300031824 Bacteria 508
1359 Ga0307410_10006186 3300031852 Bacteria 6431
1360 Ga0307410_10493002 3300031852 Bacteria 1007
1361 Ga0307410_10699597 3300031852 Bacteria 854
1362 Ga0307410_11238769 3300031852 Bacteria 651
1363 Ga0307406_10009086 3300031901 Bacteria 5560
1364 Ga0307406_10048547 3300031901 Bacteria 2682
1365 Ga0307406_10154488 3300031901 Bacteria 1641
1366 Ga0307406_10424736 3300031901 Bacteria 1060
1367 Ga0307406_10613602 3300031901 Bacteria 898
1368 Ga0307406_10795272 3300031901 Bacteria 798
1369 Ga0307407_10125284 3300031903 Bacteria 1635
1370 Ga0307407_10197530 3300031903 Bacteria 1345
1371 Ga0307407_10237909 3300031903 Bacteria 1241
1372 Ga0307407_10789264 3300031903 Bacteria 722
1373 Ga0307412_10008934 3300031911 Bacteria 5739
1374 Ga0307412_10106523 3300031911 Bacteria 1993
1375 Ga0307412_10152178 3300031911 Bacteria 1708
1376 Ga0307412_10156542 3300031911 Bacteria 1687
1377 Ga0307412_10209380 3300031911 Bacteria 1486
1378 Ga0307412_10427755 3300031911 Bacteria 1085
1379 Ga0307412_10565616 3300031911 Bacteria 957
1380 Ga0307412_10710080 3300031911 Bacteria 864
1381 Ga0307412_10725839 3300031911 Bacteria 855
1382 Ga0307412_11299118 3300031911 Bacteria 655
1383 Ga0307412_11376482 3300031911 Bacteria 638
1384 Ga0307412_11639177 3300031911 Bacteria 588
1385 Ga0307409_100001314 3300031995 Bacteria 12044
1386 Ga0307409_100049671 3300031995 Bacteria 3200
1387 Ga0307409_100065516 3300031995 Bacteria 2859
1388 Ga0307409_101124546 3300031995 Bacteria 807
1389 Ga0307409_101406187 3300031995 Bacteria 724
1390 Ga0307409_101614946 3300031995 Bacteria 677
1391 Ga0307416_100020404 3300032002 Bacteria 4727
1392 Ga0307416_100063772 3300032002 Bacteria 3019
1393 Ga0307416_100071278 3300032002 Bacteria 2886
1394 Ga0307416_100087114 3300032002 Bacteria 2665
1395 Ga0307416_100320417 3300032002 Bacteria 1552
1396 Ga0307416_100345066 3300032002 Bacteria 1504
1397 Ga0307416_100388486 3300032002 Bacteria 1429
1398 Ga0307416_100568835 3300032002 Bacteria 1209
1399 Ga0307416_100997030 3300032002 Bacteria 940
1400 Ga0307416_101441695 3300032002 Bacteria 794
1401 Ga0307416_101727569 3300032002 Bacteria 730
1402 Ga0307416_103778436 3300032002 Bacteria 507
1403 Ga0307414_10057023 3300032004 Bacteria 2743
1404 Ga0307414_10115978 3300032004 Bacteria 2049
1405 Ga0307414_10116063 3300032004 Bacteria 2049
1406 Ga0307414_10149621 3300032004 Bacteria 1840
1407 Ga0307414_10594092 3300032004 Bacteria 992
1408 Ga0307414_10808429 3300032004 Bacteria 855
1409 Ga0307414_10881583 3300032004 Bacteria 820
1410 Ga0307414_11170491 3300032004 Bacteria 711
1411 Ga0307414_12122285 3300032004 Bacteria 525
1412 Ga0307411_10006938 3300032005 Bacteria 5714
1413 Ga0307411_10022274 3300032005 Bacteria 3726
1414 Ga0307411_10239552 3300032005 Bacteria 1419
1415 Ga0307411_10247367 3300032005 Bacteria 1400
1416 Ga0307411_10814359 3300032005 Bacteria 823
1417 Ga0307411_10968779 3300032005 Bacteria 760
1418 Ga0307411_12363398 3300032005 Bacteria 500
1419 Ga0307415_100004417 3300032126 Bacteria 7292
1420 Ga0307415_100124110 3300032126 Bacteria 1942
1421 Ga0307415_100152845 3300032126 Bacteria 1779
1422 Ga0307415_100894793 3300032126 Bacteria 818
1423 Ga0307415_101060223 3300032126 Bacteria 757
1424 Ga0307507_10031462 3300033179 Bacteria 5570
1425 Ga0307507_10055670 3300033179 Bacteria 3746
1426 Ga0307507_10376296 3300033179 Bacteria 820
1427 Ga0307510_10000568 3300033180 Bacteria 37247
1428 Ga0307510_10564632 3300033180 Bacteria 585
1429 Ga0373950_0004635 3300034818 Bacteria 2022
1430 Ga0373958_0028957 3300034819 Bacteria 1075
1431 Ga0373959_0080937 3300034820 Bacteria 748
1432 Ga0373938_0018968 3300034957 Bacteria 1372
1433 Ga0373938_0247902 3300034957 Bacteria 508
1434 Ga0373928_0027809 3300035084 Bacteria 1233
1435 Ga0373928_0114285 3300035084 Bacteria 717
1436 Ga0373940_0035128 3300035088 Bacteria 1356
1437 Ga0373944_0326561 3300035089 Bacteria 580
1438 Ga0373952_0002684 3300035092 Bacteria 3210
1439 Ga0373952_0052535 3300035092 Bacteria 976
1440 Ga0373932_0018539 3300035112 Bacteria 1801
1441 Ga0373932_0030415 3300035112 Bacteria 1497
1442 Ga0373939_0133835 3300035114 Bacteria 887
1443 Ga0373941_0042220 3300035115 Bacteria 1415
1444 Ga0373945_0413159 3300035116 Bacteria 593
1445 Ga0373953_0270922 3300035117 Bacteria 739
1446 Ga0373960_0006818 3300035121 Bacteria 2690
1447 Ga0373946_0179335 3300035171 Bacteria 1005
1448 Ga0373946_0189477 3300035171 Bacteria 980
1449 Ga0373942_0031813 3300035207 Bacteria 1398
1450 Ga0373961_0112681 3300035241 Bacteria 893
1451 Ga0373961_0244560 3300035241 Bacteria 647
1452 Ga0373962_0019072 3300035242 Bacteria 1791
1453 Ga0373962_0040272 3300035242 Bacteria 1314
1454 Ga0373924_0050922 3300035410 Bacteria 1716
1455 Ga0373931_0007502 3300035691 Bacteria 5135
1456 Ga0373931_0306109 3300035691 Bacteria 983
1457 Ga0373935_0664801 3300035692 Bacteria 765
1458 Ga0373947_0273281 3300035725 Bacteria 1122
1459 Ga0373937_0168463 3300036401 Bacteria 2055
1460 Ga0373937_0377255 3300036401 Bacteria 1345
1461 Ga0373937_1291590 3300036401 Bacteria 678
1462 Ga0373937_1872254 3300036401 Bacteria 546
1463 Ga0373925_0219622 3300037068 Bacteria 1517
1464 Ga0373925_0487964 3300037068 Bacteria 1011
1465 Ga0395898_0707204 3300037466 Bacteria 949
1466 Ga0395905_0000071 3300037471 Bacteria 174580
1467 Ga0395905_0003377 3300037471 Bacteria 17102
1468 Ga0395905_0158997 3300037471 Bacteria 2124
1469 Ga0395905_0205360 3300037471 Bacteria 1846
1470 Ga0395905_0292538 3300037471 Bacteria 1515
1471 Ga0395905_0637559 3300037471 Bacteria 967
1472 Ga0395905_0726434 3300037471 Bacteria 895
1473 Ga0395905_1171095 3300037471 Bacteria 672
1474 Ga0395905_1245362 3300037471 Bacteria 648
1475 Ga0400483_050487 3300039062 Bacteria 45898
1476 Ga0400483_054100 3300039062 Bacteria 1406
1477 Ga0400483_058112 3300039062 Bacteria 39642
1478 Ga0400483_147621 3300039062 Bacteria 10623
1479 Ga0400483_243387 3300039062 Bacteria 56211
1480 Ga0400483_250036 3300039062 Bacteria 396353
1481 Ga0400483_259735 3300039062 Bacteria 8645
1482 Ga0436365_0385285 3300039437 Bacteria 2218
1483 Ga0436365_0393891 3300039437 Bacteria 1272
1484 Ga0436365_0508202 3300039437 Bacteria 921
1485 Ga0436365_1754335 3300039437 Bacteria 1182
1486 Ga0436365_1910867 3300039437 Bacteria 1720
1487 Ga0439436_0000087 3300041404 Bacteria 22052
1488 Ga0439438_022946 3300041405 Bacteria 1726
1489 Ga0439439_0023785 3300041406 Bacteria 1536
1490 Ga0439447_029848 3300041407 Bacteria 1378
1491 Ga0439461_0005108 3300041410 Bacteria 2224
1492 Ga0439461_0036152 3300041410 Bacteria 1050
1493 Ga0439466_0016508 3300041411 Bacteria 2667
1494 Ga0439466_0045273 3300041411 Bacteria 1455
1495 Ga0439466_0049909 3300041411 Bacteria 1373
1496 Ga0439465_0008564 3300041413 Bacteria 3227
1497 Ga0439465_0134195 3300041413 Bacteria 876
1498 Ga0451787_135752 3300041441 Bacteria 525
1499 Ga0451789_0485836 3300041443 Bacteria 713
1500 Ga0451789_0873756 3300041443 Bacteria 781
1501 Ga0451789_1195116 3300041443 Bacteria 1937
1502 Ga0451789_1353168 3300041443 Bacteria 695
1503 Ga0451791_0888711 3300041451 Bacteria 592
1504 Ga0451791_1547075 3300041451 Bacteria 825
1505 Ga0451793_0351601 3300041452 Bacteria 559
1506 Ga0451793_0606671 3300041452 Bacteria 1102
1507 Ga0451793_0969557 3300041452 Bacteria 1813
1508 Ga0451793_1911556 3300041452 Bacteria 551
1509 Ga0451797_0651689 3300041453 Bacteria 617
1510 Ga0451797_1136303 3300041453 Bacteria 524
1511 Ga0451797_1454471 3300041453 Bacteria 767
1512 Ga0451797_1559014 3300041453 Bacteria 734
1513 Ga0451795_0264279 3300041456 Bacteria 804
1514 Ga0451795_0458032 3300041456 Bacteria 542
1515 Ga0451795_0612071 3300041456 Bacteria 1521
1516 Ga0451795_1631029 3300041456 Bacteria 625
1517 Ga0451798_0075940 3300041458 Bacteria 2713
1518 Ga0451800_0112075 3300041459 Bacteria 643
1519 Ga0451802_0039409 3300041460 Bacteria 3366
1520 Ga0451802_0496814 3300041460 Bacteria 578
1521 Ga0451802_1029972 3300041460 Bacteria 548
1522 Ga0451804_1177037 3300041463 Bacteria 717
1523 Ga0451807_1456924 3300041486 Bacteria 517
1524 Ga0451833_0642716 3300041491 Bacteria 1416
1525 Ga0451833_0671749 3300041491 Bacteria 516
1526 Ga0451833_0863719 3300041491 Bacteria 978
1527 Ga0451839_0092707 3300041496 Bacteria 728
1528 Ga0451839_0195547 3300041496 Bacteria 1592
1529 Ga0451839_1646573 3300041496 Bacteria 564
1530 Ga0451841_0064685 3300041498 Bacteria 591
1531 Ga0451841_0374427 3300041498 Bacteria 551
1532 Ga0451849_0140783 3300041505 Bacteria 854
1533 Ga0451849_1174768 3300041505 Bacteria 633
1534 Ga0451851_0377524 3300041507 Bacteria 718
1535 Ga0451851_0664708 3300041507 Bacteria 617
1536 Ga0451851_0775016 3300041507 Bacteria 732
1537 Ga0451843_0094093 3300041509 Bacteria 783
1538 Ga0451843_0289726 3300041509 Bacteria 528
1539 Ga0451843_1448663 3300041509 Bacteria 604
1540 Ga0451855_1473803 3300041511 Bacteria 748
1541 Ga0451853_0258583 3300041512 Bacteria 675
1542 Ga0451853_0312486 3300041512 Bacteria 1389
1543 Ga0451853_2717321 3300041512 Bacteria 1246
1544 Ga0451853_2957169 3300041512 Bacteria 1168
1545 Ga0451853_3970409 3300041512 Bacteria 538
1546 Ga0439431_0002540 3300041997 Bacteria 4028
1547 Ga0439431_0019679 3300041997 Bacteria 1606
1548 Ga0439431_0161495 3300041997 Bacteria 640
1549 Ga0439433_0006733 3300041999 Bacteria 2475
1550 Ga0439433_0009312 3300041999 Bacteria 2137
1551 Ga0439437_000403 3300042000 Bacteria 4173
1552 Ga0439445_0000816 3300042004 Bacteria 6574
1553 Ga0439445_0067787 3300042004 Bacteria 984
1554 Ga0439445_0118103 3300042004 Bacteria 760
1555 Ga0439432_004375 3300042006 Bacteria 5160
1556 Ga0439449_0005260 3300042007 Bacteria 4967
1557 Ga0439449_0009502 3300042007 Bacteria 3685
1558 Ga0439449_0019959 3300042007 Bacteria 2512
1559 Ga0439449_0035314 3300042007 Bacteria 1861
1560 Ga0439449_0069502 3300042007 Bacteria 1298
1561 Ga0439449_0269811 3300042007 Bacteria 641
1562 Ga0439452_001338 3300042010 Bacteria 10284
1563 Ga0439452_021923 3300042010 Bacteria 1658
1564 Ga0439455_0023026 3300042012 Bacteria 1498
1565 Ga0439455_0031169 3300042012 Bacteria 1326
1566 Ga0439455_0103196 3300042012 Bacteria 789
1567 Ga0439457_006319 3300042014 Bacteria 2911
1568 Ga0439457_037410 3300042014 Bacteria 1080
1569 Ga0439457_160441 3300042014 Bacteria 543
1570 Ga0439462_0003614 3300042015 Bacteria 3722
1571 Ga0439462_0005695 3300042015 Bacteria 3078
1572 Ga0439462_0082272 3300042015 Bacteria 880
1573 Ga0439463_155667 3300042016 Bacteria 593
1574 Ga0450911_022634 3300042115 Bacteria 818
1575 Ga0450914_002759 3300042118 Bacteria 1288
1576 Ga0450917_007679 3300042120 Bacteria 825
1577 Ga0450919_000846 3300042121 Bacteria 3954
1578 Ga0450920_033140 3300042122 Bacteria 1020
1579 Ga0450922_013808 3300042124 Bacteria 792
1580 Ga0450923_062420 3300042125 Bacteria 815
1581 Ga0450890_010639 3300042127 Bacteria 1184
1582 Ga0450891_000064 3300042129 Bacteria 8447
1583 Ga0450891_018549 3300042129 Bacteria 674
1584 Ga0450892_003526 3300042130 Bacteria 1283
1585 Ga0450892_020418 3300042130 Bacteria 648
1586 Ga0450894_001711 3300042131 Bacteria 3096
1587 Ga0450896_048175 3300042133 Bacteria 675
1588 Ga0450898_030446 3300042134 Bacteria 988
1589 Ga0450898_030894 3300042134 Bacteria 983
1590 Ga0450898_055455 3300042134 Bacteria 772
1591 Ga0450899_009529 3300042135 Bacteria 1071
1592 Ga0450889_003240 3300042144 Bacteria 1606
1593 Ga0450906_007913 3300042145 Bacteria 2080
