F496459
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2143 | 688 | 4287 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300050508|nmdc:mga09592_14154_c1|nmdc:mga09592_14154_c1_3867_4157 |
| Length | 96 |
| Sequence | LKLERRDVDSAQVFTFGQQGLYLLLMVAAPLLLTVLAVGLVVSIFQAATQIHEATLSFVPKIVAAVAVLAVAGPWMLTTLVEYLQRTLQAIPTVVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 21 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 111 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 114 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 149 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 150 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 151 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 152 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 153 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 154 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 155 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 156 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 157 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 158 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 171 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 178 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 181 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 282 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 283 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 284 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 286 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 287 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 288 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 289 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 290 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 291 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 292 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 293 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 294 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 296 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 297 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 298 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 299 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 300 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 301 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 302 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 303 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 306 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 307 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 308 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 309 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 310 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 311 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 312 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 313 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 314 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 315 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 316 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 317 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 318 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 319 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 320 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 321 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 322 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 323 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 324 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 326 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 327 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 328 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 329 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 331 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 334 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 337 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 338 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 341 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 342 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 343 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 344 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 345 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 346 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 347 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 348 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 349 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 350 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 351 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 358 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 359 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 361 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 362 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 363 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 364 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 365 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 366 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 367 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 368 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 369 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 370 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 371 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 372 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 373 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 374 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 375 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 376 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 377 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 378 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 379 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 380 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 381 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 382 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 383 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 384 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 385 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 386 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 387 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 388 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 389 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 390 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 391 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 392 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 393 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 394 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 395 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 396 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 397 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 398 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 399 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 400 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 401 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 402 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 403 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 404 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 405 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 406 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 407 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 408 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 409 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 410 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 411 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 412 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 413 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 414 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 415 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 416 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 417 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 418 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 419 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 420 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 421 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 422 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 423 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 424 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 425 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 426 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 427 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 428 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 429 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 500 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 502 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 503 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 504 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 505 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 506 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 507 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 508 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 509 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 510 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 511 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 512 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 513 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 514 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 515 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 516 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 517 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 518 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 519 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 520 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 521 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 522 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 523 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 524 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 525 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 526 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 531 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 532 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 533 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 545 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 546 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 547 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 548 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 549 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 550 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 551 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 552 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 553 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 554 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 555 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 556 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 557 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 558 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 559 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 560 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 561 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 562 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 563 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 566 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 567 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 568 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 569 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 570 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 571 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 572 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 576 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 577 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 578 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 579 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 580 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 581 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 582 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 583 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 587 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 588 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 589 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 592 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 594 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 595 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 596 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 597 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 598 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 599 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 600 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 601 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 602 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 604 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 605 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 606 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 607 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 608 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 609 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 610 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 611 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 612 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 613 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 614 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 615 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 616 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 617 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 618 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 619 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 620 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 621 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 622 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 623 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 624 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 625 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 626 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 627 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 629 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 630 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 631 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 632 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 634 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 635 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 636 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 637 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 638 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 639 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 640 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 641 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 642 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 643 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 644 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 645 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 646 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 647 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 648 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 649 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 650 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 651 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 652 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 653 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 654 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 655 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 656 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 657 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 658 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 659 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 660 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 661 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 662 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 663 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 664 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 665 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 666 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 667 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 668 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 669 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 670 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 671 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 672 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 673 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 674 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 675 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 676 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 677 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 678 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 679 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 680 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 681 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 682 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 683 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 684 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 685 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 686 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 687 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 688 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0.61 |
| Isolates | 2.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.19 |
| Nodule | 0.23 |
| Rhizoplane | 3.78 |
| Rhizosphere | 74.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga09592_14154_c1 | 3300050508 | Bacteria | 6507 |
| 2 | SwRhRL2b_contig_93844 | 2162886007 | Bacteria | 809 |
| 3 | JGI24746J21847_1025597 | 3300001977 | Bacteria | 816 |
| 4 | JGI24740J21852_10030620 | 3300001979 | Bacteria | 1748 |
| 5 | JGI24740J21852_10061013 | 3300001979 | Bacteria | 1040 |
| 6 | JGI24739J22299_10016035 | 3300001989 | Bacteria | 2717 |
| 7 | JGI24739J22299_10125477 | 3300001989 | Bacteria | 765 |
| 8 | JGI24735J21928_10247644 | 3300002067 | Bacteria | 519 |
| 9 | JGI24750J21931_1076289 | 3300002070 | Bacteria | 553 |
| 10 | JGI25158J39367_1004622 | 3300002739 | Bacteria | 2059 |
| 11 | JGI25158J39367_1015083 | 3300002739 | Bacteria | 992 |
| 12 | JGI25152J39213_1006440 | 3300002773 | Bacteria | 3204 |
| 13 | JGI25150J39212_1000713 | 3300002774 | Bacteria | 11919 |
| 14 | JGI25159J45721_1007232 | 3300002987 | Bacteria | 3204 |
| 15 | JGI25159J45721_1009555 | 3300002987 | Bacteria | 2549 |
| 16 | JGI25151J46595_10016692 | 3300003187 | Bacteria | 3204 |
| 17 | JGI25153J46596_10004412 | 3300003215 | Bacteria | 7594 |
| 18 | JGI25153J46596_10011494 | 3300003215 | Bacteria | 3905 |
| 19 | JGI25153J46596_10012754 | 3300003215 | Bacteria | 3601 |
| 20 | JGI25153J46596_10014829 | 3300003215 | Bacteria | 3215 |
| 21 | JGI25153J46596_10028238 | 3300003215 | Bacteria | 1950 |
| 22 | rootH1_10029168 | 3300003316 | Bacteria | 1401 |
| 23 | rootH1_10056955 | 3300003316 | Bacteria | 3500 |
| 24 | rootH2_10190564 | 3300003320 | Bacteria | 1403 |
| 25 | rootL2_10040047 | 3300003322 | Bacteria | 3883 |
| 26 | rootL2_10046934 | 3300003322 | Bacteria | 6020 |
| 27 | rootL2_10150001 | 3300003322 | Bacteria | 2623 |
| 28 | rootH1_10038325 | 3300003323 | Bacteria | 4703 |
| 29 | rootH1_10042098 | 3300003323 | Bacteria | 5137 |
| 30 | rootH1_10068314 | 3300003316 | Bacteria | 3199 |
| 31 | rootH1_10068314 | 3300003323 | Bacteria | 2671 |
| 32 | JGI26128J50194_1000847 | 3300003347 | Bacteria | 1832 |
| 33 | JGI25160J50197_1011152 | 3300003354 | Bacteria | 3204 |
| 34 | JGI25160J50197_1013627 | 3300003354 | Bacteria | 2761 |
| 35 | JGI26145J50221_1025494 | 3300003371 | Bacteria | 588 |
| 36 | JGI25161J50226_1003238 | 3300003374 | Bacteria | 3808 |
| 37 | JGI25161J50226_1008435 | 3300003374 | Bacteria | 1588 |
| 38 | Ga0006562J51391_1125153 | 3300003578 | Bacteria | 3430 |
| 39 | Ga0006562J51391_1125156 | 3300003578 | Bacteria | 970 |
| 40 | Ga0055532_1025643 | 3300003758 | Bacteria | 580 |
| 41 | Ga0055535_1001434 | 3300003761 | Bacteria | 12127 |
| 42 | Ga0055542_1000127 | 3300003762 | Bacteria | 100078 |
| 43 | Ga0055526_1002532 | 3300003771 | Bacteria | 12277 |
| 44 | Ga0055526_1014660 | 3300003771 | Bacteria | 3204 |
| 45 | Ga0055526_1014781 | 3300003771 | Bacteria | 3183 |
| 46 | Ga0055537_1005895 | 3300003773 | Bacteria | 3204 |
| 47 | Ga0055537_1005952 | 3300003773 | Bacteria | 3179 |
| 48 | Ga0055524_1000207 | 3300003775 | Bacteria | 63213 |
| 49 | Ga0055524_1012781 | 3300003775 | Bacteria | 3204 |
| 50 | Ga0055524_1015362 | 3300003775 | Bacteria | 2795 |
| 51 | Ga0055536_1000530 | 3300003781 | Bacteria | 26325 |
| 52 | Ga0055536_1001748 | 3300003781 | Bacteria | 12822 |
| 53 | Ga0055536_1038022 | 3300003781 | Bacteria | 1171 |
| 54 | Ga0055534_1003750 | 3300003784 | Bacteria | 4681 |
| 55 | Ga0055534_1005868 | 3300003784 | Bacteria | 3204 |
| 56 | Ga0055534_1015344 | 3300003784 | Bacteria | 1405 |
| 57 | Ga0055528_1007039 | 3300003790 | Bacteria | 5027 |
| 58 | Ga0055528_1013037 | 3300003790 | Bacteria | 3180 |
| 59 | Ga0055528_1063074 | 3300003790 | Bacteria | 693 |
| 60 | Ga0055528_1081495 | 3300003790 | Bacteria | 567 |
| 61 | Ga0055530_10000464 | 3300003791 | Bacteria | 35595 |
| 62 | Ga0055530_10020044 | 3300003791 | Bacteria | 2009 |
| 63 | Ga0055530_10057447 | 3300003791 | Bacteria | 879 |
| 64 | Ga0055530_10122084 | 3300003791 | Bacteria | 504 |
| 65 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 66 | Ga0055540_1000603 | 3300003792 | Bacteria | 25833 |
| 67 | Ga0055540_1002445 | 3300003792 | Bacteria | 9798 |
| 68 | Ga0055540_1002836 | 3300003792 | Bacteria | 8832 |
| 69 | Ga0055540_1020072 | 3300003792 | Bacteria | 1780 |
| 70 | Ga0055531_10001607 | 3300003794 | Bacteria | 16412 |
| 71 | Ga0055531_10001895 | 3300003794 | Bacteria | 14645 |
| 72 | Ga0055531_10011526 | 3300003794 | Bacteria | 4250 |
| 73 | Ga0055543_1000771 | 3300004625 | Bacteria | 15959 |
| 74 | Ga0055543_1003491 | 3300004625 | Bacteria | 4611 |
| 75 | Ga0065165_1001786 | 3300005262 | Bacteria | 21245 |
| 76 | Ga0065165_1003619 | 3300005262 | Bacteria | 10607 |
| 77 | Ga0065165_1010543 | 3300005262 | Bacteria | 3973 |
| 78 | Ga0065714_10276998 | 3300005288 | Bacteria | 729 |
| 79 | Ga0065714_10299280 | 3300005288 | Bacteria | 682 |
| 80 | Ga0065704_10100495 | 3300005289 | Bacteria | 2271 |
| 81 | Ga0065704_10153191 | 3300005289 | Bacteria | 1412 |
| 82 | Ga0065704_10178466 | 3300005289 | Bacteria | 1250 |
| 83 | Ga0065704_10251990 | 3300005289 | Bacteria | 987 |
| 84 | Ga0065704_10776945 | 3300005289 | Bacteria | 526 |
| 85 | Ga0065712_10045136 | 3300005290 | Bacteria | 751 |
| 86 | Ga0065712_10054430 | 3300005290 | Bacteria | 689 |
| 87 | Ga0065715_10145513 | 3300005293 | Bacteria | 1794 |
| 88 | Ga0065715_10245821 | 3300005293 | Bacteria | 1184 |
| 89 | Ga0070658_10897051 | 3300005327 | Bacteria | 771 |
| 90 | Ga0070676_10001849 | 3300005328 | Bacteria | 10793 |
| 91 | Ga0070676_10019835 | 3300005328 | Bacteria | 3745 |
| 92 | Ga0070676_10083237 | 3300005328 | Bacteria | 1946 |
| 93 | Ga0070676_10099580 | 3300005328 | Bacteria | 1793 |
| 94 | Ga0070676_10380340 | 3300005328 | Bacteria | 977 |
| 95 | Ga0070676_10420234 | 3300005328 | Bacteria | 934 |
| 96 | Ga0070676_10617389 | 3300005328 | Bacteria | 784 |
| 97 | Ga0070676_10841459 | 3300005328 | Bacteria | 680 |
| 98 | Ga0070676_11502463 | 3300005328 | Bacteria | 519 |
| 99 | Ga0070683_100032863 | 3300005329 | Bacteria | 4728 |