1594 Ga0450907_019923 3300042146 Bacteria 1125
1595 Ga0450910_042973 3300042147 Bacteria 734
1596 Ga0439446_0004543 3300042156 Bacteria 3517
1597 Ga0439446_0240238 3300042156 Bacteria 622
1598 Ga0439446_0253262 3300042156 Bacteria 608
1599 Ga0450909_002243 3300042185 Bacteria 2730
1600 Ga0450909_012351 3300042185 Bacteria 1252
1601 Ga0439434_0005187 3300042435 Bacteria 3809
1602 Ga0439434_0032148 3300042435 Bacteria 1596
1603 Ga0439434_0106731 3300042435 Bacteria 905
1604 Ga0439434_0120244 3300042435 Bacteria 856
1605 Ga0439434_0184084 3300042435 Bacteria 700
1606 Ga0439444_0193484 3300042437 Bacteria 510
1607 Ga0439459_0079902 3300042438 Bacteria 770
1608 Ga0439464_0021522 3300042439 Bacteria 1771
1609 Ga0439464_0169221 3300042439 Bacteria 689
1610 Ga0439460_0146488 3300042461 Bacteria 786
1611 Ga0450916_001775 3300042530 Bacteria 2199
1612 Ga0450918_000344 3300042531 Bacteria 10277
1613 Ga0450918_083618 3300042531 Bacteria 611
1614 Ga0450893_0021080 3300042532 Bacteria 1123
1615 Ga0450893_0059738 3300042532 Bacteria 726
1616 Ga0451577_0026364 3300042876 Bacteria 5265
1617 Ga0451577_0061568 3300042876 Bacteria 3347
1618 Ga0451577_1682399 3300042876 Bacteria 558
1619 Ga0439440_0185855 3300042993 Bacteria 611
1620 Ga0466969_0037790 3300044656 Bacteria 2433
1621 Ga0466969_0089971 3300044656 Bacteria 1455
1622 Ga0466972_0020558 3300044658 Bacteria 3298
1623 Ga0466972_0035894 3300044658 Bacteria 2427
1624 Ga0466972_0041116 3300044658 Bacteria 2251
1625 Ga0466972_0046599 3300044658 Bacteria 2098
1626 Ga0466972_0170373 3300044658 Bacteria 1022
1627 Ga0453683_0394669 3300044673 Bacteria 891
1628 Ga0453683_0429046 3300044673 Bacteria 854
1629 Ga0453683_0934536 3300044673 Bacteria 574
1630 Ga0466965_0068051 3300044683 Bacteria 1787
1631 Ga0466965_0108619 3300044683 Bacteria 1424
1632 Ga0466965_0131641 3300044683 Bacteria 1297
1633 Ga0466965_0212725 3300044683 Bacteria 1028
1634 Ga0466965_0386555 3300044683 Bacteria 771
1635 Ga0466965_0801347 3300044683 Bacteria 545
1636 Ga0466966_0015315 3300044684 Bacteria 5070
1637 Ga0466966_0752500 3300044684 Bacteria 587
1638 Ga0466961_0003217 3300044693 Bacteria 10163
1639 Ga0466961_0006410 3300044693 Bacteria 7472
1640 Ga0466961_0043879 3300044693 Bacteria 2863
1641 Ga0466963_0000935 3300044694 Bacteria 14918
1642 Ga0466964_0003021 3300044706 Bacteria 6099
1643 Ga0466964_0118004 3300044706 Bacteria 1192
1644 Ga0453684_0000917 3300044712 Bacteria 97990
1645 Ga0453684_0001658 3300044712 Bacteria 60385
1646 Ga0453684_0017401 3300044712 Bacteria 11136
1647 Ga0453684_0051049 3300044712 Bacteria 5429
1648 Ga0453684_0272674 3300044712 Bacteria 1932
1649 Ga0453684_0346557 3300044712 Bacteria 1676
1650 Ga0453684_0613701 3300044712 Bacteria 1191
1651 Ga0453684_1282602 3300044712 Bacteria 765
1652 Ga0466971_0382138 3300044719 Bacteria 684
1653 Ga0466968_0005264 3300044735 Bacteria 4847
1654 Ga0466968_0721818 3300044735 Bacteria 510
1655 Ga0466970_0007142 3300044765 Bacteria 5592
1656 Ga0466970_0015254 3300044765 Bacteria 3950
1657 Ga0466970_0128278 3300044765 Bacteria 1392
1658 Ga0466957_0007668 3300044842 Bacteria 6104
1659 Ga0466960_0012592 3300044901 Bacteria 3575
1660 Ga0466960_0654384 3300044901 Bacteria 627
1661 Ga0466959_0013106 3300045049 Bacteria 6003
1662 Ga0466959_0250383 3300045049 Bacteria 1222
1663 Ga0451576_0034152 3300045051 Bacteria 5402
1664 Ga0451576_0126973 3300045051 Bacteria 2657
1665 Ga0451576_0228247 3300045051 Bacteria 1944
1666 Ga0451576_0312262 3300045051 Bacteria 1645
1667 Ga0451576_0393108 3300045051 Bacteria 1454
1668 Ga0451576_0422698 3300045051 Bacteria 1398
1669 Ga0451576_1296890 3300045051 Bacteria 759
1670 Ga0466958_0023688 3300045836 Bacteria 3606
1671 Ga0466958_0695385 3300045836 Bacteria 662
1672 Ga0466967_0021184 3300045976 Bacteria 5272
1673 Ga0466967_0546277 3300045976 Bacteria 1140
1674 Ga0466967_1103268 3300045976 Bacteria 791
1675 Ga0495627_032297 3300046453 Bacteria 1648
1676 Ga0495590_0131290 3300046457 Bacteria 901
1677 Ga0495629_0040968 3300046459 Bacteria 3259
1678 Ga0495638_0191549 3300046460 Bacteria 1160
1679 Ga0495638_0240052 3300046460 Bacteria 1004
1680 Ga0495638_0306508 3300046460 Bacteria 854
1681 Ga0495651_0038375 3300046462 Bacteria 3730
1682 Ga0495650_0002988 3300046471 Bacteria 12804
1683 Ga0495650_0147479 3300046471 Bacteria 847
1684 Ga0495650_0200566 3300046471 Bacteria 693
1685 Ga0495580_0175846 3300046472 Bacteria 1479
1686 Ga0495580_0631714 3300046472 Bacteria 705
1687 Ga0495582_0409091 3300046473 Bacteria 783
1688 Ga0495582_0418253 3300046473 Bacteria 773
1689 Ga0495582_0578047 3300046473 Bacteria 650
1690 Ga0495605_0484521 3300046474 Bacteria 507
1691 Ga0495639_0518165 3300046475 Bacteria 609
1692 Ga0495662_0358629 3300046476 Bacteria 717
1693 Ga0495664_0543098 3300046477 Bacteria 693
1694 Ga0495583_0380114 3300046506 Bacteria 556
1695 Ga0495606_0103334 3300046507 Bacteria 1731
1696 Ga0495606_0184202 3300046507 Bacteria 1201
1697 Ga0495606_0426203 3300046507 Bacteria 685
1698 Ga0495606_0619442 3300046507 Bacteria 528
1699 Ga0495610_0020900 3300046512 Bacteria 3616
1700 Ga0495610_0035222 3300046512 Bacteria 2572
1701 Ga0495610_0201109 3300046512 Bacteria 816
1702 Ga0495616_0002648 3300046513 Bacteria 11757
1703 Ga0495618_0779930 3300046514 Bacteria 558
1704 Ga0495620_0083637 3300046515 Bacteria 1288
1705 Ga0495620_0134181 3300046515 Bacteria 970
1706 Ga0495620_0309700 3300046515 Bacteria 600
1707 Ga0495628_0503705 3300046516 Bacteria 874
1708 Ga0495628_0630016 3300046516 Bacteria 763
1709 Ga0495630_0141411 3300046517 Bacteria 1830
1710 Ga0495631_0000024 3300046518 Bacteria 90896
1711 Ga0495632_0007918 3300046519 Bacteria 6606
1712 Ga0495632_0010962 3300046519 Bacteria 5318
1713 Ga0495632_0067015 3300046519 Bacteria 1731
1714 Ga0495632_0485708 3300046519 Bacteria 534
1715 Ga0495637_0010974 3300046520 Bacteria 4366
1716 Ga0495637_0282631 3300046520 Bacteria 592
1717 Ga0495643_0106698 3300046522 Bacteria 1429
1718 Ga0495643_0248979 3300046522 Bacteria 830
1719 Ga0495648_0371714 3300046524 Bacteria 647
1720 Ga0495666_0197046 3300046526 Bacteria 927
1721 Ga0495642_0091393 3300046528 Bacteria 1289
1722 Ga0495642_0176947 3300046528 Bacteria 928
1723 Ga0495652_0345447 3300046529 Bacteria 1068
1724 Ga0495654_0041183 3300046530 Bacteria 2298
1725 Ga0495640_0302006 3300046533 Bacteria 994
1726 Ga0495586_0208483 3300046535 Bacteria 1109
1727 Ga0495586_0445148 3300046535 Bacteria 747
1728 Ga0495587_0680751 3300046536 Bacteria 564
1729 Ga0495598_0018863 3300046537 Bacteria 1799
1730 Ga0495598_0021212 3300046537 Bacteria 1725
1731 Ga0495621_0003869 3300046539 Bacteria 4159
1732 Ga0495621_0058128 3300046539 Bacteria 1398
1733 Ga0495621_0162718 3300046539 Bacteria 883
1734 Ga0495597_0010476 3300046542 Bacteria 4530
1735 Ga0495645_0203502 3300046543 Bacteria 1341
1736 Ga0495645_0313913 3300046543 Bacteria 1020
1737 Ga0495622_0121235 3300046557 Bacteria 1194
1738 Ga0495633_0254105 3300046558 Bacteria 802
1739 Ga0495667_0114833 3300046559 Bacteria 1740
1740 Ga0495667_0623864 3300046559 Bacteria 671
1741 Ga0495656_0001070 3300046615 Bacteria 8866
1742 Ga0495668_0056564 3300046616 Bacteria 2165
1743 Ga0495668_0148126 3300046616 Bacteria 1285
1744 Ga0495668_0340680 3300046616 Bacteria 823
1745 Ga0495611_0037183 3300046648 Bacteria 2163
1746 Ga0495611_0352882 3300046648 Bacteria 675
1747 Ga0495625_0021963 3300046660 Bacteria 4900
1748 Ga0495625_0040736 3300046660 Bacteria 3384
1749 Ga0495625_0060694 3300046660 Bacteria 2678
1750 Ga0495625_0078070 3300046660 Bacteria 2311
1751 Ga0495625_0161052 3300046660 Bacteria 1503
1752 Ga0495625_0683058 3300046660 Bacteria 608
1753 Ga0495635_0146612 3300046663 Bacteria 1607
1754 Ga0495635_0283978 3300046663 Bacteria 1112
1755 Ga0495635_0298249 3300046663 Bacteria 1081
1756 Ga0495588_0026440 3300046674 Bacteria 2897
1757 Ga0495588_0067240 3300046674 Bacteria 1860
1758 Ga0495588_0542843 3300046674 Bacteria 609
1759 Ga0495657_0592767 3300046675 Bacteria 642
1760 Ga0495599_0642120 3300046678 Bacteria 615
1761 Ga0495646_0176976 3300046680 Bacteria 1173
1762 Ga0495646_0186533 3300046680 Bacteria 1136
1763 Ga0495646_0525651 3300046680 Bacteria 606
1764 Ga0495647_0029408 3300046681 Bacteria 2032
1765 Ga0495647_0145353 3300046681 Bacteria 1013
1766 Ga0495658_0014926 3300046683 Bacteria 3979
1767 Ga0495658_0093624 3300046683 Bacteria 1783
1768 Ga0495658_0164808 3300046683 Bacteria 1369
1769 Ga0495658_0226087 3300046683 Bacteria 1173
1770 Ga0495613_0231866 3300046689 Bacteria 1293
1771 Ga0495624_0413054 3300046690 Bacteria 810
1772 Ga0495670_0501458 3300046691 Bacteria 659
1773 Ga0495670_0733163 3300046691 Bacteria 539
1774 Ga0495670_0818997 3300046691 Bacteria 508
1775 Ga0495671_0115776 3300046692 Bacteria 1309
1776 Ga0495671_0151942 3300046692 Bacteria 1127
1777 Ga0495671_0330015 3300046692 Bacteria 732
1778 Ga0495649_0009554 3300046694 Bacteria 5753
1779 Ga0495589_0137142 3300046794 Bacteria 1173
1780 Ga0495600_0792769 3300046809 Bacteria 565
1781 Ga0495600_0822637 3300046809 Bacteria 552
1782 Ga0495660_0119551 3300046810 Bacteria 1334
1783 Ga0495660_0368547 3300046810 Bacteria 635
1784 Ga0495581_0511806 3300047315 Bacteria 698
1785 Ga0495581_0903825 3300047315 Bacteria 504
1786 Ga0495674_1479822 3300047319 Bacteria 503
1787 Ga0495676_0035806 3300047321 Bacteria 4149
1788 Ga0495676_0078953 3300047321 Bacteria 2504
1789 Ga0495676_0682244 3300047321 Bacteria 665
1790 Ga0495680_0048736 3300047322 Bacteria 3325
1791 Ga0495687_002064 3300047443 Bacteria 16886
1792 Ga0495687_005696 3300047443 Bacteria 7855
1793 Ga0495687_022510 3300047443 Bacteria 3023
1794 Ga0495673_0107757 3300047469 Bacteria 1118
1795 Ga0495673_0153463 3300047469 Bacteria 889
1796 Ga0495681_0392955 3300047470 Bacteria 520
1797 Ga0495684_0548175 3300047471 Bacteria 788
1798 Ga0495686_0133926 3300047472 Bacteria 1467
1799 Ga0495686_0149048 3300047472 Bacteria 1375
1800 Ga0495614_0183605 3300048089 Bacteria 942
1801 Ga0495614_0219437 3300048089 Bacteria 864
1802 Ga0495615_0023842 3300048090 Bacteria 1406
1803 Ga0495615_0132714 3300048090 Bacteria 729
1804 Ga0495615_0168331 3300048090 Bacteria 662
1805 Ga0495626_0050116 3300048091 Bacteria 1930
1806 Ga0495626_0090337 3300048091 Bacteria 1347
1807 Ga0496100_0046363 3300048903 Bacteria 2794
1808 Ga0496100_0058669 3300048903 Bacteria 2527
1809 Ga0496100_0849746 3300048903 Bacteria 716
1810 Ga0496100_1204822 3300048903 Bacteria 597
1811 Ga0496101_0005293 3300048904 Bacteria 8218
1812 Ga0496101_0008869 3300048904 Bacteria 6584
1813 Ga0496101_0019357 3300048904 Bacteria 4646
1814 Ga0496101_0692603 3300048904 Bacteria 805
1815 Ga0496101_0891250 3300048904 Bacteria 701
1816 Ga0496102_0004160 3300048905 Bacteria 12251
1817 Ga0496102_0022357 3300048905 Bacteria 5603
1818 Ga0496102_0025441 3300048905 Bacteria 5269
1819 Ga0496102_1735265 3300048905 Bacteria 542
1820 Ga0496103_0052729 3300048906 Bacteria 2519
1821 Ga0496103_0545910 3300048906 Bacteria 740
1822 Ga0496104_0004072 3300048907 Bacteria 12679
1823 Ga0496104_0225894 3300048907 Bacteria 1784
1824 Ga0496105_0013340 3300048908 Bacteria 6521
1825 Ga0496105_0335099 3300048908 Bacteria 1210
1826 Ga0496105_0346090 3300048908 Bacteria 1188
1827 Ga0496105_1017770 3300048908 Bacteria 619
1828 Ga0496106_0004162 3300048909 Bacteria 10783
1829 Ga0496106_0054027 3300048909 Bacteria 3034
1830 Ga0496106_0118004 3300048909 Bacteria 2071
1831 Ga0496107_0012377 3300048910 Bacteria 5954
1832 Ga0496107_0185959 3300048910 Bacteria 1543
1833 Ga0496107_0743017 3300048910 Bacteria 720
1834 Ga0496107_1023953 3300048910 Bacteria 599
1835 Ga0496107_1315008 3300048910 Bacteria 517
1836 Ga0496108_0017286 3300048911 Bacteria 5899
1837 Ga0496108_0054001 3300048911 Bacteria 3371
1838 Ga0496108_0059614 3300048911 Bacteria 3209
1839 Ga0496108_1037113 3300048911 Bacteria 699
1840 Ga0496109_0040199 3300048912 Bacteria 4235
1841 Ga0496109_0069350 3300048912 Bacteria 3233
1842 Ga0496109_0499406 3300048912 Bacteria 1148
1843 Ga0496109_0508627 3300048912 Bacteria 1137
1844 Ga0496109_0959386 3300048912 Bacteria 793
1845 Ga0496110_0010357 3300048913 Bacteria 7579
1846 Ga0496110_0110191 3300048913 Bacteria 2473
1847 Ga0496110_0238223 3300048913 Bacteria 1655
1848 Ga0496111_0226566 3300048914 Bacteria 1388
1849 Ga0496111_0824314 3300048914 Bacteria 671
1850 Ga0496112_0290238 3300048915 Bacteria 1582
1851 Ga0496113_0185358 3300048916 Bacteria 1650
1852 Ga0496113_0713531 3300048916 Bacteria 800
1853 Ga0496114_0022464 3300048917 Bacteria 5143
1854 Ga0496114_0419093 3300048917 Bacteria 1186
1855 Ga0496114_0563757 3300048917 Bacteria 1006
1856 Ga0496114_0736330 3300048917 Bacteria 863
1857 Ga0496114_1051712 3300048917 Bacteria 698
1858 Ga0496115_0002077 3300048918 Bacteria 14341
1859 Ga0496116_0066945 3300048919 Bacteria 2296
1860 Ga0496117_0004106 3300048920 Bacteria 16315
1861 Ga0496117_0051373 3300048920 Bacteria 2914
1862 Ga0496117_0195326 3300048920 Bacteria 1148
1863 Ga0496118_0009212 3300048921 Bacteria 10026
1864 Ga0496118_0078153 3300048921 Bacteria 2343
1865 Ga0496118_0374968 3300048921 Bacteria 749
1866 Ga0496119_0213336 3300048922 Bacteria 992
1867 Ga0496120_0199693 3300048923 Bacteria 969
1868 Ga0496121_0002206 3300048924 Bacteria 30412
1869 Ga0496121_0026908 3300048924 Bacteria 5399
1870 Ga0496122_0000415 3300048925 Bacteria 90626
1871 Ga0496122_0092947 3300048925 Bacteria 2048
1872 Ga0496122_0181637 3300048925 Bacteria 1254
1873 Ga0496122_0223552 3300048925 Bacteria 1078
1874 Ga0496122_0491478 3300048925 Bacteria 598
1875 Ga0496123_0000330 3300048926 Bacteria 90102
1876 Ga0496123_0022183 3300048926 Bacteria 4903
1877 Ga0496123_0036339 3300048926 Bacteria 3495
1878 Ga0496123_0047297 3300048926 Bacteria 2909
1879 Ga0496123_0245124 3300048926 Bacteria 887
1880 Ga0496124_0044485 3300048927 Bacteria 3809
1881 Ga0496124_0135708 3300048927 Bacteria 1948
1882 Ga0496124_0415473 3300048927 Bacteria 929
1883 Ga0496124_0525099 3300048927 Bacteria 787
1884 Ga0496124_0874145 3300048927 Bacteria 548
1885 Ga0496125_0041632 3300048928 Bacteria 3925
1886 Ga0496125_0674360 3300048928 Bacteria 553
1887 Ga0496126_0148535 3300048929 Bacteria 2011
1888 Ga0501309_000004 3300049129 Bacteria 11581
1889 Ga0501309_092679 3300049129 Bacteria 517
1890 Ga0501310_002992 3300049130 Bacteria 1636
1891 Ga0501310_019556 3300049130 Bacteria 834
1892 Ga0501310_057280 3300049130 Bacteria 575
1893 Ga0501305_001609 3300049161 Bacteria 2255
1894 Ga0501305_036628 3300049161 Bacteria 785
1895 Ga0501305_096135 3300049161 Bacteria 547
1896 Ga0495682_0343906 3300049460 Bacteria 526
1897 Ga0501292_023460 3300049515 Bacteria 1008
1898 Ga0501297_002256 3300049520 Bacteria 1852
1899 Ga0501303_004947 3300049526 Bacteria 1117
1900 Ga0501312_026367 3300049528 Bacteria 891
1901 Ga0501333_022767 3300049549 Bacteria 507
1902 Ga0501032_0090633 3300049569 Bacteria 2029
1903 Ga0501034_0016622 3300049571 Bacteria 7544
1904 Ga0501034_0792889 3300049571 Bacteria 840
1905 Ga0501037_0007252 3300049573 Bacteria 8102
1906 Ga0501043_0000545 3300049579 Bacteria 33864
1907 Ga0501046_0000021 3300049580 Bacteria 217313
1908 Ga0501046_0004297 3300049580 Bacteria 12968
1909 Ga0501046_0008745 3300049580 Bacteria 8796
1910 Ga0501047_0000757 3300049581 Bacteria 33717
1911 Ga0501048_0013766 3300049582 Bacteria 6000
1912 Ga0501069_0002093 3300049585 Bacteria 10048
1913 Ga0501070_0008659 3300049586 Bacteria 8601
1914 Ga0501198_000047 3300049649 Bacteria 40126
1915 Ga0501198_133305 3300049649 Bacteria 534
1916 Ga0501201_004855 3300049651 Bacteria 1251
1917 Ga0501206_015864 3300049653 Bacteria 1044
1918 Ga0501207_019125 3300049654 Bacteria 1083
1919 Ga0501222_000056 3300049662 Bacteria 40303
1920 Ga0501222_010931 3300049662 Bacteria 1197
1921 Ga0501223_035862 3300049663 Bacteria 964
1922 Ga0501227_030701 3300049665 Bacteria 1288
1923 Ga0501233_174043 3300049668 Bacteria 613
1924 Ga0501235_029982 3300049669 Bacteria 1225
1925 Ga0501236_062095 3300049670 Bacteria 665
1926 Ga0501238_043408 3300049671 Bacteria 665
1927 Ga0501242_026331 3300049674 Bacteria 769
1928 Ga0501249_040180 3300049679 Bacteria 1059
1929 Ga0501253_020019 3300049683 Bacteria 1162
1930 Ga0501257_031579 3300049686 Bacteria 1278
1931 Ga0501258_028345 3300049687 Bacteria 695
1932 Ga0501221_000933 3300049704 Bacteria 4793
1933 Ga0501225_0013159 3300049705 Bacteria 2317
1934 Ga0501225_0032891 3300049705 Bacteria 1426
1935 Ga0501229_000077 3300049706 Bacteria 9792
1936 Ga0501079_0051579 3300049741 Bacteria 3177
1937 Ga0501080_0199531 3300049742 Bacteria 1837
1938 Ga0501232_004559 3300049757 Bacteria 1331
1939 Ga0501241_108453 3300049758 Bacteria 605
1940 Ga0501262_000157 3300049759 Bacteria 8322
1941 Ga0501265_002252 3300049762 Bacteria 2185
1942 Ga0501268_087695 3300049765 Bacteria 651
1943 Ga0501271_052504 3300049768 Bacteria 556
1944 Ga0501282_007907 3300049778 Bacteria 1138
1945 Ga0501035_0120765 3300049822 Bacteria 2291
1946 Ga0501044_0180518 3300049823 Bacteria 2078
1947 Ga0501045_0002486 3300049824 Bacteria 12544
1948 nmdc:mga03683_218037_c1 3300050489 Bacteria 879
1949 nmdc:mga03683_22920_c1 3300050489 Bacteria 2426
1950 nmdc:mga03683_30347_c1 3300050489 Bacteria 2163
1951 nmdc:mga03683_354569_c1 3300050489 Bacteria 695
1952 nmdc:mga03683_447720_c1 3300050489 Bacteria 621
1953 nmdc:mga03683_48543_c1 3300050489 Bacteria 1764
1954 nmdc:mga03683_51579_c1 3300050489 Bacteria 1718
1955 nmdc:mga03683_90285_c1 3300050489 Bacteria 1335
1956 nmdc:mga03n38_226732_c1 3300050490 Bacteria 978
1957 nmdc:mga03n38_399825_c1 3300050490 Bacteria 756
1958 nmdc:mga03n38_454002_c1 3300050490 Bacteria 713
1959 nmdc:mga03n38_603014_c1 3300050490 Bacteria 626
1960 nmdc:mga00v17_152383_c1 3300050491 Bacteria 1485
1961 nmdc:mga00v17_202355_c1 3300050491 Bacteria 1284
1962 nmdc:mga00v17_401612_c1 3300050491 Bacteria 890
1963 nmdc:mga00v17_87307_c1 3300050491 Bacteria 1955
1964 nmdc:mga0yw44_240784_c1 3300050492 Bacteria 1202
1965 nmdc:mga0k408_10460_c1 3300050493 Bacteria 5017
1966 nmdc:mga0k408_12490_c1 3300050493 Bacteria 4643
1967 nmdc:mga0k408_164742_c1 3300050493 Bacteria 1321
1968 nmdc:mga0k408_171695_c1 3300050493 Bacteria 1293
1969 nmdc:mga0k408_18200_c2 3300050493 Bacteria 3187
1970 nmdc:mga0k408_190517_c1 3300050493 Bacteria 1224
1971 nmdc:mga0k408_256190_c1 3300050493 Bacteria 1045
1972 nmdc:mga0k408_26610_c1 3300050493 Bacteria 3281
1973 nmdc:mga0k408_270913_c1 3300050493 Bacteria 1014
1974 nmdc:mga0k408_302597_c1 3300050493 Bacteria 954
1975 nmdc:mga0k408_36110_c1 3300050493 Bacteria 2836
1976 nmdc:mga0k408_40302_c1 3300050493 Bacteria 2687
1977 nmdc:mga0k408_438894_c1 3300050493 Bacteria 776
1978 nmdc:mga0k408_583656_c1 3300050493 Bacteria 660
1979 nmdc:mga0k408_6644_c1 3300050493 Bacteria 6167
1980 nmdc:mga0k408_794578_c1 3300050493 Bacteria 552
1981 nmdc:mga0k408_83530_c1 3300050493 Bacteria 1872
1982 nmdc:mga06z11_125624_c1 3300050494 Bacteria 1435
1983 nmdc:mga06z11_255108_c1 3300050494 Bacteria 1034
1984 nmdc:mga06z11_363850_c1 3300050494 Bacteria 867
1985 nmdc:mga06z11_37405_c1 3300050494 Bacteria 2403
1986 nmdc:mga06z11_445710_c1 3300050494 Bacteria 782
1987 nmdc:mga06z11_507645_c1 3300050494 Bacteria 731
1988 nmdc:mga04h51_235928_c1 3300050495 Bacteria 729
1989 nmdc:mga07m45_12950_c1 3300050496 Bacteria 4414
1990 nmdc:mga07m45_151739_c1 3300050496 Bacteria 1344
1991 nmdc:mga07m45_154307_c1 3300050496 Bacteria 1332
1992 nmdc:mga07m45_156357_c1 3300050496 Bacteria 1323
1993 nmdc:mga07m45_16681_c1 3300050496 Bacteria 3933
1994 nmdc:mga07m45_18099_c1 3300050496 Bacteria 3797
1995 nmdc:mga07m45_18802_c1 3300050496 Bacteria 3737
1996 nmdc:mga07m45_18856_c1 3300050496 Bacteria 3732
1997 nmdc:mga07m45_201253_c1 3300050496 Bacteria 1159
1998 nmdc:mga07m45_21210_c1 3300050496 Bacteria 3535
1999 nmdc:mga07m45_342605_c1 3300050496 Bacteria 869
2000 nmdc:mga07m45_399292_c1 3300050496 Bacteria 798
2001 nmdc:mga07m45_4213_c1 3300050496 Bacteria 7032
2002 nmdc:mga07m45_460138_c1 3300050496 Bacteria 738
2003 nmdc:mga07m45_506933_c1 3300050496 Bacteria 699
2004 nmdc:mga07m45_529161_c1 3300050496 Bacteria 682
2005 nmdc:mga07m45_724059_c1 3300050496 Bacteria 572
2006 nmdc:mga07m45_836123_c1 3300050496 Bacteria 527
2007 nmdc:mga07m45_912609_c1 3300050496 Bacteria 502
2008 nmdc:mga05p37_182246_c1 3300050507 Bacteria 2554
2009 nmdc:mga05p37_220452_c1 3300050507 Bacteria 2289
2010 nmdc:mga0qj67_110899_c1 3300050509 Bacteria 2215
2011 nmdc:mga08y16_605174_c1 3300050511 Bacteria 1104
2012 nmdc:mga08y16_714912_c1 3300050511 Bacteria 1000
2013 nmdc:mga08y16_823151_c1 3300050511 Bacteria 920
2014 nmdc:mga08y16_950785_c1 3300050511 Bacteria 842
2015 nmdc:mga0n895_280592_c1 3300050512 Bacteria 1689
2016 nmdc:mga08x19_1194464_c1 3300050514 Bacteria 539
2017 nmdc:mga0sz30_14201_c1 3300050516 Bacteria 3130
2018 nmdc:mga0sz30_185966_c1 3300050516 Bacteria 922
2019 nmdc:mga0sz30_37847_c1 3300050516 Bacteria 2020
2020 nmdc:mga0sz30_405475_c1 3300050516 Bacteria 611
2021 nmdc:mga0sz30_442377_c1 3300050516 Bacteria 583
2022 nmdc:mga0sz30_5056_c1 3300050516 Bacteria 4821
2023 Ga0495601_0284010 3300053077 Bacteria 1079
2024 Ga0495612_0091577 3300053078 Bacteria 1288
2025 Ga0495612_0385124 3300053078 Bacteria 636
2026 Ga0500635_0087433 3300053080 Bacteria 1129
2027 Ga0495595_0323284 3300053084 Bacteria 777
2028 Ga0500578_0000006 3300053086 Bacteria 234598
2029 Ga0500578_0265118 3300053086 Bacteria 1030
2030 Ga0500643_006994 3300053087 Bacteria 4628
2031 Ga0500643_012618 3300053087 Bacteria 3020
2032 Ga0500644_0018587 3300053088 Bacteria 2039
2033 Ga0500646_0033981 3300053090 Bacteria 1412
2034 Ga0500646_0346932 3300053090 Bacteria 540
2035 Ga0500651_0000156 3300053093 Bacteria 43636
2036 Ga0500651_0076022 3300053093 Bacteria 2085
2037 Ga0500651_0168496 3300053093 Bacteria 1307
2038 Ga0500651_0444845 3300053093 Bacteria 722
2039 Ga0500566_0160156 3300053094 Bacteria 1174
2040 Ga0500650_0145041 3300053098 Bacteria 1099
2041 Ga0500650_0338961 3300053098 Bacteria 659
2042 Ga0500557_128395 3300053105 Bacteria 840
2043 Ga0500562_005406 3300053108 Bacteria 3208
2044 Ga0500562_008977 3300053108 Bacteria 2525
2045 Ga0500571_000005 3300053110 Bacteria 109625
2046 Ga0500594_0001096 3300053118 Bacteria 5806
2047 Ga0500597_317525 3300053120 Bacteria 616
2048 Ga0500608_022424 3300053122 Bacteria 2927
2049 Ga0500608_074158 3300053122 Bacteria 1614
2050 Ga0500618_164499 3300053125 Bacteria 508
2051 Ga0500621_251616 3300053126 Bacteria 593
2052 Ga0500623_007865 3300053127 Bacteria 5280
2053 Ga0500626_035282 3300053128 Bacteria 2260
2054 Ga0500628_003722 3300053129 Bacteria 2518
2055 Ga0500628_060492 3300053129 Bacteria 924
2056 Ga0500642_0064667 3300053130 Bacteria 1651
2057 Ga0500652_001283 3300053131 Bacteria 7966
2058 Ga0500655_000516 3300053133 Bacteria 7797
2059 Ga0500655_020988 3300053133 Bacteria 1222