| 100 | Ga0070683_100713614 | 3300005329 | Bacteria | 960 |
| 101 | Ga0070683_100935908 | 3300005329 | Bacteria | 831 |
| 102 | Ga0070690_100006214 | 3300005330 | Bacteria | 6773 |
| 103 | Ga0070670_100013010 | 3300005331 | Bacteria | 7128 |
| 104 | Ga0070670_100037154 | 3300005331 | Bacteria | 4190 |
| 105 | Ga0070670_100095571 | 3300005331 | Bacteria | 2556 |
| 106 | Ga0070670_100199248 | 3300005331 | Bacteria | 1739 |
| 107 | Ga0070670_100465496 | 3300005331 | Bacteria | 1121 |
| 108 | Ga0070670_100545083 | 3300005331 | Bacteria | 1034 |
| 109 | Ga0070670_100594711 | 3300005331 | Bacteria | 990 |
| 110 | Ga0070670_100678357 | 3300005331 | Bacteria | 926 |
| 111 | Ga0070670_100738722 | 3300005331 | Bacteria | 886 |
| 112 | Ga0070670_100947184 | 3300005331 | Bacteria | 782 |
| 113 | Ga0070670_101263339 | 3300005331 | Bacteria | 675 |
| 114 | Ga0070670_101497598 | 3300005331 | Bacteria | 619 |
| 115 | Ga0070670_101693075 | 3300005331 | Bacteria | 582 |
| 116 | Ga0070677_10017835 | 3300005333 | Bacteria | 2547 |
| 117 | Ga0070677_10033687 | 3300005333 | Bacteria | 1974 |
| 118 | Ga0070677_10071030 | 3300005333 | Bacteria | 1465 |
| 119 | Ga0070677_10108197 | 3300005333 | Bacteria | 1237 |
| 120 | Ga0070677_10146861 | 3300005333 | Bacteria | 1093 |
| 121 | Ga0070677_10241124 | 3300005333 | Bacteria | 892 |
| 122 | Ga0070677_10241125 | 3300005333 | Bacteria | 892 |
| 123 | Ga0070677_10481215 | 3300005333 | Bacteria | 670 |
| 124 | Ga0068869_100014166 | 3300005334 | Bacteria | 5322 |
| 125 | Ga0068869_100036584 | 3300005334 | Bacteria | 3486 |
| 126 | Ga0068869_100067518 | 3300005334 | Bacteria | 2638 |
| 127 | Ga0068869_100095143 | 3300005334 | Bacteria | 2247 |
| 128 | Ga0068869_100347984 | 3300005334 | Bacteria | 1207 |
| 129 | Ga0068869_100378568 | 3300005334 | Bacteria | 1159 |
| 130 | Ga0068869_100447250 | 3300005334 | Bacteria | 1070 |
| 131 | Ga0068869_100666018 | 3300005334 | Bacteria | 885 |
| 132 | Ga0068869_101160634 | 3300005334 | Bacteria | 677 |
| 133 | Ga0070666_10020373 | 3300005335 | Bacteria | 4286 |
| 134 | Ga0070666_10071419 | 3300005335 | Bacteria | 2362 |
| 135 | Ga0070666_10332138 | 3300005335 | Bacteria | 1086 |
| 136 | Ga0070666_10689634 | 3300005335 | Bacteria | 749 |
| 137 | Ga0070666_10735042 | 3300005335 | Bacteria | 725 |
| 138 | Ga0070666_11311054 | 3300005335 | Bacteria | 540 |
| 139 | Ga0070666_11338559 | 3300005335 | Bacteria | 535 |
| 140 | Ga0070666_11453302 | 3300005335 | Bacteria | 512 |
| 141 | Ga0070680_100012570 | 3300005336 | Bacteria | 6581 |
| 142 | Ga0070680_100121871 | 3300005336 | Bacteria | 2177 |
| 143 | Ga0070680_100130032 | 3300005336 | Bacteria | 2106 |
| 144 | Ga0070680_101068157 | 3300005336 | Bacteria | 698 |
| 145 | Ga0068868_100003711 | 3300005338 | Bacteria | 10664 |
| 146 | Ga0068868_100052781 | 3300005338 | Bacteria | 3200 |
| 147 | Ga0068868_100058644 | 3300005338 | Bacteria | 3043 |
| 148 | Ga0068868_100059788 | 3300005338 | Bacteria | 3015 |
| 149 | Ga0068868_100140028 | 3300005338 | Bacteria | 1985 |
| 150 | Ga0068868_100205867 | 3300005338 | Bacteria | 1642 |
| 151 | Ga0068868_100233241 | 3300005338 | Bacteria | 1544 |
| 152 | Ga0068868_100322318 | 3300005338 | Bacteria | 1317 |
| 153 | Ga0068868_100362665 | 3300005338 | Bacteria | 1243 |
| 154 | Ga0068868_100982060 | 3300005338 | Bacteria | 771 |
| 155 | Ga0068868_101411987 | 3300005338 | Bacteria | 649 |
| 156 | Ga0068868_102317947 | 3300005338 | Bacteria | 512 |
| 157 | Ga0068868_102431744 | 3300005338 | Bacteria | 500 |
| 158 | Ga0070660_100002224 | 3300005339 | Bacteria | 13368 |
| 159 | Ga0070660_101270341 | 3300005339 | Bacteria | 625 |
| 160 | Ga0070660_101583083 | 3300005339 | Bacteria | 557 |
| 161 | Ga0070660_101863067 | 3300005339 | Bacteria | 513 |
| 162 | Ga0070689_100021223 | 3300005340 | Bacteria | 4830 |
| 163 | Ga0070689_101343224 | 3300005340 | Bacteria | 645 |
| 164 | Ga0070691_10522081 | 3300005341 | Bacteria | 690 |
| 165 | Ga0070687_100038494 | 3300005343 | Bacteria | 2397 |
| 166 | Ga0070687_100496478 | 3300005343 | Bacteria | 821 |
| 167 | Ga0070687_100518213 | 3300005343 | Bacteria | 806 |
| 168 | Ga0070687_101353116 | 3300005343 | Bacteria | 530 |
| 169 | Ga0070687_101443009 | 3300005343 | Bacteria | 516 |
| 170 | Ga0070661_100005152 | 3300005344 | Bacteria | 9001 |
| 171 | Ga0070661_100042215 | 3300005344 | Bacteria | 3328 |
| 172 | Ga0070661_100219593 | 3300005344 | Bacteria | 1458 |
| 173 | Ga0070661_100597918 | 3300005344 | Bacteria | 892 |
| 174 | Ga0070661_100783587 | 3300005344 | Bacteria | 781 |
| 175 | Ga0070668_100013101 | 3300005347 | Bacteria | 6179 |
| 176 | Ga0070668_100130926 | 3300005347 | Bacteria | 2013 |
| 177 | Ga0070668_100246169 | 3300005347 | Bacteria | 1482 |
| 178 | Ga0070668_100467784 | 3300005347 | Bacteria | 1087 |
| 179 | Ga0070668_100583008 | 3300005347 | Bacteria | 976 |
| 180 | Ga0070668_100617705 | 3300005347 | Bacteria | 950 |
| 181 | Ga0070669_100015642 | 3300005353 | Bacteria | 5410 |
| 182 | Ga0070669_100071256 | 3300005353 | Bacteria | 2571 |
| 183 | Ga0070669_100097794 | 3300005353 | Bacteria | 2210 |
| 184 | Ga0070669_100160545 | 3300005353 | Bacteria | 1746 |
| 185 | Ga0070669_100426231 | 3300005353 | Bacteria | 1089 |
| 186 | Ga0070669_100704995 | 3300005353 | Bacteria | 852 |
| 187 | Ga0070669_101135656 | 3300005353 | Bacteria | 674 |
| 188 | Ga0070669_101481984 | 3300005353 | Bacteria | 590 |
| 189 | Ga0070669_101570594 | 3300005353 | Bacteria | 572 |
| 190 | Ga0070675_100000250 | 3300005354 | Bacteria | 34971 |
| 191 | Ga0070675_100003213 | 3300005354 | Bacteria | 12380 |
| 192 | Ga0070675_100011215 | 3300005354 | Bacteria | 7015 |
| 193 | Ga0070675_100012571 | 3300005354 | Bacteria | 6636 |
| 194 | Ga0070675_100018746 | 3300005354 | Bacteria | 5508 |
| 195 | Ga0070675_100025359 | 3300005354 | Bacteria | 4754 |
| 196 | Ga0070675_100114393 | 3300005354 | Bacteria | 2286 |
| 197 | Ga0070675_100171767 | 3300005354 | Bacteria | 1870 |
| 198 | Ga0070675_100207755 | 3300005354 | Bacteria | 1701 |
| 199 | Ga0070675_100326159 | 3300005354 | Bacteria | 1357 |
| 200 | Ga0070675_100419443 | 3300005354 | Bacteria | 1196 |
| 201 | Ga0070675_100571434 | 3300005354 | Bacteria | 1024 |
| 202 | Ga0070675_101423761 | 3300005354 | Bacteria | 639 |
| 203 | Ga0070675_101469976 | 3300005354 | Bacteria | 628 |
| 204 | Ga0070675_101820912 | 3300005354 | Bacteria | 561 |
| 205 | Ga0070671_100006682 | 3300005355 | Bacteria | 9222 |
| 206 | Ga0070671_100126528 | 3300005355 | Bacteria | 2151 |
| 207 | Ga0070671_100152385 | 3300005355 | Bacteria | 1952 |
| 208 | Ga0070671_100202994 | 3300005355 | Bacteria | 1681 |
| 209 | Ga0070671_100315170 | 3300005355 | Bacteria | 1333 |
| 210 | Ga0070671_100440500 | 3300005355 | Bacteria | 1117 |
| 211 | Ga0070671_100656227 | 3300005355 | Bacteria | 908 |
| 212 | Ga0070671_101156220 | 3300005355 | Bacteria | 680 |
| 213 | Ga0070671_101169761 | 3300005355 | Bacteria | 676 |
| 214 | Ga0070671_101200285 | 3300005355 | Bacteria | 668 |
| 215 | Ga0070671_101970988 | 3300005355 | Bacteria | 520 |
| 216 | Ga0070671_102000250 | 3300005355 | Bacteria | 516 |
| 217 | Ga0070674_100002846 | 3300005356 | Bacteria | 9563 |
| 218 | Ga0070674_100029632 | 3300005356 | Bacteria | 3608 |
| 219 | Ga0070674_100038484 | 3300005356 | Bacteria | 3223 |
| 220 | Ga0070674_100233224 | 3300005356 | Bacteria | 1437 |
| 221 | Ga0070674_100792281 | 3300005356 | Bacteria | 818 |
| 222 | Ga0070674_101416738 | 3300005356 | Bacteria | 623 |
| 223 | Ga0070674_101536814 | 3300005356 | Bacteria | 599 |
| 224 | Ga0070674_101616631 | 3300005356 | Bacteria | 585 |
| 225 | Ga0070674_101700792 | 3300005356 | Bacteria | 570 |
| 226 | Ga0070673_100027009 | 3300005364 | Bacteria | 4249 |
| 227 | Ga0070673_100073056 | 3300005364 | Bacteria | 2760 |
| 228 | Ga0070673_100102804 | 3300005364 | Bacteria | 2356 |
| 229 | Ga0070673_100164539 | 3300005364 | Bacteria | 1889 |
| 230 | Ga0070673_100260429 | 3300005364 | Bacteria | 1515 |
| 231 | Ga0070673_100274931 | 3300005364 | Bacteria | 1475 |
| 232 | Ga0070673_100329470 | 3300005364 | Bacteria | 1350 |
| 233 | Ga0070673_100490950 | 3300005364 | Bacteria | 1109 |
| 234 | Ga0070673_100768445 | 3300005364 | Bacteria | 888 |
| 235 | Ga0070673_101126854 | 3300005364 | Bacteria | 733 |
| 236 | Ga0070688_100004925 | 3300005365 | Bacteria | 6988 |
| 237 | Ga0070688_100578414 | 3300005365 | Bacteria | 857 |
| 238 | Ga0070688_100648628 | 3300005365 | Bacteria | 813 |
| 239 | Ga0070688_101656546 | 3300005365 | Bacteria | 523 |
| 240 | Ga0070659_100008671 | 3300005366 | Bacteria | 7436 |
| 241 | Ga0070659_100011205 | 3300005366 | Bacteria | 6625 |
| 242 | Ga0070659_100051316 | 3300005366 | Bacteria | 3243 |
| 243 | Ga0070659_100510243 | 3300005366 | Bacteria | 1026 |
| 244 | Ga0070659_100710562 | 3300005366 | Bacteria | 869 |
| 245 | Ga0070659_100882452 | 3300005366 | Bacteria | 781 |
| 246 | Ga0070659_101020976 | 3300005366 | Bacteria | 726 |
| 247 | Ga0070659_101026845 | 3300005366 | Bacteria | 724 |
| 248 | Ga0070659_101090530 | 3300005366 | Bacteria | 703 |
| 249 | Ga0070667_100039183 | 3300005367 | Bacteria | 3971 |
| 250 | Ga0070667_100257230 | 3300005367 | Bacteria | 1562 |
| 251 | Ga0070667_100334063 | 3300005367 | Bacteria | 1370 |
| 252 | Ga0070667_100334570 | 3300005367 | Bacteria | 1369 |
| 253 | Ga0070667_100354680 | 3300005367 | Bacteria | 1328 |
| 254 | Ga0070667_100533371 | 3300005367 | Bacteria | 1078 |
| 255 | Ga0070667_100958035 | 3300005367 | Bacteria | 798 |
| 256 | Ga0070667_100989473 | 3300005367 | Bacteria | 784 |
| 257 | Ga0070667_101176329 | 3300005367 | Bacteria | 718 |
| 258 | Ga0070667_101205557 | 3300005367 | Bacteria | 708 |
| 259 | Ga0070667_101609601 | 3300005367 | Bacteria | 610 |
| 260 | Ga0070667_101677350 | 3300005367 | Bacteria | 598 |
| 261 | Ga0070667_102151080 | 3300005367 | Bacteria | 526 |
| 262 | Ga0070703_10571995 | 3300005406 | Bacteria | 518 |
| 263 | Ga0070709_10084240 | 3300005434 | Bacteria | 2082 |
| 264 | Ga0070714_100003247 | 3300005435 | Bacteria | 12099 |
| 265 | Ga0070713_100255447 | 3300005436 | Bacteria | 1600 |
| 266 | Ga0070713_102202206 | 3300005436 | Bacteria | 534 |
| 267 | Ga0070710_10151357 | 3300005437 | Bacteria | 1431 |
| 268 | Ga0070710_10918525 | 3300005437 | Bacteria | 633 |
| 269 | Ga0070701_10500696 | 3300005438 | Bacteria | 789 |
| 270 | Ga0070701_10595090 | 3300005438 | Bacteria | 732 |
| 271 | Ga0070711_100892482 | 3300005439 | Bacteria | 758 |
| 272 | Ga0070705_100393727 | 3300005440 | Bacteria | 1024 |
| 273 | Ga0070700_101212675 | 3300005441 | Bacteria | 630 |
| 274 | Ga0070708_100063831 | 3300005445 | Bacteria | 3298 |
| 275 | Ga0070708_101003617 | 3300005445 | Bacteria | 783 |
| 276 | Ga0070663_100003281 | 3300005455 | Bacteria | 9317 |
| 277 | Ga0070663_100196930 | 3300005455 | Bacteria | 1570 |
| 278 | Ga0070663_100290568 | 3300005455 | Bacteria | 1305 |
| 279 | Ga0070663_100316389 | 3300005455 | Bacteria | 1254 |
| 280 | Ga0070663_100974126 | 3300005455 | Bacteria | 736 |
| 281 | Ga0070663_101134196 | 3300005455 | Bacteria | 685 |
| 282 | Ga0070663_101300241 | 3300005455 | Bacteria | 641 |
| 283 | Ga0070663_101584809 | 3300005455 | Bacteria | 584 |
| 284 | Ga0070663_101716594 | 3300005455 | Bacteria | 562 |
| 285 | Ga0070678_100053998 | 3300005456 | Bacteria | 2925 |
| 286 | Ga0070678_100060240 | 3300005456 | Bacteria | 2793 |
| 287 | Ga0070678_100074682 | 3300005456 | Bacteria | 2549 |
| 288 | Ga0070678_100080841 | 3300005456 | Bacteria | 2462 |
| 289 | Ga0070678_100086444 | 3300005456 | Bacteria | 2392 |
| 290 | Ga0070678_100093252 | 3300005456 | Bacteria | 2315 |
| 291 | Ga0070678_100097628 | 3300005456 | Bacteria | 2269 |
| 292 | Ga0070678_100226044 | 3300005456 | Bacteria | 1558 |
| 293 | Ga0070678_100417015 | 3300005456 | Bacteria | 1169 |
| 294 | Ga0070678_100435618 | 3300005456 | Bacteria | 1145 |
| 295 | Ga0070678_100736692 | 3300005456 | Bacteria | 890 |
| 296 | Ga0070678_100964237 | 3300005456 | Bacteria | 782 |
| 297 | Ga0070678_100974049 | 3300005456 | Bacteria | 778 |
| 298 | Ga0070678_101332825 | 3300005456 | Bacteria | 669 |
| 299 | Ga0070678_101701187 | 3300005456 | Bacteria | 594 |
| 300 | Ga0070678_101707733 | 3300005456 | Bacteria | 592 |
| 301 | Ga0070678_101961243 | 3300005456 | Bacteria | 553 |
| 302 | Ga0070678_102104866 | 3300005456 | Bacteria | 535 |
| 303 | Ga0070662_100013275 | 3300005457 | Bacteria | 5479 |
| 304 | Ga0070662_100043528 | 3300005457 | Bacteria | 3213 |
| 305 | Ga0070662_100052894 | 3300005457 | Bacteria | 2938 |
| 306 | Ga0070662_100127998 | 3300005457 | Bacteria | 1954 |
| 307 | Ga0070662_100262606 | 3300005457 | Bacteria | 1391 |
| 308 | Ga0070662_100287034 | 3300005457 | Bacteria | 1333 |
| 309 | Ga0070662_100418097 | 3300005457 | Bacteria | 1109 |
| 310 | Ga0070662_100576707 | 3300005457 | Bacteria | 945 |
| 311 | Ga0070662_100596614 | 3300005457 | Bacteria | 929 |
| 312 | Ga0070662_100598633 | 3300005457 | Bacteria | 927 |
| 313 | Ga0070662_100896512 | 3300005457 | Bacteria | 756 |
| 314 | Ga0070662_101444633 | 3300005457 | Bacteria | 593 |
| 315 | Ga0070662_101616173 | 3300005457 | Bacteria | 559 |
| 316 | Ga0070662_101678461 | 3300005457 | Bacteria | 548 |
| 317 | Ga0070681_10170120 | 3300005458 | Bacteria | 2101 |
| 318 | Ga0070681_10265946 | 3300005458 | Bacteria | 1626 |
| 319 | Ga0068867_100000329 | 3300005459 | Bacteria | 31296 |
| 320 | Ga0068867_100001932 | 3300005459 | Bacteria | 14439 |
| 321 | Ga0068867_100020667 | 3300005459 | Bacteria | 4691 |
| 322 | Ga0068867_100056082 | 3300005459 | Bacteria | 2914 |
| 323 | Ga0068867_100102861 | 3300005459 | Bacteria | 2184 |
| 324 | Ga0068867_100115742 | 3300005459 | Bacteria | 2065 |
| 325 | Ga0068867_100178615 | 3300005459 | Bacteria | 1686 |
| 326 | Ga0068867_100248108 | 3300005459 | Bacteria | 1447 |
| 327 | Ga0068867_100422376 | 3300005459 | Bacteria | 1129 |
| 328 | Ga0068867_100548975 | 3300005459 | Bacteria | 1001 |
| 329 | Ga0068867_100623126 | 3300005459 | Bacteria | 943 |
| 330 | Ga0068867_100691947 | 3300005459 | Bacteria | 899 |
| 331 | Ga0068867_100944551 | 3300005459 | Bacteria | 778 |
| 332 | Ga0068867_101049289 | 3300005459 | Bacteria | 741 |
| 333 | Ga0068867_101129962 | 3300005459 | Bacteria | 716 |
| 334 | Ga0070685_10693949 | 3300005466 | Bacteria | 742 |
| 335 | Ga0070685_10833306 | 3300005466 | Bacteria | 682 |
| 336 | Ga0070685_11177346 | 3300005466 | Bacteria | 582 |
| 337 | Ga0070685_11588165 | 3300005466 | Bacteria | 506 |
| 338 | Ga0070706_100004486 | 3300005467 | Bacteria | 13456 |
| 339 | Ga0070706_100096620 | 3300005467 | Bacteria | 2743 |
| 340 | Ga0070707_100355610 | 3300005468 | Bacteria | 1422 |
| 341 | Ga0070698_100138790 | 3300005471 | Bacteria | 2384 |
| 342 | Ga0070699_101436279 | 3300005518 | Bacteria | 633 |
| 343 | Ga0070679_100043614 | 3300005530 | Bacteria | 4466 |
| 344 | Ga0070679_100212093 | 3300005530 | Bacteria | 1900 |
| 345 | Ga0070679_100241396 | 3300005530 | Bacteria | 1764 |
| 346 | Ga0070679_100475313 | 3300005530 | Bacteria | 1194 |
| 347 | Ga0070679_101126452 | 3300005530 | Bacteria | 730 |
| 348 | Ga0070684_100181994 | 3300005535 | Bacteria | 1911 |
| 349 | Ga0070684_100202985 | 3300005535 | Bacteria | 1806 |
| 350 | Ga0070684_100775796 | 3300005535 | Bacteria | 895 |
| 351 | Ga0070684_102145738 | 3300005535 | Bacteria | 527 |
| 352 | Ga0068853_100004811 | 3300005539 | Bacteria | 10499 |
| 353 | Ga0068853_100007795 | 3300005539 | Bacteria | 8588 |
| 354 | Ga0068853_100010420 | 3300005539 | Bacteria | 7521 |
| 355 | Ga0068853_100105575 | 3300005539 | Bacteria | 2496 |
| 356 | Ga0068853_100160997 | 3300005539 | Bacteria | 2025 |
| 357 | Ga0068853_100281317 | 3300005539 | Bacteria | 1534 |
| 358 | Ga0068853_100490057 | 3300005539 | Bacteria | 1159 |
| 359 | Ga0068853_100522230 | 3300005539 | Bacteria | 1122 |
| 360 | Ga0070672_100001451 | 3300005543 | Bacteria | 14681 |
| 361 | Ga0070672_100015547 | 3300005543 | Bacteria | 5423 |
| 362 | Ga0070672_100021276 | 3300005543 | Bacteria | 4744 |
| 363 | Ga0070672_100027777 | 3300005543 | Bacteria | 4224 |
| 364 | Ga0070672_100030773 | 3300005543 | Bacteria | 4036 |
| 365 | Ga0070672_100033709 | 3300005543 | Bacteria | 3880 |
| 366 | Ga0070672_100042276 | 3300005543 | Bacteria | 3508 |
| 367 | Ga0070672_100135479 | 3300005543 | Bacteria | 2028 |
| 368 | Ga0070672_100318781 | 3300005543 | Bacteria | 1321 |
| 369 | Ga0070672_100332166 | 3300005543 | Bacteria | 1293 |
| 370 | Ga0070672_100412143 | 3300005543 | Bacteria | 1159 |
| 371 | Ga0070672_100572100 | 3300005543 | Bacteria | 982 |
| 372 | Ga0070672_101391110 | 3300005543 | Bacteria | 627 |
| 373 | Ga0070695_100085874 | 3300005545 | Bacteria | 2090 |
| 374 | Ga0070693_100026317 | 3300005547 | Bacteria | 3140 |
| 375 | Ga0070693_100629876 | 3300005547 | Bacteria | 778 |
| 376 | Ga0070665_100543803 | 3300005548 | Bacteria | 1173 |
| 377 | Ga0070665_100790261 | 3300005548 | Bacteria | 962 |
| 378 | Ga0070665_100853711 | 3300005548 | Bacteria | 923 |
| 379 | Ga0070665_101205973 | 3300005548 | Bacteria | 767 |
| 380 | Ga0070665_102467209 | 3300005548 | Bacteria | 522 |
| 381 | Ga0068855_100015899 | 3300005563 | Bacteria | 9053 |
| 382 | Ga0068855_100019544 | 3300005563 | Bacteria | 8138 |
| 383 | Ga0068855_100399137 | 3300005563 | Bacteria | 1507 |
| 384 | Ga0068855_100409839 | 3300005563 | Bacteria | 1484 |
| 385 | Ga0068855_100546779 | 3300005563 | Bacteria | 1254 |
| 386 | Ga0070664_100001831 | 3300005564 | Bacteria | 17028 |
| 387 | Ga0070664_100040136 | 3300005564 | Bacteria | 3945 |
| 388 | Ga0070664_100148636 | 3300005564 | Bacteria | 2067 |
| 389 | Ga0070664_100230636 | 3300005564 | Bacteria | 1659 |
| 390 | Ga0070664_100262430 | 3300005564 | Bacteria | 1554 |
| 391 | Ga0070664_100285705 | 3300005564 | Bacteria | 1488 |
| 392 | Ga0070664_100512445 | 3300005564 | Bacteria | 1106 |
| 393 | Ga0070664_100832791 | 3300005564 | Bacteria | 863 |
| 394 | Ga0070664_101046865 | 3300005564 | Bacteria | 768 |
| 395 | Ga0070664_101047334 | 3300005564 | Bacteria | 767 |
| 396 | Ga0070664_101638866 | 3300005564 | Bacteria | 609 |
| 397 | Ga0070664_102223047 | 3300005564 | Bacteria | 520 |
| 398 | Ga0068857_100001323 | 3300005577 | Bacteria | 19468 |
| 399 | Ga0068857_100188666 | 3300005577 | Bacteria | 1877 |
| 400 | Ga0068857_100220281 | 3300005577 | Bacteria | 1733 |
| 401 | Ga0068857_100804946 | 3300005577 | Bacteria | 897 |
| 402 | Ga0068857_100923447 | 3300005577 | Bacteria | 838 |
| 403 | Ga0068857_101427885 | 3300005577 | Bacteria | 673 |
| 404 | Ga0068857_102188780 | 3300005577 | Bacteria | 543 |
| 405 | Ga0068854_100014719 | 3300005578 | Bacteria | 5162 |
| 406 | Ga0068854_100499034 | 3300005578 | Bacteria | 1025 |
| 407 | Ga0068854_100691507 | 3300005578 | Bacteria | 879 |
| 408 | Ga0068854_100801982 | 3300005578 | Bacteria | 821 |
| 409 | Ga0068856_100012520 | 3300005614 | Bacteria | 8213 |
| 410 | Ga0068856_100234744 | 3300005614 | Bacteria | 1849 |
| 411 | Ga0068856_100588995 | 3300005614 | Bacteria | 1133 |
| 412 | Ga0070702_100330559 | 3300005615 | Bacteria | 1066 |
| 413 | Ga0070702_100390308 | 3300005615 | Bacteria | 992 |
| 414 | Ga0070702_100970483 | 3300005615 | Bacteria | 670 |
| 415 | Ga0070702_101678808 | 3300005615 | Bacteria | 527 |
| 416 | Ga0068852_100003059 | 3300005616 | Bacteria | 11640 |
| 417 | Ga0068852_100003215 | 3300005616 | Bacteria | 11409 |
| 418 | Ga0068852_100005883 | 3300005616 | Bacteria | 8816 |
| 419 | Ga0068852_100060508 | 3300005616 | Bacteria | 3287 |
| 420 | Ga0068852_100063413 | 3300005616 | Bacteria | 3218 |
| 421 | Ga0068852_100081438 | 3300005616 | Bacteria | 2873 |
| 422 | Ga0068852_100085851 | 3300005616 | Bacteria | 2804 |
| 423 | Ga0068852_100281484 | 3300005616 | Bacteria | 1603 |
| 424 | Ga0068852_100289797 | 3300005616 | Bacteria | 1581 |
| 425 | Ga0068852_100338183 | 3300005616 | Bacteria | 1466 |
| 426 | Ga0068852_100429912 | 3300005616 | Bacteria | 1304 |
| 427 | Ga0068852_100496905 | 3300005616 | Bacteria | 1214 |
| 428 | Ga0068852_100623488 | 3300005616 | Bacteria | 1084 |
| 429 | Ga0068852_100877640 | 3300005616 | Bacteria | 913 |
| 430 | Ga0068852_100944013 | 3300005616 | Bacteria | 880 |
| 431 | Ga0068852_101778848 | 3300005616 | Bacteria | 639 |
| 432 | Ga0068852_101993761 | 3300005616 | Bacteria | 603 |
| 433 | Ga0068852_102203231 | 3300005616 | Bacteria | 572 |
| 434 | Ga0068852_102555406 | 3300005616 | Bacteria | 530 |
| 435 | Ga0068859_100024423 | 3300005617 | Bacteria | 6063 |
| 436 | Ga0068859_100030871 | 3300005617 | Bacteria | 5377 |
| 437 | Ga0068859_100205505 | 3300005617 | Bacteria | 2054 |
| 438 | Ga0068859_100420551 | 3300005617 | Bacteria | 1433 |
| 439 | Ga0068864_100003978 | 3300005618 | Bacteria | 12169 |
| 440 | Ga0068864_100026806 | 3300005618 | Bacteria | 4860 |
| 441 | Ga0068864_100070862 | 3300005618 | Bacteria | 3034 |
| 442 | Ga0068864_100074432 | 3300005618 | Bacteria | 2963 |
| 443 | Ga0068864_100186642 | 3300005618 | Bacteria | 1898 |
| 444 | Ga0068864_100507830 | 3300005618 | Bacteria | 1161 |
| 445 | Ga0068864_100959443 | 3300005618 | Bacteria | 846 |
| 446 | Ga0068864_102179872 | 3300005618 | Bacteria | 560 |
| 447 | Ga0068864_102491605 | 3300005618 | Bacteria | 523 |
| 448 | Ga0068866_10010148 | 3300005718 | Bacteria | 4027 |
| 449 | Ga0068866_10092812 | 3300005718 | Bacteria | 1648 |
| 450 | Ga0068866_10246875 | 3300005718 | Bacteria | 1090 |
| 451 | Ga0068866_10624189 | 3300005718 | Bacteria | 731 |
| 452 | Ga0068861_100007969 | 3300005719 | Bacteria | 7292 |
| 453 | Ga0068861_100050459 | 3300005719 | Bacteria | 3155 |
| 454 | Ga0068861_100252792 | 3300005719 | Bacteria | 1505 |
| 455 | Ga0068861_100566595 | 3300005719 | Bacteria | 1037 |
| 456 | Ga0068861_100754860 | 3300005719 | Bacteria | 909 |
| 457 | Ga0068861_101024062 | 3300005719 | Bacteria | 789 |
| 458 | Ga0068861_101437731 | 3300005719 | Bacteria | 675 |
| 459 | Ga0068861_102366491 | 3300005719 | Bacteria | 534 |
| 460 | Ga0068851_10010993 | 3300005834 | Bacteria | 4236 |
| 461 | Ga0068851_10013080 | 3300005834 | Bacteria | 3924 |
| 462 | Ga0068851_10049026 | 3300005834 | Bacteria | 2141 |
| 463 | Ga0068851_10061522 | 3300005834 | Bacteria | 1924 |
| 464 | Ga0068851_10110219 | 3300005834 | Bacteria | 1468 |
| 465 | Ga0068851_10232097 | 3300005834 | Bacteria | 1041 |
| 466 | Ga0068851_10365005 | 3300005834 | Bacteria | 843 |
| 467 | Ga0068851_10403524 | 3300005834 | Bacteria | 804 |
| 468 | Ga0068851_10871972 | 3300005834 | Bacteria | 562 |
| 469 | Ga0068870_10184872 | 3300005840 | Bacteria | 1254 |
| 470 | Ga0068870_10286484 | 3300005840 | Bacteria | 1035 |
| 471 | Ga0068870_10433751 | 3300005840 | Bacteria | 862 |
| 472 | Ga0068863_100019694 | 3300005841 | Bacteria | 6454 |
| 473 | Ga0068863_100076202 | 3300005841 | Bacteria | 3173 |
| 474 | Ga0068863_100160408 | 3300005841 | Bacteria | 2154 |
| 475 | Ga0068863_100294731 | 3300005841 | Bacteria | 1573 |
| 476 | Ga0068863_100352912 | 3300005841 | Bacteria | 1432 |
| 477 | Ga0068863_100587577 | 3300005841 | Bacteria | 1101 |
| 478 | Ga0068863_102685320 | 3300005841 | Bacteria | 507 |
| 479 | Ga0068858_100001515 | 3300005842 | Bacteria | 23851 |
| 480 | Ga0068858_100001818 | 3300005842 | Bacteria | 21717 |
| 481 | Ga0068858_100003704 | 3300005842 | Bacteria | 15140 |
| 482 | Ga0068860_100001009 | 3300005843 | Bacteria | 31175 |
| 483 | Ga0068860_100003030 | 3300005843 | Bacteria | 17343 |
| 484 | Ga0068860_100057253 | 3300005843 | Bacteria | 3705 |
| 485 | Ga0068860_100249680 | 3300005843 | Bacteria | 1727 |
| 486 | Ga0068860_100730483 | 3300005843 | Bacteria | 1001 |
| 487 | Ga0068860_102665865 | 3300005843 | Bacteria | 519 |
| 488 | Ga0068862_100036617 | 3300005844 | Bacteria | 4159 |
| 489 | Ga0068862_100243673 | 3300005844 | Bacteria | 1636 |
| 490 | Ga0068862_101222035 | 3300005844 | Bacteria | 751 |
| 491 | Ga0070717_10994756 | 3300006028 | Bacteria | 764 |
| 492 | Ga0075365_10270767 | 3300006038 | Bacteria | 1194 |
| 493 | Ga0075368_10069600 | 3300006042 | Bacteria | 1419 |
| 494 | Ga0075363_100009238 | 3300006048 | Bacteria | 4630 |
| 495 | Ga0075363_100131110 | 3300006048 | Bacteria | 1406 |
| 496 | Ga0075363_100157455 | 3300006048 | Bacteria | 1285 |
| 497 | Ga0075363_100301776 | 3300006048 | Bacteria | 929 |