2060 Ga0500658_0000141 3300053134 Bacteria 34224
2061 Ga0500658_0000561 3300053134 Bacteria 15644
2062 Ga0500658_0006983 3300053134 Bacteria 4179
2063 Ga0500658_0163347 3300053134 Bacteria 1009
2064 Ga0500559_0000880 3300053136 Bacteria 19209
2065 Ga0500559_0006764 3300053136 Bacteria 5146
2066 Ga0500564_001417 3300053138 Bacteria 8279
2067 Ga0500568_0001097 3300053139 Bacteria 18225
2068 Ga0500568_0127304 3300053139 Bacteria 947
2069 Ga0500573_0032467 3300053140 Bacteria 3013
2070 Ga0500579_150348 3300053143 Bacteria 1017
2071 Ga0500604_0019070 3300053151 Bacteria 1917
2072 Ga0500604_0284338 3300053151 Bacteria 573
2073 Ga0500616_0059379 3300053153 Bacteria 1986
2074 Ga0500619_000073 3300053154 Bacteria 28363
2075 Ga0500622_0001738 3300053156 Bacteria 16832
2076 Ga0500624_028461 3300053157 Bacteria 946
2077 Ga0500624_115262 3300053157 Bacteria 561
2078 Ga0500634_0055702 3300053161 Bacteria 2114
2079 Ga0500638_016327 3300053162 Bacteria 3423
2080 Ga0500636_0214708 3300053177 Bacteria 1007
2081 Ga0500625_115871 3300053729 Bacteria 1088
2082 Ga0500645_007607 3300053730 Bacteria 3758
2083 Ga0500596_018165 3300053735 Bacteria 1055
2084 Ga0590071_099013 3300059421 Bacteria 734
2085 Ga0501082_0033320 3300060353 Bacteria 4445
2086 Ga0501082_1844706 3300060353 Bacteria 527
2087 Ga0466962_0056126 3300061719 Bacteria 1881
2088 Ga0466962_0127631 3300061719 Bacteria 1228
2089 2587725128 2585428057 Bacteria 6737412
2090 2587731512 2585428058 Bacteria 6853932
2091 2587756191 2585428062 Bacteria 6842168
2092 2588295157 2588253510 Bacteria 6901809
2093 2599623208 2599185214 Bacteria 8209958
2094 2599674855 2599185226 Bacteria 8233575
2095 2599680812 2599185227 Bacteria 8246414
2096 2599692827 2599185229 Bacteria 8216126
2097 2643743907 2643221544 Bacteria 5886209
2098 2643933067 2643221585 Bacteria 5812563
2099 2643966984 2643221592 Bacteria 6608788
2100 2644142647 2643221625 Bacteria 6512927
2101 2644217210 2643221639 Bacteria 6649903
2102 2644248385 2643221644 Bacteria 6865017
2103 2644259022 2643221646 Bacteria 6433402
2104 2644273678 2643221648 Bacteria 6521465
2105 2644301595 2643221654 Bacteria 5273570
2106 2644314316 2643221656 Bacteria 5809961
2107 2644340934 2643221660 Bacteria 4208257
2108 2644467186 2643221683 Bacteria 5749203
2109 2649122609 2648501241 Bacteria 5312320
2110 2652974065 2651869818 Bacteria 5864031
2111 2738723941 2738541277 Bacteria 7458140
2112 2738882767 2738541307 Bacteria 8606193
2113 2739055759 2738541337 Bacteria 6183410
2114 2739250496 2738543013 Bacteria 5618633
2115 2739280468 2738543019 Bacteria 7459457
2116 2819600344 2818991446 Bacteria 7757362
2117 2831271862 2831265667 Bacteria 7184833
2118 2838059700 2838054893 Bacteria 7451788
2119 2842682804 2842677519 Bacteria 5615038
2120 2842735792 2842733646 Bacteria 5716726
2121 2885193535 2885192300 Bacteria 5882526
2122 2885198646 2885198086 Bacteria 7212419
2123 2885211974 2885211737 Bacteria 7212420
2124 2887632367 2887630918 Bacteria 3239855
2125 2899928485 2899924645 Bacteria 7487985
2126 2904451787 2904449895 Bacteria 6927402
2127 2904462556 2904456579 Bacteria 6819253
2128 2919467229 2919462493 Bacteria 5817112
2129 2919494179 2919493220 Bacteria 4598500
2130 2919543811 2919543075 Bacteria 4728703
2131 2919688610 2919688452 Bacteria 4595932
2132 2923525961 2923525760 Bacteria 4472324
2133 2923527662 2923525760 Bacteria 4472324
2134 2928041406 2928037797 Bacteria 7273642
2135 2928048248 2928044640 Bacteria 7271509
2136 2928056092 2928051484 Bacteria 7773759
2137 2928066428 2928064002 Bacteria 7419480
2138 2928076083 2928070936 Bacteria 8062541
2139 2928087728 2928084124 Bacteria 7159212
2140 2929523670 2929520902 Bacteria 6765052
2141 2945946087 2945945610 Bacteria 5951079
2142 2945975686 2945972063 Bacteria 6086495
2143 2954768861 2954767861 Bacteria 5535784
2144 8002746423 8002745576 Bacteria 4840272
2145 nmdc:mga09592_14154_c1
2146 SwRhRL2b_contig_93844
2147 JGI24746J21847_1025597
2148 JGI24740J21852_10030620
2149 JGI24740J21852_10061013
2150 JGI24739J22299_10016035
2151 JGI24739J22299_10125477
2152 JGI24735J21928_10247644
2153 JGI24750J21931_1076289
2154 JGI25158J39367_1004622
2155 JGI25158J39367_1015083
2156 JGI25152J39213_1006440
2157 JGI25150J39212_1000713
2158 JGI25159J45721_1007232
2159 JGI25159J45721_1009555
2160 JGI25151J46595_10016692
2161 JGI25153J46596_10004412
2162 JGI25153J46596_10011494
2163 JGI25153J46596_10012754
2164 JGI25153J46596_10014829
2165 JGI25153J46596_10028238
2166 rootH1_10029168
2167 rootH1_10056955
2168 rootH2_10190564
2169 rootL2_10040047
2170 rootL2_10046934
2171 rootL2_10150001
2172 rootH1_10038325
2173 rootH1_10042098
2174 rootH1_10068314
2175 JGI26128J50194_1000847
2176 JGI25160J50197_1011152
2177 JGI25160J50197_1013627
2178 JGI26145J50221_1025494
2179 JGI25161J50226_1003238
2180 JGI25161J50226_1008435
2181 Ga0006562J51391_1125153
2182 Ga0006562J51391_1125156
2183 Ga0055532_1025643
2184 Ga0055535_1001434
2185 Ga0055542_1000127
2186 Ga0055526_1002532
2187 Ga0055526_1014660
2188 Ga0055526_1014781
2189 Ga0055537_1005895
2190 Ga0055537_1005952
2191 Ga0055524_1000207
2192 Ga0055524_1012781
2193 Ga0055524_1015362
2194 Ga0055536_1000530
2195 Ga0055536_1001748
2196 Ga0055536_1038022
2197 Ga0055534_1003750
2198 Ga0055534_1005868
2199 Ga0055534_1015344
2200 Ga0055528_1007039
2201 Ga0055528_1013037
2202 Ga0055528_1063074
2203 Ga0055528_1081495
2204 Ga0055530_10000464
2205 Ga0055530_10020044
2206 Ga0055530_10057447
2207 Ga0055530_10122084
2208 Ga0055540_1000011
2209 Ga0055540_1000603
2210 Ga0055540_1002445
2211 Ga0055540_1002836
2212 Ga0055540_1020072
2213 Ga0055531_10001607
2214 Ga0055531_10001895
2215 Ga0055531_10011526
2216 Ga0055543_1000771
2217 Ga0055543_1003491
2218 Ga0065165_1001786
2219 Ga0065165_1003619
2220 Ga0065165_1010543
2221 Ga0065714_10276998
2222 Ga0065714_10299280
2223 Ga0065704_10100495
2224 Ga0065704_10153191
2225 Ga0065704_10178466
2226 Ga0065704_10251990
2227 Ga0065704_10776945
2228 Ga0065712_10045136
2229 Ga0065712_10054430
2230 Ga0065715_10145513
2231 Ga0065715_10245821
2232 Ga0070658_10897051
2233 Ga0070676_10001849
2234 Ga0070676_10019835
2235 Ga0070676_10083237
2236 Ga0070676_10099580
2237 Ga0070676_10380340
2238 Ga0070676_10420234
2239 Ga0070676_10617389
2240 Ga0070676_10841459
2241 Ga0070676_11502463
2242 Ga0070683_100032863
2243 Ga0070683_100713614
2244 Ga0070683_100935908
2245 Ga0070690_100006214
2246 Ga0070670_100013010
2247 Ga0070670_100037154
2248 Ga0070670_100095571
2249 Ga0070670_100199248
2250 Ga0070670_100465496
2251 Ga0070670_100545083
2252 Ga0070670_100594711
2253 Ga0070670_100678357
2254 Ga0070670_100738722
2255 Ga0070670_100947184
2256 Ga0070670_101263339
2257 Ga0070670_101497598
2258 Ga0070670_101693075
2259 Ga0070677_10017835
2260 Ga0070677_10033687
2261 Ga0070677_10071030
2262 Ga0070677_10108197
2263 Ga0070677_10146861
2264 Ga0070677_10241124
2265 Ga0070677_10241125
2266 Ga0070677_10481215
2267 Ga0068869_100014166
2268 Ga0068869_100036584
2269 Ga0068869_100067518
2270 Ga0068869_100095143
2271 Ga0068869_100347984
2272 Ga0068869_100378568
2273 Ga0068869_100447250
2274 Ga0068869_100666018
2275 Ga0068869_101160634
2276 Ga0070666_10020373
2277 Ga0070666_10071419
2278 Ga0070666_10332138
2279 Ga0070666_10689634
2280 Ga0070666_10735042
2281 Ga0070666_11311054
2282 Ga0070666_11338559
2283 Ga0070666_11453302
2284 Ga0070680_100012570
2285 Ga0070680_100121871
2286 Ga0070680_100130032
2287 Ga0070680_101068157
2288 Ga0068868_100003711
2289 Ga0068868_100052781
2290 Ga0068868_100058644
2291 Ga0068868_100059788
2292 Ga0068868_100140028
2293 Ga0068868_100205867
2294 Ga0068868_100233241
2295 Ga0068868_100322318
2296 Ga0068868_100362665
2297 Ga0068868_100982060
2298 Ga0068868_101411987
2299 Ga0068868_102317947
2300 Ga0068868_102431744
2301 Ga0070660_100002224
2302 Ga0070660_101270341
2303 Ga0070660_101583083
2304 Ga0070660_101863067
2305 Ga0070689_100021223
2306 Ga0070689_101343224
2307 Ga0070691_10522081
2308 Ga0070687_100038494
2309 Ga0070687_100496478
2310 Ga0070687_100518213
2311 Ga0070687_101353116
2312 Ga0070687_101443009
2313 Ga0070661_100005152
2314 Ga0070661_100042215
2315 Ga0070661_100219593
2316 Ga0070661_100597918
2317 Ga0070661_100783587
2318 Ga0070668_100013101
2319 Ga0070668_100130926
2320 Ga0070668_100246169
2321 Ga0070668_100467784
2322 Ga0070668_100583008
2323 Ga0070668_100617705
2324 Ga0070669_100015642
2325 Ga0070669_100071256
2326 Ga0070669_100097794
2327 Ga0070669_100160545
2328 Ga0070669_100426231
2329 Ga0070669_100704995
2330 Ga0070669_101135656
2331 Ga0070669_101481984
2332 Ga0070669_101570594
2333 Ga0070675_100000250
2334 Ga0070675_100003213
2335 Ga0070675_100011215
2336 Ga0070675_100012571
2337 Ga0070675_100018746
2338 Ga0070675_100025359
2339 Ga0070675_100114393
2340 Ga0070675_100171767
2341 Ga0070675_100207755
2342 Ga0070675_100326159
2343 Ga0070675_100419443
2344 Ga0070675_100571434
2345 Ga0070675_101423761
2346 Ga0070675_101469976
2347 Ga0070675_101820912
2348 Ga0070671_100006682
2349 Ga0070671_100126528
2350 Ga0070671_100152385
2351 Ga0070671_100202994
2352 Ga0070671_100315170
2353 Ga0070671_100440500
2354 Ga0070671_100656227
2355 Ga0070671_101156220
2356 Ga0070671_101169761
2357 Ga0070671_101200285
2358 Ga0070671_101970988
2359 Ga0070671_102000250
2360 Ga0070674_100002846
2361 Ga0070674_100029632
2362 Ga0070674_100038484
2363 Ga0070674_100233224
2364 Ga0070674_100792281
2365 Ga0070674_101416738
2366 Ga0070674_101536814
2367 Ga0070674_101616631
2368 Ga0070674_101700792
2369 Ga0070673_100027009
2370 Ga0070673_100073056
2371 Ga0070673_100102804
2372 Ga0070673_100164539
2373 Ga0070673_100260429
2374 Ga0070673_100274931
2375 Ga0070673_100329470
2376 Ga0070673_100490950
2377 Ga0070673_100768445
2378 Ga0070673_101126854
2379 Ga0070688_100004925
2380 Ga0070688_100578414
2381 Ga0070688_100648628
2382 Ga0070688_101656546
2383 Ga0070659_100008671
2384 Ga0070659_100011205
2385 Ga0070659_100051316
2386 Ga0070659_100510243
2387 Ga0070659_100710562
2388 Ga0070659_100882452
2389 Ga0070659_101020976
2390 Ga0070659_101026845
2391 Ga0070659_101090530
2392 Ga0070667_100039183
2393 Ga0070667_100257230
2394 Ga0070667_100334063
2395 Ga0070667_100334570
2396 Ga0070667_100354680
2397 Ga0070667_100533371
2398 Ga0070667_100958035
2399 Ga0070667_100989473
2400 Ga0070667_101176329
2401 Ga0070667_101205557
2402 Ga0070667_101609601
2403 Ga0070667_101677350
2404 Ga0070667_102151080
2405 Ga0070703_10571995
2406 Ga0070709_10084240
2407 Ga0070714_100003247
2408 Ga0070713_100255447
2409 Ga0070713_102202206
2410 Ga0070710_10151357
2411 Ga0070710_10918525
2412 Ga0070701_10500696
2413 Ga0070701_10595090
2414 Ga0070711_100892482
2415 Ga0070705_100393727
2416 Ga0070700_101212675
2417 Ga0070708_100063831
2418 Ga0070708_101003617
2419 Ga0070663_100003281
2420 Ga0070663_100196930
2421 Ga0070663_100290568
2422 Ga0070663_100316389
2423 Ga0070663_100974126
2424 Ga0070663_101134196
2425 Ga0070663_101300241
2426 Ga0070663_101584809
2427 Ga0070663_101716594
2428 Ga0070678_100053998
2429 Ga0070678_100060240
2430 Ga0070678_100074682
2431 Ga0070678_100080841
2432 Ga0070678_100086444
2433 Ga0070678_100093252
2434 Ga0070678_100097628
2435 Ga0070678_100226044
2436 Ga0070678_100417015
2437 Ga0070678_100435618
2438 Ga0070678_100736692
2439 Ga0070678_100964237
2440 Ga0070678_100974049
2441 Ga0070678_101332825
2442 Ga0070678_101701187
2443 Ga0070678_101707733
2444 Ga0070678_101961243
2445 Ga0070678_102104866
2446 Ga0070662_100013275
2447 Ga0070662_100043528
2448 Ga0070662_100052894
2449 Ga0070662_100127998
2450 Ga0070662_100262606
2451 Ga0070662_100287034
2452 Ga0070662_100418097
2453 Ga0070662_100576707
2454 Ga0070662_100596614
2455 Ga0070662_100598633
2456 Ga0070662_100896512
2457 Ga0070662_101444633
2458 Ga0070662_101616173
2459 Ga0070662_101678461
2460 Ga0070681_10170120
2461 Ga0070681_10265946
2462 Ga0068867_100000329
2463 Ga0068867_100001932
2464 Ga0068867_100020667
2465 Ga0068867_100056082
2466 Ga0068867_100102861
2467 Ga0068867_100115742
2468 Ga0068867_100178615
2469 Ga0068867_100248108
2470 Ga0068867_100422376
2471 Ga0068867_100548975
2472 Ga0068867_100623126
2473 Ga0068867_100691947
2474 Ga0068867_100944551
2475 Ga0068867_101049289
2476 Ga0068867_101129962
2477 Ga0070685_10693949
2478 Ga0070685_10833306
2479 Ga0070685_11177346
2480 Ga0070685_11588165
2481 Ga0070706_100004486
2482 Ga0070706_100096620
2483 Ga0070707_100355610
2484 Ga0070698_100138790
2485 Ga0070699_101436279
2486 Ga0070679_100043614
2487 Ga0070679_100212093
2488 Ga0070679_100241396
2489 Ga0070679_100475313
2490 Ga0070679_101126452
2491 Ga0070684_100181994
2492 Ga0070684_100202985
2493 Ga0070684_100775796
2494 Ga0070684_102145738
2495 Ga0068853_100004811
2496 Ga0068853_100007795
2497 Ga0068853_100010420
2498 Ga0068853_100105575
2499 Ga0068853_100160997
2500 Ga0068853_100281317
2501 Ga0068853_100490057
2502 Ga0068853_100522230
2503 Ga0070672_100001451
2504 Ga0070672_100015547
2505 Ga0070672_100021276
2506 Ga0070672_100027777
2507 Ga0070672_100030773
2508 Ga0070672_100033709
2509 Ga0070672_100042276
2510 Ga0070672_100135479
2511 Ga0070672_100318781
2512 Ga0070672_100332166
2513 Ga0070672_100412143
2514 Ga0070672_100572100
2515 Ga0070672_101391110
2516 Ga0070695_100085874
2517 Ga0070693_100026317
2518 Ga0070693_100629876
2519 Ga0070665_100543803
2520 Ga0070665_100790261
2521 Ga0070665_100853711
2522 Ga0070665_101205973
2523 Ga0070665_102467209
2524 Ga0068855_100015899
2525 Ga0068855_100019544
2526 Ga0068855_100399137
2527 Ga0068855_100409839
2528 Ga0068855_100546779
2529 Ga0070664_100001831
2530 Ga0070664_100040136
2531 Ga0070664_100148636
2532 Ga0070664_100230636
2533 Ga0070664_100262430
2534 Ga0070664_100285705
2535 Ga0070664_100512445
2536 Ga0070664_100832791
2537 Ga0070664_101046865
2538 Ga0070664_101047334
2539 Ga0070664_101638866
2540 Ga0070664_102223047
2541 Ga0068857_100001323
2542 Ga0068857_100188666
2543 Ga0068857_100220281
2544 Ga0068857_100804946
2545 Ga0068857_100923447
2546 Ga0068857_101427885
2547 Ga0068857_102188780
2548 Ga0068854_100014719
2549 Ga0068854_100499034
2550 Ga0068854_100691507
2551 Ga0068854_100801982
2552 Ga0068856_100012520
2553 Ga0068856_100234744
2554 Ga0068856_100588995
2555 Ga0070702_100330559
2556 Ga0070702_100390308
2557 Ga0070702_100970483
2558 Ga0070702_101678808
2559 Ga0068852_100003059
2560 Ga0068852_100003215
2561 Ga0068852_100005883
2562 Ga0068852_100060508
2563 Ga0068852_100063413
2564 Ga0068852_100081438
2565 Ga0068852_100085851
2566 Ga0068852_100281484
2567 Ga0068852_100289797
2568 Ga0068852_100338183
2569 Ga0068852_100429912
2570 Ga0068852_100496905
2571 Ga0068852_100623488
2572 Ga0068852_100877640
2573 Ga0068852_100944013
2574 Ga0068852_101778848
2575 Ga0068852_101993761
2576 Ga0068852_102203231
2577 Ga0068852_102555406
2578 Ga0068859_100024423
2579 Ga0068859_100030871
2580 Ga0068859_100205505
2581 Ga0068859_100420551
2582 Ga0068864_100003978
2583 Ga0068864_100026806
2584 Ga0068864_100070862
2585 Ga0068864_100074432
2586 Ga0068864_100186642
2587 Ga0068864_100507830
2588 Ga0068864_100959443
2589 Ga0068864_102179872
2590 Ga0068864_102491605
2591 Ga0068866_10010148
2592 Ga0068866_10092812
2593 Ga0068866_10246875
2594 Ga0068866_10624189
2595 Ga0068861_100007969
2596 Ga0068861_100050459
2597 Ga0068861_100252792
2598 Ga0068861_100566595
2599 Ga0068861_100754860
2600 Ga0068861_101024062
2601 Ga0068861_101437731
2602 Ga0068861_102366491
2603 Ga0068851_10010993
2604 Ga0068851_10013080
2605 Ga0068851_10049026
2606 Ga0068851_10061522
2607 Ga0068851_10110219
2608 Ga0068851_10232097
2609 Ga0068851_10365005
2610 Ga0068851_10403524
2611 Ga0068851_10871972
2612 Ga0068870_10184872
2613 Ga0068870_10286484
2614 Ga0068870_10433751
2615 Ga0068863_100019694
2616 Ga0068863_100076202
2617 Ga0068863_100160408
2618 Ga0068863_100294731
2619 Ga0068863_100352912
2620 Ga0068863_100587577
2621 Ga0068863_102685320
2622 Ga0068858_100001515
2623 Ga0068858_100001818
2624 Ga0068858_100003704
2625 Ga0068860_100001009
2626 Ga0068860_100003030
2627 Ga0068860_100057253
2628 Ga0068860_100249680
2629 Ga0068860_100730483
2630 Ga0068860_102665865
2631 Ga0068862_100036617
2632 Ga0068862_100243673
2633 Ga0068862_101222035
2634 Ga0070717_10994756
2635 Ga0075365_10270767
2636 Ga0075368_10069600
2637 Ga0075363_100009238
2638 Ga0075363_100131110
2639 Ga0075363_100157455
2640 Ga0075363_100301776
2641 Ga0075364_10002974
2642 Ga0075364_10121068
2643 Ga0075364_10187923
2644 Ga0070715_10214039
2645 Ga0070716_100205061
2646 Ga0070716_100776094
2647 Ga0070712_101297678
2648 Ga0075362_10010715
2649 Ga0075362_10021615
2650 Ga0075362_10064250
2651 Ga0075362_10162263
2652 Ga0075362_10173547
2653 Ga0075362_10190963
2654 Ga0075362_10409447
2655 Ga0075362_10434037
2656 Ga0075362_10500658
2657 Ga0075362_10516424
2658 Ga0075362_10672741
2659 Ga0075367_10015588
2660 Ga0075367_10033387
2661 Ga0075367_10056015
2662 Ga0075367_10078408
2663 Ga0075367_10389942
2664 Ga0075369_10007815
2665 Ga0075369_10013367
2666 Ga0075369_10104184
2667 Ga0075369_10408093
2668 Ga0075366_10025896
2669 Ga0075366_10046947
2670 Ga0075366_10058370
2671 Ga0075366_10083646
2672 Ga0075366_10124788
2673 Ga0075366_10179318
2674 Ga0075366_10251270
2675 Ga0075366_10317687
2676 Ga0075366_10371893
2677 Ga0075366_10479410
2678 Ga0075366_10485219
2679 Ga0075366_10577374
2680 Ga0075366_10638500
2681 Ga0075366_10859577
2682 Ga0075366_10944258
2683 Ga0097621_100016134
2684 Ga0097621_100056447
2685 Ga0097621_100096593
2686 Ga0097621_100104372
2687 Ga0097621_100406286
2688 Ga0097621_100566255
2689 Ga0097621_101293660
2690 Ga0097621_101392461
2691 Ga0075370_10000524
2692 Ga0075370_10002753
2693 Ga0075370_10010292
2694 Ga0075370_10014590
2695 Ga0075370_10024961
2696 Ga0075370_10054018
2697 Ga0075370_10104776
2698 Ga0075370_10130104
2699 Ga0075370_10137636
2700 Ga0075370_10182783
2701 Ga0075370_10194837
2702 Ga0075370_10198370
2703 Ga0075370_10321799
2704 Ga0075370_10440707
2705 Ga0075370_10479758
2706 Ga0075370_10505437
2707 Ga0075370_10511414
2708 Ga0075370_10656904
2709 Ga0075370_10795353
2710 Ga0068871_100083637
2711 Ga0068871_100163910
2712 Ga0068871_100183476
2713 Ga0068871_100321654
2714 Ga0068871_100518079
2715 Ga0068871_100886165
2716 Ga0068871_100890569
2717 Ga0068871_101112981
2718 Ga0068871_101214269
2719 Ga0068871_101446739
2720 Ga0068871_101757230
2721 Ga0075428_100529609
2722 Ga0075428_101653622
2723 Ga0075430_100023009
2724 Ga0075434_100130115
2725 Ga0075429_100008966
2726 Ga0068865_100091831
2727 Ga0068865_100097410
2728 Ga0068865_100112935
2729 Ga0068865_100367678
2730 Ga0068865_100546026
2731 Ga0097620_100024424
2732 Ga0097620_100030873
2733 Ga0097620_100205485
2734 Ga0097620_100420551
2735 Ga0079104_1000040
2736 Ga0079104_1044093
2737 Ga0099826_10238378
2738 Ga0105251_10343262
2739 Ga0105244_10026422
2740 Ga0105244_10480951
2741 Ga0105240_10002903
2742 Ga0105240_10030212
2743 Ga0105240_10039246
2744 Ga0105240_10183372
2745 Ga0105240_10221428
2746 Ga0105240_10721263
2747 Ga0111539_10492911
2748 Ga0111539_10542458
2749 Ga0111539_10867708
2750 Ga0105245_10008631
2751 Ga0105245_10049840
2752 Ga0105245_10061364
2753 Ga0105245_10293445
2754 Ga0105245_11520681
2755 Ga0105245_12155683
2756 Ga0105247_10237932
2757 Ga0105247_10253737
2758 Ga0105247_10947597
2759 Ga0114129_10023973
2760 Ga0114129_10267738
2761 Ga0105243_10000197
2762 Ga0105243_10008438
2763 Ga0105243_10013128
2764 Ga0105243_10083870
2765 Ga0105243_10312678
2766 Ga0105243_10475551
2767 Ga0105243_11079602
2768 Ga0105243_11459518
2769 Ga0105243_12658700
2770 Ga0105241_10086637
2771 Ga0105241_10191455
2772 Ga0105241_10669885
2773 Ga0105241_11599311
2774 Ga0105241_11902796
2775 Ga0105242_10058974
2776 Ga0105242_10282573
2777 Ga0105242_10339727
2778 Ga0105242_11759390
2779 Ga0105242_12123191
2780 Ga0105248_10013699
2781 Ga0105248_10031936
2782 Ga0105248_10285735
2783 Ga0105248_10446577
2784 Ga0105248_10459956
2785 Ga0105248_10754462
2786 Ga0105248_10989899
2787 Ga0105248_11718831
2788 Ga0105248_11948689
2789 Ga0105237_10000605
2790 Ga0105237_10014977
2791 Ga0105237_10021204
2792 Ga0105237_10024647
2793 Ga0105237_10035003
2794 Ga0105237_10073055
2795 Ga0105237_10452160
2796 Ga0105238_10001575
2797 Ga0105238_10028942
2798 Ga0105238_10307061
2799 Ga0105238_10378039
2800 Ga0105238_10393781
2801 Ga0105238_10483868
2802 Ga0105238_10898267
2803 Ga0105249_10138150
2804 Ga0105249_10394623
2805 Ga0105249_10755732
2806 Ga0105249_10957132
2807 Ga0105249_10978956
2808 Ga0105249_12241215
2809 Ga0105239_10000328
2810 Ga0105239_10026320
2811 Ga0105239_10031452
2812 Ga0105239_10114097
2813 Ga0105239_11237406
2814 Ga0105246_10153471
2815 Ga0105246_10439382
2816 Ga0105246_10458010
2817 Ga0105246_10616419
2818 Ga0105246_11820562
2819 Ga0105246_12419946
2820 Ga0157317_1005765
2821 Ga0157328_1027883
2822 Ga0157337_1031094
2823 Ga0157325_1015900
2824 Ga0157329_1014777
2825 Ga0157323_1004876
2826 Ga0157314_1005685
2827 Ga0157315_1034929
2828 Ga0157316_1005909
2829 Ga0157327_1046621
2830 Ga0157338_1059789
2831 Ga0157373_10009706
2832 Ga0157373_10020413
2833 Ga0157373_10213609
2834 Ga0157373_10329462
2835 Ga0157373_10371991
2836 Ga0157373_11023067
2837 Ga0157373_11092864
2838 Ga0157371_10034557
2839 Ga0157371_10094994
2840 Ga0157371_10095280
2841 Ga0157371_10907224
2842 Ga0157371_11150079
2843 Ga0157371_11595439
2844 Ga0157370_10026238
2845 Ga0157370_10233816
2846 Ga0157370_10653068
2847 Ga0157370_11467787
2848 Ga0157370_11660903
2849 Ga0157370_11811047
2850 Ga0157370_12092579
2851 Ga0157369_10014064
2852 Ga0157369_10014312
2853 Ga0157369_10298892
2854 Ga0157369_10957638
2855 Ga0157374_10007375
2856 Ga0157374_10047442
2857 Ga0157374_10074924
2858 Ga0157374_10202503
2859 Ga0157374_10765796
2860 Ga0157374_10994380
2861 Ga0157374_11476736
2862 Ga0157374_12492433
2863 Ga0157378_10113037
2864 Ga0157378_10138443
2865 Ga0157378_10754387
2866 Ga0157378_11027931
2867 Ga0157378_11150283
2868 Ga0157378_11505132
2869 Ga0163162_10023275
2870 Ga0163162_10060967
2871 Ga0163162_10080866
2872 Ga0163162_10128822
2873 Ga0163162_10218886
2874 Ga0163162_10696994
2875 Ga0163162_10816582
2876 Ga0163162_11052362
2877 Ga0163162_11054926
2878 Ga0163162_11324107
2879 Ga0163162_11989478
2880 Ga0163162_12242593
2881 Ga0163162_12253968
2882 Ga0163162_12395248
2883 Ga0157372_10005958
2884 Ga0157372_10010263
2885 Ga0157372_10059208
2886 Ga0157372_10502453
2887 Ga0157372_10507343
2888 Ga0157372_11772534
2889 Ga0157372_11943755
2890 Ga0157375_10024076
2891 Ga0157375_10044133
2892 Ga0157375_10165940
2893 Ga0157375_10220885
2894 Ga0157375_10543308
2895 Ga0157375_11008528
2896 Ga0157375_11096261
2897 Ga0157375_11410600
2898 Ga0157375_11918122
2899 Ga0157375_12704414
2900 Ga0157375_12882360
2901 Ga0157375_13344920
2902 Ga0163163_10220374
2903 Ga0163163_10251732
2904 Ga0163163_10394057