| 498 | Ga0075364_10002974 | 3300006051 | Bacteria | 9569 |
| 499 | Ga0075364_10121068 | 3300006051 | Bacteria | 1751 |
| 500 | Ga0075364_10187923 | 3300006051 | Bacteria | 1399 |
| 501 | Ga0070715_10214039 | 3300006163 | Bacteria | 987 |
| 502 | Ga0070716_100205061 | 3300006173 | Bacteria | 1313 |
| 503 | Ga0070716_100776094 | 3300006173 | Bacteria | 740 |
| 504 | Ga0070712_101297678 | 3300006175 | Bacteria | 634 |
| 505 | Ga0075362_10010715 | 3300006177 | Bacteria | 3588 |
| 506 | Ga0075362_10021615 | 3300006177 | Bacteria | 2703 |
| 507 | Ga0075362_10064250 | 3300006177 | Bacteria | 1665 |
| 508 | Ga0075362_10162263 | 3300006177 | Bacteria | 1077 |
| 509 | Ga0075362_10173547 | 3300006177 | Bacteria | 1042 |
| 510 | Ga0075362_10190963 | 3300006177 | Bacteria | 995 |
| 511 | Ga0075362_10409447 | 3300006177 | Bacteria | 685 |
| 512 | Ga0075362_10434037 | 3300006177 | Bacteria | 666 |
| 513 | Ga0075362_10500658 | 3300006177 | Bacteria | 621 |
| 514 | Ga0075362_10516424 | 3300006177 | Bacteria | 612 |
| 515 | Ga0075362_10672741 | 3300006177 | Bacteria | 539 |
| 516 | Ga0075367_10015588 | 3300006178 | Bacteria | 4137 |
| 517 | Ga0075367_10033387 | 3300006178 | Bacteria | 2965 |
| 518 | Ga0075367_10056015 | 3300006178 | Bacteria | 2341 |
| 519 | Ga0075367_10078408 | 3300006178 | Bacteria | 1995 |
| 520 | Ga0075367_10389942 | 3300006178 | Bacteria | 880 |
| 521 | Ga0075369_10007815 | 3300006186 | Bacteria | 4091 |
| 522 | Ga0075369_10013367 | 3300006186 | Bacteria | 3258 |
| 523 | Ga0075369_10104184 | 3300006186 | Bacteria | 1275 |
| 524 | Ga0075369_10408093 | 3300006186 | Bacteria | 641 |
| 525 | Ga0075366_10025896 | 3300006195 | Bacteria | 3431 |
| 526 | Ga0075366_10046947 | 3300006195 | Bacteria | 2559 |
| 527 | Ga0075366_10058370 | 3300006195 | Bacteria | 2292 |
| 528 | Ga0075366_10083646 | 3300006195 | Bacteria | 1907 |
| 529 | Ga0075366_10124788 | 3300006195 | Bacteria | 1552 |
| 530 | Ga0075366_10179318 | 3300006195 | Bacteria | 1286 |
| 531 | Ga0075366_10251270 | 3300006195 | Bacteria | 1078 |
| 532 | Ga0075366_10317687 | 3300006195 | Bacteria | 954 |
| 533 | Ga0075366_10371893 | 3300006195 | Bacteria | 878 |
| 534 | Ga0075366_10479410 | 3300006195 | Bacteria | 768 |
| 535 | Ga0075366_10485219 | 3300006195 | Bacteria | 764 |
| 536 | Ga0075366_10577374 | 3300006195 | Bacteria | 696 |
| 537 | Ga0075366_10638500 | 3300006195 | Bacteria | 660 |
| 538 | Ga0075366_10859577 | 3300006195 | Bacteria | 565 |
| 539 | Ga0075366_10944258 | 3300006195 | Bacteria | 538 |
| 540 | Ga0097621_100016134 | 3300006237 | Bacteria | 5640 |
| 541 | Ga0097621_100056447 | 3300006237 | Bacteria | 3208 |
| 542 | Ga0097621_100096593 | 3300006237 | Bacteria | 2479 |
| 543 | Ga0097621_100104372 | 3300006237 | Bacteria | 2388 |
| 544 | Ga0097621_100406286 | 3300006237 | Bacteria | 1220 |
| 545 | Ga0097621_100566255 | 3300006237 | Bacteria | 1035 |
| 546 | Ga0097621_101293660 | 3300006237 | Bacteria | 688 |
| 547 | Ga0097621_101392461 | 3300006237 | Bacteria | 664 |
| 548 | Ga0075370_10000524 | 3300006353 | Bacteria | 14643 |
| 549 | Ga0075370_10002753 | 3300006353 | Bacteria | 8237 |
| 550 | Ga0075370_10010292 | 3300006353 | Bacteria | 4886 |
| 551 | Ga0075370_10014590 | 3300006353 | Bacteria | 4194 |
| 552 | Ga0075370_10024961 | 3300006353 | Bacteria | 3304 |
| 553 | Ga0075370_10054018 | 3300006353 | Bacteria | 2280 |
| 554 | Ga0075370_10104776 | 3300006353 | Bacteria | 1639 |
| 555 | Ga0075370_10130104 | 3300006353 | Bacteria | 1468 |
| 556 | Ga0075370_10137636 | 3300006353 | Bacteria | 1427 |
| 557 | Ga0075370_10182783 | 3300006353 | Bacteria | 1234 |
| 558 | Ga0075370_10194837 | 3300006353 | Bacteria | 1195 |
| 559 | Ga0075370_10198370 | 3300006353 | Bacteria | 1183 |
| 560 | Ga0075370_10321799 | 3300006353 | Bacteria | 921 |
| 561 | Ga0075370_10440707 | 3300006353 | Bacteria | 783 |
| 562 | Ga0075370_10479758 | 3300006353 | Bacteria | 749 |
| 563 | Ga0075370_10505437 | 3300006353 | Bacteria | 729 |
| 564 | Ga0075370_10511414 | 3300006353 | Bacteria | 725 |
| 565 | Ga0075370_10656904 | 3300006353 | Bacteria | 636 |
| 566 | Ga0075370_10795353 | 3300006353 | Bacteria | 576 |
| 567 | Ga0068871_100083637 | 3300006358 | Bacteria | 2647 |
| 568 | Ga0068871_100163910 | 3300006358 | Bacteria | 1902 |
| 569 | Ga0068871_100183476 | 3300006358 | Bacteria | 1799 |
| 570 | Ga0068871_100321654 | 3300006358 | Bacteria | 1362 |
| 571 | Ga0068871_100518079 | 3300006358 | Bacteria | 1076 |
| 572 | Ga0068871_100886165 | 3300006358 | Bacteria | 826 |
| 573 | Ga0068871_100890569 | 3300006358 | Bacteria | 824 |
| 574 | Ga0068871_101112981 | 3300006358 | Bacteria | 739 |
| 575 | Ga0068871_101214269 | 3300006358 | Bacteria | 707 |
| 576 | Ga0068871_101446739 | 3300006358 | Bacteria | 648 |
| 577 | Ga0068871_101757230 | 3300006358 | Bacteria | 589 |
| 578 | Ga0075428_100529609 | 3300006844 | Bacteria | 1260 |
| 579 | Ga0075428_101653622 | 3300006844 | Bacteria | 669 |
| 580 | Ga0075430_100023009 | 3300006846 | Bacteria | 5300 |
| 581 | Ga0075434_100130115 | 3300006871 | Bacteria | 2535 |
| 582 | Ga0075429_100008966 | 3300006880 | Bacteria | 8689 |
| 583 | Ga0068865_100091831 | 3300006881 | Bacteria | 2204 |
| 584 | Ga0068865_100097410 | 3300006881 | Bacteria | 2147 |
| 585 | Ga0068865_100112935 | 3300006881 | Bacteria | 2007 |
| 586 | Ga0068865_100367678 | 3300006881 | Bacteria | 1169 |
| 587 | Ga0068865_100546026 | 3300006881 | Bacteria | 972 |
| 588 | Ga0097620_100024424 | 3300006931 | Bacteria | 6063 |
| 589 | Ga0097620_100030873 | 3300006931 | Bacteria | 5377 |
| 590 | Ga0097620_100205485 | 3300006931 | Bacteria | 2054 |
| 591 | Ga0097620_100420551 | 3300006931 | Bacteria | 1433 |
| 592 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 593 | Ga0079104_1044093 | 3300006946 | Bacteria | 1024 |
| 594 | Ga0099826_10238378 | 3300006948 | Bacteria | 967 |
| 595 | Ga0105251_10343262 | 3300009011 | Bacteria | 681 |
| 596 | Ga0105244_10026422 | 3300009036 | Bacteria | 3142 |
| 597 | Ga0105244_10480951 | 3300009036 | Bacteria | 571 |
| 598 | Ga0105240_10002903 | 3300009093 | Bacteria | 27043 |
| 599 | Ga0105240_10030212 | 3300009093 | Bacteria | 7045 |
| 600 | Ga0105240_10039246 | 3300009093 | Bacteria | 6065 |
| 601 | Ga0105240_10183372 | 3300009093 | Bacteria | 2468 |
| 602 | Ga0105240_10221428 | 3300009093 | Bacteria | 2204 |
| 603 | Ga0105240_10721263 | 3300009093 | Bacteria | 1086 |
| 604 | Ga0111539_10492911 | 3300009094 | Bacteria | 1427 |
| 605 | Ga0111539_10542458 | 3300009094 | Bacteria | 1355 |
| 606 | Ga0111539_10867708 | 3300009094 | Bacteria | 1050 |
| 607 | Ga0105245_10008631 | 3300009098 | Bacteria | 8888 |
| 608 | Ga0105245_10049840 | 3300009098 | Bacteria | 3751 |
| 609 | Ga0105245_10061364 | 3300009098 | Bacteria | 3388 |
| 610 | Ga0105245_10293445 | 3300009098 | Bacteria | 1593 |
| 611 | Ga0105245_11520681 | 3300009098 | Bacteria | 720 |
| 612 | Ga0105245_12155683 | 3300009098 | Bacteria | 611 |
| 613 | Ga0105247_10237932 | 3300009101 | Bacteria | 1239 |
| 614 | Ga0105247_10253737 | 3300009101 | Bacteria | 1203 |
| 615 | Ga0105247_10947597 | 3300009101 | Bacteria | 668 |
| 616 | Ga0114129_10023973 | 3300009147 | Bacteria | 8647 |
| 617 | Ga0114129_10267738 | 3300009147 | Bacteria | 2287 |
| 618 | Ga0105243_10000197 | 3300009148 | Bacteria | 70941 |
| 619 | Ga0105243_10008438 | 3300009148 | Bacteria | 7910 |
| 620 | Ga0105243_10013128 | 3300009148 | Bacteria | 6260 |
| 621 | Ga0105243_10083870 | 3300009148 | Bacteria | 2608 |
| 622 | Ga0105243_10312678 | 3300009148 | Bacteria | 1428 |
| 623 | Ga0105243_10475551 | 3300009148 | Bacteria | 1178 |
| 624 | Ga0105243_11079602 | 3300009148 | Bacteria | 810 |
| 625 | Ga0105243_11459518 | 3300009148 | Bacteria | 706 |
| 626 | Ga0105243_12658700 | 3300009148 | Bacteria | 540 |
| 627 | Ga0105241_10086637 | 3300009174 | Bacteria | 2463 |
| 628 | Ga0105241_10191455 | 3300009174 | Bacteria | 1703 |
| 629 | Ga0105241_10669885 | 3300009174 | Bacteria | 944 |
| 630 | Ga0105241_11599311 | 3300009174 | Bacteria | 630 |
| 631 | Ga0105241_11902796 | 3300009174 | Bacteria | 583 |
| 632 | Ga0105242_10058974 | 3300009176 | Bacteria | 3148 |
| 633 | Ga0105242_10282573 | 3300009176 | Bacteria | 1508 |
| 634 | Ga0105242_10339727 | 3300009176 | Bacteria | 1383 |
| 635 | Ga0105242_11759390 | 3300009176 | Bacteria | 657 |
| 636 | Ga0105242_12123191 | 3300009176 | Bacteria | 606 |
| 637 | Ga0105248_10013699 | 3300009177 | Bacteria | 8926 |
| 638 | Ga0105248_10031936 | 3300009177 | Bacteria | 5884 |
| 639 | Ga0105248_10285735 | 3300009177 | Bacteria | 1857 |
| 640 | Ga0105248_10446577 | 3300009177 | Bacteria | 1457 |
| 641 | Ga0105248_10459956 | 3300009177 | Bacteria | 1434 |
| 642 | Ga0105248_10754462 | 3300009177 | Bacteria | 1098 |
| 643 | Ga0105248_10989899 | 3300009177 | Bacteria | 950 |
| 644 | Ga0105248_11718831 | 3300009177 | Bacteria | 711 |
| 645 | Ga0105248_11948689 | 3300009177 | Bacteria | 667 |
| 646 | Ga0105237_10000605 | 3300009545 | Bacteria | 50037 |
| 647 | Ga0105237_10014977 | 3300009545 | Bacteria | 8082 |
| 648 | Ga0105237_10021204 | 3300009545 | Bacteria | 6682 |
| 649 | Ga0105237_10024647 | 3300009545 | Bacteria | 6153 |
| 650 | Ga0105237_10035003 | 3300009545 | Bacteria | 5082 |
| 651 | Ga0105237_10073055 | 3300009545 | Bacteria | 3423 |
| 652 | Ga0105237_10452160 | 3300009545 | Bacteria | 1290 |
| 653 | Ga0105238_10001575 | 3300009551 | Bacteria | 22864 |
| 654 | Ga0105238_10028942 | 3300009551 | Bacteria | 5642 |
| 655 | Ga0105238_10307061 | 3300009551 | Bacteria | 1571 |
| 656 | Ga0105238_10378039 | 3300009551 | Bacteria | 1407 |
| 657 | Ga0105238_10393781 | 3300009551 | Bacteria | 1378 |
| 658 | Ga0105238_10483868 | 3300009551 | Bacteria | 1237 |
| 659 | Ga0105238_10898267 | 3300009551 | Bacteria | 904 |
| 660 | Ga0105249_10138150 | 3300009553 | Bacteria | 2334 |
| 661 | Ga0105249_10394623 | 3300009553 | Bacteria | 1413 |
| 662 | Ga0105249_10755732 | 3300009553 | Bacteria | 1034 |
| 663 | Ga0105249_10957132 | 3300009553 | Bacteria | 924 |
| 664 | Ga0105249_10978956 | 3300009553 | Bacteria | 914 |
| 665 | Ga0105249_12241215 | 3300009553 | Bacteria | 619 |
| 666 | Ga0105239_10000328 | 3300010375 | Bacteria | 70165 |
| 667 | Ga0105239_10026320 | 3300010375 | Bacteria | 6401 |
| 668 | Ga0105239_10031452 | 3300010375 | Bacteria | 5836 |
| 669 | Ga0105239_10114097 | 3300010375 | Bacteria | 2997 |
| 670 | Ga0105239_11237406 | 3300010375 | Bacteria | 861 |
| 671 | Ga0105246_10153471 | 3300011119 | Bacteria | 1746 |
| 672 | Ga0105246_10439382 | 3300011119 | Bacteria | 1094 |
| 673 | Ga0105246_10458010 | 3300011119 | Bacteria | 1073 |
| 674 | Ga0105246_10616419 | 3300011119 | Bacteria | 940 |
| 675 | Ga0105246_11820562 | 3300011119 | Bacteria | 582 |
| 676 | Ga0105246_12419946 | 3300011119 | Bacteria | 515 |
| 677 | Ga0157317_1005765 | 3300012475 | Bacteria | 846 |
| 678 | Ga0157328_1027883 | 3300012478 | Bacteria | 518 |
| 679 | Ga0157337_1031094 | 3300012483 | Bacteria | 547 |
| 680 | Ga0157325_1015900 | 3300012485 | Bacteria | 620 |
| 681 | Ga0157329_1014777 | 3300012491 | Bacteria | 667 |
| 682 | Ga0157323_1004876 | 3300012495 | Bacteria | 877 |
| 683 | Ga0157314_1005685 | 3300012500 | Bacteria | 954 |
| 684 | Ga0157315_1034929 | 3300012508 | Bacteria | 610 |
| 685 | Ga0157316_1005909 | 3300012510 | Bacteria | 985 |
| 686 | Ga0157327_1046621 | 3300012512 | Bacteria | 602 |
| 687 | Ga0157338_1059789 | 3300012515 | Bacteria | 569 |
| 688 | Ga0157373_10009706 | 3300013100 | Bacteria | 7104 |
| 689 | Ga0157373_10020413 | 3300013100 | Bacteria | 4815 |
| 690 | Ga0157373_10213609 | 3300013100 | Bacteria | 1360 |
| 691 | Ga0157373_10329462 | 3300013100 | Bacteria | 1087 |
| 692 | Ga0157373_10371991 | 3300013100 | Bacteria | 1021 |
| 693 | Ga0157373_11023067 | 3300013100 | Bacteria | 617 |
| 694 | Ga0157373_11092864 | 3300013100 | Bacteria | 598 |
| 695 | Ga0157371_10034557 | 3300013102 | Bacteria | 3626 |
| 696 | Ga0157371_10094994 | 3300013102 | Bacteria | 2113 |
| 697 | Ga0157371_10095280 | 3300013102 | Bacteria | 2109 |
| 698 | Ga0157371_10907224 | 3300013102 | Bacteria | 668 |
| 699 | Ga0157371_11150079 | 3300013102 | Bacteria | 597 |
| 700 | Ga0157371_11595439 | 3300013102 | Bacteria | 511 |
| 701 | Ga0157370_10026238 | 3300013104 | Bacteria | 5756 |
| 702 | Ga0157370_10233816 | 3300013104 | Bacteria | 1701 |
| 703 | Ga0157370_10653068 | 3300013104 | Bacteria | 961 |
| 704 | Ga0157370_11467787 | 3300013104 | Bacteria | 613 |
| 705 | Ga0157370_11660903 | 3300013104 | Bacteria | 574 |
| 706 | Ga0157370_11811047 | 3300013104 | Bacteria | 548 |
| 707 | Ga0157370_12092579 | 3300013104 | Bacteria | 507 |
| 708 | Ga0157369_10014064 | 3300013105 | Bacteria | 9040 |
| 709 | Ga0157369_10014312 | 3300013105 | Bacteria | 8961 |
| 710 | Ga0157369_10298892 | 3300013105 | Bacteria | 1675 |
| 711 | Ga0157369_10957638 | 3300013105 | Bacteria | 877 |
| 712 | Ga0157374_10007375 | 3300013296 | Bacteria | 9379 |
| 713 | Ga0157374_10047442 | 3300013296 | Bacteria | 3983 |
| 714 | Ga0157374_10074924 | 3300013296 | Bacteria | 3197 |
| 715 | Ga0157374_10202503 | 3300013296 | Bacteria | 1944 |
| 716 | Ga0157374_10765796 | 3300013296 | Bacteria | 980 |
| 717 | Ga0157374_10994380 | 3300013296 | Bacteria | 858 |
| 718 | Ga0157374_11476736 | 3300013296 | Bacteria | 703 |
| 719 | Ga0157374_12492433 | 3300013296 | Bacteria | 545 |
| 720 | Ga0157378_10113037 | 3300013297 | Bacteria | 2492 |
| 721 | Ga0157378_10138443 | 3300013297 | Bacteria | 2259 |
| 722 | Ga0157378_10754387 | 3300013297 | Bacteria | 996 |
| 723 | Ga0157378_11027931 | 3300013297 | Bacteria | 859 |
| 724 | Ga0157378_11150283 | 3300013297 | Bacteria | 814 |
| 725 | Ga0157378_11505132 | 3300013297 | Bacteria | 718 |
| 726 | Ga0163162_10023275 | 3300013306 | Bacteria | 6113 |
| 727 | Ga0163162_10060967 | 3300013306 | Bacteria | 3810 |
| 728 | Ga0163162_10080866 | 3300013306 | Bacteria | 3319 |
| 729 | Ga0163162_10128822 | 3300013306 | Bacteria | 2638 |
| 730 | Ga0163162_10218886 | 3300013306 | Bacteria | 2034 |
| 731 | Ga0163162_10696994 | 3300013306 | Bacteria | 1137 |
| 732 | Ga0163162_10816582 | 3300013306 | Bacteria | 1049 |
| 733 | Ga0163162_11052362 | 3300013306 | Bacteria | 921 |
| 734 | Ga0163162_11054926 | 3300013306 | Bacteria | 920 |
| 735 | Ga0163162_11324107 | 3300013306 | Bacteria | 819 |
| 736 | Ga0163162_11989478 | 3300013306 | Bacteria | 666 |
| 737 | Ga0163162_12242593 | 3300013306 | Bacteria | 627 |
| 738 | Ga0163162_12253968 | 3300013306 | Bacteria | 625 |
| 739 | Ga0163162_12395248 | 3300013306 | Bacteria | 607 |
| 740 | Ga0157372_10005958 | 3300013307 | Bacteria | 12960 |
| 741 | Ga0157372_10010263 | 3300013307 | Bacteria | 9948 |
| 742 | Ga0157372_10059208 | 3300013307 | Bacteria | 4283 |
| 743 | Ga0157372_10502453 | 3300013307 | Bacteria | 1414 |
| 744 | Ga0157372_10507343 | 3300013307 | Bacteria | 1406 |
| 745 | Ga0157372_11772534 | 3300013307 | Bacteria | 710 |
| 746 | Ga0157372_11943755 | 3300013307 | Bacteria | 676 |
| 747 | Ga0157375_10024076 | 3300013308 | Bacteria | 5629 |
| 748 | Ga0157375_10044133 | 3300013308 | Bacteria | 4328 |
| 749 | Ga0157375_10165940 | 3300013308 | Bacteria | 2353 |
| 750 | Ga0157375_10220885 | 3300013308 | Bacteria | 2053 |
| 751 | Ga0157375_10543308 | 3300013308 | Bacteria | 1324 |
| 752 | Ga0157375_11008528 | 3300013308 | Bacteria | 972 |
| 753 | Ga0157375_11096261 | 3300013308 | Bacteria | 932 |
| 754 | Ga0157375_11410600 | 3300013308 | Bacteria | 821 |
| 755 | Ga0157375_11918122 | 3300013308 | Bacteria | 703 |
| 756 | Ga0157375_12704414 | 3300013308 | Bacteria | 593 |
| 757 | Ga0157375_12882360 | 3300013308 | Bacteria | 575 |
| 758 | Ga0157375_13344920 | 3300013308 | Bacteria | 534 |
| 759 | Ga0163163_10220374 | 3300014325 | Bacteria | 1946 |
| 760 | Ga0163163_10251732 | 3300014325 | Bacteria | 1817 |
| 761 | Ga0163163_10394057 | 3300014325 | Bacteria | 1443 |
| 762 | Ga0163163_10527368 | 3300014325 | Bacteria | 1243 |
| 763 | Ga0163163_10767023 | 3300014325 | Bacteria | 1028 |
| 764 | Ga0163163_10998768 | 3300014325 | Bacteria | 900 |
| 765 | Ga0163163_11021015 | 3300014325 | Bacteria | 890 |
| 766 | Ga0163163_11230600 | 3300014325 | Bacteria | 811 |
| 767 | Ga0163163_11713957 | 3300014325 | Bacteria | 689 |
| 768 | Ga0163163_12521296 | 3300014325 | Bacteria | 572 |
| 769 | Ga0157380_10360353 | 3300014326 | Bacteria | 1364 |
| 770 | Ga0157380_10607993 | 3300014326 | Bacteria | 1083 |
| 771 | Ga0157380_10854464 | 3300014326 | Bacteria | 932 |
| 772 | Ga0157380_11008816 | 3300014326 | Bacteria | 866 |
| 773 | Ga0157380_11107608 | 3300014326 | Bacteria | 831 |
| 774 | Ga0157380_11265346 | 3300014326 | Bacteria | 784 |
| 775 | Ga0157380_11730149 | 3300014326 | Bacteria | 683 |
| 776 | Ga0157380_12519827 | 3300014326 | Bacteria | 580 |
| 777 | Ga0157380_12697823 | 3300014326 | Bacteria | 563 |
| 778 | Ga0157380_13486133 | 3300014326 | Bacteria | 504 |
| 779 | Ga0182008_10020420 | 3300014497 | Bacteria | 3411 |
| 780 | Ga0182008_10096215 | 3300014497 | Bacteria | 1461 |
| 781 | Ga0182008_10136468 | 3300014497 | Bacteria | 1225 |
| 782 | Ga0182008_10383655 | 3300014497 | Bacteria | 751 |
| 783 | Ga0157377_10000170 | 3300014745 | Bacteria | 38897 |
| 784 | Ga0157377_10043830 | 3300014745 | Bacteria | 2492 |
| 785 | Ga0157377_10165085 | 3300014745 | Bacteria | 1380 |
| 786 | Ga0157377_10461045 | 3300014745 | Bacteria | 880 |
| 787 | Ga0157379_10006124 | 3300014968 | Bacteria | 10355 |
| 788 | Ga0157379_10018100 | 3300014968 | Bacteria | 6208 |
| 789 | Ga0157379_10039682 | 3300014968 | Bacteria | 4201 |
| 790 | Ga0157379_10082445 | 3300014968 | Bacteria | 2882 |
| 791 | Ga0157379_10724686 | 3300014968 | Bacteria | 935 |
| 792 | Ga0157379_11528669 | 3300014968 | Bacteria | 650 |
| 793 | Ga0157376_10029275 | 3300014969 | Bacteria | 4387 |
| 794 | Ga0157376_10128576 | 3300014969 | Bacteria | 2257 |
| 795 | Ga0157376_10328604 | 3300014969 | Bacteria | 1456 |
| 796 | Ga0157376_10334767 | 3300014969 | Bacteria | 1443 |
| 797 | Ga0157376_10537979 | 3300014969 | Bacteria | 1154 |
| 798 | Ga0157376_10998736 | 3300014969 | Bacteria | 859 |
| 799 | Ga0157376_11986897 | 3300014969 | Bacteria | 619 |
| 800 | Ga0157376_12879482 | 3300014969 | Bacteria | 521 |
| 801 | Ga0157376_12881165 | 3300014969 | Bacteria | 521 |
| 802 | Ga0182006_1051132 | 3300015261 | Bacteria | 1590 |
| 803 | Ga0182006_1121441 | 3300015261 | Bacteria | 907 |
| 804 | Ga0182006_1179085 | 3300015261 | Bacteria | 707 |
| 805 | Ga0182006_1273992 | 3300015261 | Bacteria | 553 |
| 806 | Ga0182007_10002567 | 3300015262 | Bacteria | 8943 |
| 807 | Ga0182005_1017803 | 3300015265 | Bacteria | 1966 |
| 808 | Ga0182005_1033460 | 3300015265 | Bacteria | 1398 |
| 809 | Ga0182005_1120196 | 3300015265 | Bacteria | 747 |
| 810 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 811 | Ga0163161_10017494 | 3300017792 | Bacteria | 5016 |
| 812 | Ga0163161_10144969 | 3300017792 | Bacteria | 1800 |
| 813 | Ga0163161_10255007 | 3300017792 | Bacteria | 1368 |
| 814 | Ga0163161_10325350 | 3300017792 | Bacteria | 1216 |
| 815 | Ga0163161_10401696 | 3300017792 | Bacteria | 1099 |
| 816 | Ga0163161_10443080 | 3300017792 | Bacteria | 1048 |
| 817 | Ga0163161_10999557 | 3300017792 | Bacteria | 714 |
| 818 | Ga0163161_11013310 | 3300017792 | Bacteria | 709 |
| 819 | Ga0163161_11119543 | 3300017792 | Bacteria | 677 |
| 820 | Ga0163161_11681147 | 3300017792 | Bacteria | 562 |
| 821 | Ga0163161_11761836 | 3300017792 | Bacteria | 550 |
| 822 | Ga0206353_11880330 | 3300020082 | Bacteria | 609 |
| 823 | Ga0213876_10076899 | 3300021384 | Bacteria | 1763 |
| 824 | Ga0213876_10358837 | 3300021384 | Bacteria | 775 |
| 825 | Ga0209436_102722 | 3300025208 | Bacteria | 5093 |
| 826 | Ga0209436_113640 | 3300025208 | Bacteria | 1320 |
| 827 | Ga0209672_102060 | 3300025228 | Bacteria | 5470 |
| 828 | Ga0209147_101677 | 3300025229 | Bacteria | 7269 |
| 829 | Ga0209258_100078 | 3300025242 | Bacteria | 263996 |
| 830 | Ga0207425_1000726 | 3300025245 | Bacteria | 17525 |
| 831 | Ga0207425_1000881 | 3300025245 | Bacteria | 14608 |
| 832 | Ga0207425_1002203 | 3300025245 | Bacteria | 7090 |
| 833 | Ga0209148_1000086 | 3300025254 | Bacteria | 263996 |
| 834 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 835 | Ga0209129_1000054 | 3300025258 | Bacteria | 261997 |
| 836 | Ga0209565_1000317 | 3300025263 | Bacteria | 44071 |
| 837 | Ga0209565_1001263 | 3300025263 | Bacteria | 11754 |
| 838 | Ga0209565_1015434 | 3300025263 | Bacteria | 1723 |
| 839 | Ga0207666_1004468 | 3300025271 | Bacteria | 1758 |
| 840 | Ga0209673_1000168 | 3300025273 | Bacteria | 135126 |
| 841 | Ga0209673_1000355 | 3300025273 | Bacteria | 83197 |
| 842 | Ga0209673_1005247 | 3300025273 | Bacteria | 6592 |
| 843 | Ga0209673_1038095 | 3300025273 | Bacteria | 1404 |
| 844 | Ga0209130_1000206 | 3300025284 | Bacteria | 79198 |
| 845 | Ga0209130_1001172 | 3300025284 | Bacteria | 18829 |
| 846 | Ga0209130_1035061 | 3300025284 | Bacteria | 1005 |
| 847 | Ga0207673_1007194 | 3300025290 | Bacteria | 1391 |
| 848 | Ga0207673_1042741 | 3300025290 | Bacteria | 637 |
| 849 | Ga0209675_1000388 | 3300025291 | Bacteria | 36674 |
| 850 | Ga0209675_1002561 | 3300025291 | Bacteria | 9228 |
| 851 | Ga0209675_1004338 | 3300025291 | Bacteria | 6351 |
| 852 | Ga0209675_1013516 | 3300025291 | Bacteria | 2545 |
| 853 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 854 | Ga0209676_1000290 | 3300025292 | Bacteria | 103000 |
| 855 | Ga0209676_1005377 | 3300025292 | Bacteria | 6722 |
| 856 | Ga0209025_1000201 | 3300025294 | Bacteria | 145890 |
| 857 | Ga0209025_1019038 | 3300025294 | Bacteria | 3842 |
| 858 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 859 | Ga0209564_1000289 | 3300025295 | Bacteria | 101976 |
| 860 | Ga0209564_1000408 | 3300025295 | Bacteria | 76528 |
| 861 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 862 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 863 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 864 | Ga0209758_1005547 | 3300025297 | Bacteria | 9627 |
| 865 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 866 | Ga0209050_1000416 | 3300025298 | Bacteria | 78976 |
| 867 | Ga0209050_1001233 | 3300025298 | Bacteria | 29602 |
| 868 | Ga0209050_1005046 | 3300025298 | Bacteria | 8546 |
| 869 | Ga0209050_1008921 | 3300025298 | Bacteria | 5239 |
| 870 | Ga0209050_1052859 | 3300025298 | Bacteria | 1014 |
| 871 | Ga0209256_1000066 | 3300025299 | Bacteria | 247534 |
| 872 | Ga0209256_1000092 | 3300025299 | Bacteria | 210547 |
| 873 | Ga0209256_1001887 | 3300025299 | Bacteria | 19263 |
| 874 | Ga0209256_1022736 | 3300025299 | Bacteria | 1891 |
| 875 | Ga0209256_1036914 | 3300025299 | Bacteria | 1278 |
| 876 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 877 | Ga0207426_1000266 | 3300025302 | Bacteria | 109895 |
| 878 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 879 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 880 | Ga0209051_1000141 | 3300025303 | Bacteria | 135837 |
| 881 | Ga0209051_1000235 | 3300025303 | Bacteria | 92799 |
| 882 | Ga0209051_1007019 | 3300025303 | Bacteria | 6238 |
| 883 | Ga0209051_1054597 | 3300025303 | Bacteria | 1302 |
| 884 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 885 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 886 | Ga0209257_1002015 | 3300025304 | Bacteria | 21717 |
| 887 | Ga0209257_1014801 | 3300025304 | Bacteria | 3312 |
| 888 | Ga0209257_1028057 | 3300025304 | Bacteria | 1860 |
| 889 | Ga0209257_1110720 | 3300025304 | Bacteria | 655 |
| 890 | Ga0207697_10046050 | 3300025315 | Bacteria | 1796 |
| 891 | Ga0207697_10146000 | 3300025315 | Bacteria | 1028 |
| 892 | Ga0207697_10350704 | 3300025315 | Bacteria | 655 |
| 893 | Ga0207697_10418582 | 3300025315 | Bacteria | 595 |
| 894 | Ga0207656_10019106 | 3300025321 | Bacteria | 2708 |
| 895 | Ga0207656_10054086 | 3300025321 | Bacteria | 1744 |
| 896 | Ga0207656_10071784 | 3300025321 | Bacteria | 1540 |
| 897 | Ga0207656_10078424 | 3300025321 | Bacteria | 1480 |
| 898 | Ga0207656_10093435 | 3300025321 | Bacteria | 1369 |
| 899 | Ga0207656_10302931 | 3300025321 | Bacteria | 791 |
| 900 | Ga0207656_10410776 | 3300025321 | Bacteria | 681 |
| 901 | Ga0207656_10415708 | 3300025321 | Bacteria | 677 |
| 902 | Ga0207682_10002310 | 3300025893 | Bacteria | 8592 |
| 903 | Ga0207682_10008487 | 3300025893 | Bacteria | 4061 |
| 904 | Ga0207682_10026248 | 3300025893 | Bacteria | 2315 |
| 905 | Ga0207682_10120596 | 3300025893 | Bacteria | 1163 |
| 906 | Ga0207682_10200063 | 3300025893 | Bacteria | 918 |
| 907 | Ga0207682_10397213 | 3300025893 | Bacteria | 651 |
| 908 | Ga0207682_10616884 | 3300025893 | Bacteria | 511 |
| 909 | Ga0207692_10443623 | 3300025898 | Bacteria | 816 |
| 910 | Ga0207642_10006194 | 3300025899 | Bacteria | 3963 |
| 911 | Ga0207642_10008862 | 3300025899 | Bacteria | 3476 |
| 912 | Ga0207642_10210723 | 3300025899 | Bacteria | 1079 |
| 913 | Ga0207710_10236509 | 3300025900 | Bacteria | 910 |
| 914 | Ga0207688_10009912 | 3300025901 | Bacteria | 5186 |
| 915 | Ga0207688_10264029 | 3300025901 | Bacteria | 1046 |
| 916 | Ga0207688_10279028 | 3300025901 | Bacteria | 1018 |
| 917 | Ga0207680_10002216 | 3300025903 | Bacteria | 9082 |
| 918 | Ga0207680_10002264 | 3300025903 | Bacteria | 8971 |
| 919 | Ga0207680_10270354 | 3300025903 | Bacteria | 1179 |
| 920 | Ga0207680_10358265 | 3300025903 | Bacteria | 1025 |
| 921 | Ga0207680_10474754 | 3300025903 | Bacteria | 889 |
| 922 | Ga0207680_10895762 | 3300025903 | Bacteria | 636 |
| 923 | Ga0207680_10945479 | 3300025903 | Bacteria | 618 |
| 924 | Ga0207647_10221382 | 3300025904 | Bacteria | 1091 |
| 925 | Ga0207685_10025303 | 3300025905 | Bacteria | 2047 |
| 926 | Ga0207645_10003401 | 3300025907 | Bacteria | 12101 |
| 927 | Ga0207645_10026486 | 3300025907 | Bacteria | 3746 |
| 928 | Ga0207645_10046517 | 3300025907 | Bacteria | 2772 |
| 929 | Ga0207645_10102536 | 3300025907 | Bacteria | 1847 |
| 930 | Ga0207645_10207117 | 3300025907 | Bacteria | 1291 |
| 931 | Ga0207645_10231411 | 3300025907 | Bacteria | 1220 |
| 932 | Ga0207645_10313915 | 3300025907 | Bacteria | 1045 |
| 933 | Ga0207643_10062542 | 3300025908 | Bacteria | 2127 |
| 934 | Ga0207643_10173555 | 3300025908 | Bacteria | 1302 |
| 935 | Ga0207643_10379750 | 3300025908 | Bacteria | 891 |
| 936 | Ga0207643_10581104 | 3300025908 | Bacteria | 720 |
| 937 | Ga0207643_10883314 | 3300025908 | Bacteria | 579 |
| 938 | Ga0207705_10033984 | 3300025909 | Bacteria | 3645 |
| 939 | Ga0207705_10276873 | 3300025909 | Bacteria | 1284 |
| 940 | Ga0207705_10609256 | 3300025909 | Bacteria | 849 |
| 941 | Ga0207705_10673759 | 3300025909 | Bacteria | 804 |
| 942 | Ga0207705_11448229 | 3300025909 | Bacteria | 521 |
| 943 | Ga0207684_10005949 | 3300025910 | Bacteria | 11169 |
| 944 | Ga0207684_10071919 | 3300025910 | Bacteria | 2938 |
| 945 | Ga0207654_10082391 | 3300025911 | Bacteria | 1940 |
| 946 | Ga0207654_10736192 | 3300025911 | Bacteria | 710 |
| 947 | Ga0207707_10174846 | 3300025912 | Bacteria | 1876 |
| 948 | Ga0207707_10425784 | 3300025912 | Bacteria | 1137 |
| 949 | Ga0207695_10002543 | 3300025913 | Bacteria | 26790 |
| 950 | Ga0207695_10032900 | 3300025913 | Bacteria | 5667 |
| 951 | Ga0207695_10061905 | 3300025913 | Bacteria | 3866 |
| 952 | Ga0207695_10088943 | 3300025913 | Bacteria | 3107 |
| 953 | Ga0207695_10218048 | 3300025913 | Bacteria | 1816 |
| 954 | Ga0207695_10638987 | 3300025913 | Bacteria | 945 |
| 955 | Ga0207671_10006429 | 3300025914 | Bacteria | 10462 |
| 956 | Ga0207671_10010328 | 3300025914 | Bacteria | 7713 |
| 957 | Ga0207671_10022402 | 3300025914 | Bacteria | 4778 |
| 958 | Ga0207671_10035144 | 3300025914 | Bacteria | 3721 |
| 959 | Ga0207671_10499298 | 3300025914 | Bacteria | 970 |
| 960 | Ga0207671_10610822 | 3300025914 | Bacteria | 869 |
| 961 | Ga0207671_10997043 | 3300025914 | Bacteria | 660 |
| 962 | Ga0207660_10141322 | 3300025917 | Bacteria | 1841 |
| 963 | Ga0207660_10458070 | 3300025917 | Bacteria | 1032 |
| 964 | Ga0207662_10052728 | 3300025918 | Bacteria | 2421 |
| 965 | Ga0207662_10434229 | 3300025918 | Bacteria | 896 |
| 966 | Ga0207662_10449027 | 3300025918 | Bacteria | 881 |
| 967 | Ga0207662_11227200 | 3300025918 | Bacteria | 533 |
| 968 | Ga0207657_10002308 | 3300025919 | Bacteria | 20679 |
| 969 | Ga0207657_10015804 | 3300025919 | Bacteria | 7296 |
| 970 | Ga0207657_10224482 | 3300025919 | Bacteria | 1504 |
| 971 | Ga0207657_11352505 | 3300025919 | Bacteria | 536 |
| 972 | Ga0207649_10012057 | 3300025920 | Bacteria | 4783 |
| 973 | Ga0207649_10019732 | 3300025920 | Bacteria | 3858 |
| 974 | Ga0207649_10626611 | 3300025920 | Bacteria | 829 |
| 975 | Ga0207649_10715711 | 3300025920 | Bacteria | 777 |
| 976 | Ga0207652_10081244 | 3300025921 | Bacteria | 2835 |
| 977 | Ga0207652_10197585 | 3300025921 | Bacteria | 1810 |
| 978 | Ga0207652_10446683 | 3300025921 | Bacteria | 1166 |
| 979 | Ga0207646_10033392 | 3300025922 | Bacteria | 4656 |
| 980 | Ga0207681_10000795 | 3300025923 | Bacteria | 20798 |
| 981 | Ga0207681_10017788 | 3300025923 | Bacteria | 4469 |
| 982 | Ga0207681_10084282 | 3300025923 | Bacteria | 2252 |
| 983 | Ga0207681_10084985 | 3300025923 | Bacteria | 2244 |
| 984 | Ga0207681_10098706 | 3300025923 | Bacteria | 2101 |
| 985 | Ga0207681_10527279 | 3300025923 | Bacteria | 970 |
| 986 | Ga0207681_10586239 | 3300025923 | Bacteria | 920 |
| 987 | Ga0207694_10004060 | 3300025924 | Bacteria | 11503 |
| 988 | Ga0207694_10029043 | 3300025924 | Bacteria | 4217 |
| 989 | Ga0207694_10213474 | 3300025924 | Bacteria | 1572 |
| 990 | Ga0207694_10336316 | 3300025924 | Bacteria | 1248 |
| 991 | Ga0207694_10357825 | 3300025924 | Bacteria | 1209 |
| 992 | Ga0207694_10446452 | 3300025924 | Bacteria | 1079 |
| 993 | Ga0207650_10002550 | 3300025925 | Bacteria | 12629 |
| 994 | Ga0207650_10004501 | 3300025925 | Bacteria | 9532 |
| 995 | Ga0207650_10014903 | 3300025925 | Bacteria | 5408 |
| 996 | Ga0207650_10131086 | 3300025925 | Bacteria | 1961 |
| 997 | Ga0207650_10209144 | 3300025925 | Bacteria | 1566 |
| 998 | Ga0207650_10373972 | 3300025925 | Bacteria | 1176 |
| 999 | Ga0207650_10410273 | 3300025925 | Bacteria | 1122 |
| 1000 | Ga0207650_11159414 | 3300025925 | Bacteria | 658 |
| 1001 | Ga0207650_11297563 | 3300025925 | Bacteria | 620 |
| 1002 | Ga0207659_10013398 | 3300025926 | Bacteria | 5249 |
| 1003 | Ga0207659_10020083 | 3300025926 | Bacteria | 4408 |
| 1004 | Ga0207659_10032887 | 3300025926 | Bacteria | 3563 |
| 1005 | Ga0207659_10037282 | 3300025926 | Bacteria | 3374 |
| 1006 | Ga0207659_10201000 | 3300025926 | Bacteria | 1592 |
| 1007 | Ga0207659_10228388 | 3300025926 | Bacteria | 1500 |
| 1008 | Ga0207659_10344347 | 3300025926 | Bacteria | 1235 |
| 1009 | Ga0207659_10657623 | 3300025926 | Bacteria | 896 |
| 1010 | Ga0207659_10917374 | 3300025926 | Bacteria | 753 |
| 1011 | Ga0207659_10982537 | 3300025926 | Bacteria | 726 |
| 1012 | Ga0207659_11119751 | 3300025926 | Bacteria | 677 |
| 1013 | Ga0207687_11076475 | 3300025927 | Bacteria | 690 |
| 1014 | Ga0207687_11099818 | 3300025927 | Bacteria | 683 |
| 1015 | Ga0207664_10025828 | 3300025929 | Bacteria | 4431 |
| 1016 | Ga0207644_10002048 | 3300025931 | Bacteria | 13051 |
| 1017 | Ga0207644_10002949 | 3300025931 | Bacteria | 10959 |
| 1018 | Ga0207644_10348255 | 3300025931 | Bacteria | 1202 |
| 1019 | Ga0207644_10530117 | 3300025931 | Bacteria | 973 |
| 1020 | Ga0207644_11180534 | 3300025931 | Bacteria | 643 |
| 1021 | Ga0207644_11460616 | 3300025931 | Bacteria | 574 |
| 1022 | Ga0207644_11659747 | 3300025931 | Bacteria | 536 |
| 1023 | Ga0207690_10005174 | 3300025932 | Bacteria | 7694 |
| 1024 | Ga0207690_10028785 | 3300025932 | Bacteria | 3524 |
| 1025 | Ga0207690_10219101 | 3300025932 | Bacteria | 1455 |
| 1026 | Ga0207690_11282417 | 3300025932 | Bacteria | 612 |
| 1027 | Ga0207690_11301379 | 3300025932 | Bacteria | 607 |
| 1028 | Ga0207690_11627988 | 3300025932 | Bacteria | 539 |
| 1029 | Ga0207706_10014450 | 3300025933 | Bacteria | 7156 |
| 1030 | Ga0207706_10032604 | 3300025933 | Bacteria | 4639 |
| 1031 | Ga0207706_10208896 | 3300025933 | Bacteria | 1711 |
| 1032 | Ga0207706_10265450 | 3300025933 | Bacteria | 1498 |
| 1033 | Ga0207706_10445308 | 3300025933 | Bacteria | 1121 |
| 1034 | Ga0207706_10474106 | 3300025933 | Bacteria | 1082 |
| 1035 | Ga0207706_10616074 | 3300025933 | Bacteria | 931 |
| 1036 | Ga0207706_10761981 | 3300025933 | Bacteria | 824 |
| 1037 | Ga0207706_10886243 | 3300025933 | Bacteria | 754 |
| 1038 | Ga0207706_11121191 | 3300025933 | Bacteria | 657 |
| 1039 | Ga0207686_10046095 | 3300025934 | Bacteria | 2687 |
| 1040 | Ga0207686_10047390 | 3300025934 | Bacteria | 2657 |
| 1041 | Ga0207686_10131449 | 3300025934 | Bacteria | 1717 |
| 1042 | Ga0207686_10249615 | 3300025934 | Bacteria | 1296 |
| 1043 | Ga0207686_10289968 | 3300025934 | Bacteria | 1211 |
| 1044 | Ga0207709_10000383 | 3300025935 | Bacteria | 43985 |
| 1045 | Ga0207709_10001296 | 3300025935 | Bacteria | 17820 |
| 1046 | Ga0207709_10030033 | 3300025935 | Bacteria | 3158 |
| 1047 | Ga0207709_10858658 | 3300025935 | Bacteria | 736 |
| 1048 | Ga0207709_10929598 | 3300025935 | Bacteria | 708 |
| 1049 | Ga0207709_11292534 | 3300025935 | Bacteria | 603 |
| 1050 | Ga0207670_10030732 | 3300025936 | Bacteria | 3433 |
| 1051 | Ga0207670_10933017 | 3300025936 | Bacteria | 728 |
| 1052 | Ga0207669_10041654 | 3300025937 | Bacteria | 2675 |
| 1053 | Ga0207669_10935431 | 3300025937 | Bacteria | 726 |
| 1054 | Ga0207669_11398536 | 3300025937 | Bacteria | 596 |
| 1055 | Ga0207669_11432381 | 3300025937 | Bacteria | 588 |
| 1056 | Ga0207669_11727593 | 3300025937 | Bacteria | 534 |
| 1057 | Ga0207704_10243329 | 3300025938 | Bacteria | 1346 |
| 1058 | Ga0207704_10330831 | 3300025938 | Bacteria | 1179 |
| 1059 | Ga0207704_10860243 | 3300025938 | Bacteria | 760 |
| 1060 | Ga0207704_11003114 | 3300025938 | Bacteria | 706 |
| 1061 | Ga0207704_11184036 | 3300025938 | Bacteria | 651 |
| 1062 | Ga0207665_10109570 | 3300025939 | Bacteria | 1938 |
| 1063 | Ga0207691_10005390 | 3300025940 | Bacteria | 12350 |
| 1064 | Ga0207691_10007761 | 3300025940 | Bacteria | 10333 |
| 1065 | Ga0207691_10012093 | 3300025940 | Bacteria | 8276 |
| 1066 | Ga0207691_10026402 | 3300025940 | Bacteria | 5449 |
| 1067 | Ga0207691_10057886 | 3300025940 | Bacteria | 3526 |
| 1068 | Ga0207691_10058275 | 3300025940 | Bacteria | 3513 |
| 1069 | Ga0207691_10109518 | 3300025940 | Bacteria | 2457 |
| 1070 | Ga0207691_10131930 | 3300025940 | Bacteria | 2206 |
| 1071 | Ga0207691_10219778 | 3300025940 | Bacteria | 1648 |
| 1072 | Ga0207691_10261767 | 3300025940 | Bacteria | 1491 |
| 1073 | Ga0207691_10418523 | 3300025940 | Bacteria | 1142 |
| 1074 | Ga0207691_10538352 | 3300025940 | Bacteria | 991 |
| 1075 | Ga0207691_10713981 | 3300025940 | Bacteria | 845 |
| 1076 | Ga0207711_10012457 | 3300025941 | Bacteria | 7068 |
| 1077 | Ga0207711_10067509 | 3300025941 | Bacteria | 3096 |
| 1078 | Ga0207711_10126201 | 3300025941 | Bacteria | 2289 |
| 1079 | Ga0207711_10481256 | 3300025941 | Bacteria | 1156 |
| 1080 | Ga0207711_10849956 | 3300025941 | Bacteria | 849 |
| 1081 | Ga0207711_10968069 | 3300025941 | Bacteria | 790 |
| 1082 | Ga0207711_11137038 | 3300025941 | Bacteria | 722 |
| 1083 | Ga0207711_11974308 | 3300025941 | Bacteria | 526 |
| 1084 | Ga0207689_10003512 | 3300025942 | Bacteria | 14319 |
| 1085 | Ga0207689_10004908 | 3300025942 | Bacteria | 12049 |
| 1086 | Ga0207689_10050658 | 3300025942 | Bacteria | 3423 |
| 1087 | Ga0207689_10075589 | 3300025942 | Bacteria | 2769 |
| 1088 | Ga0207689_10102173 | 3300025942 | Bacteria | 2355 |
| 1089 | Ga0207689_10404359 | 3300025942 | Bacteria | 1138 |
| 1090 | Ga0207689_11273389 | 3300025942 | Bacteria | 618 |
| 1091 | Ga0207661_10191726 | 3300025944 | Bacteria | 1792 |
| 1092 | Ga0207679_10004109 | 3300025945 | Bacteria | 9035 |
| 1093 | Ga0207679_10011721 | 3300025945 | Bacteria | 5692 |
| 1094 | Ga0207679_10014481 | 3300025945 | Bacteria | 5189 |
| 1095 | Ga0207679_10053631 | 3300025945 | Bacteria | 2964 |
| 1096 | Ga0207679_10061091 | 3300025945 | Bacteria | 2804 |
| 1097 | Ga0207679_10417878 | 3300025945 | Bacteria | 1183 |
| 1098 | Ga0207679_10613967 | 3300025945 | Bacteria | 981 |
| 1099 | Ga0207679_10749071 | 3300025945 | Bacteria | 888 |
| 1100 | Ga0207679_11674927 | 3300025945 | Bacteria | 582 |
| 1101 | Ga0207667_10002655 | 3300025949 | Bacteria | 22096 |
| 1102 | Ga0207667_10009860 | 3300025949 | Bacteria | 11213 |
| 1103 | Ga0207667_10214430 | 3300025949 | Bacteria | 1973 |
| 1104 | Ga0207667_10586071 | 3300025949 | Bacteria | 1125 |
| 1105 | Ga0207651_10025563 | 3300025960 | Bacteria | 3672 |
| 1106 | Ga0207651_10060152 | 3300025960 | Bacteria | 2635 |
| 1107 | Ga0207651_10093139 | 3300025960 | Bacteria | 2212 |
| 1108 | Ga0207651_10541167 | 3300025960 | Bacteria | 1011 |
| 1109 | Ga0207651_10622978 | 3300025960 | Bacteria | 945 |
| 1110 | Ga0207651_10722735 | 3300025960 | Bacteria | 879 |
| 1111 | Ga0207651_11591610 | 3300025960 | Bacteria | 588 |
| 1112 | Ga0207651_11774164 | 3300025960 | Bacteria | 555 |
| 1113 | Ga0207712_10054882 | 3300025961 | Bacteria | 2800 |
| 1114 | Ga0207712_10598083 | 3300025961 | Bacteria | 954 |
| 1115 | Ga0207712_10600466 | 3300025961 | Bacteria | 952 |
| 1116 | Ga0207712_10939869 | 3300025961 | Bacteria | 765 |
| 1117 | Ga0207668_10017712 | 3300025972 | Bacteria | 4469 |
| 1118 | Ga0207668_10633512 | 3300025972 | Bacteria | 934 |
| 1119 | Ga0207668_10907040 | 3300025972 | Bacteria | 784 |
| 1120 | Ga0207668_11450775 | 3300025972 | Bacteria | 619 |
| 1121 | Ga0207640_10025789 | 3300025981 | Bacteria | 3562 |
| 1122 | Ga0207640_10140289 | 3300025981 | Bacteria | 1761 |
| 1123 | Ga0207640_10229824 | 3300025981 | Bacteria | 1426 |
| 1124 | Ga0207640_10449149 | 3300025981 | Bacteria | 1062 |
| 1125 | Ga0207640_10487586 | 3300025981 | Bacteria | 1024 |
| 1126 | Ga0207640_10500017 | 3300025981 | Bacteria | 1012 |
| 1127 | Ga0207640_10545529 | 3300025981 | Bacteria | 973 |
| 1128 | Ga0207640_10711722 | 3300025981 | Bacteria | 862 |
| 1129 | Ga0207658_10001151 | 3300025986 | Bacteria | 21193 |
| 1130 | Ga0207658_10005593 | 3300025986 | Bacteria | 8597 |
| 1131 | Ga0207658_10114940 | 3300025986 | Bacteria | 2135 |
| 1132 | Ga0207658_10146914 | 3300025986 | Bacteria | 1916 |
| 1133 | Ga0207658_10146925 | 3300025986 | Bacteria | 1916 |
| 1134 | Ga0207658_10171038 | 3300025986 | Bacteria | 1790 |
| 1135 | Ga0207658_10360032 | 3300025986 | Bacteria | 1269 |
| 1136 | Ga0207658_10671075 | 3300025986 | Bacteria | 935 |
| 1137 | Ga0207658_10965157 | 3300025986 | Bacteria | 777 |
| 1138 | Ga0207658_11447551 | 3300025986 | Bacteria | 628 |
| 1139 | Ga0207677_10000452 | 3300026023 | Bacteria | 27626 |
| 1140 | Ga0207677_10037654 | 3300026023 | Bacteria | 3163 |
| 1141 | Ga0207677_10381138 | 3300026023 | Bacteria | 1190 |
| 1142 | Ga0207677_10482308 | 3300026023 | Bacteria | 1068 |
| 1143 | Ga0207677_10932485 | 3300026023 | Bacteria | 784 |
| 1144 | Ga0207677_12038880 | 3300026023 | Bacteria | 533 |
| 1145 | Ga0207703_10003262 | 3300026035 | Bacteria | 13624 |
| 1146 | Ga0207703_10007044 | 3300026035 | Bacteria | 8945 |
| 1147 | Ga0207703_10121427 | 3300026035 | Bacteria | 2243 |
| 1148 | Ga0207703_10413074 | 3300026035 | Bacteria | 1254 |
| 1149 | Ga0207639_10005439 | 3300026041 | Bacteria | 8600 |
| 1150 | Ga0207639_10025544 | 3300026041 | Bacteria | 4283 |
| 1151 | Ga0207639_10117049 | 3300026041 | Bacteria | 2183 |
| 1152 | Ga0207639_10190198 | 3300026041 | Bacteria | 1753 |
| 1153 | Ga0207639_10248274 | 3300026041 | Bacteria | 1551 |
| 1154 | Ga0207639_10354566 | 3300026041 | Bacteria | 1311 |
| 1155 | Ga0207639_10634407 | 3300026041 | Bacteria | 987 |
| 1156 | Ga0207639_11608274 | 3300026041 | Bacteria | 609 |
| 1157 | Ga0207639_12256148 | 3300026041 | Bacteria | 506 |
| 1158 | Ga0207678_10002363 | 3300026067 | Bacteria | 17106 |
| 1159 | Ga0207678_10098740 | 3300026067 | Bacteria | 2494 |
| 1160 | Ga0207678_10305127 | 3300026067 | Bacteria | 1368 |
| 1161 | Ga0207678_10831301 | 3300026067 | Bacteria | 816 |
| 1162 | Ga0207678_10968874 | 3300026067 | Bacteria | 753 |
| 1163 | Ga0207678_11193875 | 3300026067 | Bacteria | 674 |
| 1164 | Ga0207708_10064706 | 3300026075 | Bacteria | 2794 |
| 1165 | Ga0207708_10458336 | 3300026075 | Bacteria | 1063 |
| 1166 | Ga0207702_10044080 | 3300026078 | Bacteria | 3748 |
| 1167 | Ga0207702_10182928 | 3300026078 | Bacteria | 1931 |
| 1168 | Ga0207702_10578685 | 3300026078 | Bacteria | 1100 |
| 1169 | Ga0207702_12211938 | 3300026078 | Bacteria | 539 |
| 1170 | Ga0207641_10013179 | 3300026088 | Bacteria | 6778 |
| 1171 | Ga0207641_10026325 | 3300026088 | Bacteria | 4799 |
| 1172 | Ga0207641_10038644 | 3300026088 | Bacteria | 3990 |
| 1173 | Ga0207641_10167453 | 3300026088 | Bacteria | 2003 |
| 1174 | Ga0207641_10429589 | 3300026088 | Bacteria | 1273 |
| 1175 | Ga0207641_10494108 | 3300026088 | Bacteria | 1187 |
| 1176 | Ga0207641_11613931 | 3300026088 | Bacteria | 650 |
| 1177 | Ga0207648_10000748 | 3300026089 | Bacteria | 36506 |
| 1178 | Ga0207648_10004891 | 3300026089 | Bacteria | 13654 |
| 1179 | Ga0207648_10009156 | 3300026089 | Bacteria | 9513 |
| 1180 | Ga0207648_10015290 | 3300026089 | Bacteria | 7061 |
| 1181 | Ga0207648_10018447 | 3300026089 | Bacteria | 6317 |
| 1182 | Ga0207648_10153113 | 3300026089 | Bacteria | 2035 |
| 1183 | Ga0207648_10159491 | 3300026089 | Bacteria | 1992 |
| 1184 | Ga0207648_10308103 | 3300026089 | Bacteria | 1421 |
| 1185 | Ga0207648_10503985 | 3300026089 | Bacteria | 1108 |
| 1186 | Ga0207648_10877779 | 3300026089 | Bacteria | 837 |
| 1187 | Ga0207648_10996400 | 3300026089 | Bacteria | 785 |
| 1188 | Ga0207648_11329572 | 3300026089 | Bacteria | 675 |
| 1189 | Ga0207648_11568146 | 3300026089 | Bacteria | 619 |
| 1190 | Ga0207676_10012508 | 3300026095 | Bacteria | 6084 |
| 1191 | Ga0207676_10042218 | 3300026095 | Bacteria | 3506 |
| 1192 | Ga0207676_10052796 | 3300026095 | Bacteria | 3179 |
| 1193 | Ga0207676_10149898 | 3300026095 | Bacteria | 2007 |
| 1194 | Ga0207676_10163884 | 3300026095 | Bacteria | 1929 |
| 1195 | Ga0207676_10873679 | 3300026095 | Bacteria | 880 |
| 1196 | Ga0207676_12560108 | 3300026095 | Bacteria | 507 |
| 1197 | Ga0207674_10000040 | 3300026116 | Bacteria | 130571 |
| 1198 | Ga0207674_10009428 | 3300026116 | Bacteria | 11151 |
| 1199 | Ga0207674_10078389 | 3300026116 | Bacteria | 3309 |
| 1200 | Ga0207674_10082081 | 3300026116 | Bacteria | 3225 |
| 1201 | Ga0207674_10253170 | 3300026116 | Bacteria | 1708 |
| 1202 | Ga0207674_10773161 | 3300026116 | Bacteria | 927 |
| 1203 | Ga0207674_10871479 | 3300026116 | Bacteria | 868 |
| 1204 | Ga0207674_11484866 | 3300026116 | Bacteria | 647 |
| 1205 | Ga0207674_11607913 | 3300026116 | Bacteria | 618 |
| 1206 | Ga0207675_100003386 | 3300026118 | Bacteria | 15580 |
| 1207 | Ga0207675_100005550 | 3300026118 | Bacteria | 12070 |
| 1208 | Ga0207675_100059119 | 3300026118 | Bacteria | 3577 |
| 1209 | Ga0207675_100100746 | 3300026118 | Bacteria | 2721 |
| 1210 | Ga0207675_100731231 | 3300026118 | Bacteria | 1000 |
| 1211 | Ga0207675_100812892 | 3300026118 | Bacteria | 948 |
| 1212 | Ga0207683_10008569 | 3300026121 | Bacteria | 8752 |
| 1213 | Ga0207683_10037960 | 3300026121 | Bacteria | 4195 |
| 1214 | Ga0207683_10064870 | 3300026121 | Bacteria | 3219 |
| 1215 | Ga0207683_10089863 | 3300026121 | Bacteria | 2734 |
| 1216 | Ga0207683_10116457 | 3300026121 | Bacteria | 2396 |
| 1217 | Ga0207683_10145705 | 3300026121 | Bacteria | 2135 |
| 1218 | Ga0207683_10278749 | 3300026121 | Bacteria | 1528 |
| 1219 | Ga0207683_10307655 | 3300026121 | Bacteria | 1450 |
| 1220 | Ga0207683_10410972 | 3300026121 | Bacteria | 1246 |
| 1221 | Ga0207683_10548197 | 3300026121 | Bacteria | 1069 |
| 1222 | Ga0207683_10574489 | 3300026121 | Bacteria | 1043 |
| 1223 | Ga0207683_10632075 | 3300026121 | Bacteria | 991 |
| 1224 | Ga0207683_11151674 | 3300026121 | Bacteria | 719 |
| 1225 | Ga0207683_12101076 | 3300026121 | Bacteria | 513 |
| 1226 | Ga0207698_10005011 | 3300026142 | Bacteria | 8123 |
| 1227 | Ga0207698_10011131 | 3300026142 | Bacteria | 5817 |
| 1228 | Ga0207698_10115704 | 3300026142 | Bacteria | 2258 |
| 1229 | Ga0207698_10445721 | 3300026142 | Bacteria | 1248 |
| 1230 | Ga0207698_10672177 | 3300026142 | Bacteria | 1028 |
| 1231 | Ga0207698_10688459 | 3300026142 | Bacteria | 1016 |
| 1232 | Ga0207698_10787371 | 3300026142 | Bacteria | 952 |
| 1233 | Ga0207698_10798694 | 3300026142 | Bacteria | 946 |
| 1234 | Ga0207698_10994822 | 3300026142 | Bacteria | 849 |
| 1235 | Ga0207698_11031752 | 3300026142 | Bacteria | 834 |
| 1236 | Ga0207698_11308235 | 3300026142 | Bacteria | 740 |
| 1237 | Ga0207698_11328955 | 3300026142 | Bacteria | 734 |
| 1238 | Ga0207698_12659290 | 3300026142 | Bacteria | 509 |
| 1239 | Ga0207698_12698549 | 3300026142 | Bacteria | 505 |
| 1240 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 1241 | Ga0209969_1012477 | 3300027360 | Bacteria | 1226 |
| 1242 | Ga0209981_1004500 | 3300027378 | Bacteria | 1831 |
| 1243 | Ga0209996_1002081 | 3300027395 | Bacteria | 2467 |
| 1244 | Ga0209995_1016563 | 3300027471 | Bacteria | 1211 |
| 1245 | Ga0209995_1064430 | 3300027471 | Bacteria | 625 |
| 1246 | Ga0209968_1000140 | 3300027526 | Bacteria | 12794 |
| 1247 | Ga0209999_1004899 | 3300027543 | Bacteria | 2407 |
| 1248 | Ga0210002_1106826 | 3300027617 | Bacteria | 508 |
| 1249 | Ga0209966_1000388 | 3300027695 | Bacteria | 13148 |
| 1250 | Ga0209813_10061166 | 3300027866 | Bacteria | 1202 |
| 1251 | Ga0209974_10006661 | 3300027876 | Bacteria | 4017 |
| 1252 | Ga0209974_10034713 | 3300027876 | Bacteria | 1675 |
| 1253 | Ga0209974_10284711 | 3300027876 | Bacteria | 629 |
| 1254 | Ga0207428_10621197 | 3300027907 | Bacteria | 777 |
| 1255 | Ga0207428_10876374 | 3300027907 | Bacteria | 635 |
| 1256 | Ga0268266_10037082 | 3300028379 | Bacteria | 4153 |
| 1257 | Ga0268266_11230998 | 3300028379 | Bacteria | 724 |
| 1258 | Ga0268266_11705868 | 3300028379 | Bacteria | 605 |
| 1259 | Ga0268265_10098075 | 3300028380 | Bacteria | 2359 |
| 1260 | Ga0268265_10121264 | 3300028380 | Bacteria | 2154 |
| 1261 | Ga0268265_10914139 | 3300028380 | Bacteria | 862 |
| 1262 | Ga0268264_10003378 | 3300028381 | Bacteria | 13783 |
| 1263 | Ga0268264_10003920 | 3300028381 | Bacteria | 12743 |
| 1264 | Ga0268264_10141634 | 3300028381 | Bacteria | 2145 |
| 1265 | Ga0268264_10672979 | 3300028381 | Bacteria | 1026 |
| 1266 | Ga0268264_11168625 | 3300028381 | Bacteria | 779 |
| 1267 | Ga0268264_11655308 | 3300028381 | Bacteria | 650 |
| 1268 | Ga0268264_12694867 | 3300028381 | Bacteria | 501 |
| 1269 | Ga0265323_10180575 | 3300028653 | Bacteria | 668 |
| 1270 | Ga0307517_10005592 | 3300028786 | Bacteria | 18878 |
| 1271 | Ga0307517_10193402 | 3300028786 | Bacteria | 1286 |
| 1272 | Ga0307517_10222524 | 3300028786 | Bacteria | 1145 |
| 1273 | Ga0307517_10569249 | 3300028786 | Bacteria | 563 |
| 1274 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 1275 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 1276 | Ga0307515_10000716 | 3300028794 | Bacteria | 76332 |
| 1277 | Ga0307515_10009711 | 3300028794 | Bacteria | 18549 |
| 1278 | Ga0307515_10029175 | 3300028794 | Bacteria | 9340 |
| 1279 | Ga0307515_10069456 | 3300028794 | Bacteria | 4815 |
| 1280 | Ga0307515_10100821 | 3300028794 | Bacteria | 3492 |
| 1281 | Ga0307515_10280252 | 3300028794 | Bacteria | 1375 |
| 1282 | Ga0307515_10524851 | 3300028794 | Bacteria | 794 |
| 1283 | Ga0265324_10000007 | 3300029957 | Bacteria | 264024 |
| 1284 | Ga0307512_10125965 | 3300030522 | Bacteria | 1626 |
| 1285 | Ga0307512_10310690 | 3300030522 | Bacteria | 725 |
| 1286 | Ga0314311_1161279 | 3300030733 | Bacteria | 5559 |
| 1287 | Ga0316179_1013512 | 3300030734 | Bacteria | 6580 |
| 1288 | Ga0316178_1081817 | 3300030735 | Bacteria | 4049 |
| 1289 | Ga0316180_1033826 | 3300030736 | Bacteria | 1837 |
| 1290 | Ga0316183_1096459 | 3300030742 | Bacteria | 1261 |
| 1291 | Ga0316181_1169024 | 3300030744 | Bacteria | 4022 |
| 1292 | Ga0316182_1190268 | 3300030745 | Bacteria | 2981 |
| 1293 | Ga0316182_1435093 | 3300030745 | Bacteria | 562 |
| 1294 | Ga0265328_10004603 | 3300031239 | Bacteria | 5974 |
| 1295 | Ga0265328_10270814 | 3300031239 | Bacteria | 652 |
| 1296 | Ga0265331_10002534 | 3300031250 | Bacteria | 12300 |
| 1297 | Ga0265331_10165768 | 3300031250 | Bacteria | 1000 |
| 1298 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 1299 | Ga0265327_10005919 | 3300031251 | Bacteria | 9987 |