2905 Ga0163163_10527368
2906 Ga0163163_10767023
2907 Ga0163163_10998768
2908 Ga0163163_11021015
2909 Ga0163163_11230600
2910 Ga0163163_11713957
2911 Ga0163163_12521296
2912 Ga0157380_10360353
2913 Ga0157380_10607993
2914 Ga0157380_10854464
2915 Ga0157380_11008816
2916 Ga0157380_11107608
2917 Ga0157380_11265346
2918 Ga0157380_11730149
2919 Ga0157380_12519827
2920 Ga0157380_12697823
2921 Ga0157380_13486133
2922 Ga0182008_10020420
2923 Ga0182008_10096215
2924 Ga0182008_10136468
2925 Ga0182008_10383655
2926 Ga0157377_10000170
2927 Ga0157377_10043830
2928 Ga0157377_10165085
2929 Ga0157377_10461045
2930 Ga0157379_10006124
2931 Ga0157379_10018100
2932 Ga0157379_10039682
2933 Ga0157379_10082445
2934 Ga0157379_10724686
2935 Ga0157379_11528669
2936 Ga0157376_10029275
2937 Ga0157376_10128576
2938 Ga0157376_10328604
2939 Ga0157376_10334767
2940 Ga0157376_10537979
2941 Ga0157376_10998736
2942 Ga0157376_11986897
2943 Ga0157376_12879482
2944 Ga0157376_12881165
2945 Ga0182006_1051132
2946 Ga0182006_1121441
2947 Ga0182006_1179085
2948 Ga0182006_1273992
2949 Ga0182007_10002567
2950 Ga0182005_1017803
2951 Ga0182005_1033460
2952 Ga0182005_1120196
2953 Ga0183362_10001
2954 Ga0163161_10017494
2955 Ga0163161_10144969
2956 Ga0163161_10255007
2957 Ga0163161_10325350
2958 Ga0163161_10401696
2959 Ga0163161_10443080
2960 Ga0163161_10999557
2961 Ga0163161_11013310
2962 Ga0163161_11119543
2963 Ga0163161_11681147
2964 Ga0163161_11761836
2965 Ga0206353_11880330
2966 Ga0213876_10076899
2967 Ga0213876_10358837
2968 Ga0209436_102722
2969 Ga0209436_113640
2970 Ga0209672_102060
2971 Ga0209147_101677
2972 Ga0209258_100078
2973 Ga0207425_1000726
2974 Ga0207425_1000881
2975 Ga0207425_1002203
2976 Ga0209148_1000086
2977 Ga0209129_1000027
2978 Ga0209129_1000054
2979 Ga0209565_1000317
2980 Ga0209565_1001263
2981 Ga0209565_1015434
2982 Ga0207666_1004468
2983 Ga0209673_1000168
2984 Ga0209673_1000355
2985 Ga0209673_1005247
2986 Ga0209673_1038095
2987 Ga0209130_1000206
2988 Ga0209130_1001172
2989 Ga0209130_1035061
2990 Ga0207673_1007194
2991 Ga0207673_1042741
2992 Ga0209675_1000388
2993 Ga0209675_1002561
2994 Ga0209675_1004338
2995 Ga0209675_1013516
2996 Ga0209676_1000103
2997 Ga0209676_1000290
2998 Ga0209676_1005377
2999 Ga0209025_1000201
3000 Ga0209025_1019038
3001 Ga0209564_1000014
3002 Ga0209564_1000289
3003 Ga0209564_1000408
3004 Ga0209758_1000034
3005 Ga0209758_1000193
3006 Ga0209758_1000208
3007 Ga0209758_1005547
3008 Ga0209050_1000012
3009 Ga0209050_1000416
3010 Ga0209050_1001233
3011 Ga0209050_1005046
3012 Ga0209050_1008921
3013 Ga0209050_1052859
3014 Ga0209256_1000066
3015 Ga0209256_1000092
3016 Ga0209256_1001887
3017 Ga0209256_1022736
3018 Ga0209256_1036914
3019 Ga0207426_1000067
3020 Ga0207426_1000266
3021 Ga0209051_1000019
3022 Ga0209051_1000020
3023 Ga0209051_1000141
3024 Ga0209051_1000235
3025 Ga0209051_1007019
3026 Ga0209051_1054597
3027 Ga0209257_1000024
3028 Ga0209257_1000085
3029 Ga0209257_1002015
3030 Ga0209257_1014801
3031 Ga0209257_1028057
3032 Ga0209257_1110720
3033 Ga0207697_10046050
3034 Ga0207697_10146000
3035 Ga0207697_10350704
3036 Ga0207697_10418582
3037 Ga0207656_10019106
3038 Ga0207656_10054086
3039 Ga0207656_10071784
3040 Ga0207656_10078424
3041 Ga0207656_10093435
3042 Ga0207656_10302931
3043 Ga0207656_10410776
3044 Ga0207656_10415708
3045 Ga0207682_10002310
3046 Ga0207682_10008487
3047 Ga0207682_10026248
3048 Ga0207682_10120596
3049 Ga0207682_10200063
3050 Ga0207682_10397213
3051 Ga0207682_10616884
3052 Ga0207692_10443623
3053 Ga0207642_10006194
3054 Ga0207642_10008862
3055 Ga0207642_10210723
3056 Ga0207710_10236509
3057 Ga0207688_10009912
3058 Ga0207688_10264029
3059 Ga0207688_10279028
3060 Ga0207680_10002216
3061 Ga0207680_10002264
3062 Ga0207680_10270354
3063 Ga0207680_10358265
3064 Ga0207680_10474754
3065 Ga0207680_10895762
3066 Ga0207680_10945479
3067 Ga0207647_10221382
3068 Ga0207685_10025303
3069 Ga0207645_10003401
3070 Ga0207645_10026486
3071 Ga0207645_10046517
3072 Ga0207645_10102536
3073 Ga0207645_10207117
3074 Ga0207645_10231411
3075 Ga0207645_10313915
3076 Ga0207643_10062542
3077 Ga0207643_10173555
3078 Ga0207643_10379750
3079 Ga0207643_10581104
3080 Ga0207643_10883314
3081 Ga0207705_10033984
3082 Ga0207705_10276873
3083 Ga0207705_10609256
3084 Ga0207705_10673759
3085 Ga0207705_11448229
3086 Ga0207684_10005949
3087 Ga0207684_10071919
3088 Ga0207654_10082391
3089 Ga0207654_10736192
3090 Ga0207707_10174846
3091 Ga0207707_10425784
3092 Ga0207695_10002543
3093 Ga0207695_10032900
3094 Ga0207695_10061905
3095 Ga0207695_10088943
3096 Ga0207695_10218048
3097 Ga0207695_10638987
3098 Ga0207671_10006429
3099 Ga0207671_10010328
3100 Ga0207671_10022402
3101 Ga0207671_10035144
3102 Ga0207671_10499298
3103 Ga0207671_10610822
3104 Ga0207671_10997043
3105 Ga0207660_10141322
3106 Ga0207660_10458070
3107 Ga0207662_10052728
3108 Ga0207662_10434229
3109 Ga0207662_10449027
3110 Ga0207662_11227200
3111 Ga0207657_10002308
3112 Ga0207657_10015804
3113 Ga0207657_10224482
3114 Ga0207657_11352505
3115 Ga0207649_10012057
3116 Ga0207649_10019732
3117 Ga0207649_10626611
3118 Ga0207649_10715711
3119 Ga0207652_10081244
3120 Ga0207652_10197585
3121 Ga0207652_10446683
3122 Ga0207646_10033392
3123 Ga0207681_10000795
3124 Ga0207681_10017788
3125 Ga0207681_10084282
3126 Ga0207681_10084985
3127 Ga0207681_10098706
3128 Ga0207681_10527279
3129 Ga0207681_10586239
3130 Ga0207694_10004060
3131 Ga0207694_10029043
3132 Ga0207694_10213474
3133 Ga0207694_10336316
3134 Ga0207694_10357825
3135 Ga0207694_10446452
3136 Ga0207650_10002550
3137 Ga0207650_10004501
3138 Ga0207650_10014903
3139 Ga0207650_10131086
3140 Ga0207650_10209144
3141 Ga0207650_10373972
3142 Ga0207650_10410273
3143 Ga0207650_11159414
3144 Ga0207650_11297563
3145 Ga0207659_10013398
3146 Ga0207659_10020083
3147 Ga0207659_10032887
3148 Ga0207659_10037282
3149 Ga0207659_10201000
3150 Ga0207659_10228388
3151 Ga0207659_10344347
3152 Ga0207659_10657623
3153 Ga0207659_10917374
3154 Ga0207659_10982537
3155 Ga0207659_11119751
3156 Ga0207687_11076475
3157 Ga0207687_11099818
3158 Ga0207664_10025828
3159 Ga0207644_10002048
3160 Ga0207644_10002949
3161 Ga0207644_10348255
3162 Ga0207644_10530117
3163 Ga0207644_11180534
3164 Ga0207644_11460616
3165 Ga0207644_11659747
3166 Ga0207690_10005174
3167 Ga0207690_10028785
3168 Ga0207690_10219101
3169 Ga0207690_11282417
3170 Ga0207690_11301379
3171 Ga0207690_11627988
3172 Ga0207706_10014450
3173 Ga0207706_10032604
3174 Ga0207706_10208896
3175 Ga0207706_10265450
3176 Ga0207706_10445308
3177 Ga0207706_10474106
3178 Ga0207706_10616074
3179 Ga0207706_10761981
3180 Ga0207706_10886243
3181 Ga0207706_11121191
3182 Ga0207686_10046095
3183 Ga0207686_10047390
3184 Ga0207686_10131449
3185 Ga0207686_10249615
3186 Ga0207686_10289968
3187 Ga0207709_10000383
3188 Ga0207709_10001296
3189 Ga0207709_10030033
3190 Ga0207709_10858658
3191 Ga0207709_10929598
3192 Ga0207709_11292534
3193 Ga0207670_10030732
3194 Ga0207670_10933017
3195 Ga0207669_10041654
3196 Ga0207669_10935431
3197 Ga0207669_11398536
3198 Ga0207669_11432381
3199 Ga0207669_11727593
3200 Ga0207704_10243329
3201 Ga0207704_10330831
3202 Ga0207704_10860243
3203 Ga0207704_11003114
3204 Ga0207704_11184036
3205 Ga0207665_10109570
3206 Ga0207691_10005390
3207 Ga0207691_10007761
3208 Ga0207691_10012093
3209 Ga0207691_10026402
3210 Ga0207691_10057886
3211 Ga0207691_10058275
3212 Ga0207691_10109518
3213 Ga0207691_10131930
3214 Ga0207691_10219778
3215 Ga0207691_10261767
3216 Ga0207691_10418523
3217 Ga0207691_10538352
3218 Ga0207691_10713981
3219 Ga0207711_10012457
3220 Ga0207711_10067509
3221 Ga0207711_10126201
3222 Ga0207711_10481256
3223 Ga0207711_10849956
3224 Ga0207711_10968069
3225 Ga0207711_11137038
3226 Ga0207711_11974308
3227 Ga0207689_10003512
3228 Ga0207689_10004908
3229 Ga0207689_10050658
3230 Ga0207689_10075589
3231 Ga0207689_10102173
3232 Ga0207689_10404359
3233 Ga0207689_11273389
3234 Ga0207661_10191726
3235 Ga0207679_10004109
3236 Ga0207679_10011721
3237 Ga0207679_10014481
3238 Ga0207679_10053631
3239 Ga0207679_10061091
3240 Ga0207679_10417878
3241 Ga0207679_10613967
3242 Ga0207679_10749071
3243 Ga0207679_11674927
3244 Ga0207667_10002655
3245 Ga0207667_10009860
3246 Ga0207667_10214430
3247 Ga0207667_10586071
3248 Ga0207651_10025563
3249 Ga0207651_10060152
3250 Ga0207651_10093139
3251 Ga0207651_10541167
3252 Ga0207651_10622978
3253 Ga0207651_10722735
3254 Ga0207651_11591610
3255 Ga0207651_11774164
3256 Ga0207712_10054882
3257 Ga0207712_10598083
3258 Ga0207712_10600466
3259 Ga0207712_10939869
3260 Ga0207668_10017712
3261 Ga0207668_10633512
3262 Ga0207668_10907040
3263 Ga0207668_11450775
3264 Ga0207640_10025789
3265 Ga0207640_10140289
3266 Ga0207640_10229824
3267 Ga0207640_10449149
3268 Ga0207640_10487586
3269 Ga0207640_10500017
3270 Ga0207640_10545529
3271 Ga0207640_10711722
3272 Ga0207658_10001151
3273 Ga0207658_10005593
3274 Ga0207658_10114940
3275 Ga0207658_10146914
3276 Ga0207658_10146925
3277 Ga0207658_10171038
3278 Ga0207658_10360032
3279 Ga0207658_10671075
3280 Ga0207658_10965157
3281 Ga0207658_11447551
3282 Ga0207677_10000452
3283 Ga0207677_10037654
3284 Ga0207677_10381138
3285 Ga0207677_10482308
3286 Ga0207677_10932485
3287 Ga0207677_12038880
3288 Ga0207703_10003262
3289 Ga0207703_10007044
3290 Ga0207703_10121427
3291 Ga0207703_10413074
3292 Ga0207639_10005439
3293 Ga0207639_10025544
3294 Ga0207639_10117049
3295 Ga0207639_10190198
3296 Ga0207639_10248274
3297 Ga0207639_10354566
3298 Ga0207639_10634407
3299 Ga0207639_11608274
3300 Ga0207639_12256148
3301 Ga0207678_10002363
3302 Ga0207678_10098740
3303 Ga0207678_10305127
3304 Ga0207678_10831301
3305 Ga0207678_10968874
3306 Ga0207678_11193875
3307 Ga0207708_10064706
3308 Ga0207708_10458336
3309 Ga0207702_10044080
3310 Ga0207702_10182928
3311 Ga0207702_10578685
3312 Ga0207702_12211938
3313 Ga0207641_10013179
3314 Ga0207641_10026325
3315 Ga0207641_10038644
3316 Ga0207641_10167453
3317 Ga0207641_10429589
3318 Ga0207641_10494108
3319 Ga0207641_11613931
3320 Ga0207648_10000748
3321 Ga0207648_10004891
3322 Ga0207648_10009156
3323 Ga0207648_10015290
3324 Ga0207648_10018447
3325 Ga0207648_10153113
3326 Ga0207648_10159491
3327 Ga0207648_10308103
3328 Ga0207648_10503985
3329 Ga0207648_10877779
3330 Ga0207648_10996400
3331 Ga0207648_11329572
3332 Ga0207648_11568146
3333 Ga0207676_10012508
3334 Ga0207676_10042218
3335 Ga0207676_10052796
3336 Ga0207676_10149898
3337 Ga0207676_10163884
3338 Ga0207676_10873679
3339 Ga0207676_12560108
3340 Ga0207674_10000040
3341 Ga0207674_10009428
3342 Ga0207674_10078389
3343 Ga0207674_10082081
3344 Ga0207674_10253170
3345 Ga0207674_10773161
3346 Ga0207674_10871479
3347 Ga0207674_11484866
3348 Ga0207674_11607913
3349 Ga0207675_100003386
3350 Ga0207675_100005550
3351 Ga0207675_100059119
3352 Ga0207675_100100746
3353 Ga0207675_100731231
3354 Ga0207675_100812892
3355 Ga0207683_10008569
3356 Ga0207683_10037960
3357 Ga0207683_10064870
3358 Ga0207683_10089863
3359 Ga0207683_10116457
3360 Ga0207683_10145705
3361 Ga0207683_10278749
3362 Ga0207683_10307655
3363 Ga0207683_10410972
3364 Ga0207683_10548197
3365 Ga0207683_10574489
3366 Ga0207683_10632075
3367 Ga0207683_11151674
3368 Ga0207683_12101076
3369 Ga0207698_10005011
3370 Ga0207698_10011131
3371 Ga0207698_10115704
3372 Ga0207698_10445721
3373 Ga0207698_10672177
3374 Ga0207698_10688459
3375 Ga0207698_10787371
3376 Ga0207698_10798694
3377 Ga0207698_10994822