| 1300 | Ga0265327_10256515 | 3300031251 | Bacteria | 777 |
| 1301 | Ga0265316_10000181 | 3300031344 | Bacteria | 71764 |
| 1302 | Ga0265316_10040823 | 3300031344 | Bacteria | 3718 |
| 1303 | Ga0265316_10175648 | 3300031344 | Bacteria | 1596 |
| 1304 | Ga0307513_10020857 | 3300031456 | Bacteria | 7755 |
| 1305 | Ga0307513_10198447 | 3300031456 | Bacteria | 1850 |
| 1306 | Ga0307513_10223635 | 3300031456 | Bacteria | 1701 |
| 1307 | Ga0307513_10336433 | 3300031456 | Bacteria | 1262 |
| 1308 | Ga0307513_10382862 | 3300031456 | Bacteria | 1146 |
| 1309 | Ga0307513_10392021 | 3300031456 | Bacteria | 1125 |
| 1310 | Ga0307513_10757889 | 3300031456 | Bacteria | 676 |
| 1311 | Ga0307509_10047896 | 3300031507 | Bacteria | 4595 |
| 1312 | Ga0307509_10070806 | 3300031507 | Bacteria | 3640 |
| 1313 | Ga0307509_10166102 | 3300031507 | Bacteria | 2095 |
| 1314 | Ga0307509_10255000 | 3300031507 | Bacteria | 1534 |
| 1315 | Ga0307509_10258468 | 3300031507 | Bacteria | 1519 |
| 1316 | Ga0307509_10388258 | 3300031507 | Bacteria | 1107 |
| 1317 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 1318 | Ga0307408_100034418 | 3300031548 | Bacteria | 3549 |
| 1319 | Ga0307408_100045283 | 3300031548 | Bacteria | 3141 |
| 1320 | Ga0307408_100158236 | 3300031548 | Bacteria | 1796 |
| 1321 | Ga0307408_100166791 | 3300031548 | Bacteria | 1755 |
| 1322 | Ga0307408_100202535 | 3300031548 | Bacteria | 1607 |
| 1323 | Ga0307408_100550048 | 3300031548 | Bacteria | 1018 |
| 1324 | Ga0307408_101009952 | 3300031548 | Bacteria | 767 |
| 1325 | Ga0307408_101237660 | 3300031548 | Bacteria | 697 |
| 1326 | Ga0307408_101609315 | 3300031548 | Bacteria | 617 |
| 1327 | Ga0307408_101710987 | 3300031548 | Bacteria | 599 |
| 1328 | Ga0307408_102394828 | 3300031548 | Bacteria | 512 |
| 1329 | Ga0307508_10000016 | 3300031616 | Bacteria | 206976 |
| 1330 | Ga0307508_10001467 | 3300031616 | Bacteria | 26444 |
| 1331 | Ga0307508_10052609 | 3300031616 | Bacteria | 3615 |
| 1332 | Ga0307508_10538212 | 3300031616 | Bacteria | 765 |
| 1333 | Ga0307508_10576065 | 3300031616 | Bacteria | 725 |
| 1334 | Ga0307514_10037190 | 3300031649 | Bacteria | 3862 |
| 1335 | Ga0307514_10375139 | 3300031649 | Bacteria | 742 |
| 1336 | Ga0307516_10004400 | 3300031730 | Bacteria | 17413 |
| 1337 | Ga0307516_10035476 | 3300031730 | Bacteria | 5004 |
| 1338 | Ga0307516_10058975 | 3300031730 | Bacteria | 3734 |
| 1339 | Ga0307516_10128425 | 3300031730 | Bacteria | 2317 |
| 1340 | Ga0307516_10356786 | 3300031730 | Bacteria | 1127 |
| 1341 | Ga0307516_10363028 | 3300031730 | Bacteria | 1112 |
| 1342 | Ga0307516_10453728 | 3300031730 | Bacteria | 938 |
| 1343 | Ga0307405_10021832 | 3300031731 | Bacteria | 3606 |
| 1344 | Ga0307405_10053071 | 3300031731 | Bacteria | 2523 |
| 1345 | Ga0307405_10058871 | 3300031731 | Bacteria | 2419 |
| 1346 | Ga0307405_10190515 | 3300031731 | Bacteria | 1481 |
| 1347 | Ga0307405_10226137 | 3300031731 | Bacteria | 1376 |
| 1348 | Ga0307405_10260018 | 3300031731 | Bacteria | 1296 |
| 1349 | Ga0307405_10894422 | 3300031731 | Bacteria | 750 |
| 1350 | Ga0307405_10996428 | 3300031731 | Bacteria | 715 |
| 1351 | Ga0307405_11040726 | 3300031731 | Bacteria | 700 |
| 1352 | Ga0307405_11075034 | 3300031731 | Bacteria | 690 |
| 1353 | Ga0307405_11313412 | 3300031731 | Bacteria | 630 |
| 1354 | Ga0307405_11440125 | 3300031731 | Bacteria | 603 |
| 1355 | Ga0307405_11608569 | 3300031731 | Bacteria | 573 |
| 1356 | Ga0307413_10199627 | 3300031824 | Bacteria | 1443 |
| 1357 | Ga0307413_11169348 | 3300031824 | Bacteria | 668 |
| 1358 | Ga0307413_12123964 | 3300031824 | Bacteria | 508 |
| 1359 | Ga0307410_10006186 | 3300031852 | Bacteria | 6431 |
| 1360 | Ga0307410_10493002 | 3300031852 | Bacteria | 1007 |
| 1361 | Ga0307410_10699597 | 3300031852 | Bacteria | 854 |
| 1362 | Ga0307410_11238769 | 3300031852 | Bacteria | 651 |
| 1363 | Ga0307406_10009086 | 3300031901 | Bacteria | 5560 |
| 1364 | Ga0307406_10048547 | 3300031901 | Bacteria | 2682 |
| 1365 | Ga0307406_10154488 | 3300031901 | Bacteria | 1641 |
| 1366 | Ga0307406_10424736 | 3300031901 | Bacteria | 1060 |
| 1367 | Ga0307406_10613602 | 3300031901 | Bacteria | 898 |
| 1368 | Ga0307406_10795272 | 3300031901 | Bacteria | 798 |
| 1369 | Ga0307407_10125284 | 3300031903 | Bacteria | 1635 |
| 1370 | Ga0307407_10197530 | 3300031903 | Bacteria | 1345 |
| 1371 | Ga0307407_10237909 | 3300031903 | Bacteria | 1241 |
| 1372 | Ga0307407_10789264 | 3300031903 | Bacteria | 722 |
| 1373 | Ga0307412_10008934 | 3300031911 | Bacteria | 5739 |
| 1374 | Ga0307412_10106523 | 3300031911 | Bacteria | 1993 |
| 1375 | Ga0307412_10152178 | 3300031911 | Bacteria | 1708 |
| 1376 | Ga0307412_10156542 | 3300031911 | Bacteria | 1687 |
| 1377 | Ga0307412_10209380 | 3300031911 | Bacteria | 1486 |
| 1378 | Ga0307412_10427755 | 3300031911 | Bacteria | 1085 |
| 1379 | Ga0307412_10565616 | 3300031911 | Bacteria | 957 |
| 1380 | Ga0307412_10710080 | 3300031911 | Bacteria | 864 |
| 1381 | Ga0307412_10725839 | 3300031911 | Bacteria | 855 |
| 1382 | Ga0307412_11299118 | 3300031911 | Bacteria | 655 |
| 1383 | Ga0307412_11376482 | 3300031911 | Bacteria | 638 |
| 1384 | Ga0307412_11639177 | 3300031911 | Bacteria | 588 |
| 1385 | Ga0307409_100001314 | 3300031995 | Bacteria | 12044 |
| 1386 | Ga0307409_100049671 | 3300031995 | Bacteria | 3200 |
| 1387 | Ga0307409_100065516 | 3300031995 | Bacteria | 2859 |
| 1388 | Ga0307409_101124546 | 3300031995 | Bacteria | 807 |
| 1389 | Ga0307409_101406187 | 3300031995 | Bacteria | 724 |
| 1390 | Ga0307409_101614946 | 3300031995 | Bacteria | 677 |
| 1391 | Ga0307416_100020404 | 3300032002 | Bacteria | 4727 |
| 1392 | Ga0307416_100063772 | 3300032002 | Bacteria | 3019 |
| 1393 | Ga0307416_100071278 | 3300032002 | Bacteria | 2886 |
| 1394 | Ga0307416_100087114 | 3300032002 | Bacteria | 2665 |
| 1395 | Ga0307416_100320417 | 3300032002 | Bacteria | 1552 |
| 1396 | Ga0307416_100345066 | 3300032002 | Bacteria | 1504 |
| 1397 | Ga0307416_100388486 | 3300032002 | Bacteria | 1429 |
| 1398 | Ga0307416_100568835 | 3300032002 | Bacteria | 1209 |
| 1399 | Ga0307416_100997030 | 3300032002 | Bacteria | 940 |
| 1400 | Ga0307416_101441695 | 3300032002 | Bacteria | 794 |
| 1401 | Ga0307416_101727569 | 3300032002 | Bacteria | 730 |
| 1402 | Ga0307416_103778436 | 3300032002 | Bacteria | 507 |
| 1403 | Ga0307414_10057023 | 3300032004 | Bacteria | 2743 |
| 1404 | Ga0307414_10115978 | 3300032004 | Bacteria | 2049 |
| 1405 | Ga0307414_10116063 | 3300032004 | Bacteria | 2049 |
| 1406 | Ga0307414_10149621 | 3300032004 | Bacteria | 1840 |
| 1407 | Ga0307414_10594092 | 3300032004 | Bacteria | 992 |
| 1408 | Ga0307414_10808429 | 3300032004 | Bacteria | 855 |
| 1409 | Ga0307414_10881583 | 3300032004 | Bacteria | 820 |
| 1410 | Ga0307414_11170491 | 3300032004 | Bacteria | 711 |
| 1411 | Ga0307414_12122285 | 3300032004 | Bacteria | 525 |
| 1412 | Ga0307411_10006938 | 3300032005 | Bacteria | 5714 |
| 1413 | Ga0307411_10022274 | 3300032005 | Bacteria | 3726 |
| 1414 | Ga0307411_10239552 | 3300032005 | Bacteria | 1419 |
| 1415 | Ga0307411_10247367 | 3300032005 | Bacteria | 1400 |
| 1416 | Ga0307411_10814359 | 3300032005 | Bacteria | 823 |
| 1417 | Ga0307411_10968779 | 3300032005 | Bacteria | 760 |
| 1418 | Ga0307411_12363398 | 3300032005 | Bacteria | 500 |
| 1419 | Ga0307415_100004417 | 3300032126 | Bacteria | 7292 |
| 1420 | Ga0307415_100124110 | 3300032126 | Bacteria | 1942 |
| 1421 | Ga0307415_100152845 | 3300032126 | Bacteria | 1779 |
| 1422 | Ga0307415_100894793 | 3300032126 | Bacteria | 818 |
| 1423 | Ga0307415_101060223 | 3300032126 | Bacteria | 757 |
| 1424 | Ga0307507_10031462 | 3300033179 | Bacteria | 5570 |
| 1425 | Ga0307507_10055670 | 3300033179 | Bacteria | 3746 |
| 1426 | Ga0307507_10376296 | 3300033179 | Bacteria | 820 |
| 1427 | Ga0307510_10000568 | 3300033180 | Bacteria | 37247 |
| 1428 | Ga0307510_10564632 | 3300033180 | Bacteria | 585 |
| 1429 | Ga0373950_0004635 | 3300034818 | Bacteria | 2022 |
| 1430 | Ga0373958_0028957 | 3300034819 | Bacteria | 1075 |
| 1431 | Ga0373959_0080937 | 3300034820 | Bacteria | 748 |
| 1432 | Ga0373938_0018968 | 3300034957 | Bacteria | 1372 |
| 1433 | Ga0373938_0247902 | 3300034957 | Bacteria | 508 |
| 1434 | Ga0373928_0027809 | 3300035084 | Bacteria | 1233 |
| 1435 | Ga0373928_0114285 | 3300035084 | Bacteria | 717 |
| 1436 | Ga0373940_0035128 | 3300035088 | Bacteria | 1356 |
| 1437 | Ga0373944_0326561 | 3300035089 | Bacteria | 580 |
| 1438 | Ga0373952_0002684 | 3300035092 | Bacteria | 3210 |
| 1439 | Ga0373952_0052535 | 3300035092 | Bacteria | 976 |
| 1440 | Ga0373932_0018539 | 3300035112 | Bacteria | 1801 |
| 1441 | Ga0373932_0030415 | 3300035112 | Bacteria | 1497 |
| 1442 | Ga0373939_0133835 | 3300035114 | Bacteria | 887 |
| 1443 | Ga0373941_0042220 | 3300035115 | Bacteria | 1415 |
| 1444 | Ga0373945_0413159 | 3300035116 | Bacteria | 593 |
| 1445 | Ga0373953_0270922 | 3300035117 | Bacteria | 739 |
| 1446 | Ga0373960_0006818 | 3300035121 | Bacteria | 2690 |
| 1447 | Ga0373946_0179335 | 3300035171 | Bacteria | 1005 |
| 1448 | Ga0373946_0189477 | 3300035171 | Bacteria | 980 |
| 1449 | Ga0373942_0031813 | 3300035207 | Bacteria | 1398 |
| 1450 | Ga0373961_0112681 | 3300035241 | Bacteria | 893 |
| 1451 | Ga0373961_0244560 | 3300035241 | Bacteria | 647 |
| 1452 | Ga0373962_0019072 | 3300035242 | Bacteria | 1791 |
| 1453 | Ga0373962_0040272 | 3300035242 | Bacteria | 1314 |
| 1454 | Ga0373924_0050922 | 3300035410 | Bacteria | 1716 |
| 1455 | Ga0373931_0007502 | 3300035691 | Bacteria | 5135 |
| 1456 | Ga0373931_0306109 | 3300035691 | Bacteria | 983 |
| 1457 | Ga0373935_0664801 | 3300035692 | Bacteria | 765 |
| 1458 | Ga0373947_0273281 | 3300035725 | Bacteria | 1122 |
| 1459 | Ga0373937_0168463 | 3300036401 | Bacteria | 2055 |
| 1460 | Ga0373937_0377255 | 3300036401 | Bacteria | 1345 |
| 1461 | Ga0373937_1291590 | 3300036401 | Bacteria | 678 |
| 1462 | Ga0373937_1872254 | 3300036401 | Bacteria | 546 |
| 1463 | Ga0373925_0219622 | 3300037068 | Bacteria | 1517 |
| 1464 | Ga0373925_0487964 | 3300037068 | Bacteria | 1011 |
| 1465 | Ga0395898_0707204 | 3300037466 | Bacteria | 949 |
| 1466 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 1467 | Ga0395905_0003377 | 3300037471 | Bacteria | 17102 |
| 1468 | Ga0395905_0158997 | 3300037471 | Bacteria | 2124 |
| 1469 | Ga0395905_0205360 | 3300037471 | Bacteria | 1846 |
| 1470 | Ga0395905_0292538 | 3300037471 | Bacteria | 1515 |
| 1471 | Ga0395905_0637559 | 3300037471 | Bacteria | 967 |
| 1472 | Ga0395905_0726434 | 3300037471 | Bacteria | 895 |
| 1473 | Ga0395905_1171095 | 3300037471 | Bacteria | 672 |
| 1474 | Ga0395905_1245362 | 3300037471 | Bacteria | 648 |
| 1475 | Ga0400483_050487 | 3300039062 | Bacteria | 45898 |
| 1476 | Ga0400483_054100 | 3300039062 | Bacteria | 1406 |
| 1477 | Ga0400483_058112 | 3300039062 | Bacteria | 39642 |
| 1478 | Ga0400483_147621 | 3300039062 | Bacteria | 10623 |
| 1479 | Ga0400483_243387 | 3300039062 | Bacteria | 56211 |
| 1480 | Ga0400483_250036 | 3300039062 | Bacteria | 396353 |
| 1481 | Ga0400483_259735 | 3300039062 | Bacteria | 8645 |
| 1482 | Ga0436365_0385285 | 3300039437 | Bacteria | 2218 |
| 1483 | Ga0436365_0393891 | 3300039437 | Bacteria | 1272 |
| 1484 | Ga0436365_0508202 | 3300039437 | Bacteria | 921 |
| 1485 | Ga0436365_1754335 | 3300039437 | Bacteria | 1182 |
| 1486 | Ga0436365_1910867 | 3300039437 | Bacteria | 1720 |
| 1487 | Ga0439436_0000087 | 3300041404 | Bacteria | 22052 |
| 1488 | Ga0439438_022946 | 3300041405 | Bacteria | 1726 |
| 1489 | Ga0439439_0023785 | 3300041406 | Bacteria | 1536 |
| 1490 | Ga0439447_029848 | 3300041407 | Bacteria | 1378 |
| 1491 | Ga0439461_0005108 | 3300041410 | Bacteria | 2224 |
| 1492 | Ga0439461_0036152 | 3300041410 | Bacteria | 1050 |
| 1493 | Ga0439466_0016508 | 3300041411 | Bacteria | 2667 |
| 1494 | Ga0439466_0045273 | 3300041411 | Bacteria | 1455 |
| 1495 | Ga0439466_0049909 | 3300041411 | Bacteria | 1373 |
| 1496 | Ga0439465_0008564 | 3300041413 | Bacteria | 3227 |
| 1497 | Ga0439465_0134195 | 3300041413 | Bacteria | 876 |
| 1498 | Ga0451787_135752 | 3300041441 | Bacteria | 525 |
| 1499 | Ga0451789_0485836 | 3300041443 | Bacteria | 713 |
| 1500 | Ga0451789_0873756 | 3300041443 | Bacteria | 781 |
| 1501 | Ga0451789_1195116 | 3300041443 | Bacteria | 1937 |
| 1502 | Ga0451789_1353168 | 3300041443 | Bacteria | 695 |
| 1503 | Ga0451791_0888711 | 3300041451 | Bacteria | 592 |
| 1504 | Ga0451791_1547075 | 3300041451 | Bacteria | 825 |
| 1505 | Ga0451793_0351601 | 3300041452 | Bacteria | 559 |
| 1506 | Ga0451793_0606671 | 3300041452 | Bacteria | 1102 |
| 1507 | Ga0451793_0969557 | 3300041452 | Bacteria | 1813 |
| 1508 | Ga0451793_1911556 | 3300041452 | Bacteria | 551 |
| 1509 | Ga0451797_0651689 | 3300041453 | Bacteria | 617 |
| 1510 | Ga0451797_1136303 | 3300041453 | Bacteria | 524 |
| 1511 | Ga0451797_1454471 | 3300041453 | Bacteria | 767 |
| 1512 | Ga0451797_1559014 | 3300041453 | Bacteria | 734 |
| 1513 | Ga0451795_0264279 | 3300041456 | Bacteria | 804 |
| 1514 | Ga0451795_0458032 | 3300041456 | Bacteria | 542 |
| 1515 | Ga0451795_0612071 | 3300041456 | Bacteria | 1521 |
| 1516 | Ga0451795_1631029 | 3300041456 | Bacteria | 625 |
| 1517 | Ga0451798_0075940 | 3300041458 | Bacteria | 2713 |
| 1518 | Ga0451800_0112075 | 3300041459 | Bacteria | 643 |
| 1519 | Ga0451802_0039409 | 3300041460 | Bacteria | 3366 |
| 1520 | Ga0451802_0496814 | 3300041460 | Bacteria | 578 |
| 1521 | Ga0451802_1029972 | 3300041460 | Bacteria | 548 |
| 1522 | Ga0451804_1177037 | 3300041463 | Bacteria | 717 |
| 1523 | Ga0451807_1456924 | 3300041486 | Bacteria | 517 |
| 1524 | Ga0451833_0642716 | 3300041491 | Bacteria | 1416 |
| 1525 | Ga0451833_0671749 | 3300041491 | Bacteria | 516 |
| 1526 | Ga0451833_0863719 | 3300041491 | Bacteria | 978 |
| 1527 | Ga0451839_0092707 | 3300041496 | Bacteria | 728 |
| 1528 | Ga0451839_0195547 | 3300041496 | Bacteria | 1592 |
| 1529 | Ga0451839_1646573 | 3300041496 | Bacteria | 564 |
| 1530 | Ga0451841_0064685 | 3300041498 | Bacteria | 591 |
| 1531 | Ga0451841_0374427 | 3300041498 | Bacteria | 551 |
| 1532 | Ga0451849_0140783 | 3300041505 | Bacteria | 854 |
| 1533 | Ga0451849_1174768 | 3300041505 | Bacteria | 633 |
| 1534 | Ga0451851_0377524 | 3300041507 | Bacteria | 718 |
| 1535 | Ga0451851_0664708 | 3300041507 | Bacteria | 617 |
| 1536 | Ga0451851_0775016 | 3300041507 | Bacteria | 732 |
| 1537 | Ga0451843_0094093 | 3300041509 | Bacteria | 783 |
| 1538 | Ga0451843_0289726 | 3300041509 | Bacteria | 528 |
| 1539 | Ga0451843_1448663 | 3300041509 | Bacteria | 604 |
| 1540 | Ga0451855_1473803 | 3300041511 | Bacteria | 748 |
| 1541 | Ga0451853_0258583 | 3300041512 | Bacteria | 675 |
| 1542 | Ga0451853_0312486 | 3300041512 | Bacteria | 1389 |
| 1543 | Ga0451853_2717321 | 3300041512 | Bacteria | 1246 |
| 1544 | Ga0451853_2957169 | 3300041512 | Bacteria | 1168 |
| 1545 | Ga0451853_3970409 | 3300041512 | Bacteria | 538 |
| 1546 | Ga0439431_0002540 | 3300041997 | Bacteria | 4028 |
| 1547 | Ga0439431_0019679 | 3300041997 | Bacteria | 1606 |
| 1548 | Ga0439431_0161495 | 3300041997 | Bacteria | 640 |
| 1549 | Ga0439433_0006733 | 3300041999 | Bacteria | 2475 |
| 1550 | Ga0439433_0009312 | 3300041999 | Bacteria | 2137 |
| 1551 | Ga0439437_000403 | 3300042000 | Bacteria | 4173 |
| 1552 | Ga0439445_0000816 | 3300042004 | Bacteria | 6574 |
| 1553 | Ga0439445_0067787 | 3300042004 | Bacteria | 984 |
| 1554 | Ga0439445_0118103 | 3300042004 | Bacteria | 760 |
| 1555 | Ga0439432_004375 | 3300042006 | Bacteria | 5160 |
| 1556 | Ga0439449_0005260 | 3300042007 | Bacteria | 4967 |
| 1557 | Ga0439449_0009502 | 3300042007 | Bacteria | 3685 |
| 1558 | Ga0439449_0019959 | 3300042007 | Bacteria | 2512 |
| 1559 | Ga0439449_0035314 | 3300042007 | Bacteria | 1861 |
| 1560 | Ga0439449_0069502 | 3300042007 | Bacteria | 1298 |
| 1561 | Ga0439449_0269811 | 3300042007 | Bacteria | 641 |
| 1562 | Ga0439452_001338 | 3300042010 | Bacteria | 10284 |
| 1563 | Ga0439452_021923 | 3300042010 | Bacteria | 1658 |
| 1564 | Ga0439455_0023026 | 3300042012 | Bacteria | 1498 |
| 1565 | Ga0439455_0031169 | 3300042012 | Bacteria | 1326 |
| 1566 | Ga0439455_0103196 | 3300042012 | Bacteria | 789 |
| 1567 | Ga0439457_006319 | 3300042014 | Bacteria | 2911 |
| 1568 | Ga0439457_037410 | 3300042014 | Bacteria | 1080 |
| 1569 | Ga0439457_160441 | 3300042014 | Bacteria | 543 |
| 1570 | Ga0439462_0003614 | 3300042015 | Bacteria | 3722 |
| 1571 | Ga0439462_0005695 | 3300042015 | Bacteria | 3078 |
| 1572 | Ga0439462_0082272 | 3300042015 | Bacteria | 880 |
| 1573 | Ga0439463_155667 | 3300042016 | Bacteria | 593 |
| 1574 | Ga0450911_022634 | 3300042115 | Bacteria | 818 |
| 1575 | Ga0450914_002759 | 3300042118 | Bacteria | 1288 |
| 1576 | Ga0450917_007679 | 3300042120 | Bacteria | 825 |
| 1577 | Ga0450919_000846 | 3300042121 | Bacteria | 3954 |
| 1578 | Ga0450920_033140 | 3300042122 | Bacteria | 1020 |
| 1579 | Ga0450922_013808 | 3300042124 | Bacteria | 792 |
| 1580 | Ga0450923_062420 | 3300042125 | Bacteria | 815 |
| 1581 | Ga0450890_010639 | 3300042127 | Bacteria | 1184 |
| 1582 | Ga0450891_000064 | 3300042129 | Bacteria | 8447 |
| 1583 | Ga0450891_018549 | 3300042129 | Bacteria | 674 |
| 1584 | Ga0450892_003526 | 3300042130 | Bacteria | 1283 |
| 1585 | Ga0450892_020418 | 3300042130 | Bacteria | 648 |
| 1586 | Ga0450894_001711 | 3300042131 | Bacteria | 3096 |
| 1587 | Ga0450896_048175 | 3300042133 | Bacteria | 675 |
| 1588 | Ga0450898_030446 | 3300042134 | Bacteria | 988 |
| 1589 | Ga0450898_030894 | 3300042134 | Bacteria | 983 |
| 1590 | Ga0450898_055455 | 3300042134 | Bacteria | 772 |
| 1591 | Ga0450899_009529 | 3300042135 | Bacteria | 1071 |
| 1592 | Ga0450889_003240 | 3300042144 | Bacteria | 1606 |
| 1593 | Ga0450906_007913 | 3300042145 | Bacteria | 2080 |
| 1594 | Ga0450907_019923 | 3300042146 | Bacteria | 1125 |
| 1595 | Ga0450910_042973 | 3300042147 | Bacteria | 734 |
| 1596 | Ga0439446_0004543 | 3300042156 | Bacteria | 3517 |
| 1597 | Ga0439446_0240238 | 3300042156 | Bacteria | 622 |
| 1598 | Ga0439446_0253262 | 3300042156 | Bacteria | 608 |
| 1599 | Ga0450909_002243 | 3300042185 | Bacteria | 2730 |
| 1600 | Ga0450909_012351 | 3300042185 | Bacteria | 1252 |
| 1601 | Ga0439434_0005187 | 3300042435 | Bacteria | 3809 |
| 1602 | Ga0439434_0032148 | 3300042435 | Bacteria | 1596 |
| 1603 | Ga0439434_0106731 | 3300042435 | Bacteria | 905 |
| 1604 | Ga0439434_0120244 | 3300042435 | Bacteria | 856 |
| 1605 | Ga0439434_0184084 | 3300042435 | Bacteria | 700 |
| 1606 | Ga0439444_0193484 | 3300042437 | Bacteria | 510 |
| 1607 | Ga0439459_0079902 | 3300042438 | Bacteria | 770 |
| 1608 | Ga0439464_0021522 | 3300042439 | Bacteria | 1771 |
| 1609 | Ga0439464_0169221 | 3300042439 | Bacteria | 689 |
| 1610 | Ga0439460_0146488 | 3300042461 | Bacteria | 786 |
| 1611 | Ga0450916_001775 | 3300042530 | Bacteria | 2199 |
| 1612 | Ga0450918_000344 | 3300042531 | Bacteria | 10277 |
| 1613 | Ga0450918_083618 | 3300042531 | Bacteria | 611 |
| 1614 | Ga0450893_0021080 | 3300042532 | Bacteria | 1123 |
| 1615 | Ga0450893_0059738 | 3300042532 | Bacteria | 726 |
| 1616 | Ga0451577_0026364 | 3300042876 | Bacteria | 5265 |
| 1617 | Ga0451577_0061568 | 3300042876 | Bacteria | 3347 |
| 1618 | Ga0451577_1682399 | 3300042876 | Bacteria | 558 |
| 1619 | Ga0439440_0185855 | 3300042993 | Bacteria | 611 |
| 1620 | Ga0466969_0037790 | 3300044656 | Bacteria | 2433 |
| 1621 | Ga0466969_0089971 | 3300044656 | Bacteria | 1455 |
| 1622 | Ga0466972_0020558 | 3300044658 | Bacteria | 3298 |
| 1623 | Ga0466972_0035894 | 3300044658 | Bacteria | 2427 |
| 1624 | Ga0466972_0041116 | 3300044658 | Bacteria | 2251 |
| 1625 | Ga0466972_0046599 | 3300044658 | Bacteria | 2098 |
| 1626 | Ga0466972_0170373 | 3300044658 | Bacteria | 1022 |
| 1627 | Ga0453683_0394669 | 3300044673 | Bacteria | 891 |
| 1628 | Ga0453683_0429046 | 3300044673 | Bacteria | 854 |
| 1629 | Ga0453683_0934536 | 3300044673 | Bacteria | 574 |
| 1630 | Ga0466965_0068051 | 3300044683 | Bacteria | 1787 |
| 1631 | Ga0466965_0108619 | 3300044683 | Bacteria | 1424 |
| 1632 | Ga0466965_0131641 | 3300044683 | Bacteria | 1297 |
| 1633 | Ga0466965_0212725 | 3300044683 | Bacteria | 1028 |
| 1634 | Ga0466965_0386555 | 3300044683 | Bacteria | 771 |
| 1635 | Ga0466965_0801347 | 3300044683 | Bacteria | 545 |
| 1636 | Ga0466966_0015315 | 3300044684 | Bacteria | 5070 |
| 1637 | Ga0466966_0752500 | 3300044684 | Bacteria | 587 |
| 1638 | Ga0466961_0003217 | 3300044693 | Bacteria | 10163 |
| 1639 | Ga0466961_0006410 | 3300044693 | Bacteria | 7472 |
| 1640 | Ga0466961_0043879 | 3300044693 | Bacteria | 2863 |
| 1641 | Ga0466963_0000935 | 3300044694 | Bacteria | 14918 |
| 1642 | Ga0466964_0003021 | 3300044706 | Bacteria | 6099 |
| 1643 | Ga0466964_0118004 | 3300044706 | Bacteria | 1192 |
| 1644 | Ga0453684_0000917 | 3300044712 | Bacteria | 97990 |
| 1645 | Ga0453684_0001658 | 3300044712 | Bacteria | 60385 |
| 1646 | Ga0453684_0017401 | 3300044712 | Bacteria | 11136 |
| 1647 | Ga0453684_0051049 | 3300044712 | Bacteria | 5429 |
| 1648 | Ga0453684_0272674 | 3300044712 | Bacteria | 1932 |
| 1649 | Ga0453684_0346557 | 3300044712 | Bacteria | 1676 |
| 1650 | Ga0453684_0613701 | 3300044712 | Bacteria | 1191 |
| 1651 | Ga0453684_1282602 | 3300044712 | Bacteria | 765 |
| 1652 | Ga0466971_0382138 | 3300044719 | Bacteria | 684 |
| 1653 | Ga0466968_0005264 | 3300044735 | Bacteria | 4847 |
| 1654 | Ga0466968_0721818 | 3300044735 | Bacteria | 510 |
| 1655 | Ga0466970_0007142 | 3300044765 | Bacteria | 5592 |
| 1656 | Ga0466970_0015254 | 3300044765 | Bacteria | 3950 |
| 1657 | Ga0466970_0128278 | 3300044765 | Bacteria | 1392 |
| 1658 | Ga0466957_0007668 | 3300044842 | Bacteria | 6104 |
| 1659 | Ga0466960_0012592 | 3300044901 | Bacteria | 3575 |
| 1660 | Ga0466960_0654384 | 3300044901 | Bacteria | 627 |
| 1661 | Ga0466959_0013106 | 3300045049 | Bacteria | 6003 |
| 1662 | Ga0466959_0250383 | 3300045049 | Bacteria | 1222 |
| 1663 | Ga0451576_0034152 | 3300045051 | Bacteria | 5402 |
| 1664 | Ga0451576_0126973 | 3300045051 | Bacteria | 2657 |
| 1665 | Ga0451576_0228247 | 3300045051 | Bacteria | 1944 |
| 1666 | Ga0451576_0312262 | 3300045051 | Bacteria | 1645 |
| 1667 | Ga0451576_0393108 | 3300045051 | Bacteria | 1454 |
| 1668 | Ga0451576_0422698 | 3300045051 | Bacteria | 1398 |
| 1669 | Ga0451576_1296890 | 3300045051 | Bacteria | 759 |
| 1670 | Ga0466958_0023688 | 3300045836 | Bacteria | 3606 |
| 1671 | Ga0466958_0695385 | 3300045836 | Bacteria | 662 |
| 1672 | Ga0466967_0021184 | 3300045976 | Bacteria | 5272 |
| 1673 | Ga0466967_0546277 | 3300045976 | Bacteria | 1140 |
| 1674 | Ga0466967_1103268 | 3300045976 | Bacteria | 791 |
| 1675 | Ga0495627_032297 | 3300046453 | Bacteria | 1648 |
| 1676 | Ga0495590_0131290 | 3300046457 | Bacteria | 901 |
| 1677 | Ga0495629_0040968 | 3300046459 | Bacteria | 3259 |
| 1678 | Ga0495638_0191549 | 3300046460 | Bacteria | 1160 |
| 1679 | Ga0495638_0240052 | 3300046460 | Bacteria | 1004 |
| 1680 | Ga0495638_0306508 | 3300046460 | Bacteria | 854 |
| 1681 | Ga0495651_0038375 | 3300046462 | Bacteria | 3730 |
| 1682 | Ga0495650_0002988 | 3300046471 | Bacteria | 12804 |
| 1683 | Ga0495650_0147479 | 3300046471 | Bacteria | 847 |
| 1684 | Ga0495650_0200566 | 3300046471 | Bacteria | 693 |
| 1685 | Ga0495580_0175846 | 3300046472 | Bacteria | 1479 |
| 1686 | Ga0495580_0631714 | 3300046472 | Bacteria | 705 |
| 1687 | Ga0495582_0409091 | 3300046473 | Bacteria | 783 |
| 1688 | Ga0495582_0418253 | 3300046473 | Bacteria | 773 |
| 1689 | Ga0495582_0578047 | 3300046473 | Bacteria | 650 |
| 1690 | Ga0495605_0484521 | 3300046474 | Bacteria | 507 |
| 1691 | Ga0495639_0518165 | 3300046475 | Bacteria | 609 |
| 1692 | Ga0495662_0358629 | 3300046476 | Bacteria | 717 |
| 1693 | Ga0495664_0543098 | 3300046477 | Bacteria | 693 |
| 1694 | Ga0495583_0380114 | 3300046506 | Bacteria | 556 |
| 1695 | Ga0495606_0103334 | 3300046507 | Bacteria | 1731 |
| 1696 | Ga0495606_0184202 | 3300046507 | Bacteria | 1201 |
| 1697 | Ga0495606_0426203 | 3300046507 | Bacteria | 685 |
| 1698 | Ga0495606_0619442 | 3300046507 | Bacteria | 528 |
| 1699 | Ga0495610_0020900 | 3300046512 | Bacteria | 3616 |
| 1700 | Ga0495610_0035222 | 3300046512 | Bacteria | 2572 |
| 1701 | Ga0495610_0201109 | 3300046512 | Bacteria | 816 |
| 1702 | Ga0495616_0002648 | 3300046513 | Bacteria | 11757 |
| 1703 | Ga0495618_0779930 | 3300046514 | Bacteria | 558 |
| 1704 | Ga0495620_0083637 | 3300046515 | Bacteria | 1288 |
| 1705 | Ga0495620_0134181 | 3300046515 | Bacteria | 970 |
| 1706 | Ga0495620_0309700 | 3300046515 | Bacteria | 600 |
| 1707 | Ga0495628_0503705 | 3300046516 | Bacteria | 874 |
| 1708 | Ga0495628_0630016 | 3300046516 | Bacteria | 763 |
| 1709 | Ga0495630_0141411 | 3300046517 | Bacteria | 1830 |
| 1710 | Ga0495631_0000024 | 3300046518 | Bacteria | 90896 |
| 1711 | Ga0495632_0007918 | 3300046519 | Bacteria | 6606 |
| 1712 | Ga0495632_0010962 | 3300046519 | Bacteria | 5318 |
| 1713 | Ga0495632_0067015 | 3300046519 | Bacteria | 1731 |
| 1714 | Ga0495632_0485708 | 3300046519 | Bacteria | 534 |
| 1715 | Ga0495637_0010974 | 3300046520 | Bacteria | 4366 |
| 1716 | Ga0495637_0282631 | 3300046520 | Bacteria | 592 |
| 1717 | Ga0495643_0106698 | 3300046522 | Bacteria | 1429 |
| 1718 | Ga0495643_0248979 | 3300046522 | Bacteria | 830 |
| 1719 | Ga0495648_0371714 | 3300046524 | Bacteria | 647 |
| 1720 | Ga0495666_0197046 | 3300046526 | Bacteria | 927 |
| 1721 | Ga0495642_0091393 | 3300046528 | Bacteria | 1289 |
| 1722 | Ga0495642_0176947 | 3300046528 | Bacteria | 928 |
| 1723 | Ga0495652_0345447 | 3300046529 | Bacteria | 1068 |
| 1724 | Ga0495654_0041183 | 3300046530 | Bacteria | 2298 |
| 1725 | Ga0495640_0302006 | 3300046533 | Bacteria | 994 |
| 1726 | Ga0495586_0208483 | 3300046535 | Bacteria | 1109 |
| 1727 | Ga0495586_0445148 | 3300046535 | Bacteria | 747 |
| 1728 | Ga0495587_0680751 | 3300046536 | Bacteria | 564 |
| 1729 | Ga0495598_0018863 | 3300046537 | Bacteria | 1799 |
| 1730 | Ga0495598_0021212 | 3300046537 | Bacteria | 1725 |
| 1731 | Ga0495621_0003869 | 3300046539 | Bacteria | 4159 |
| 1732 | Ga0495621_0058128 | 3300046539 | Bacteria | 1398 |
| 1733 | Ga0495621_0162718 | 3300046539 | Bacteria | 883 |
| 1734 | Ga0495597_0010476 | 3300046542 | Bacteria | 4530 |
| 1735 | Ga0495645_0203502 | 3300046543 | Bacteria | 1341 |
| 1736 | Ga0495645_0313913 | 3300046543 | Bacteria | 1020 |
| 1737 | Ga0495622_0121235 | 3300046557 | Bacteria | 1194 |
| 1738 | Ga0495633_0254105 | 3300046558 | Bacteria | 802 |
| 1739 | Ga0495667_0114833 | 3300046559 | Bacteria | 1740 |
| 1740 | Ga0495667_0623864 | 3300046559 | Bacteria | 671 |
| 1741 | Ga0495656_0001070 | 3300046615 | Bacteria | 8866 |
| 1742 | Ga0495668_0056564 | 3300046616 | Bacteria | 2165 |
| 1743 | Ga0495668_0148126 | 3300046616 | Bacteria | 1285 |
| 1744 | Ga0495668_0340680 | 3300046616 | Bacteria | 823 |
| 1745 | Ga0495611_0037183 | 3300046648 | Bacteria | 2163 |
| 1746 | Ga0495611_0352882 | 3300046648 | Bacteria | 675 |
| 1747 | Ga0495625_0021963 | 3300046660 | Bacteria | 4900 |
| 1748 | Ga0495625_0040736 | 3300046660 | Bacteria | 3384 |
| 1749 | Ga0495625_0060694 | 3300046660 | Bacteria | 2678 |
| 1750 | Ga0495625_0078070 | 3300046660 | Bacteria | 2311 |
| 1751 | Ga0495625_0161052 | 3300046660 | Bacteria | 1503 |
| 1752 | Ga0495625_0683058 | 3300046660 | Bacteria | 608 |
| 1753 | Ga0495635_0146612 | 3300046663 | Bacteria | 1607 |
| 1754 | Ga0495635_0283978 | 3300046663 | Bacteria | 1112 |
| 1755 | Ga0495635_0298249 | 3300046663 | Bacteria | 1081 |
| 1756 | Ga0495588_0026440 | 3300046674 | Bacteria | 2897 |
| 1757 | Ga0495588_0067240 | 3300046674 | Bacteria | 1860 |
| 1758 | Ga0495588_0542843 | 3300046674 | Bacteria | 609 |
| 1759 | Ga0495657_0592767 | 3300046675 | Bacteria | 642 |
| 1760 | Ga0495599_0642120 | 3300046678 | Bacteria | 615 |
| 1761 | Ga0495646_0176976 | 3300046680 | Bacteria | 1173 |
| 1762 | Ga0495646_0186533 | 3300046680 | Bacteria | 1136 |
| 1763 | Ga0495646_0525651 | 3300046680 | Bacteria | 606 |
| 1764 | Ga0495647_0029408 | 3300046681 | Bacteria | 2032 |
| 1765 | Ga0495647_0145353 | 3300046681 | Bacteria | 1013 |
| 1766 | Ga0495658_0014926 | 3300046683 | Bacteria | 3979 |
| 1767 | Ga0495658_0093624 | 3300046683 | Bacteria | 1783 |
| 1768 | Ga0495658_0164808 | 3300046683 | Bacteria | 1369 |
| 1769 | Ga0495658_0226087 | 3300046683 | Bacteria | 1173 |
| 1770 | Ga0495613_0231866 | 3300046689 | Bacteria | 1293 |
| 1771 | Ga0495624_0413054 | 3300046690 | Bacteria | 810 |
| 1772 | Ga0495670_0501458 | 3300046691 | Bacteria | 659 |
| 1773 | Ga0495670_0733163 | 3300046691 | Bacteria | 539 |
| 1774 | Ga0495670_0818997 | 3300046691 | Bacteria | 508 |
| 1775 | Ga0495671_0115776 | 3300046692 | Bacteria | 1309 |
| 1776 | Ga0495671_0151942 | 3300046692 | Bacteria | 1127 |
| 1777 | Ga0495671_0330015 | 3300046692 | Bacteria | 732 |
| 1778 | Ga0495649_0009554 | 3300046694 | Bacteria | 5753 |
| 1779 | Ga0495589_0137142 | 3300046794 | Bacteria | 1173 |
| 1780 | Ga0495600_0792769 | 3300046809 | Bacteria | 565 |
| 1781 | Ga0495600_0822637 | 3300046809 | Bacteria | 552 |
| 1782 | Ga0495660_0119551 | 3300046810 | Bacteria | 1334 |
| 1783 | Ga0495660_0368547 | 3300046810 | Bacteria | 635 |
| 1784 | Ga0495581_0511806 | 3300047315 | Bacteria | 698 |
| 1785 | Ga0495581_0903825 | 3300047315 | Bacteria | 504 |
| 1786 | Ga0495674_1479822 | 3300047319 | Bacteria | 503 |
| 1787 | Ga0495676_0035806 | 3300047321 | Bacteria | 4149 |
| 1788 | Ga0495676_0078953 | 3300047321 | Bacteria | 2504 |
| 1789 | Ga0495676_0682244 | 3300047321 | Bacteria | 665 |
| 1790 | Ga0495680_0048736 | 3300047322 | Bacteria | 3325 |
| 1791 | Ga0495687_002064 | 3300047443 | Bacteria | 16886 |
| 1792 | Ga0495687_005696 | 3300047443 | Bacteria | 7855 |
| 1793 | Ga0495687_022510 | 3300047443 | Bacteria | 3023 |
| 1794 | Ga0495673_0107757 | 3300047469 | Bacteria | 1118 |
| 1795 | Ga0495673_0153463 | 3300047469 | Bacteria | 889 |
| 1796 | Ga0495681_0392955 | 3300047470 | Bacteria | 520 |
| 1797 | Ga0495684_0548175 | 3300047471 | Bacteria | 788 |
| 1798 | Ga0495686_0133926 | 3300047472 | Bacteria | 1467 |
| 1799 | Ga0495686_0149048 | 3300047472 | Bacteria | 1375 |
| 1800 | Ga0495614_0183605 | 3300048089 | Bacteria | 942 |
| 1801 | Ga0495614_0219437 | 3300048089 | Bacteria | 864 |
| 1802 | Ga0495615_0023842 | 3300048090 | Bacteria | 1406 |
| 1803 | Ga0495615_0132714 | 3300048090 | Bacteria | 729 |
| 1804 | Ga0495615_0168331 | 3300048090 | Bacteria | 662 |
| 1805 | Ga0495626_0050116 | 3300048091 | Bacteria | 1930 |
| 1806 | Ga0495626_0090337 | 3300048091 | Bacteria | 1347 |
| 1807 | Ga0496100_0046363 | 3300048903 | Bacteria | 2794 |
| 1808 | Ga0496100_0058669 | 3300048903 | Bacteria | 2527 |
| 1809 | Ga0496100_0849746 | 3300048903 | Bacteria | 716 |
| 1810 | Ga0496100_1204822 | 3300048903 | Bacteria | 597 |
| 1811 | Ga0496101_0005293 | 3300048904 | Bacteria | 8218 |
| 1812 | Ga0496101_0008869 | 3300048904 | Bacteria | 6584 |
| 1813 | Ga0496101_0019357 | 3300048904 | Bacteria | 4646 |
| 1814 | Ga0496101_0692603 | 3300048904 | Bacteria | 805 |
| 1815 | Ga0496101_0891250 | 3300048904 | Bacteria | 701 |
| 1816 | Ga0496102_0004160 | 3300048905 | Bacteria | 12251 |
| 1817 | Ga0496102_0022357 | 3300048905 | Bacteria | 5603 |
| 1818 | Ga0496102_0025441 | 3300048905 | Bacteria | 5269 |
| 1819 | Ga0496102_1735265 | 3300048905 | Bacteria | 542 |
| 1820 | Ga0496103_0052729 | 3300048906 | Bacteria | 2519 |
| 1821 | Ga0496103_0545910 | 3300048906 | Bacteria | 740 |
| 1822 | Ga0496104_0004072 | 3300048907 | Bacteria | 12679 |
| 1823 | Ga0496104_0225894 | 3300048907 | Bacteria | 1784 |
| 1824 | Ga0496105_0013340 | 3300048908 | Bacteria | 6521 |
| 1825 | Ga0496105_0335099 | 3300048908 | Bacteria | 1210 |
| 1826 | Ga0496105_0346090 | 3300048908 | Bacteria | 1188 |
| 1827 | Ga0496105_1017770 | 3300048908 | Bacteria | 619 |
| 1828 | Ga0496106_0004162 | 3300048909 | Bacteria | 10783 |
| 1829 | Ga0496106_0054027 | 3300048909 | Bacteria | 3034 |
| 1830 | Ga0496106_0118004 | 3300048909 | Bacteria | 2071 |
| 1831 | Ga0496107_0012377 | 3300048910 | Bacteria | 5954 |
| 1832 | Ga0496107_0185959 | 3300048910 | Bacteria | 1543 |
| 1833 | Ga0496107_0743017 | 3300048910 | Bacteria | 720 |
| 1834 | Ga0496107_1023953 | 3300048910 | Bacteria | 599 |
| 1835 | Ga0496107_1315008 | 3300048910 | Bacteria | 517 |
| 1836 | Ga0496108_0017286 | 3300048911 | Bacteria | 5899 |
| 1837 | Ga0496108_0054001 | 3300048911 | Bacteria | 3371 |
| 1838 | Ga0496108_0059614 | 3300048911 | Bacteria | 3209 |
| 1839 | Ga0496108_1037113 | 3300048911 | Bacteria | 699 |
| 1840 | Ga0496109_0040199 | 3300048912 | Bacteria | 4235 |
| 1841 | Ga0496109_0069350 | 3300048912 | Bacteria | 3233 |
| 1842 | Ga0496109_0499406 | 3300048912 | Bacteria | 1148 |
| 1843 | Ga0496109_0508627 | 3300048912 | Bacteria | 1137 |
| 1844 | Ga0496109_0959386 | 3300048912 | Bacteria | 793 |
| 1845 | Ga0496110_0010357 | 3300048913 | Bacteria | 7579 |
| 1846 | Ga0496110_0110191 | 3300048913 | Bacteria | 2473 |
| 1847 | Ga0496110_0238223 | 3300048913 | Bacteria | 1655 |
| 1848 | Ga0496111_0226566 | 3300048914 | Bacteria | 1388 |
| 1849 | Ga0496111_0824314 | 3300048914 | Bacteria | 671 |
| 1850 | Ga0496112_0290238 | 3300048915 | Bacteria | 1582 |
| 1851 | Ga0496113_0185358 | 3300048916 | Bacteria | 1650 |
| 1852 | Ga0496113_0713531 | 3300048916 | Bacteria | 800 |
| 1853 | Ga0496114_0022464 | 3300048917 | Bacteria | 5143 |
| 1854 | Ga0496114_0419093 | 3300048917 | Bacteria | 1186 |
| 1855 | Ga0496114_0563757 | 3300048917 | Bacteria | 1006 |
| 1856 | Ga0496114_0736330 | 3300048917 | Bacteria | 863 |
| 1857 | Ga0496114_1051712 | 3300048917 | Bacteria | 698 |
| 1858 | Ga0496115_0002077 | 3300048918 | Bacteria | 14341 |
| 1859 | Ga0496116_0066945 | 3300048919 | Bacteria | 2296 |
| 1860 | Ga0496117_0004106 | 3300048920 | Bacteria | 16315 |
| 1861 | Ga0496117_0051373 | 3300048920 | Bacteria | 2914 |
| 1862 | Ga0496117_0195326 | 3300048920 | Bacteria | 1148 |
| 1863 | Ga0496118_0009212 | 3300048921 | Bacteria | 10026 |
| 1864 | Ga0496118_0078153 | 3300048921 | Bacteria | 2343 |
| 1865 | Ga0496118_0374968 | 3300048921 | Bacteria | 749 |
| 1866 | Ga0496119_0213336 | 3300048922 | Bacteria | 992 |
| 1867 | Ga0496120_0199693 | 3300048923 | Bacteria | 969 |
| 1868 | Ga0496121_0002206 | 3300048924 | Bacteria | 30412 |
| 1869 | Ga0496121_0026908 | 3300048924 | Bacteria | 5399 |
| 1870 | Ga0496122_0000415 | 3300048925 | Bacteria | 90626 |
| 1871 | Ga0496122_0092947 | 3300048925 | Bacteria | 2048 |
| 1872 | Ga0496122_0181637 | 3300048925 | Bacteria | 1254 |
| 1873 | Ga0496122_0223552 | 3300048925 | Bacteria | 1078 |
| 1874 | Ga0496122_0491478 | 3300048925 | Bacteria | 598 |
| 1875 | Ga0496123_0000330 | 3300048926 | Bacteria | 90102 |
| 1876 | Ga0496123_0022183 | 3300048926 | Bacteria | 4903 |
| 1877 | Ga0496123_0036339 | 3300048926 | Bacteria | 3495 |
| 1878 | Ga0496123_0047297 | 3300048926 | Bacteria | 2909 |
| 1879 | Ga0496123_0245124 | 3300048926 | Bacteria | 887 |
| 1880 | Ga0496124_0044485 | 3300048927 | Bacteria | 3809 |
| 1881 | Ga0496124_0135708 | 3300048927 | Bacteria | 1948 |
| 1882 | Ga0496124_0415473 | 3300048927 | Bacteria | 929 |
| 1883 | Ga0496124_0525099 | 3300048927 | Bacteria | 787 |
| 1884 | Ga0496124_0874145 | 3300048927 | Bacteria | 548 |
| 1885 | Ga0496125_0041632 | 3300048928 | Bacteria | 3925 |
| 1886 | Ga0496125_0674360 | 3300048928 | Bacteria | 553 |
| 1887 | Ga0496126_0148535 | 3300048929 | Bacteria | 2011 |
| 1888 | Ga0501309_000004 | 3300049129 | Bacteria | 11581 |
| 1889 | Ga0501309_092679 | 3300049129 | Bacteria | 517 |
| 1890 | Ga0501310_002992 | 3300049130 | Bacteria | 1636 |
| 1891 | Ga0501310_019556 | 3300049130 | Bacteria | 834 |
| 1892 | Ga0501310_057280 | 3300049130 | Bacteria | 575 |
| 1893 | Ga0501305_001609 | 3300049161 | Bacteria | 2255 |
| 1894 | Ga0501305_036628 | 3300049161 | Bacteria | 785 |
| 1895 | Ga0501305_096135 | 3300049161 | Bacteria | 547 |
| 1896 | Ga0495682_0343906 | 3300049460 | Bacteria | 526 |
| 1897 | Ga0501292_023460 | 3300049515 | Bacteria | 1008 |
| 1898 | Ga0501297_002256 | 3300049520 | Bacteria | 1852 |
| 1899 | Ga0501303_004947 | 3300049526 | Bacteria | 1117 |
| 1900 | Ga0501312_026367 | 3300049528 | Bacteria | 891 |
| 1901 | Ga0501333_022767 | 3300049549 | Bacteria | 507 |
| 1902 | Ga0501032_0090633 | 3300049569 | Bacteria | 2029 |
| 1903 | Ga0501034_0016622 | 3300049571 | Bacteria | 7544 |
| 1904 | Ga0501034_0792889 | 3300049571 | Bacteria | 840 |
| 1905 | Ga0501037_0007252 | 3300049573 | Bacteria | 8102 |
| 1906 | Ga0501043_0000545 | 3300049579 | Bacteria | 33864 |
| 1907 | Ga0501046_0000021 | 3300049580 | Bacteria | 217313 |
| 1908 | Ga0501046_0004297 | 3300049580 | Bacteria | 12968 |
| 1909 | Ga0501046_0008745 | 3300049580 | Bacteria | 8796 |
| 1910 | Ga0501047_0000757 | 3300049581 | Bacteria | 33717 |
| 1911 | Ga0501048_0013766 | 3300049582 | Bacteria | 6000 |
| 1912 | Ga0501069_0002093 | 3300049585 | Bacteria | 10048 |
| 1913 | Ga0501070_0008659 | 3300049586 | Bacteria | 8601 |
| 1914 | Ga0501198_000047 | 3300049649 | Bacteria | 40126 |
| 1915 | Ga0501198_133305 | 3300049649 | Bacteria | 534 |
| 1916 | Ga0501201_004855 | 3300049651 | Bacteria | 1251 |
| 1917 | Ga0501206_015864 | 3300049653 | Bacteria | 1044 |
| 1918 | Ga0501207_019125 | 3300049654 | Bacteria | 1083 |
| 1919 | Ga0501222_000056 | 3300049662 | Bacteria | 40303 |
| 1920 | Ga0501222_010931 | 3300049662 | Bacteria | 1197 |
| 1921 | Ga0501223_035862 | 3300049663 | Bacteria | 964 |
| 1922 | Ga0501227_030701 | 3300049665 | Bacteria | 1288 |
| 1923 | Ga0501233_174043 | 3300049668 | Bacteria | 613 |
| 1924 | Ga0501235_029982 | 3300049669 | Bacteria | 1225 |
| 1925 | Ga0501236_062095 | 3300049670 | Bacteria | 665 |
| 1926 | Ga0501238_043408 | 3300049671 | Bacteria | 665 |
| 1927 | Ga0501242_026331 | 3300049674 | Bacteria | 769 |
| 1928 | Ga0501249_040180 | 3300049679 | Bacteria | 1059 |
| 1929 | Ga0501253_020019 | 3300049683 | Bacteria | 1162 |
| 1930 | Ga0501257_031579 | 3300049686 | Bacteria | 1278 |
| 1931 | Ga0501258_028345 | 3300049687 | Bacteria | 695 |
| 1932 | Ga0501221_000933 | 3300049704 | Bacteria | 4793 |
| 1933 | Ga0501225_0013159 | 3300049705 | Bacteria | 2317 |
| 1934 | Ga0501225_0032891 | 3300049705 | Bacteria | 1426 |
| 1935 | Ga0501229_000077 | 3300049706 | Bacteria | 9792 |
| 1936 | Ga0501079_0051579 | 3300049741 | Bacteria | 3177 |
| 1937 | Ga0501080_0199531 | 3300049742 | Bacteria | 1837 |
| 1938 | Ga0501232_004559 | 3300049757 | Bacteria | 1331 |
| 1939 | Ga0501241_108453 | 3300049758 | Bacteria | 605 |
| 1940 | Ga0501262_000157 | 3300049759 | Bacteria | 8322 |
| 1941 | Ga0501265_002252 | 3300049762 | Bacteria | 2185 |
| 1942 | Ga0501268_087695 | 3300049765 | Bacteria | 651 |
| 1943 | Ga0501271_052504 | 3300049768 | Bacteria | 556 |
| 1944 | Ga0501282_007907 | 3300049778 | Bacteria | 1138 |
| 1945 | Ga0501035_0120765 | 3300049822 | Bacteria | 2291 |
| 1946 | Ga0501044_0180518 | 3300049823 | Bacteria | 2078 |
| 1947 | Ga0501045_0002486 | 3300049824 | Bacteria | 12544 |
| 1948 | nmdc:mga03683_218037_c1 | 3300050489 | Bacteria | 879 |
| 1949 | nmdc:mga03683_22920_c1 | 3300050489 | Bacteria | 2426 |
| 1950 | nmdc:mga03683_30347_c1 | 3300050489 | Bacteria | 2163 |
| 1951 | nmdc:mga03683_354569_c1 | 3300050489 | Bacteria | 695 |
| 1952 | nmdc:mga03683_447720_c1 | 3300050489 | Bacteria | 621 |
| 1953 | nmdc:mga03683_48543_c1 | 3300050489 | Bacteria | 1764 |
| 1954 | nmdc:mga03683_51579_c1 | 3300050489 | Bacteria | 1718 |
| 1955 | nmdc:mga03683_90285_c1 | 3300050489 | Bacteria | 1335 |
| 1956 | nmdc:mga03n38_226732_c1 | 3300050490 | Bacteria | 978 |
| 1957 | nmdc:mga03n38_399825_c1 | 3300050490 | Bacteria | 756 |
| 1958 | nmdc:mga03n38_454002_c1 | 3300050490 | Bacteria | 713 |
| 1959 | nmdc:mga03n38_603014_c1 | 3300050490 | Bacteria | 626 |
| 1960 | nmdc:mga00v17_152383_c1 | 3300050491 | Bacteria | 1485 |
| 1961 | nmdc:mga00v17_202355_c1 | 3300050491 | Bacteria | 1284 |
| 1962 | nmdc:mga00v17_401612_c1 | 3300050491 | Bacteria | 890 |
| 1963 | nmdc:mga00v17_87307_c1 | 3300050491 | Bacteria | 1955 |
| 1964 | nmdc:mga0yw44_240784_c1 | 3300050492 | Bacteria | 1202 |
| 1965 | nmdc:mga0k408_10460_c1 | 3300050493 | Bacteria | 5017 |
| 1966 | nmdc:mga0k408_12490_c1 | 3300050493 | Bacteria | 4643 |
| 1967 | nmdc:mga0k408_164742_c1 | 3300050493 | Bacteria | 1321 |
| 1968 | nmdc:mga0k408_171695_c1 | 3300050493 | Bacteria | 1293 |
| 1969 | nmdc:mga0k408_18200_c2 | 3300050493 | Bacteria | 3187 |
| 1970 | nmdc:mga0k408_190517_c1 | 3300050493 | Bacteria | 1224 |
| 1971 | nmdc:mga0k408_256190_c1 | 3300050493 | Bacteria | 1045 |
| 1972 | nmdc:mga0k408_26610_c1 | 3300050493 | Bacteria | 3281 |
| 1973 | nmdc:mga0k408_270913_c1 | 3300050493 | Bacteria | 1014 |
| 1974 | nmdc:mga0k408_302597_c1 | 3300050493 | Bacteria | 954 |
| 1975 | nmdc:mga0k408_36110_c1 | 3300050493 | Bacteria | 2836 |
| 1976 | nmdc:mga0k408_40302_c1 | 3300050493 | Bacteria | 2687 |
| 1977 | nmdc:mga0k408_438894_c1 | 3300050493 | Bacteria | 776 |
| 1978 | nmdc:mga0k408_583656_c1 | 3300050493 | Bacteria | 660 |
| 1979 | nmdc:mga0k408_6644_c1 | 3300050493 | Bacteria | 6167 |
| 1980 | nmdc:mga0k408_794578_c1 | 3300050493 | Bacteria | 552 |
| 1981 | nmdc:mga0k408_83530_c1 | 3300050493 | Bacteria | 1872 |
| 1982 | nmdc:mga06z11_125624_c1 | 3300050494 | Bacteria | 1435 |
| 1983 | nmdc:mga06z11_255108_c1 | 3300050494 | Bacteria | 1034 |
| 1984 | nmdc:mga06z11_363850_c1 | 3300050494 | Bacteria | 867 |
| 1985 | nmdc:mga06z11_37405_c1 | 3300050494 | Bacteria | 2403 |
| 1986 | nmdc:mga06z11_445710_c1 | 3300050494 | Bacteria | 782 |
| 1987 | nmdc:mga06z11_507645_c1 | 3300050494 | Bacteria | 731 |
| 1988 | nmdc:mga04h51_235928_c1 | 3300050495 | Bacteria | 729 |
| 1989 | nmdc:mga07m45_12950_c1 | 3300050496 | Bacteria | 4414 |
| 1990 | nmdc:mga07m45_151739_c1 | 3300050496 | Bacteria | 1344 |
| 1991 | nmdc:mga07m45_154307_c1 | 3300050496 | Bacteria | 1332 |
| 1992 | nmdc:mga07m45_156357_c1 | 3300050496 | Bacteria | 1323 |
| 1993 | nmdc:mga07m45_16681_c1 | 3300050496 | Bacteria | 3933 |
| 1994 | nmdc:mga07m45_18099_c1 | 3300050496 | Bacteria | 3797 |
| 1995 | nmdc:mga07m45_18802_c1 | 3300050496 | Bacteria | 3737 |
| 1996 | nmdc:mga07m45_18856_c1 | 3300050496 | Bacteria | 3732 |
| 1997 | nmdc:mga07m45_201253_c1 | 3300050496 | Bacteria | 1159 |
| 1998 | nmdc:mga07m45_21210_c1 | 3300050496 | Bacteria | 3535 |
| 1999 | nmdc:mga07m45_342605_c1 | 3300050496 | Bacteria | 869 |
| 2000 | nmdc:mga07m45_399292_c1 | 3300050496 | Bacteria | 798 |
| 2001 | nmdc:mga07m45_4213_c1 | 3300050496 | Bacteria | 7032 |
| 2002 | nmdc:mga07m45_460138_c1 | 3300050496 | Bacteria | 738 |
| 2003 | nmdc:mga07m45_506933_c1 | 3300050496 | Bacteria | 699 |
| 2004 | nmdc:mga07m45_529161_c1 | 3300050496 | Bacteria | 682 |
| 2005 | nmdc:mga07m45_724059_c1 | 3300050496 | Bacteria | 572 |
| 2006 | nmdc:mga07m45_836123_c1 | 3300050496 | Bacteria | 527 |
| 2007 | nmdc:mga07m45_912609_c1 | 3300050496 | Bacteria | 502 |
| 2008 | nmdc:mga05p37_182246_c1 | 3300050507 | Bacteria | 2554 |
| 2009 | nmdc:mga05p37_220452_c1 | 3300050507 | Bacteria | 2289 |
| 2010 | nmdc:mga0qj67_110899_c1 | 3300050509 | Bacteria | 2215 |
| 2011 | nmdc:mga08y16_605174_c1 | 3300050511 | Bacteria | 1104 |
| 2012 | nmdc:mga08y16_714912_c1 | 3300050511 | Bacteria | 1000 |
| 2013 | nmdc:mga08y16_823151_c1 | 3300050511 | Bacteria | 920 |
| 2014 | nmdc:mga08y16_950785_c1 | 3300050511 | Bacteria | 842 |
| 2015 | nmdc:mga0n895_280592_c1 | 3300050512 | Bacteria | 1689 |
| 2016 | nmdc:mga08x19_1194464_c1 | 3300050514 | Bacteria | 539 |
| 2017 | nmdc:mga0sz30_14201_c1 | 3300050516 | Bacteria | 3130 |
| 2018 | nmdc:mga0sz30_185966_c1 | 3300050516 | Bacteria | 922 |
| 2019 | nmdc:mga0sz30_37847_c1 | 3300050516 | Bacteria | 2020 |
| 2020 | nmdc:mga0sz30_405475_c1 | 3300050516 | Bacteria | 611 |
| 2021 | nmdc:mga0sz30_442377_c1 | 3300050516 | Bacteria | 583 |
| 2022 | nmdc:mga0sz30_5056_c1 | 3300050516 | Bacteria | 4821 |
| 2023 | Ga0495601_0284010 | 3300053077 | Bacteria | 1079 |
| 2024 | Ga0495612_0091577 | 3300053078 | Bacteria | 1288 |
| 2025 | Ga0495612_0385124 | 3300053078 | Bacteria | 636 |
| 2026 | Ga0500635_0087433 | 3300053080 | Bacteria | 1129 |
| 2027 | Ga0495595_0323284 | 3300053084 | Bacteria | 777 |
| 2028 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 2029 | Ga0500578_0265118 | 3300053086 | Bacteria | 1030 |
| 2030 | Ga0500643_006994 | 3300053087 | Bacteria | 4628 |
| 2031 | Ga0500643_012618 | 3300053087 | Bacteria | 3020 |
| 2032 | Ga0500644_0018587 | 3300053088 | Bacteria | 2039 |
| 2033 | Ga0500646_0033981 | 3300053090 | Bacteria | 1412 |
| 2034 | Ga0500646_0346932 | 3300053090 | Bacteria | 540 |
| 2035 | Ga0500651_0000156 | 3300053093 | Bacteria | 43636 |
| 2036 | Ga0500651_0076022 | 3300053093 | Bacteria | 2085 |
| 2037 | Ga0500651_0168496 | 3300053093 | Bacteria | 1307 |
| 2038 | Ga0500651_0444845 | 3300053093 | Bacteria | 722 |
| 2039 | Ga0500566_0160156 | 3300053094 | Bacteria | 1174 |
| 2040 | Ga0500650_0145041 | 3300053098 | Bacteria | 1099 |
| 2041 | Ga0500650_0338961 | 3300053098 | Bacteria | 659 |
| 2042 | Ga0500557_128395 | 3300053105 | Bacteria | 840 |
| 2043 | Ga0500562_005406 | 3300053108 | Bacteria | 3208 |
| 2044 | Ga0500562_008977 | 3300053108 | Bacteria | 2525 |
| 2045 | Ga0500571_000005 | 3300053110 | Bacteria | 109625 |
| 2046 | Ga0500594_0001096 | 3300053118 | Bacteria | 5806 |
| 2047 | Ga0500597_317525 | 3300053120 | Bacteria | 616 |
| 2048 | Ga0500608_022424 | 3300053122 | Bacteria | 2927 |
| 2049 | Ga0500608_074158 | 3300053122 | Bacteria | 1614 |
| 2050 | Ga0500618_164499 | 3300053125 | Bacteria | 508 |
| 2051 | Ga0500621_251616 | 3300053126 | Bacteria | 593 |
| 2052 | Ga0500623_007865 | 3300053127 | Bacteria | 5280 |
| 2053 | Ga0500626_035282 | 3300053128 | Bacteria | 2260 |
| 2054 | Ga0500628_003722 | 3300053129 | Bacteria | 2518 |
| 2055 | Ga0500628_060492 | 3300053129 | Bacteria | 924 |
| 2056 | Ga0500642_0064667 | 3300053130 | Bacteria | 1651 |
| 2057 | Ga0500652_001283 | 3300053131 | Bacteria | 7966 |
| 2058 | Ga0500655_000516 | 3300053133 | Bacteria | 7797 |
| 2059 | Ga0500655_020988 | 3300053133 | Bacteria | 1222 |
| 2060 | Ga0500658_0000141 | 3300053134 | Bacteria | 34224 |
| 2061 | Ga0500658_0000561 | 3300053134 | Bacteria | 15644 |
| 2062 | Ga0500658_0006983 | 3300053134 | Bacteria | 4179 |
| 2063 | Ga0500658_0163347 | 3300053134 | Bacteria | 1009 |
| 2064 | Ga0500559_0000880 | 3300053136 | Bacteria | 19209 |
| 2065 | Ga0500559_0006764 | 3300053136 | Bacteria | 5146 |
| 2066 | Ga0500564_001417 | 3300053138 | Bacteria | 8279 |
| 2067 | Ga0500568_0001097 | 3300053139 | Bacteria | 18225 |
| 2068 | Ga0500568_0127304 | 3300053139 | Bacteria | 947 |
| 2069 | Ga0500573_0032467 | 3300053140 | Bacteria | 3013 |
| 2070 | Ga0500579_150348 | 3300053143 | Bacteria | 1017 |
| 2071 | Ga0500604_0019070 | 3300053151 | Bacteria | 1917 |
| 2072 | Ga0500604_0284338 | 3300053151 | Bacteria | 573 |
| 2073 | Ga0500616_0059379 | 3300053153 | Bacteria | 1986 |
| 2074 | Ga0500619_000073 | 3300053154 | Bacteria | 28363 |
| 2075 | Ga0500622_0001738 | 3300053156 | Bacteria | 16832 |
| 2076 | Ga0500624_028461 | 3300053157 | Bacteria | 946 |
| 2077 | Ga0500624_115262 | 3300053157 | Bacteria | 561 |
| 2078 | Ga0500634_0055702 | 3300053161 | Bacteria | 2114 |
| 2079 | Ga0500638_016327 | 3300053162 | Bacteria | 3423 |
| 2080 | Ga0500636_0214708 | 3300053177 | Bacteria | 1007 |
| 2081 | Ga0500625_115871 | 3300053729 | Bacteria | 1088 |
| 2082 | Ga0500645_007607 | 3300053730 | Bacteria | 3758 |
| 2083 | Ga0500596_018165 | 3300053735 | Bacteria | 1055 |
| 2084 | Ga0590071_099013 | 3300059421 | Bacteria | 734 |
| 2085 | Ga0501082_0033320 | 3300060353 | Bacteria | 4445 |
| 2086 | Ga0501082_1844706 | 3300060353 | Bacteria | 527 |
| 2087 | Ga0466962_0056126 | 3300061719 | Bacteria | 1881 |
| 2088 | Ga0466962_0127631 | 3300061719 | Bacteria | 1228 |
| 2089 | 2587725128 | 2585428057 | Bacteria | 6737412 |
| 2090 | 2587731512 | 2585428058 | Bacteria | 6853932 |
| 2091 | 2587756191 | 2585428062 | Bacteria | 6842168 |
| 2092 | 2588295157 | 2588253510 | Bacteria | 6901809 |
| 2093 | 2599623208 | 2599185214 | Bacteria | 8209958 |
| 2094 | 2599674855 | 2599185226 | Bacteria | 8233575 |
| 2095 | 2599680812 | 2599185227 | Bacteria | 8246414 |
| 2096 | 2599692827 | 2599185229 | Bacteria | 8216126 |
| 2097 | 2643743907 | 2643221544 | Bacteria | 5886209 |
| 2098 | 2643933067 | 2643221585 | Bacteria | 5812563 |
| 2099 | 2643966984 | 2643221592 | Bacteria | 6608788 |