3378 Ga0207698_11031752
3379 Ga0207698_11308235
3380 Ga0207698_11328955
3381 Ga0207698_12659290
3382 Ga0207698_12698549
3383 Ga0209281_1000074
3384 Ga0209969_1012477
3385 Ga0209981_1004500
3386 Ga0209996_1002081
3387 Ga0209995_1016563
3388 Ga0209995_1064430
3389 Ga0209968_1000140
3390 Ga0209999_1004899
3391 Ga0210002_1106826
3392 Ga0209966_1000388
3393 Ga0209813_10061166
3394 Ga0209974_10006661
3395 Ga0209974_10034713
3396 Ga0209974_10284711
3397 Ga0207428_10621197
3398 Ga0207428_10876374
3399 Ga0268266_10037082
3400 Ga0268266_11230998
3401 Ga0268266_11705868
3402 Ga0268265_10098075
3403 Ga0268265_10121264
3404 Ga0268265_10914139
3405 Ga0268264_10003378
3406 Ga0268264_10003920
3407 Ga0268264_10141634
3408 Ga0268264_10672979
3409 Ga0268264_11168625
3410 Ga0268264_11655308
3411 Ga0268264_12694867
3412 Ga0265323_10180575
3413 Ga0307517_10005592
3414 Ga0307517_10193402
3415 Ga0307517_10222524
3416 Ga0307517_10569249
3417 Ga0307515_10000165
3418 Ga0307515_10000232
3419 Ga0307515_10000716
3420 Ga0307515_10009711
3421 Ga0307515_10029175
3422 Ga0307515_10069456
3423 Ga0307515_10100821
3424 Ga0307515_10280252
3425 Ga0307515_10524851
3426 Ga0265324_10000007
3427 Ga0307512_10125965
3428 Ga0307512_10310690
3429 Ga0314311_1161279
3430 Ga0316179_1013512
3431 Ga0316178_1081817
3432 Ga0316180_1033826
3433 Ga0316183_1096459
3434 Ga0316181_1169024
3435 Ga0316182_1190268
3436 Ga0316182_1435093
3437 Ga0265328_10004603
3438 Ga0265328_10270814
3439 Ga0265331_10002534
3440 Ga0265331_10165768
3441 Ga0265327_10000028
3442 Ga0265327_10005919
3443 Ga0265327_10256515
3444 Ga0265316_10000181
3445 Ga0265316_10040823
3446 Ga0265316_10175648
3447 Ga0307513_10020857
3448 Ga0307513_10198447
3449 Ga0307513_10223635
3450 Ga0307513_10336433
3451 Ga0307513_10382862
3452 Ga0307513_10392021
3453 Ga0307513_10757889
3454 Ga0307509_10047896
3455 Ga0307509_10070806
3456 Ga0307509_10166102
3457 Ga0307509_10255000
3458 Ga0307509_10258468
3459 Ga0307509_10388258
3460 Ga0307408_100000160
3461 Ga0307408_100034418
3462 Ga0307408_100045283
3463 Ga0307408_100158236
3464 Ga0307408_100166791
3465 Ga0307408_100202535
3466 Ga0307408_100550048
3467 Ga0307408_101009952
3468 Ga0307408_101237660
3469 Ga0307408_101609315
3470 Ga0307408_101710987
3471 Ga0307408_102394828
3472 Ga0307508_10000016
3473 Ga0307508_10001467
3474 Ga0307508_10052609
3475 Ga0307508_10538212
3476 Ga0307508_10576065
3477 Ga0307514_10037190
3478 Ga0307514_10375139
3479 Ga0307516_10004400
3480 Ga0307516_10035476
3481 Ga0307516_10058975
3482 Ga0307516_10128425
3483 Ga0307516_10356786
3484 Ga0307516_10363028
3485 Ga0307516_10453728
3486 Ga0307405_10021832
3487 Ga0307405_10053071
3488 Ga0307405_10058871
3489 Ga0307405_10190515
3490 Ga0307405_10226137
3491 Ga0307405_10260018
3492 Ga0307405_10894422
3493 Ga0307405_10996428
3494 Ga0307405_11040726
3495 Ga0307405_11075034
3496 Ga0307405_11313412
3497 Ga0307405_11440125
3498 Ga0307405_11608569
3499 Ga0307413_10199627
3500 Ga0307413_11169348
3501 Ga0307413_12123964
3502 Ga0307410_10006186
3503 Ga0307410_10493002
3504 Ga0307410_10699597
3505 Ga0307410_11238769
3506 Ga0307406_10009086
3507 Ga0307406_10048547
3508 Ga0307406_10154488
3509 Ga0307406_10424736
3510 Ga0307406_10613602
3511 Ga0307406_10795272
3512 Ga0307407_10125284
3513 Ga0307407_10197530
3514 Ga0307407_10237909
3515 Ga0307407_10789264
3516 Ga0307412_10008934
3517 Ga0307412_10106523
3518 Ga0307412_10152178
3519 Ga0307412_10156542
3520 Ga0307412_10209380
3521 Ga0307412_10427755
3522 Ga0307412_10565616
3523 Ga0307412_10710080
3524 Ga0307412_10725839
3525 Ga0307412_11299118
3526 Ga0307412_11376482
3527 Ga0307412_11639177
3528 Ga0307409_100001314
3529 Ga0307409_100049671
3530 Ga0307409_100065516
3531 Ga0307409_101124546
3532 Ga0307409_101406187
3533 Ga0307409_101614946
3534 Ga0307416_100020404
3535 Ga0307416_100063772
3536 Ga0307416_100071278
3537 Ga0307416_100087114
3538 Ga0307416_100320417
3539 Ga0307416_100345066
3540 Ga0307416_100388486
3541 Ga0307416_100568835
3542 Ga0307416_100997030
3543 Ga0307416_101441695
3544 Ga0307416_101727569
3545 Ga0307416_103778436
3546 Ga0307414_10057023
3547 Ga0307414_10115978
3548 Ga0307414_10116063
3549 Ga0307414_10149621
3550 Ga0307414_10594092
3551 Ga0307414_10808429
3552 Ga0307414_10881583
3553 Ga0307414_11170491
3554 Ga0307414_12122285
3555 Ga0307411_10006938
3556 Ga0307411_10022274
3557 Ga0307411_10239552
3558 Ga0307411_10247367
3559 Ga0307411_10814359
3560 Ga0307411_10968779
3561 Ga0307411_12363398
3562 Ga0307415_100004417
3563 Ga0307415_100124110
3564 Ga0307415_100152845
3565 Ga0307415_100894793
3566 Ga0307415_101060223
3567 Ga0307507_10031462
3568 Ga0307507_10055670
3569 Ga0307507_10376296
3570 Ga0307510_10000568
3571 Ga0307510_10564632
3572 Ga0373950_0004635
3573 Ga0373958_0028957
3574 Ga0373959_0080937
3575 Ga0373938_0018968
3576 Ga0373938_0247902
3577 Ga0373928_0027809
3578 Ga0373928_0114285
3579 Ga0373940_0035128
3580 Ga0373944_0326561
3581 Ga0373952_0002684
3582 Ga0373952_0052535
3583 Ga0373932_0018539
3584 Ga0373932_0030415
3585 Ga0373939_0133835
3586 Ga0373941_0042220
3587 Ga0373945_0413159
3588 Ga0373953_0270922
3589 Ga0373960_0006818
3590 Ga0373946_0179335
3591 Ga0373946_0189477
3592 Ga0373942_0031813
3593 Ga0373961_0112681
3594 Ga0373961_0244560
3595 Ga0373962_0019072
3596 Ga0373962_0040272
3597 Ga0373924_0050922
3598 Ga0373931_0007502
3599 Ga0373931_0306109
3600 Ga0373935_0664801
3601 Ga0373947_0273281
3602 Ga0373937_0168463
3603 Ga0373937_0377255
3604 Ga0373937_1291590
3605 Ga0373937_1872254
3606 Ga0373925_0219622
3607 Ga0373925_0487964
3608 Ga0395898_0707204
3609 Ga0395905_0000071
3610 Ga0395905_0003377
3611 Ga0395905_0158997
3612 Ga0395905_0205360
3613 Ga0395905_0292538
3614 Ga0395905_0637559
3615 Ga0395905_0726434
3616 Ga0395905_1171095
3617 Ga0395905_1245362
3618 Ga0400483_050487
3619 Ga0400483_054100
3620 Ga0400483_058112
3621 Ga0400483_147621
3622 Ga0400483_243387
3623 Ga0400483_250036
3624 Ga0400483_259735
3625 Ga0436365_0385285
3626 Ga0436365_0393891
3627 Ga0436365_0508202
3628 Ga0436365_1754335
3629 Ga0436365_1910867
3630 Ga0439436_0000087
3631 Ga0439438_022946
3632 Ga0439439_0023785
3633 Ga0439447_029848
3634 Ga0439461_0005108
3635 Ga0439461_0036152
3636 Ga0439466_0016508
3637 Ga0439466_0045273
3638 Ga0439466_0049909
3639 Ga0439465_0008564
3640 Ga0439465_0134195
3641 Ga0451787_135752
3642 Ga0451789_0485836
3643 Ga0451789_0873756
3644 Ga0451789_1195116
3645 Ga0451789_1353168
3646 Ga0451791_0888711
3647 Ga0451791_1547075
3648 Ga0451793_0351601
3649 Ga0451793_0606671
3650 Ga0451793_0969557
3651 Ga0451793_1911556
3652 Ga0451797_0651689
3653 Ga0451797_1136303
3654 Ga0451797_1454471
3655 Ga0451797_1559014
3656 Ga0451795_0264279
3657 Ga0451795_0458032
3658 Ga0451795_0612071
3659 Ga0451795_1631029
3660 Ga0451798_0075940
3661 Ga0451800_0112075
3662 Ga0451802_0039409
3663 Ga0451802_0496814
3664 Ga0451802_1029972
3665 Ga0451804_1177037
3666 Ga0451807_1456924
3667 Ga0451833_0642716
3668 Ga0451833_0671749
3669 Ga0451833_0863719
3670 Ga0451839_0092707
3671 Ga0451839_0195547
3672 Ga0451839_1646573
3673 Ga0451841_0064685
3674 Ga0451841_0374427
3675 Ga0451849_0140783
3676 Ga0451849_1174768
3677 Ga0451851_0377524
3678 Ga0451851_0664708
3679 Ga0451851_0775016
3680 Ga0451843_0094093
3681 Ga0451843_0289726
3682 Ga0451843_1448663
3683 Ga0451855_1473803
3684 Ga0451853_0258583
3685 Ga0451853_0312486
3686 Ga0451853_2717321
3687 Ga0451853_2957169
3688 Ga0451853_3970409
3689 Ga0439431_0002540
3690 Ga0439431_0019679
3691 Ga0439431_0161495
3692 Ga0439433_0006733
3693 Ga0439433_0009312
3694 Ga0439437_000403
3695 Ga0439445_0000816
3696 Ga0439445_0067787
3697 Ga0439445_0118103
3698 Ga0439432_004375
3699 Ga0439449_0005260
3700 Ga0439449_0009502
3701 Ga0439449_0019959
3702 Ga0439449_0035314
3703 Ga0439449_0069502
3704 Ga0439449_0269811
3705 Ga0439452_001338
3706 Ga0439452_021923
3707 Ga0439455_0023026
3708 Ga0439455_0031169
3709 Ga0439455_0103196
3710 Ga0439457_006319
3711 Ga0439457_037410
3712 Ga0439457_160441
3713 Ga0439462_0003614
3714 Ga0439462_0005695
3715 Ga0439462_0082272
3716 Ga0439463_155667
3717 Ga0450911_022634
3718 Ga0450914_002759
3719 Ga0450917_007679
3720 Ga0450919_000846
3721 Ga0450920_033140
3722 Ga0450922_013808
3723 Ga0450923_062420
3724 Ga0450890_010639
3725 Ga0450891_000064
3726 Ga0450891_018549
3727 Ga0450892_003526
3728 Ga0450892_020418
3729 Ga0450894_001711
3730 Ga0450896_048175
3731 Ga0450898_030446
3732 Ga0450898_030894
3733 Ga0450898_055455
3734 Ga0450899_009529
3735 Ga0450889_003240
3736 Ga0450906_007913
3737 Ga0450907_019923
3738 Ga0450910_042973
3739 Ga0439446_0004543
3740 Ga0439446_0240238
3741 Ga0439446_0253262
3742 Ga0450909_002243
3743 Ga0450909_012351
3744 Ga0439434_0005187
3745 Ga0439434_0032148
3746 Ga0439434_0106731
3747 Ga0439434_0120244
3748 Ga0439434_0184084
3749 Ga0439444_0193484
3750 Ga0439459_0079902
3751 Ga0439464_0021522
3752 Ga0439464_0169221
3753 Ga0439460_0146488
3754 Ga0450916_001775
3755 Ga0450918_000344
3756 Ga0450918_083618
3757 Ga0450893_0021080
3758 Ga0450893_0059738
3759 Ga0451577_0026364
3760 Ga0451577_0061568
3761 Ga0451577_1682399
3762 Ga0439440_0185855
3763 Ga0466969_0037790
3764 Ga0466969_0089971
3765 Ga0466972_0020558
3766 Ga0466972_0035894
3767 Ga0466972_0041116
3768 Ga0466972_0046599
3769 Ga0466972_0170373
3770 Ga0453683_0394669
3771 Ga0453683_0429046
3772 Ga0453683_0934536
3773 Ga0466965_0068051
3774 Ga0466965_0108619
3775 Ga0466965_0131641
3776 Ga0466965_0212725
3777 Ga0466965_0386555
3778 Ga0466965_0801347
3779 Ga0466966_0015315
3780 Ga0466966_0752500
3781 Ga0466961_0003217
3782 Ga0466961_0006410
3783 Ga0466961_0043879
3784 Ga0466963_0000935
3785 Ga0466964_0003021
3786 Ga0466964_0118004
3787 Ga0453684_0000917
3788 Ga0453684_0001658
3789 Ga0453684_0017401
3790 Ga0453684_0051049
3791 Ga0453684_0272674
3792 Ga0453684_0346557
3793 Ga0453684_0613701
3794 Ga0453684_1282602
3795 Ga0466971_0382138
3796 Ga0466968_0005264
3797 Ga0466968_0721818
3798 Ga0466970_0007142
3799 Ga0466970_0015254
3800 Ga0466970_0128278
3801 Ga0466957_0007668
3802 Ga0466960_0012592
3803 Ga0466960_0654384
3804 Ga0466959_0013106
3805 Ga0466959_0250383
3806 Ga0451576_0034152
3807 Ga0451576_0126973
3808 Ga0451576_0228247
3809 Ga0451576_0312262
3810 Ga0451576_0393108
3811 Ga0451576_0422698
3812 Ga0451576_1296890
3813 Ga0466958_0023688
3814 Ga0466958_0695385
3815 Ga0466967_0021184
3816 Ga0466967_0546277
3817 Ga0466967_1103268
3818 Ga0495627_032297
3819 Ga0495590_0131290
3820 Ga0495629_0040968
3821 Ga0495638_0191549
3822 Ga0495638_0240052
3823 Ga0495638_0306508
3824 Ga0495651_0038375
3825 Ga0495650_0002988
3826 Ga0495650_0147479
3827 Ga0495650_0200566
3828 Ga0495580_0175846
3829 Ga0495580_0631714
3830 Ga0495582_0409091
3831 Ga0495582_0418253
3832 Ga0495582_0578047
3833 Ga0495605_0484521
3834 Ga0495639_0518165
3835 Ga0495662_0358629
3836 Ga0495664_0543098
3837 Ga0495583_0380114
3838 Ga0495606_0103334
3839 Ga0495606_0184202
3840 Ga0495606_0426203
3841 Ga0495606_0619442
3842 Ga0495610_0020900
3843 Ga0495610_0035222
3844 Ga0495610_0201109
3845 Ga0495616_0002648
3846 Ga0495618_0779930
3847 Ga0495620_0083637
3848 Ga0495620_0134181
3849 Ga0495620_0309700
3850 Ga0495628_0503705
3851 Ga0495628_0630016
3852 Ga0495630_0141411
3853 Ga0495631_0000024
3854 Ga0495632_0007918
3855 Ga0495632_0010962
3856 Ga0495632_0067015
3857 Ga0495632_0485708
3858 Ga0495637_0010974
3859 Ga0495637_0282631
3860 Ga0495643_0106698
3861 Ga0495643_0248979