| 2100 | 2644142647 | 2643221625 | Bacteria | 6512927 |
| 2101 | 2644217210 | 2643221639 | Bacteria | 6649903 |
| 2102 | 2644248385 | 2643221644 | Bacteria | 6865017 |
| 2103 | 2644259022 | 2643221646 | Bacteria | 6433402 |
| 2104 | 2644273678 | 2643221648 | Bacteria | 6521465 |
| 2105 | 2644301595 | 2643221654 | Bacteria | 5273570 |
| 2106 | 2644314316 | 2643221656 | Bacteria | 5809961 |
| 2107 | 2644340934 | 2643221660 | Bacteria | 4208257 |
| 2108 | 2644467186 | 2643221683 | Bacteria | 5749203 |
| 2109 | 2649122609 | 2648501241 | Bacteria | 5312320 |
| 2110 | 2652974065 | 2651869818 | Bacteria | 5864031 |
| 2111 | 2738723941 | 2738541277 | Bacteria | 7458140 |
| 2112 | 2738882767 | 2738541307 | Bacteria | 8606193 |
| 2113 | 2739055759 | 2738541337 | Bacteria | 6183410 |
| 2114 | 2739250496 | 2738543013 | Bacteria | 5618633 |
| 2115 | 2739280468 | 2738543019 | Bacteria | 7459457 |
| 2116 | 2819600344 | 2818991446 | Bacteria | 7757362 |
| 2117 | 2831271862 | 2831265667 | Bacteria | 7184833 |
| 2118 | 2838059700 | 2838054893 | Bacteria | 7451788 |
| 2119 | 2842682804 | 2842677519 | Bacteria | 5615038 |
| 2120 | 2842735792 | 2842733646 | Bacteria | 5716726 |
| 2121 | 2885193535 | 2885192300 | Bacteria | 5882526 |
| 2122 | 2885198646 | 2885198086 | Bacteria | 7212419 |
| 2123 | 2885211974 | 2885211737 | Bacteria | 7212420 |
| 2124 | 2887632367 | 2887630918 | Bacteria | 3239855 |
| 2125 | 2899928485 | 2899924645 | Bacteria | 7487985 |
| 2126 | 2904451787 | 2904449895 | Bacteria | 6927402 |
| 2127 | 2904462556 | 2904456579 | Bacteria | 6819253 |
| 2128 | 2919467229 | 2919462493 | Bacteria | 5817112 |
| 2129 | 2919494179 | 2919493220 | Bacteria | 4598500 |
| 2130 | 2919543811 | 2919543075 | Bacteria | 4728703 |
| 2131 | 2919688610 | 2919688452 | Bacteria | 4595932 |
| 2132 | 2923525961 | 2923525760 | Bacteria | 4472324 |
| 2133 | 2923527662 | 2923525760 | Bacteria | 4472324 |
| 2134 | 2928041406 | 2928037797 | Bacteria | 7273642 |
| 2135 | 2928048248 | 2928044640 | Bacteria | 7271509 |
| 2136 | 2928056092 | 2928051484 | Bacteria | 7773759 |
| 2137 | 2928066428 | 2928064002 | Bacteria | 7419480 |
| 2138 | 2928076083 | 2928070936 | Bacteria | 8062541 |
| 2139 | 2928087728 | 2928084124 | Bacteria | 7159212 |
| 2140 | 2929523670 | 2929520902 | Bacteria | 6765052 |
| 2141 | 2945946087 | 2945945610 | Bacteria | 5951079 |
| 2142 | 2945975686 | 2945972063 | Bacteria | 6086495 |
| 2143 | 2954768861 | 2954767861 | Bacteria | 5535784 |
| 2144 | 8002746423 | 8002745576 | Bacteria | 4840272 |
| 2145 | nmdc:mga09592_14154_c1 | |||
| 2146 | SwRhRL2b_contig_93844 | |||
| 2147 | JGI24746J21847_1025597 | |||
| 2148 | JGI24740J21852_10030620 | |||
| 2149 | JGI24740J21852_10061013 | |||
| 2150 | JGI24739J22299_10016035 | |||
| 2151 | JGI24739J22299_10125477 | |||
| 2152 | JGI24735J21928_10247644 | |||
| 2153 | JGI24750J21931_1076289 | |||
| 2154 | JGI25158J39367_1004622 | |||
| 2155 | JGI25158J39367_1015083 | |||
| 2156 | JGI25152J39213_1006440 | |||
| 2157 | JGI25150J39212_1000713 | |||
| 2158 | JGI25159J45721_1007232 | |||
| 2159 | JGI25159J45721_1009555 | |||
| 2160 | JGI25151J46595_10016692 | |||
| 2161 | JGI25153J46596_10004412 | |||
| 2162 | JGI25153J46596_10011494 | |||
| 2163 | JGI25153J46596_10012754 | |||
| 2164 | JGI25153J46596_10014829 | |||
| 2165 | JGI25153J46596_10028238 | |||
| 2166 | rootH1_10029168 | |||
| 2167 | rootH1_10056955 | |||
| 2168 | rootH2_10190564 | |||
| 2169 | rootL2_10040047 | |||
| 2170 | rootL2_10046934 | |||
| 2171 | rootL2_10150001 | |||
| 2172 | rootH1_10038325 | |||
| 2173 | rootH1_10042098 | |||
| 2174 | rootH1_10068314 | |||
| 2175 | JGI26128J50194_1000847 | |||
| 2176 | JGI25160J50197_1011152 | |||
| 2177 | JGI25160J50197_1013627 | |||
| 2178 | JGI26145J50221_1025494 | |||
| 2179 | JGI25161J50226_1003238 | |||
| 2180 | JGI25161J50226_1008435 | |||
| 2181 | Ga0006562J51391_1125153 | |||
| 2182 | Ga0006562J51391_1125156 | |||
| 2183 | Ga0055532_1025643 | |||
| 2184 | Ga0055535_1001434 | |||
| 2185 | Ga0055542_1000127 | |||
| 2186 | Ga0055526_1002532 | |||
| 2187 | Ga0055526_1014660 | |||
| 2188 | Ga0055526_1014781 | |||
| 2189 | Ga0055537_1005895 | |||
| 2190 | Ga0055537_1005952 | |||
| 2191 | Ga0055524_1000207 | |||
| 2192 | Ga0055524_1012781 | |||
| 2193 | Ga0055524_1015362 | |||
| 2194 | Ga0055536_1000530 | |||
| 2195 | Ga0055536_1001748 | |||
| 2196 | Ga0055536_1038022 | |||
| 2197 | Ga0055534_1003750 | |||
| 2198 | Ga0055534_1005868 | |||
| 2199 | Ga0055534_1015344 | |||
| 2200 | Ga0055528_1007039 | |||
| 2201 | Ga0055528_1013037 | |||
| 2202 | Ga0055528_1063074 | |||
| 2203 | Ga0055528_1081495 | |||
| 2204 | Ga0055530_10000464 | |||
| 2205 | Ga0055530_10020044 | |||
| 2206 | Ga0055530_10057447 | |||
| 2207 | Ga0055530_10122084 | |||
| 2208 | Ga0055540_1000011 | |||
| 2209 | Ga0055540_1000603 | |||
| 2210 | Ga0055540_1002445 | |||
| 2211 | Ga0055540_1002836 | |||
| 2212 | Ga0055540_1020072 | |||
| 2213 | Ga0055531_10001607 | |||
| 2214 | Ga0055531_10001895 | |||
| 2215 | Ga0055531_10011526 | |||
| 2216 | Ga0055543_1000771 | |||
| 2217 | Ga0055543_1003491 | |||
| 2218 | Ga0065165_1001786 | |||
| 2219 | Ga0065165_1003619 | |||
| 2220 | Ga0065165_1010543 | |||
| 2221 | Ga0065714_10276998 | |||
| 2222 | Ga0065714_10299280 | |||
| 2223 | Ga0065704_10100495 | |||
| 2224 | Ga0065704_10153191 | |||
| 2225 | Ga0065704_10178466 | |||
| 2226 | Ga0065704_10251990 | |||
| 2227 | Ga0065704_10776945 | |||
| 2228 | Ga0065712_10045136 | |||
| 2229 | Ga0065712_10054430 | |||
| 2230 | Ga0065715_10145513 | |||
| 2231 | Ga0065715_10245821 | |||
| 2232 | Ga0070658_10897051 | |||
| 2233 | Ga0070676_10001849 | |||
| 2234 | Ga0070676_10019835 | |||
| 2235 | Ga0070676_10083237 | |||
| 2236 | Ga0070676_10099580 | |||
| 2237 | Ga0070676_10380340 | |||
| 2238 | Ga0070676_10420234 | |||
| 2239 | Ga0070676_10617389 | |||
| 2240 | Ga0070676_10841459 | |||
| 2241 | Ga0070676_11502463 | |||
| 2242 | Ga0070683_100032863 | |||
| 2243 | Ga0070683_100713614 | |||
| 2244 | Ga0070683_100935908 | |||
| 2245 | Ga0070690_100006214 | |||
| 2246 | Ga0070670_100013010 | |||
| 2247 | Ga0070670_100037154 | |||
| 2248 | Ga0070670_100095571 | |||
| 2249 | Ga0070670_100199248 | |||
| 2250 | Ga0070670_100465496 | |||
| 2251 | Ga0070670_100545083 | |||
| 2252 | Ga0070670_100594711 | |||
| 2253 | Ga0070670_100678357 | |||
| 2254 | Ga0070670_100738722 | |||
| 2255 | Ga0070670_100947184 | |||
| 2256 | Ga0070670_101263339 | |||
| 2257 | Ga0070670_101497598 | |||
| 2258 | Ga0070670_101693075 | |||
| 2259 | Ga0070677_10017835 | |||
| 2260 | Ga0070677_10033687 | |||
| 2261 | Ga0070677_10071030 | |||
| 2262 | Ga0070677_10108197 | |||
| 2263 | Ga0070677_10146861 | |||
| 2264 | Ga0070677_10241124 | |||
| 2265 | Ga0070677_10241125 | |||
| 2266 | Ga0070677_10481215 | |||
| 2267 | Ga0068869_100014166 | |||
| 2268 | Ga0068869_100036584 | |||
| 2269 | Ga0068869_100067518 | |||
| 2270 | Ga0068869_100095143 | |||
| 2271 | Ga0068869_100347984 | |||
| 2272 | Ga0068869_100378568 | |||
| 2273 | Ga0068869_100447250 | |||
| 2274 | Ga0068869_100666018 | |||
| 2275 | Ga0068869_101160634 | |||
| 2276 | Ga0070666_10020373 | |||
| 2277 | Ga0070666_10071419 | |||
| 2278 | Ga0070666_10332138 | |||
| 2279 | Ga0070666_10689634 | |||
| 2280 | Ga0070666_10735042 | |||
| 2281 | Ga0070666_11311054 | |||
| 2282 | Ga0070666_11338559 | |||
| 2283 | Ga0070666_11453302 | |||
| 2284 | Ga0070680_100012570 | |||
| 2285 | Ga0070680_100121871 | |||
| 2286 | Ga0070680_100130032 | |||
| 2287 | Ga0070680_101068157 | |||
| 2288 | Ga0068868_100003711 | |||
| 2289 | Ga0068868_100052781 | |||
| 2290 | Ga0068868_100058644 | |||
| 2291 | Ga0068868_100059788 | |||
| 2292 | Ga0068868_100140028 | |||
| 2293 | Ga0068868_100205867 | |||
| 2294 | Ga0068868_100233241 | |||
| 2295 | Ga0068868_100322318 | |||
| 2296 | Ga0068868_100362665 | |||
| 2297 | Ga0068868_100982060 | |||
| 2298 | Ga0068868_101411987 | |||
| 2299 | Ga0068868_102317947 | |||
| 2300 | Ga0068868_102431744 | |||
| 2301 | Ga0070660_100002224 | |||
| 2302 | Ga0070660_101270341 | |||
| 2303 | Ga0070660_101583083 | |||
| 2304 | Ga0070660_101863067 | |||
| 2305 | Ga0070689_100021223 | |||
| 2306 | Ga0070689_101343224 | |||
| 2307 | Ga0070691_10522081 | |||
| 2308 | Ga0070687_100038494 | |||
| 2309 | Ga0070687_100496478 | |||
| 2310 | Ga0070687_100518213 | |||
| 2311 | Ga0070687_101353116 | |||
| 2312 | Ga0070687_101443009 | |||
| 2313 | Ga0070661_100005152 | |||
| 2314 | Ga0070661_100042215 | |||
| 2315 | Ga0070661_100219593 | |||
| 2316 | Ga0070661_100597918 | |||
| 2317 | Ga0070661_100783587 | |||
| 2318 | Ga0070668_100013101 | |||
| 2319 | Ga0070668_100130926 | |||
| 2320 | Ga0070668_100246169 | |||
| 2321 | Ga0070668_100467784 | |||
| 2322 | Ga0070668_100583008 | |||
| 2323 | Ga0070668_100617705 | |||
| 2324 | Ga0070669_100015642 | |||
| 2325 | Ga0070669_100071256 | |||
| 2326 | Ga0070669_100097794 | |||
| 2327 | Ga0070669_100160545 | |||
| 2328 | Ga0070669_100426231 | |||
| 2329 | Ga0070669_100704995 | |||
| 2330 | Ga0070669_101135656 | |||
| 2331 | Ga0070669_101481984 | |||
| 2332 | Ga0070669_101570594 | |||
| 2333 | Ga0070675_100000250 | |||
| 2334 | Ga0070675_100003213 | |||
| 2335 | Ga0070675_100011215 | |||
| 2336 | Ga0070675_100012571 | |||
| 2337 | Ga0070675_100018746 | |||
| 2338 | Ga0070675_100025359 | |||
| 2339 | Ga0070675_100114393 | |||
| 2340 | Ga0070675_100171767 | |||
| 2341 | Ga0070675_100207755 | |||
| 2342 | Ga0070675_100326159 | |||
| 2343 | Ga0070675_100419443 | |||
| 2344 | Ga0070675_100571434 | |||
| 2345 | Ga0070675_101423761 | |||
| 2346 | Ga0070675_101469976 | |||
| 2347 | Ga0070675_101820912 | |||
| 2348 | Ga0070671_100006682 | |||
| 2349 | Ga0070671_100126528 | |||
| 2350 | Ga0070671_100152385 | |||
| 2351 | Ga0070671_100202994 | |||
| 2352 | Ga0070671_100315170 | |||
| 2353 | Ga0070671_100440500 | |||
| 2354 | Ga0070671_100656227 | |||
| 2355 | Ga0070671_101156220 | |||
| 2356 | Ga0070671_101169761 | |||
| 2357 | Ga0070671_101200285 | |||
| 2358 | Ga0070671_101970988 | |||
| 2359 | Ga0070671_102000250 | |||
| 2360 | Ga0070674_100002846 | |||
| 2361 | Ga0070674_100029632 | |||
| 2362 | Ga0070674_100038484 | |||
| 2363 | Ga0070674_100233224 | |||
| 2364 | Ga0070674_100792281 | |||
| 2365 | Ga0070674_101416738 | |||
| 2366 | Ga0070674_101536814 | |||
| 2367 | Ga0070674_101616631 | |||
| 2368 | Ga0070674_101700792 | |||
| 2369 | Ga0070673_100027009 | |||
| 2370 | Ga0070673_100073056 | |||
| 2371 | Ga0070673_100102804 | |||
| 2372 | Ga0070673_100164539 | |||
| 2373 | Ga0070673_100260429 | |||
| 2374 | Ga0070673_100274931 | |||
| 2375 | Ga0070673_100329470 | |||
| 2376 | Ga0070673_100490950 | |||
| 2377 | Ga0070673_100768445 | |||
| 2378 | Ga0070673_101126854 | |||
| 2379 | Ga0070688_100004925 | |||
| 2380 | Ga0070688_100578414 | |||
| 2381 | Ga0070688_100648628 | |||
| 2382 | Ga0070688_101656546 | |||
| 2383 | Ga0070659_100008671 | |||
| 2384 | Ga0070659_100011205 | |||
| 2385 | Ga0070659_100051316 | |||
| 2386 | Ga0070659_100510243 | |||
| 2387 | Ga0070659_100710562 | |||
| 2388 | Ga0070659_100882452 | |||
| 2389 | Ga0070659_101020976 | |||
| 2390 | Ga0070659_101026845 | |||
| 2391 | Ga0070659_101090530 | |||
| 2392 | Ga0070667_100039183 | |||
| 2393 | Ga0070667_100257230 | |||
| 2394 | Ga0070667_100334063 | |||
| 2395 | Ga0070667_100334570 | |||
| 2396 | Ga0070667_100354680 | |||
| 2397 | Ga0070667_100533371 | |||
| 2398 | Ga0070667_100958035 | |||
| 2399 | Ga0070667_100989473 | |||
| 2400 | Ga0070667_101176329 | |||
| 2401 | Ga0070667_101205557 | |||
| 2402 | Ga0070667_101609601 | |||
| 2403 | Ga0070667_101677350 | |||
| 2404 | Ga0070667_102151080 | |||
| 2405 | Ga0070703_10571995 | |||
| 2406 | Ga0070709_10084240 | |||
| 2407 | Ga0070714_100003247 | |||
| 2408 | Ga0070713_100255447 | |||
| 2409 | Ga0070713_102202206 | |||
| 2410 | Ga0070710_10151357 | |||
| 2411 | Ga0070710_10918525 | |||
| 2412 | Ga0070701_10500696 | |||
| 2413 | Ga0070701_10595090 | |||
| 2414 | Ga0070711_100892482 | |||
| 2415 | Ga0070705_100393727 | |||
| 2416 | Ga0070700_101212675 | |||
| 2417 | Ga0070708_100063831 | |||
| 2418 | Ga0070708_101003617 | |||
| 2419 | Ga0070663_100003281 | |||
| 2420 | Ga0070663_100196930 | |||
| 2421 | Ga0070663_100290568 | |||
| 2422 | Ga0070663_100316389 | |||
| 2423 | Ga0070663_100974126 | |||
| 2424 | Ga0070663_101134196 | |||
| 2425 | Ga0070663_101300241 | |||
| 2426 | Ga0070663_101584809 | |||
| 2427 | Ga0070663_101716594 | |||
| 2428 | Ga0070678_100053998 | |||
| 2429 | Ga0070678_100060240 | |||
| 2430 | Ga0070678_100074682 | |||
| 2431 | Ga0070678_100080841 | |||
| 2432 | Ga0070678_100086444 | |||
| 2433 | Ga0070678_100093252 | |||
| 2434 | Ga0070678_100097628 | |||
| 2435 | Ga0070678_100226044 | |||
| 2436 | Ga0070678_100417015 | |||
| 2437 | Ga0070678_100435618 | |||
| 2438 | Ga0070678_100736692 | |||
| 2439 | Ga0070678_100964237 | |||
| 2440 | Ga0070678_100974049 | |||
| 2441 | Ga0070678_101332825 | |||
| 2442 | Ga0070678_101701187 | |||
| 2443 | Ga0070678_101707733 | |||
| 2444 | Ga0070678_101961243 | |||
| 2445 | Ga0070678_102104866 | |||
| 2446 | Ga0070662_100013275 | |||
| 2447 | Ga0070662_100043528 | |||
| 2448 | Ga0070662_100052894 | |||
| 2449 | Ga0070662_100127998 | |||
| 2450 | Ga0070662_100262606 | |||
| 2451 | Ga0070662_100287034 | |||
| 2452 | Ga0070662_100418097 | |||
| 2453 | Ga0070662_100576707 | |||
| 2454 | Ga0070662_100596614 | |||
| 2455 | Ga0070662_100598633 | |||
| 2456 | Ga0070662_100896512 | |||
| 2457 | Ga0070662_101444633 | |||
| 2458 | Ga0070662_101616173 | |||
| 2459 | Ga0070662_101678461 | |||
| 2460 | Ga0070681_10170120 | |||
| 2461 | Ga0070681_10265946 | |||
| 2462 | Ga0068867_100000329 | |||
| 2463 | Ga0068867_100001932 | |||
| 2464 | Ga0068867_100020667 | |||
| 2465 | Ga0068867_100056082 | |||
| 2466 | Ga0068867_100102861 | |||
| 2467 | Ga0068867_100115742 | |||
| 2468 | Ga0068867_100178615 | |||
| 2469 | Ga0068867_100248108 | |||
| 2470 | Ga0068867_100422376 | |||
| 2471 | Ga0068867_100548975 | |||
| 2472 | Ga0068867_100623126 | |||
| 2473 | Ga0068867_100691947 | |||
| 2474 | Ga0068867_100944551 | |||
| 2475 | Ga0068867_101049289 | |||
| 2476 | Ga0068867_101129962 | |||
| 2477 | Ga0070685_10693949 | |||
| 2478 | Ga0070685_10833306 | |||
| 2479 | Ga0070685_11177346 | |||
| 2480 | Ga0070685_11588165 | |||
| 2481 | Ga0070706_100004486 | |||
| 2482 | Ga0070706_100096620 | |||
| 2483 | Ga0070707_100355610 | |||
| 2484 | Ga0070698_100138790 | |||
| 2485 | Ga0070699_101436279 | |||
| 2486 | Ga0070679_100043614 | |||
| 2487 | Ga0070679_100212093 | |||
| 2488 | Ga0070679_100241396 | |||
| 2489 | Ga0070679_100475313 | |||
| 2490 | Ga0070679_101126452 | |||
| 2491 | Ga0070684_100181994 | |||
| 2492 | Ga0070684_100202985 | |||
| 2493 | Ga0070684_100775796 | |||
| 2494 | Ga0070684_102145738 | |||
| 2495 | Ga0068853_100004811 | |||
| 2496 | Ga0068853_100007795 | |||
| 2497 | Ga0068853_100010420 | |||
| 2498 | Ga0068853_100105575 | |||
| 2499 | Ga0068853_100160997 | |||
| 2500 | Ga0068853_100281317 | |||
| 2501 | Ga0068853_100490057 | |||
| 2502 | Ga0068853_100522230 | |||
| 2503 | Ga0070672_100001451 | |||
| 2504 | Ga0070672_100015547 | |||
| 2505 | Ga0070672_100021276 | |||
| 2506 | Ga0070672_100027777 | |||
| 2507 | Ga0070672_100030773 | |||
| 2508 | Ga0070672_100033709 | |||
| 2509 | Ga0070672_100042276 | |||
| 2510 | Ga0070672_100135479 | |||
| 2511 | Ga0070672_100318781 | |||
| 2512 | Ga0070672_100332166 | |||
| 2513 | Ga0070672_100412143 | |||
| 2514 | Ga0070672_100572100 | |||
| 2515 | Ga0070672_101391110 | |||
| 2516 | Ga0070695_100085874 | |||
| 2517 | Ga0070693_100026317 | |||
| 2518 | Ga0070693_100629876 | |||
| 2519 | Ga0070665_100543803 | |||
| 2520 | Ga0070665_100790261 | |||
| 2521 | Ga0070665_100853711 | |||
| 2522 | Ga0070665_101205973 | |||
| 2523 | Ga0070665_102467209 | |||
| 2524 | Ga0068855_100015899 | |||
| 2525 | Ga0068855_100019544 | |||
| 2526 | Ga0068855_100399137 | |||
| 2527 | Ga0068855_100409839 | |||
| 2528 | Ga0068855_100546779 | |||
| 2529 | Ga0070664_100001831 | |||
| 2530 | Ga0070664_100040136 | |||
| 2531 | Ga0070664_100148636 | |||
| 2532 | Ga0070664_100230636 | |||
| 2533 | Ga0070664_100262430 | |||
| 2534 | Ga0070664_100285705 | |||
| 2535 | Ga0070664_100512445 | |||
| 2536 | Ga0070664_100832791 | |||
| 2537 | Ga0070664_101046865 | |||
| 2538 | Ga0070664_101047334 | |||
| 2539 | Ga0070664_101638866 | |||
| 2540 | Ga0070664_102223047 | |||
| 2541 | Ga0068857_100001323 | |||
| 2542 | Ga0068857_100188666 | |||
| 2543 | Ga0068857_100220281 | |||
| 2544 | Ga0068857_100804946 | |||
| 2545 | Ga0068857_100923447 | |||
| 2546 | Ga0068857_101427885 | |||
| 2547 | Ga0068857_102188780 | |||
| 2548 | Ga0068854_100014719 | |||
| 2549 | Ga0068854_100499034 | |||
| 2550 | Ga0068854_100691507 | |||
| 2551 | Ga0068854_100801982 | |||
| 2552 | Ga0068856_100012520 | |||
| 2553 | Ga0068856_100234744 | |||
| 2554 | Ga0068856_100588995 | |||
| 2555 | Ga0070702_100330559 | |||
| 2556 | Ga0070702_100390308 | |||
| 2557 | Ga0070702_100970483 | |||
| 2558 | Ga0070702_101678808 | |||
| 2559 | Ga0068852_100003059 | |||
| 2560 | Ga0068852_100003215 | |||
| 2561 | Ga0068852_100005883 | |||
| 2562 | Ga0068852_100060508 | |||
| 2563 | Ga0068852_100063413 | |||
| 2564 | Ga0068852_100081438 | |||
| 2565 | Ga0068852_100085851 | |||
| 2566 | Ga0068852_100281484 | |||
| 2567 | Ga0068852_100289797 | |||
| 2568 | Ga0068852_100338183 | |||
| 2569 | Ga0068852_100429912 | |||
| 2570 | Ga0068852_100496905 | |||
| 2571 | Ga0068852_100623488 | |||
| 2572 | Ga0068852_100877640 | |||
| 2573 | Ga0068852_100944013 | |||
| 2574 | Ga0068852_101778848 | |||
| 2575 | Ga0068852_101993761 | |||
| 2576 | Ga0068852_102203231 | |||
| 2577 | Ga0068852_102555406 | |||
| 2578 | Ga0068859_100024423 | |||
| 2579 | Ga0068859_100030871 | |||
| 2580 | Ga0068859_100205505 | |||
| 2581 | Ga0068859_100420551 | |||
| 2582 | Ga0068864_100003978 | |||
| 2583 | Ga0068864_100026806 | |||
| 2584 | Ga0068864_100070862 | |||
| 2585 | Ga0068864_100074432 | |||
| 2586 | Ga0068864_100186642 | |||
| 2587 | Ga0068864_100507830 | |||
| 2588 | Ga0068864_100959443 | |||
| 2589 | Ga0068864_102179872 | |||
| 2590 | Ga0068864_102491605 | |||
| 2591 | Ga0068866_10010148 | |||
| 2592 | Ga0068866_10092812 | |||
| 2593 | Ga0068866_10246875 | |||
| 2594 | Ga0068866_10624189 | |||
| 2595 | Ga0068861_100007969 | |||
| 2596 | Ga0068861_100050459 | |||
| 2597 | Ga0068861_100252792 | |||
| 2598 | Ga0068861_100566595 | |||
| 2599 | Ga0068861_100754860 | |||
| 2600 | Ga0068861_101024062 | |||
| 2601 | Ga0068861_101437731 | |||
| 2602 | Ga0068861_102366491 | |||
| 2603 | Ga0068851_10010993 | |||
| 2604 | Ga0068851_10013080 | |||
| 2605 | Ga0068851_10049026 | |||
| 2606 | Ga0068851_10061522 | |||
| 2607 | Ga0068851_10110219 | |||
| 2608 | Ga0068851_10232097 | |||
| 2609 | Ga0068851_10365005 | |||
| 2610 | Ga0068851_10403524 | |||
| 2611 | Ga0068851_10871972 | |||
| 2612 | Ga0068870_10184872 | |||
| 2613 | Ga0068870_10286484 | |||
| 2614 | Ga0068870_10433751 | |||
| 2615 | Ga0068863_100019694 | |||
| 2616 | Ga0068863_100076202 | |||
| 2617 | Ga0068863_100160408 | |||
| 2618 | Ga0068863_100294731 | |||
| 2619 | Ga0068863_100352912 | |||
| 2620 | Ga0068863_100587577 | |||
| 2621 | Ga0068863_102685320 | |||
| 2622 | Ga0068858_100001515 | |||
| 2623 | Ga0068858_100001818 | |||
| 2624 | Ga0068858_100003704 | |||
| 2625 | Ga0068860_100001009 | |||
| 2626 | Ga0068860_100003030 | |||
| 2627 | Ga0068860_100057253 | |||
| 2628 | Ga0068860_100249680 | |||
| 2629 | Ga0068860_100730483 | |||
| 2630 | Ga0068860_102665865 | |||
| 2631 | Ga0068862_100036617 | |||
| 2632 | Ga0068862_100243673 | |||
| 2633 | Ga0068862_101222035 | |||
| 2634 | Ga0070717_10994756 | |||
| 2635 | Ga0075365_10270767 | |||
| 2636 | Ga0075368_10069600 | |||
| 2637 | Ga0075363_100009238 | |||
| 2638 | Ga0075363_100131110 | |||
| 2639 | Ga0075363_100157455 | |||
| 2640 | Ga0075363_100301776 | |||
| 2641 | Ga0075364_10002974 | |||
| 2642 | Ga0075364_10121068 | |||
| 2643 | Ga0075364_10187923 | |||
| 2644 | Ga0070715_10214039 | |||
| 2645 | Ga0070716_100205061 | |||
| 2646 | Ga0070716_100776094 | |||
| 2647 | Ga0070712_101297678 | |||
| 2648 | Ga0075362_10010715 | |||
| 2649 | Ga0075362_10021615 | |||
| 2650 | Ga0075362_10064250 | |||
| 2651 | Ga0075362_10162263 | |||
| 2652 | Ga0075362_10173547 | |||
| 2653 | Ga0075362_10190963 | |||
| 2654 | Ga0075362_10409447 | |||
| 2655 | Ga0075362_10434037 | |||
| 2656 | Ga0075362_10500658 | |||
| 2657 | Ga0075362_10516424 | |||
| 2658 | Ga0075362_10672741 | |||
| 2659 | Ga0075367_10015588 | |||
| 2660 | Ga0075367_10033387 | |||
| 2661 | Ga0075367_10056015 | |||
| 2662 | Ga0075367_10078408 | |||
| 2663 | Ga0075367_10389942 | |||
| 2664 | Ga0075369_10007815 | |||
| 2665 | Ga0075369_10013367 | |||
| 2666 | Ga0075369_10104184 | |||
| 2667 | Ga0075369_10408093 | |||
| 2668 | Ga0075366_10025896 | |||
| 2669 | Ga0075366_10046947 | |||
| 2670 | Ga0075366_10058370 | |||
| 2671 | Ga0075366_10083646 | |||
| 2672 | Ga0075366_10124788 | |||
| 2673 | Ga0075366_10179318 | |||
| 2674 | Ga0075366_10251270 | |||
| 2675 | Ga0075366_10317687 | |||
| 2676 | Ga0075366_10371893 | |||
| 2677 | Ga0075366_10479410 | |||
| 2678 | Ga0075366_10485219 | |||
| 2679 | Ga0075366_10577374 | |||
| 2680 | Ga0075366_10638500 | |||
| 2681 | Ga0075366_10859577 | |||
| 2682 | Ga0075366_10944258 | |||
| 2683 | Ga0097621_100016134 | |||
| 2684 | Ga0097621_100056447 | |||
| 2685 | Ga0097621_100096593 | |||
| 2686 | Ga0097621_100104372 | |||
| 2687 | Ga0097621_100406286 | |||
| 2688 | Ga0097621_100566255 | |||
| 2689 | Ga0097621_101293660 | |||
| 2690 | Ga0097621_101392461 | |||
| 2691 | Ga0075370_10000524 | |||
| 2692 | Ga0075370_10002753 | |||
| 2693 | Ga0075370_10010292 | |||
| 2694 | Ga0075370_10014590 | |||
| 2695 | Ga0075370_10024961 | |||
| 2696 | Ga0075370_10054018 | |||
| 2697 | Ga0075370_10104776 | |||
| 2698 | Ga0075370_10130104 | |||
| 2699 | Ga0075370_10137636 | |||
| 2700 | Ga0075370_10182783 | |||
| 2701 | Ga0075370_10194837 | |||
| 2702 | Ga0075370_10198370 | |||
| 2703 | Ga0075370_10321799 | |||
| 2704 | Ga0075370_10440707 | |||
| 2705 | Ga0075370_10479758 | |||
| 2706 | Ga0075370_10505437 | |||
| 2707 | Ga0075370_10511414 | |||
| 2708 | Ga0075370_10656904 | |||
| 2709 | Ga0075370_10795353 | |||
| 2710 | Ga0068871_100083637 | |||
| 2711 | Ga0068871_100163910 | |||
| 2712 | Ga0068871_100183476 | |||
| 2713 | Ga0068871_100321654 | |||
| 2714 | Ga0068871_100518079 | |||
| 2715 | Ga0068871_100886165 | |||
| 2716 | Ga0068871_100890569 | |||
| 2717 | Ga0068871_101112981 | |||
| 2718 | Ga0068871_101214269 | |||
| 2719 | Ga0068871_101446739 | |||
| 2720 | Ga0068871_101757230 | |||
| 2721 | Ga0075428_100529609 | |||
| 2722 | Ga0075428_101653622 | |||
| 2723 | Ga0075430_100023009 | |||
| 2724 | Ga0075434_100130115 | |||
| 2725 | Ga0075429_100008966 | |||
| 2726 | Ga0068865_100091831 | |||
| 2727 | Ga0068865_100097410 | |||
| 2728 | Ga0068865_100112935 | |||
| 2729 | Ga0068865_100367678 | |||
| 2730 | Ga0068865_100546026 | |||
| 2731 | Ga0097620_100024424 | |||
| 2732 | Ga0097620_100030873 | |||
| 2733 | Ga0097620_100205485 | |||
| 2734 | Ga0097620_100420551 | |||
| 2735 | Ga0079104_1000040 | |||
| 2736 | Ga0079104_1044093 | |||
| 2737 | Ga0099826_10238378 | |||
| 2738 | Ga0105251_10343262 | |||
| 2739 | Ga0105244_10026422 | |||
| 2740 | Ga0105244_10480951 | |||
| 2741 | Ga0105240_10002903 | |||
| 2742 | Ga0105240_10030212 | |||
| 2743 | Ga0105240_10039246 | |||
| 2744 | Ga0105240_10183372 | |||
| 2745 | Ga0105240_10221428 | |||
| 2746 | Ga0105240_10721263 | |||
| 2747 | Ga0111539_10492911 | |||
| 2748 | Ga0111539_10542458 | |||
| 2749 | Ga0111539_10867708 | |||
| 2750 | Ga0105245_10008631 | |||
| 2751 | Ga0105245_10049840 | |||
| 2752 | Ga0105245_10061364 | |||
| 2753 | Ga0105245_10293445 | |||
| 2754 | Ga0105245_11520681 | |||
| 2755 | Ga0105245_12155683 | |||
| 2756 | Ga0105247_10237932 | |||
| 2757 | Ga0105247_10253737 | |||
| 2758 | Ga0105247_10947597 | |||
| 2759 | Ga0114129_10023973 | |||
| 2760 | Ga0114129_10267738 | |||
| 2761 | Ga0105243_10000197 | |||
| 2762 | Ga0105243_10008438 | |||
| 2763 | Ga0105243_10013128 | |||
| 2764 | Ga0105243_10083870 | |||
| 2765 | Ga0105243_10312678 | |||