3862 Ga0495648_0371714
3863 Ga0495666_0197046
3864 Ga0495642_0091393
3865 Ga0495642_0176947
3866 Ga0495652_0345447
3867 Ga0495654_0041183
3868 Ga0495640_0302006
3869 Ga0495586_0208483
3870 Ga0495586_0445148
3871 Ga0495587_0680751
3872 Ga0495598_0018863
3873 Ga0495598_0021212
3874 Ga0495621_0003869
3875 Ga0495621_0058128
3876 Ga0495621_0162718
3877 Ga0495597_0010476
3878 Ga0495645_0203502
3879 Ga0495645_0313913
3880 Ga0495622_0121235
3881 Ga0495633_0254105
3882 Ga0495667_0114833
3883 Ga0495667_0623864
3884 Ga0495656_0001070
3885 Ga0495668_0056564
3886 Ga0495668_0148126
3887 Ga0495668_0340680
3888 Ga0495611_0037183
3889 Ga0495611_0352882
3890 Ga0495625_0021963
3891 Ga0495625_0040736
3892 Ga0495625_0060694
3893 Ga0495625_0078070
3894 Ga0495625_0161052
3895 Ga0495625_0683058
3896 Ga0495635_0146612
3897 Ga0495635_0283978
3898 Ga0495635_0298249
3899 Ga0495588_0026440
3900 Ga0495588_0067240
3901 Ga0495588_0542843
3902 Ga0495657_0592767
3903 Ga0495599_0642120
3904 Ga0495646_0176976
3905 Ga0495646_0186533
3906 Ga0495646_0525651
3907 Ga0495647_0029408
3908 Ga0495647_0145353
3909 Ga0495658_0014926
3910 Ga0495658_0093624
3911 Ga0495658_0164808
3912 Ga0495658_0226087
3913 Ga0495613_0231866
3914 Ga0495624_0413054
3915 Ga0495670_0501458
3916 Ga0495670_0733163
3917 Ga0495670_0818997
3918 Ga0495671_0115776
3919 Ga0495671_0151942
3920 Ga0495671_0330015
3921 Ga0495649_0009554
3922 Ga0495589_0137142
3923 Ga0495600_0792769
3924 Ga0495600_0822637
3925 Ga0495660_0119551
3926 Ga0495660_0368547
3927 Ga0495581_0511806
3928 Ga0495581_0903825
3929 Ga0495674_1479822
3930 Ga0495676_0035806
3931 Ga0495676_0078953
3932 Ga0495676_0682244
3933 Ga0495680_0048736
3934 Ga0495687_002064
3935 Ga0495687_005696
3936 Ga0495687_022510
3937 Ga0495673_0107757
3938 Ga0495673_0153463
3939 Ga0495681_0392955
3940 Ga0495684_0548175
3941 Ga0495686_0133926
3942 Ga0495686_0149048
3943 Ga0495614_0183605
3944 Ga0495614_0219437
3945 Ga0495615_0023842
3946 Ga0495615_0132714
3947 Ga0495615_0168331
3948 Ga0495626_0050116
3949 Ga0495626_0090337
3950 Ga0496100_0046363
3951 Ga0496100_0058669
3952 Ga0496100_0849746
3953 Ga0496100_1204822
3954 Ga0496101_0005293
3955 Ga0496101_0008869
3956 Ga0496101_0019357
3957 Ga0496101_0692603
3958 Ga0496101_0891250
3959 Ga0496102_0004160
3960 Ga0496102_0022357
3961 Ga0496102_0025441
3962 Ga0496102_1735265
3963 Ga0496103_0052729
3964 Ga0496103_0545910
3965 Ga0496104_0004072
3966 Ga0496104_0225894
3967 Ga0496105_0013340
3968 Ga0496105_0335099
3969 Ga0496105_0346090
3970 Ga0496105_1017770
3971 Ga0496106_0004162
3972 Ga0496106_0054027
3973 Ga0496106_0118004
3974 Ga0496107_0012377
3975 Ga0496107_0185959
3976 Ga0496107_0743017
3977 Ga0496107_1023953
3978 Ga0496107_1315008
3979 Ga0496108_0017286
3980 Ga0496108_0054001
3981 Ga0496108_0059614
3982 Ga0496108_1037113
3983 Ga0496109_0040199
3984 Ga0496109_0069350
3985 Ga0496109_0499406
3986 Ga0496109_0508627
3987 Ga0496109_0959386
3988 Ga0496110_0010357
3989 Ga0496110_0110191
3990 Ga0496110_0238223
3991 Ga0496111_0226566
3992 Ga0496111_0824314
3993 Ga0496112_0290238
3994 Ga0496113_0185358
3995 Ga0496113_0713531
3996 Ga0496114_0022464
3997 Ga0496114_0419093
3998 Ga0496114_0563757
3999 Ga0496114_0736330
4000 Ga0496114_1051712
4001 Ga0496115_0002077
4002 Ga0496116_0066945
4003 Ga0496117_0004106
4004 Ga0496117_0051373
4005 Ga0496117_0195326
4006 Ga0496118_0009212
4007 Ga0496118_0078153
4008 Ga0496118_0374968
4009 Ga0496119_0213336
4010 Ga0496120_0199693
4011 Ga0496121_0002206
4012 Ga0496121_0026908
4013 Ga0496122_0000415
4014 Ga0496122_0092947
4015 Ga0496122_0181637
4016 Ga0496122_0223552
4017 Ga0496122_0491478
4018 Ga0496123_0000330
4019 Ga0496123_0022183
4020 Ga0496123_0036339
4021 Ga0496123_0047297
4022 Ga0496123_0245124
4023 Ga0496124_0044485
4024 Ga0496124_0135708
4025 Ga0496124_0415473
4026 Ga0496124_0525099
4027 Ga0496124_0874145
4028 Ga0496125_0041632
4029 Ga0496125_0674360
4030 Ga0496126_0148535
4031 Ga0501309_000004
4032 Ga0501309_092679
4033 Ga0501310_002992
4034 Ga0501310_019556
4035 Ga0501310_057280
4036 Ga0501305_001609
4037 Ga0501305_036628
4038 Ga0501305_096135
4039 Ga0495682_0343906
4040 Ga0501292_023460
4041 Ga0501297_002256
4042 Ga0501303_004947
4043 Ga0501312_026367
4044 Ga0501333_022767
4045 Ga0501032_0090633
4046 Ga0501034_0016622
4047 Ga0501034_0792889
4048 Ga0501037_0007252
4049 Ga0501043_0000545
4050 Ga0501046_0000021
4051 Ga0501046_0004297
4052 Ga0501046_0008745
4053 Ga0501047_0000757
4054 Ga0501048_0013766
4055 Ga0501069_0002093
4056 Ga0501070_0008659
4057 Ga0501198_000047
4058 Ga0501198_133305
4059 Ga0501201_004855
4060 Ga0501206_015864
4061 Ga0501207_019125
4062 Ga0501222_000056
4063 Ga0501222_010931
4064 Ga0501223_035862
4065 Ga0501227_030701
4066 Ga0501233_174043
4067 Ga0501235_029982
4068 Ga0501236_062095
4069 Ga0501238_043408
4070 Ga0501242_026331
4071 Ga0501249_040180
4072 Ga0501253_020019
4073 Ga0501257_031579
4074 Ga0501258_028345
4075 Ga0501221_000933
4076 Ga0501225_0013159
4077 Ga0501225_0032891
4078 Ga0501229_000077
4079 Ga0501079_0051579
4080 Ga0501080_0199531
4081 Ga0501232_004559
4082 Ga0501241_108453
4083 Ga0501262_000157
4084 Ga0501265_002252
4085 Ga0501268_087695
4086 Ga0501271_052504
4087 Ga0501282_007907
4088 Ga0501035_0120765
4089 Ga0501044_0180518
4090 Ga0501045_0002486
4091 nmdc:mga03683_218037_c1
4092 nmdc:mga03683_22920_c1
4093 nmdc:mga03683_30347_c1
4094 nmdc:mga03683_354569_c1
4095 nmdc:mga03683_447720_c1
4096 nmdc:mga03683_48543_c1
4097 nmdc:mga03683_51579_c1
4098 nmdc:mga03683_90285_c1
4099 nmdc:mga03n38_226732_c1
4100 nmdc:mga03n38_399825_c1
4101 nmdc:mga03n38_454002_c1
4102 nmdc:mga03n38_603014_c1
4103 nmdc:mga00v17_152383_c1
4104 nmdc:mga00v17_202355_c1
4105 nmdc:mga00v17_401612_c1
4106 nmdc:mga00v17_87307_c1
4107 nmdc:mga0yw44_240784_c1
4108 nmdc:mga0k408_10460_c1
4109 nmdc:mga0k408_12490_c1
4110 nmdc:mga0k408_164742_c1
4111 nmdc:mga0k408_171695_c1
4112 nmdc:mga0k408_18200_c2
4113 nmdc:mga0k408_190517_c1
4114 nmdc:mga0k408_256190_c1
4115 nmdc:mga0k408_26610_c1
4116 nmdc:mga0k408_270913_c1
4117 nmdc:mga0k408_302597_c1
4118 nmdc:mga0k408_36110_c1
4119 nmdc:mga0k408_40302_c1
4120 nmdc:mga0k408_438894_c1
4121 nmdc:mga0k408_583656_c1
4122 nmdc:mga0k408_6644_c1
4123 nmdc:mga0k408_794578_c1
4124 nmdc:mga0k408_83530_c1
4125 nmdc:mga06z11_125624_c1
4126 nmdc:mga06z11_255108_c1
4127 nmdc:mga06z11_363850_c1
4128 nmdc:mga06z11_37405_c1
4129 nmdc:mga06z11_445710_c1
4130 nmdc:mga06z11_507645_c1
4131 nmdc:mga04h51_235928_c1
4132 nmdc:mga07m45_12950_c1
4133 nmdc:mga07m45_151739_c1
4134 nmdc:mga07m45_154307_c1
4135 nmdc:mga07m45_156357_c1
4136 nmdc:mga07m45_16681_c1
4137 nmdc:mga07m45_18099_c1
4138 nmdc:mga07m45_18802_c1
4139 nmdc:mga07m45_18856_c1
4140 nmdc:mga07m45_201253_c1
4141 nmdc:mga07m45_21210_c1
4142 nmdc:mga07m45_342605_c1
4143 nmdc:mga07m45_399292_c1
4144 nmdc:mga07m45_4213_c1
4145 nmdc:mga07m45_460138_c1
4146 nmdc:mga07m45_506933_c1
4147 nmdc:mga07m45_529161_c1
4148 nmdc:mga07m45_724059_c1
4149 nmdc:mga07m45_836123_c1
4150 nmdc:mga07m45_912609_c1
4151 nmdc:mga05p37_182246_c1
4152 nmdc:mga05p37_220452_c1
4153 nmdc:mga0qj67_110899_c1
4154 nmdc:mga08y16_605174_c1
4155 nmdc:mga08y16_714912_c1
4156 nmdc:mga08y16_823151_c1
4157 nmdc:mga08y16_950785_c1
4158 nmdc:mga0n895_280592_c1
4159 nmdc:mga08x19_1194464_c1
4160 nmdc:mga0sz30_14201_c1
4161 nmdc:mga0sz30_185966_c1
4162 nmdc:mga0sz30_37847_c1
4163 nmdc:mga0sz30_405475_c1
4164 nmdc:mga0sz30_442377_c1
4165 nmdc:mga0sz30_5056_c1
4166 Ga0495601_0284010
4167 Ga0495612_0091577
4168 Ga0495612_0385124
4169 Ga0500635_0087433
4170 Ga0495595_0323284
4171 Ga0500578_0000006
4172 Ga0500578_0265118
4173 Ga0500643_006994
4174 Ga0500643_012618
4175 Ga0500644_0018587
4176 Ga0500646_0033981
4177 Ga0500646_0346932
4178 Ga0500651_0000156
4179 Ga0500651_0076022
4180 Ga0500651_0168496
4181 Ga0500651_0444845
4182 Ga0500566_0160156
4183 Ga0500650_0145041
4184 Ga0500650_0338961
4185 Ga0500557_128395
4186 Ga0500562_005406
4187 Ga0500562_008977
4188 Ga0500571_000005
4189 Ga0500594_0001096
4190 Ga0500597_317525
4191 Ga0500608_022424
4192 Ga0500608_074158
4193 Ga0500618_164499
4194 Ga0500621_251616
4195 Ga0500623_007865
4196 Ga0500626_035282
4197 Ga0500628_003722
4198 Ga0500628_060492
4199 Ga0500642_0064667
4200 Ga0500652_001283
4201 Ga0500655_000516
4202 Ga0500655_020988
4203 Ga0500658_0000141
4204 Ga0500658_0000561
4205 Ga0500658_0006983
4206 Ga0500658_0163347
4207 Ga0500559_0000880
4208 Ga0500559_0006764
4209 Ga0500564_001417
4210 Ga0500568_0001097
4211 Ga0500568_0127304
4212 Ga0500573_0032467
4213 Ga0500579_150348
4214 Ga0500604_0019070
4215 Ga0500604_0284338
4216 Ga0500616_0059379
4217 Ga0500619_000073
4218 Ga0500622_0001738
4219 Ga0500624_028461
4220 Ga0500624_115262
4221 Ga0500634_0055702
4222 Ga0500638_016327
4223 Ga0500636_0214708
4224 Ga0500625_115871
4225 Ga0500645_007607
4226 Ga0500596_018165
4227 Ga0590071_099013
4228 Ga0501082_0033320
4229 Ga0501082_1844706
4230 Ga0466962_0056126
4231 Ga0466962_0127631
4232 2587725128
4233 2587731512
4234 2587756191
4235 2588295157
4236 2599623208
4237 2599674855
4238 2599680812
4239 2599692827
4240 2643743907
4241 2643933067
4242 2643966984
4243 2644142647
4244 2644217210
4245 2644248385
4246 2644259022
4247 2644273678
4248 2644301595
4249 2644314316
4250 2644340934
4251 2644467186
4252 2649122609
4253 2652974065
4254 2738723941
4255 2738882767
4256 2739055759
4257 2739250496
4258 2739280468
4259 2819600344
4260 2831271862
4261 2838059700
4262 2842682804
4263 2842735792
4264 2885193535
4265 2885198646
4266 2885211974
4267 2887632367
4268 2899928485
4269 2904451787
4270 2904462556
4271 2919467229
4272 2919494179
4273 2919543811
4274 2919688610
4275 2923525961
4276 2923527662
4277 2928041406
4278 2928048248
4279 2928056092
4280 2928066428
4281 2928076083
4282 2928087728
4283 2929523670
4284 2945946087
4285 2945975686
4286 2954768861
4287 8002746423

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

12

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.9257 4 81
6r6b-assembly1.cif.gz_H structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.9188 4 85
8axk-assembly1.cif.gz_G type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri 0.9099 1 85
7ah9-assembly1.cif.gz_1J substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 1 0.9019 4 86
7bin-assembly1.cif.gz_G salmonella export gate and rod refined in focussed c1 map 0.8997 1 89
ID Description Score Start End Superfamily
af_O53692_1_97_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.57 1 87 1.10.287.1060
af_O53692_1_97_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.5572 1 87 1.10.287.1060
af_O16530_48_904_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5513 8 59 1.20.1640.10
af_Q54DE8_365_465_1.10.472.100 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin 0.5225 6 69 1.10.472.100
af_Q9H3M0_307_417_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5161 4 79 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A074TVX4-F1-model_v4 deleted 0.9918 12 89
AF-R9VIP8-F1-model_v4 deleted 0.9903 10 89
AF-A0A0Q8XBI4-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9852 14 89 GO:0005886
GO:0009306
AF-T1BP84-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9794 10 89 GO:0005886
GO:0009306
GO:0009425
GO:0031514
GO:0044780
AF-A0A0R2D0F7-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9793 11 85 GO:0005886
GO:0009306
GO:0009425
GO:0044780

Map