| 2766 | Ga0105243_10475551 | |||
| 2767 | Ga0105243_11079602 | |||
| 2768 | Ga0105243_11459518 | |||
| 2769 | Ga0105243_12658700 | |||
| 2770 | Ga0105241_10086637 | |||
| 2771 | Ga0105241_10191455 | |||
| 2772 | Ga0105241_10669885 | |||
| 2773 | Ga0105241_11599311 | |||
| 2774 | Ga0105241_11902796 | |||
| 2775 | Ga0105242_10058974 | |||
| 2776 | Ga0105242_10282573 | |||
| 2777 | Ga0105242_10339727 | |||
| 2778 | Ga0105242_11759390 | |||
| 2779 | Ga0105242_12123191 | |||
| 2780 | Ga0105248_10013699 | |||
| 2781 | Ga0105248_10031936 | |||
| 2782 | Ga0105248_10285735 | |||
| 2783 | Ga0105248_10446577 | |||
| 2784 | Ga0105248_10459956 | |||
| 2785 | Ga0105248_10754462 | |||
| 2786 | Ga0105248_10989899 | |||
| 2787 | Ga0105248_11718831 | |||
| 2788 | Ga0105248_11948689 | |||
| 2789 | Ga0105237_10000605 | |||
| 2790 | Ga0105237_10014977 | |||
| 2791 | Ga0105237_10021204 | |||
| 2792 | Ga0105237_10024647 | |||
| 2793 | Ga0105237_10035003 | |||
| 2794 | Ga0105237_10073055 | |||
| 2795 | Ga0105237_10452160 | |||
| 2796 | Ga0105238_10001575 | |||
| 2797 | Ga0105238_10028942 | |||
| 2798 | Ga0105238_10307061 | |||
| 2799 | Ga0105238_10378039 | |||
| 2800 | Ga0105238_10393781 | |||
| 2801 | Ga0105238_10483868 | |||
| 2802 | Ga0105238_10898267 | |||
| 2803 | Ga0105249_10138150 | |||
| 2804 | Ga0105249_10394623 | |||
| 2805 | Ga0105249_10755732 | |||
| 2806 | Ga0105249_10957132 | |||
| 2807 | Ga0105249_10978956 | |||
| 2808 | Ga0105249_12241215 | |||
| 2809 | Ga0105239_10000328 | |||
| 2810 | Ga0105239_10026320 | |||
| 2811 | Ga0105239_10031452 | |||
| 2812 | Ga0105239_10114097 | |||
| 2813 | Ga0105239_11237406 | |||
| 2814 | Ga0105246_10153471 | |||
| 2815 | Ga0105246_10439382 | |||
| 2816 | Ga0105246_10458010 | |||
| 2817 | Ga0105246_10616419 | |||
| 2818 | Ga0105246_11820562 | |||
| 2819 | Ga0105246_12419946 | |||
| 2820 | Ga0157317_1005765 | |||
| 2821 | Ga0157328_1027883 | |||
| 2822 | Ga0157337_1031094 | |||
| 2823 | Ga0157325_1015900 | |||
| 2824 | Ga0157329_1014777 | |||
| 2825 | Ga0157323_1004876 | |||
| 2826 | Ga0157314_1005685 | |||
| 2827 | Ga0157315_1034929 | |||
| 2828 | Ga0157316_1005909 | |||
| 2829 | Ga0157327_1046621 | |||
| 2830 | Ga0157338_1059789 | |||
| 2831 | Ga0157373_10009706 | |||
| 2832 | Ga0157373_10020413 | |||
| 2833 | Ga0157373_10213609 | |||
| 2834 | Ga0157373_10329462 | |||
| 2835 | Ga0157373_10371991 | |||
| 2836 | Ga0157373_11023067 | |||
| 2837 | Ga0157373_11092864 | |||
| 2838 | Ga0157371_10034557 | |||
| 2839 | Ga0157371_10094994 | |||
| 2840 | Ga0157371_10095280 | |||
| 2841 | Ga0157371_10907224 | |||
| 2842 | Ga0157371_11150079 | |||
| 2843 | Ga0157371_11595439 | |||
| 2844 | Ga0157370_10026238 | |||
| 2845 | Ga0157370_10233816 | |||
| 2846 | Ga0157370_10653068 | |||
| 2847 | Ga0157370_11467787 | |||
| 2848 | Ga0157370_11660903 | |||
| 2849 | Ga0157370_11811047 | |||
| 2850 | Ga0157370_12092579 | |||
| 2851 | Ga0157369_10014064 | |||
| 2852 | Ga0157369_10014312 | |||
| 2853 | Ga0157369_10298892 | |||
| 2854 | Ga0157369_10957638 | |||
| 2855 | Ga0157374_10007375 | |||
| 2856 | Ga0157374_10047442 | |||
| 2857 | Ga0157374_10074924 | |||
| 2858 | Ga0157374_10202503 | |||
| 2859 | Ga0157374_10765796 | |||
| 2860 | Ga0157374_10994380 | |||
| 2861 | Ga0157374_11476736 | |||
| 2862 | Ga0157374_12492433 | |||
| 2863 | Ga0157378_10113037 | |||
| 2864 | Ga0157378_10138443 | |||
| 2865 | Ga0157378_10754387 | |||
| 2866 | Ga0157378_11027931 | |||
| 2867 | Ga0157378_11150283 | |||
| 2868 | Ga0157378_11505132 | |||
| 2869 | Ga0163162_10023275 | |||
| 2870 | Ga0163162_10060967 | |||
| 2871 | Ga0163162_10080866 | |||
| 2872 | Ga0163162_10128822 | |||
| 2873 | Ga0163162_10218886 | |||
| 2874 | Ga0163162_10696994 | |||
| 2875 | Ga0163162_10816582 | |||
| 2876 | Ga0163162_11052362 | |||
| 2877 | Ga0163162_11054926 | |||
| 2878 | Ga0163162_11324107 | |||
| 2879 | Ga0163162_11989478 | |||
| 2880 | Ga0163162_12242593 | |||
| 2881 | Ga0163162_12253968 | |||
| 2882 | Ga0163162_12395248 | |||
| 2883 | Ga0157372_10005958 | |||
| 2884 | Ga0157372_10010263 | |||
| 2885 | Ga0157372_10059208 | |||
| 2886 | Ga0157372_10502453 | |||
| 2887 | Ga0157372_10507343 | |||
| 2888 | Ga0157372_11772534 | |||
| 2889 | Ga0157372_11943755 | |||
| 2890 | Ga0157375_10024076 | |||
| 2891 | Ga0157375_10044133 | |||
| 2892 | Ga0157375_10165940 | |||
| 2893 | Ga0157375_10220885 | |||
| 2894 | Ga0157375_10543308 | |||
| 2895 | Ga0157375_11008528 | |||
| 2896 | Ga0157375_11096261 | |||
| 2897 | Ga0157375_11410600 | |||
| 2898 | Ga0157375_11918122 | |||
| 2899 | Ga0157375_12704414 | |||
| 2900 | Ga0157375_12882360 | |||
| 2901 | Ga0157375_13344920 | |||
| 2902 | Ga0163163_10220374 | |||
| 2903 | Ga0163163_10251732 | |||
| 2904 | Ga0163163_10394057 | |||
| 2905 | Ga0163163_10527368 | |||
| 2906 | Ga0163163_10767023 | |||
| 2907 | Ga0163163_10998768 | |||
| 2908 | Ga0163163_11021015 | |||
| 2909 | Ga0163163_11230600 | |||
| 2910 | Ga0163163_11713957 | |||
| 2911 | Ga0163163_12521296 | |||
| 2912 | Ga0157380_10360353 | |||
| 2913 | Ga0157380_10607993 | |||
| 2914 | Ga0157380_10854464 | |||
| 2915 | Ga0157380_11008816 | |||
| 2916 | Ga0157380_11107608 | |||
| 2917 | Ga0157380_11265346 | |||
| 2918 | Ga0157380_11730149 | |||
| 2919 | Ga0157380_12519827 | |||
| 2920 | Ga0157380_12697823 | |||
| 2921 | Ga0157380_13486133 | |||
| 2922 | Ga0182008_10020420 | |||
| 2923 | Ga0182008_10096215 | |||
| 2924 | Ga0182008_10136468 | |||
| 2925 | Ga0182008_10383655 | |||
| 2926 | Ga0157377_10000170 | |||
| 2927 | Ga0157377_10043830 | |||
| 2928 | Ga0157377_10165085 | |||
| 2929 | Ga0157377_10461045 | |||
| 2930 | Ga0157379_10006124 | |||
| 2931 | Ga0157379_10018100 | |||
| 2932 | Ga0157379_10039682 | |||
| 2933 | Ga0157379_10082445 | |||
| 2934 | Ga0157379_10724686 | |||
| 2935 | Ga0157379_11528669 | |||
| 2936 | Ga0157376_10029275 | |||
| 2937 | Ga0157376_10128576 | |||
| 2938 | Ga0157376_10328604 | |||
| 2939 | Ga0157376_10334767 | |||
| 2940 | Ga0157376_10537979 | |||
| 2941 | Ga0157376_10998736 | |||
| 2942 | Ga0157376_11986897 | |||
| 2943 | Ga0157376_12879482 | |||
| 2944 | Ga0157376_12881165 | |||
| 2945 | Ga0182006_1051132 | |||
| 2946 | Ga0182006_1121441 | |||
| 2947 | Ga0182006_1179085 | |||
| 2948 | Ga0182006_1273992 | |||
| 2949 | Ga0182007_10002567 | |||
| 2950 | Ga0182005_1017803 | |||
| 2951 | Ga0182005_1033460 | |||
| 2952 | Ga0182005_1120196 | |||
| 2953 | Ga0183362_10001 | |||
| 2954 | Ga0163161_10017494 | |||
| 2955 | Ga0163161_10144969 | |||
| 2956 | Ga0163161_10255007 | |||
| 2957 | Ga0163161_10325350 | |||
| 2958 | Ga0163161_10401696 | |||
| 2959 | Ga0163161_10443080 | |||
| 2960 | Ga0163161_10999557 | |||
| 2961 | Ga0163161_11013310 | |||
| 2962 | Ga0163161_11119543 | |||
| 2963 | Ga0163161_11681147 | |||
| 2964 | Ga0163161_11761836 | |||
| 2965 | Ga0206353_11880330 | |||
| 2966 | Ga0213876_10076899 | |||
| 2967 | Ga0213876_10358837 | |||
| 2968 | Ga0209436_102722 | |||
| 2969 | Ga0209436_113640 | |||
| 2970 | Ga0209672_102060 | |||
| 2971 | Ga0209147_101677 | |||
| 2972 | Ga0209258_100078 | |||
| 2973 | Ga0207425_1000726 | |||
| 2974 | Ga0207425_1000881 | |||
| 2975 | Ga0207425_1002203 | |||
| 2976 | Ga0209148_1000086 | |||
| 2977 | Ga0209129_1000027 | |||
| 2978 | Ga0209129_1000054 | |||
| 2979 | Ga0209565_1000317 | |||
| 2980 | Ga0209565_1001263 | |||
| 2981 | Ga0209565_1015434 | |||
| 2982 | Ga0207666_1004468 | |||
| 2983 | Ga0209673_1000168 | |||
| 2984 | Ga0209673_1000355 | |||
| 2985 | Ga0209673_1005247 | |||
| 2986 | Ga0209673_1038095 | |||
| 2987 | Ga0209130_1000206 | |||
| 2988 | Ga0209130_1001172 | |||
| 2989 | Ga0209130_1035061 | |||
| 2990 | Ga0207673_1007194 | |||
| 2991 | Ga0207673_1042741 | |||
| 2992 | Ga0209675_1000388 | |||
| 2993 | Ga0209675_1002561 | |||
| 2994 | Ga0209675_1004338 | |||
| 2995 | Ga0209675_1013516 | |||
| 2996 | Ga0209676_1000103 | |||
| 2997 | Ga0209676_1000290 | |||
| 2998 | Ga0209676_1005377 | |||
| 2999 | Ga0209025_1000201 | |||
| 3000 | Ga0209025_1019038 | |||
| 3001 | Ga0209564_1000014 | |||
| 3002 | Ga0209564_1000289 | |||
| 3003 | Ga0209564_1000408 | |||
| 3004 | Ga0209758_1000034 | |||
| 3005 | Ga0209758_1000193 | |||
| 3006 | Ga0209758_1000208 | |||
| 3007 | Ga0209758_1005547 | |||
| 3008 | Ga0209050_1000012 | |||
| 3009 | Ga0209050_1000416 | |||
| 3010 | Ga0209050_1001233 | |||
| 3011 | Ga0209050_1005046 | |||
| 3012 | Ga0209050_1008921 | |||
| 3013 | Ga0209050_1052859 | |||
| 3014 | Ga0209256_1000066 | |||
| 3015 | Ga0209256_1000092 | |||
| 3016 | Ga0209256_1001887 | |||
| 3017 | Ga0209256_1022736 | |||
| 3018 | Ga0209256_1036914 | |||
| 3019 | Ga0207426_1000067 | |||
| 3020 | Ga0207426_1000266 | |||
| 3021 | Ga0209051_1000019 | |||
| 3022 | Ga0209051_1000020 | |||
| 3023 | Ga0209051_1000141 | |||
| 3024 | Ga0209051_1000235 | |||
| 3025 | Ga0209051_1007019 | |||
| 3026 | Ga0209051_1054597 | |||
| 3027 | Ga0209257_1000024 | |||
| 3028 | Ga0209257_1000085 | |||
| 3029 | Ga0209257_1002015 | |||
| 3030 | Ga0209257_1014801 | |||
| 3031 | Ga0209257_1028057 | |||
| 3032 | Ga0209257_1110720 | |||
| 3033 | Ga0207697_10046050 | |||
| 3034 | Ga0207697_10146000 | |||
| 3035 | Ga0207697_10350704 | |||
| 3036 | Ga0207697_10418582 | |||
| 3037 | Ga0207656_10019106 | |||
| 3038 | Ga0207656_10054086 | |||
| 3039 | Ga0207656_10071784 | |||
| 3040 | Ga0207656_10078424 | |||
| 3041 | Ga0207656_10093435 | |||
| 3042 | Ga0207656_10302931 | |||
| 3043 | Ga0207656_10410776 | |||
| 3044 | Ga0207656_10415708 | |||
| 3045 | Ga0207682_10002310 | |||
| 3046 | Ga0207682_10008487 | |||
| 3047 | Ga0207682_10026248 | |||
| 3048 | Ga0207682_10120596 | |||
| 3049 | Ga0207682_10200063 | |||
| 3050 | Ga0207682_10397213 | |||
| 3051 | Ga0207682_10616884 | |||
| 3052 | Ga0207692_10443623 | |||
| 3053 | Ga0207642_10006194 | |||
| 3054 | Ga0207642_10008862 | |||
| 3055 | Ga0207642_10210723 | |||
| 3056 | Ga0207710_10236509 | |||
| 3057 | Ga0207688_10009912 | |||
| 3058 | Ga0207688_10264029 | |||
| 3059 | Ga0207688_10279028 | |||
| 3060 | Ga0207680_10002216 | |||
| 3061 | Ga0207680_10002264 | |||
| 3062 | Ga0207680_10270354 | |||
| 3063 | Ga0207680_10358265 | |||
| 3064 | Ga0207680_10474754 | |||
| 3065 | Ga0207680_10895762 | |||
| 3066 | Ga0207680_10945479 | |||
| 3067 | Ga0207647_10221382 | |||
| 3068 | Ga0207685_10025303 | |||
| 3069 | Ga0207645_10003401 | |||
| 3070 | Ga0207645_10026486 | |||
| 3071 | Ga0207645_10046517 | |||
| 3072 | Ga0207645_10102536 | |||
| 3073 | Ga0207645_10207117 | |||
| 3074 | Ga0207645_10231411 | |||
| 3075 | Ga0207645_10313915 | |||
| 3076 | Ga0207643_10062542 | |||
| 3077 | Ga0207643_10173555 | |||
| 3078 | Ga0207643_10379750 | |||
| 3079 | Ga0207643_10581104 | |||
| 3080 | Ga0207643_10883314 | |||
| 3081 | Ga0207705_10033984 | |||
| 3082 | Ga0207705_10276873 | |||
| 3083 | Ga0207705_10609256 | |||
| 3084 | Ga0207705_10673759 | |||
| 3085 | Ga0207705_11448229 | |||
| 3086 | Ga0207684_10005949 | |||
| 3087 | Ga0207684_10071919 | |||
| 3088 | Ga0207654_10082391 | |||
| 3089 | Ga0207654_10736192 | |||
| 3090 | Ga0207707_10174846 | |||
| 3091 | Ga0207707_10425784 | |||
| 3092 | Ga0207695_10002543 | |||
| 3093 | Ga0207695_10032900 | |||
| 3094 | Ga0207695_10061905 | |||
| 3095 | Ga0207695_10088943 | |||
| 3096 | Ga0207695_10218048 | |||
| 3097 | Ga0207695_10638987 | |||
| 3098 | Ga0207671_10006429 | |||
| 3099 | Ga0207671_10010328 | |||
| 3100 | Ga0207671_10022402 | |||
| 3101 | Ga0207671_10035144 | |||
| 3102 | Ga0207671_10499298 | |||
| 3103 | Ga0207671_10610822 | |||
| 3104 | Ga0207671_10997043 | |||
| 3105 | Ga0207660_10141322 | |||
| 3106 | Ga0207660_10458070 | |||
| 3107 | Ga0207662_10052728 | |||
| 3108 | Ga0207662_10434229 | |||
| 3109 | Ga0207662_10449027 | |||
| 3110 | Ga0207662_11227200 | |||
| 3111 | Ga0207657_10002308 | |||
| 3112 | Ga0207657_10015804 | |||
| 3113 | Ga0207657_10224482 | |||
| 3114 | Ga0207657_11352505 | |||
| 3115 | Ga0207649_10012057 | |||
| 3116 | Ga0207649_10019732 | |||
| 3117 | Ga0207649_10626611 | |||
| 3118 | Ga0207649_10715711 | |||
| 3119 | Ga0207652_10081244 | |||
| 3120 | Ga0207652_10197585 | |||
| 3121 | Ga0207652_10446683 | |||
| 3122 | Ga0207646_10033392 | |||
| 3123 | Ga0207681_10000795 | |||
| 3124 | Ga0207681_10017788 | |||
| 3125 | Ga0207681_10084282 | |||
| 3126 | Ga0207681_10084985 | |||
| 3127 | Ga0207681_10098706 | |||
| 3128 | Ga0207681_10527279 | |||
| 3129 | Ga0207681_10586239 | |||
| 3130 | Ga0207694_10004060 | |||
| 3131 | Ga0207694_10029043 | |||
| 3132 | Ga0207694_10213474 | |||
| 3133 | Ga0207694_10336316 | |||
| 3134 | Ga0207694_10357825 | |||
| 3135 | Ga0207694_10446452 | |||
| 3136 | Ga0207650_10002550 | |||
| 3137 | Ga0207650_10004501 | |||
| 3138 | Ga0207650_10014903 | |||
| 3139 | Ga0207650_10131086 | |||
| 3140 | Ga0207650_10209144 | |||
| 3141 | Ga0207650_10373972 | |||
| 3142 | Ga0207650_10410273 | |||
| 3143 | Ga0207650_11159414 | |||
| 3144 | Ga0207650_11297563 | |||
| 3145 | Ga0207659_10013398 | |||
| 3146 | Ga0207659_10020083 | |||
| 3147 | Ga0207659_10032887 | |||
| 3148 | Ga0207659_10037282 | |||
| 3149 | Ga0207659_10201000 | |||
| 3150 | Ga0207659_10228388 | |||
| 3151 | Ga0207659_10344347 | |||
| 3152 | Ga0207659_10657623 | |||
| 3153 | Ga0207659_10917374 | |||
| 3154 | Ga0207659_10982537 | |||
| 3155 | Ga0207659_11119751 | |||
| 3156 | Ga0207687_11076475 | |||
| 3157 | Ga0207687_11099818 | |||
| 3158 | Ga0207664_10025828 | |||
| 3159 | Ga0207644_10002048 | |||
| 3160 | Ga0207644_10002949 | |||
| 3161 | Ga0207644_10348255 | |||
| 3162 | Ga0207644_10530117 | |||
| 3163 | Ga0207644_11180534 | |||
| 3164 | Ga0207644_11460616 | |||
| 3165 | Ga0207644_11659747 | |||
| 3166 | Ga0207690_10005174 | |||
| 3167 | Ga0207690_10028785 | |||
| 3168 | Ga0207690_10219101 | |||
| 3169 | Ga0207690_11282417 | |||
| 3170 | Ga0207690_11301379 | |||
| 3171 | Ga0207690_11627988 | |||
| 3172 | Ga0207706_10014450 | |||
| 3173 | Ga0207706_10032604 | |||
| 3174 | Ga0207706_10208896 | |||
| 3175 | Ga0207706_10265450 | |||
| 3176 | Ga0207706_10445308 | |||
| 3177 | Ga0207706_10474106 | |||
| 3178 | Ga0207706_10616074 | |||
| 3179 | Ga0207706_10761981 | |||
| 3180 | Ga0207706_10886243 | |||
| 3181 | Ga0207706_11121191 | |||
| 3182 | Ga0207686_10046095 | |||
| 3183 | Ga0207686_10047390 | |||
| 3184 | Ga0207686_10131449 | |||
| 3185 | Ga0207686_10249615 | |||
| 3186 | Ga0207686_10289968 | |||
| 3187 | Ga0207709_10000383 | |||
| 3188 | Ga0207709_10001296 | |||
| 3189 | Ga0207709_10030033 | |||
| 3190 | Ga0207709_10858658 | |||
| 3191 | Ga0207709_10929598 | |||
| 3192 | Ga0207709_11292534 | |||
| 3193 | Ga0207670_10030732 | |||
| 3194 | Ga0207670_10933017 | |||
| 3195 | Ga0207669_10041654 | |||
| 3196 | Ga0207669_10935431 | |||
| 3197 | Ga0207669_11398536 | |||
| 3198 | Ga0207669_11432381 | |||
| 3199 | Ga0207669_11727593 | |||
| 3200 | Ga0207704_10243329 | |||
| 3201 | Ga0207704_10330831 | |||
| 3202 | Ga0207704_10860243 | |||
| 3203 | Ga0207704_11003114 | |||
| 3204 | Ga0207704_11184036 | |||
| 3205 | Ga0207665_10109570 | |||
| 3206 | Ga0207691_10005390 | |||
| 3207 | Ga0207691_10007761 | |||
| 3208 | Ga0207691_10012093 | |||
| 3209 | Ga0207691_10026402 | |||
| 3210 | Ga0207691_10057886 | |||
| 3211 | Ga0207691_10058275 | |||
| 3212 | Ga0207691_10109518 | |||
| 3213 | Ga0207691_10131930 | |||
| 3214 | Ga0207691_10219778 | |||
| 3215 | Ga0207691_10261767 | |||
| 3216 | Ga0207691_10418523 | |||
| 3217 | Ga0207691_10538352 | |||
| 3218 | Ga0207691_10713981 | |||
| 3219 | Ga0207711_10012457 | |||
| 3220 | Ga0207711_10067509 | |||
| 3221 | Ga0207711_10126201 | |||
| 3222 | Ga0207711_10481256 | |||
| 3223 | Ga0207711_10849956 | |||
| 3224 | Ga0207711_10968069 | |||
| 3225 | Ga0207711_11137038 | |||
| 3226 | Ga0207711_11974308 | |||
| 3227 | Ga0207689_10003512 | |||
| 3228 | Ga0207689_10004908 | |||
| 3229 | Ga0207689_10050658 | |||
| 3230 | Ga0207689_10075589 | |||
| 3231 | Ga0207689_10102173 | |||
| 3232 | Ga0207689_10404359 | |||
| 3233 | Ga0207689_11273389 | |||
| 3234 | Ga0207661_10191726 | |||
| 3235 | Ga0207679_10004109 | |||
| 3236 | Ga0207679_10011721 | |||
| 3237 | Ga0207679_10014481 | |||
| 3238 | Ga0207679_10053631 | |||
| 3239 | Ga0207679_10061091 | |||
| 3240 | Ga0207679_10417878 | |||
| 3241 | Ga0207679_10613967 | |||
| 3242 | Ga0207679_10749071 | |||
| 3243 | Ga0207679_11674927 | |||
| 3244 | Ga0207667_10002655 | |||
| 3245 | Ga0207667_10009860 | |||
| 3246 | Ga0207667_10214430 | |||
| 3247 | Ga0207667_10586071 | |||
| 3248 | Ga0207651_10025563 | |||
| 3249 | Ga0207651_10060152 | |||
| 3250 | Ga0207651_10093139 | |||
| 3251 | Ga0207651_10541167 | |||
| 3252 | Ga0207651_10622978 | |||
| 3253 | Ga0207651_10722735 | |||
| 3254 | Ga0207651_11591610 | |||
| 3255 | Ga0207651_11774164 | |||
| 3256 | Ga0207712_10054882 | |||
| 3257 | Ga0207712_10598083 | |||
| 3258 | Ga0207712_10600466 | |||
| 3259 | Ga0207712_10939869 | |||
| 3260 | Ga0207668_10017712 | |||
| 3261 | Ga0207668_10633512 | |||
| 3262 | Ga0207668_10907040 | |||
| 3263 | Ga0207668_11450775 | |||
| 3264 | Ga0207640_10025789 | |||
| 3265 | Ga0207640_10140289 | |||
| 3266 | Ga0207640_10229824 | |||
| 3267 | Ga0207640_10449149 | |||
| 3268 | Ga0207640_10487586 | |||
| 3269 | Ga0207640_10500017 | |||
| 3270 | Ga0207640_10545529 | |||
| 3271 | Ga0207640_10711722 | |||
| 3272 | Ga0207658_10001151 | |||
| 3273 | Ga0207658_10005593 | |||
| 3274 | Ga0207658_10114940 | |||
| 3275 | Ga0207658_10146914 | |||
| 3276 | Ga0207658_10146925 | |||
| 3277 | Ga0207658_10171038 | |||
| 3278 | Ga0207658_10360032 | |||
| 3279 | Ga0207658_10671075 | |||
| 3280 | Ga0207658_10965157 | |||
| 3281 | Ga0207658_11447551 | |||
| 3282 | Ga0207677_10000452 | |||
| 3283 | Ga0207677_10037654 | |||
| 3284 | Ga0207677_10381138 | |||
| 3285 | Ga0207677_10482308 | |||
| 3286 | Ga0207677_10932485 | |||
| 3287 | Ga0207677_12038880 | |||
| 3288 | Ga0207703_10003262 | |||
| 3289 | Ga0207703_10007044 | |||
| 3290 | Ga0207703_10121427 | |||
| 3291 | Ga0207703_10413074 | |||
| 3292 | Ga0207639_10005439 | |||
| 3293 | Ga0207639_10025544 | |||
| 3294 | Ga0207639_10117049 | |||
| 3295 | Ga0207639_10190198 | |||
| 3296 | Ga0207639_10248274 | |||
| 3297 | Ga0207639_10354566 | |||
| 3298 | Ga0207639_10634407 | |||
| 3299 | Ga0207639_11608274 | |||
| 3300 | Ga0207639_12256148 | |||
| 3301 | Ga0207678_10002363 | |||
| 3302 | Ga0207678_10098740 | |||
| 3303 | Ga0207678_10305127 | |||
| 3304 | Ga0207678_10831301 | |||
| 3305 | Ga0207678_10968874 | |||
| 3306 | Ga0207678_11193875 | |||
| 3307 | Ga0207708_10064706 | |||
| 3308 | Ga0207708_10458336 | |||
| 3309 | Ga0207702_10044080 | |||
| 3310 | Ga0207702_10182928 | |||
| 3311 | Ga0207702_10578685 | |||
| 3312 | Ga0207702_12211938 | |||
| 3313 | Ga0207641_10013179 | |||
| 3314 | Ga0207641_10026325 | |||
| 3315 | Ga0207641_10038644 | |||
| 3316 | Ga0207641_10167453 | |||
| 3317 | Ga0207641_10429589 | |||
| 3318 | Ga0207641_10494108 | |||
| 3319 | Ga0207641_11613931 | |||
| 3320 | Ga0207648_10000748 | |||
| 3321 | Ga0207648_10004891 | |||
| 3322 | Ga0207648_10009156 | |||
| 3323 | Ga0207648_10015290 | |||
| 3324 | Ga0207648_10018447 | |||
| 3325 | Ga0207648_10153113 | |||
| 3326 | Ga0207648_10159491 | |||
| 3327 | Ga0207648_10308103 | |||
| 3328 | Ga0207648_10503985 | |||
| 3329 | Ga0207648_10877779 | |||
| 3330 | Ga0207648_10996400 | |||
| 3331 | Ga0207648_11329572 | |||
| 3332 | Ga0207648_11568146 | |||
| 3333 | Ga0207676_10012508 | |||
| 3334 | Ga0207676_10042218 | |||
| 3335 | Ga0207676_10052796 | |||
| 3336 | Ga0207676_10149898 | |||
| 3337 | Ga0207676_10163884 | |||
| 3338 | Ga0207676_10873679 | |||
| 3339 | Ga0207676_12560108 | |||
| 3340 | Ga0207674_10000040 | |||
| 3341 | Ga0207674_10009428 | |||
| 3342 | Ga0207674_10078389 | |||
| 3343 | Ga0207674_10082081 | |||
| 3344 | Ga0207674_10253170 | |||
| 3345 | Ga0207674_10773161 | |||
| 3346 | Ga0207674_10871479 | |||
| 3347 | Ga0207674_11484866 | |||
| 3348 | Ga0207674_11607913 | |||
| 3349 | Ga0207675_100003386 | |||
| 3350 | Ga0207675_100005550 | |||
| 3351 | Ga0207675_100059119 | |||
| 3352 | Ga0207675_100100746 | |||
| 3353 | Ga0207675_100731231 | |||
| 3354 | Ga0207675_100812892 | |||
| 3355 | Ga0207683_10008569 | |||
| 3356 | Ga0207683_10037960 | |||
| 3357 | Ga0207683_10064870 | |||
| 3358 | Ga0207683_10089863 | |||
| 3359 | Ga0207683_10116457 | |||
| 3360 | Ga0207683_10145705 | |||
| 3361 | Ga0207683_10278749 | |||
| 3362 | Ga0207683_10307655 | |||
| 3363 | Ga0207683_10410972 | |||
| 3364 | Ga0207683_10548197 | |||
| 3365 | Ga0207683_10574489 | |||
| 3366 | Ga0207683_10632075 | |||
| 3367 | Ga0207683_11151674 | |||
| 3368 | Ga0207683_12101076 | |||
| 3369 | Ga0207698_10005011 | |||
| 3370 | Ga0207698_10011131 | |||
| 3371 | Ga0207698_10115704 | |||
| 3372 | Ga0207698_10445721 | |||
| 3373 | Ga0207698_10672177 | |||
| 3374 | Ga0207698_10688459 | |||
| 3375 | Ga0207698_10787371 | |||
| 3376 | Ga0207698_10798694 | |||
| 3377 | Ga0207698_10994822 | |||
| 3378 | Ga0207698_11031752 | |||
| 3379 | Ga0207698_11308235 | |||
| 3380 | Ga0207698_11328955 | |||
| 3381 | Ga0207698_12659290 | |||
| 3382 | Ga0207698_12698549 | |||
| 3383 | Ga0209281_1000074 | |||
| 3384 | Ga0209969_1012477 | |||
| 3385 | Ga0209981_1004500 | |||
| 3386 | Ga0209996_1002081 | |||
| 3387 | Ga0209995_1016563 | |||
| 3388 | Ga0209995_1064430 | |||
| 3389 | Ga0209968_1000140 | |||
| 3390 | Ga0209999_1004899 | |||
| 3391 | Ga0210002_1106826 | |||
| 3392 | Ga0209966_1000388 | |||
| 3393 | Ga0209813_10061166 | |||
| 3394 | Ga0209974_10006661 | |||
| 3395 | Ga0209974_10034713 | |||
| 3396 | Ga0209974_10284711 | |||
| 3397 | Ga0207428_10621197 | |||
| 3398 | Ga0207428_10876374 | |||
| 3399 | Ga0268266_10037082 | |||
| 3400 | Ga0268266_11230998 | |||
| 3401 | Ga0268266_11705868 | |||
| 3402 | Ga0268265_10098075 | |||
| 3403 | Ga0268265_10121264 | |||
| 3404 | Ga0268265_10914139 | |||
| 3405 | Ga0268264_10003378 | |||
| 3406 | Ga0268264_10003920 | |||
| 3407 | Ga0268264_10141634 | |||
| 3408 | Ga0268264_10672979 | |||
| 3409 | Ga0268264_11168625 | |||
| 3410 | Ga0268264_11655308 | |||
| 3411 | Ga0268264_12694867 | |||
| 3412 | Ga0265323_10180575 | |||
| 3413 | Ga0307517_10005592 | |||
| 3414 | Ga0307517_10193402 | |||
| 3415 | Ga0307517_10222524 | |||
| 3416 | Ga0307517_10569249 | |||
| 3417 | Ga0307515_10000165 | |||
| 3418 | Ga0307515_10000232 | |||
| 3419 | Ga0307515_10000716 | |||
| 3420 | Ga0307515_10009711 | |||
| 3421 | Ga0307515_10029175 | |||
| 3422 | Ga0307515_10069456 | |||
| 3423 | Ga0307515_10100821 | |||
| 3424 | Ga0307515_10280252 | |||
| 3425 | Ga0307515_10524851 | |||
| 3426 | Ga0265324_10000007 | |||
| 3427 | Ga0307512_10125965 | |||
| 3428 | Ga0307512_10310690 | |||
| 3429 | Ga0314311_1161279 | |||
| 3430 | Ga0316179_1013512 | |||
| 3431 | Ga0316178_1081817 | |||
| 3432 | Ga0316180_1033826 | |||
| 3433 | Ga0316183_1096459 | |||
| 3434 | Ga0316181_1169024 | |||
| 3435 | Ga0316182_1190268 | |||
| 3436 | Ga0316182_1435093 | |||
| 3437 | Ga0265328_10004603 | |||
| 3438 | Ga0265328_10270814 | |||
| 3439 | Ga0265331_10002534 | |||
| 3440 | Ga0265331_10165768 | |||
| 3441 | Ga0265327_10000028 | |||
| 3442 | Ga0265327_10005919 | |||
| 3443 | Ga0265327_10256515 | |||
| 3444 | Ga0265316_10000181 | |||
| 3445 | Ga0265316_10040823 | |||
| 3446 | Ga0265316_10175648 | |||
| 3447 | Ga0307513_10020857 | |||
| 3448 | Ga0307513_10198447 | |||
| 3449 | Ga0307513_10223635 | |||
| 3450 | Ga0307513_10336433 | |||
| 3451 | Ga0307513_10382862 | |||
| 3452 | Ga0307513_10392021 | |||
| 3453 | Ga0307513_10757889 | |||
| 3454 | Ga0307509_10047896 | |||
| 3455 | Ga0307509_10070806 | |||
| 3456 | Ga0307509_10166102 | |||
| 3457 | Ga0307509_10255000 | |||
| 3458 | Ga0307509_10258468 | |||
| 3459 | Ga0307509_10388258 | |||
| 3460 | Ga0307408_100000160 | |||
| 3461 | Ga0307408_100034418 | |||
| 3462 | Ga0307408_100045283 | |||
| 3463 | Ga0307408_100158236 | |||
| 3464 | Ga0307408_100166791 | |||
| 3465 | Ga0307408_100202535 | |||
| 3466 | Ga0307408_100550048 | |||
| 3467 | Ga0307408_101009952 | |||
| 3468 | Ga0307408_101237660 | |||
| 3469 | Ga0307408_101609315 | |||
| 3470 | Ga0307408_101710987 | |||
| 3471 | Ga0307408_102394828 | |||
| 3472 | Ga0307508_10000016 | |||
| 3473 | Ga0307508_10001467 | |||
| 3474 | Ga0307508_10052609 | |||
| 3475 | Ga0307508_10538212 | |||
| 3476 | Ga0307508_10576065 | |||
| 3477 | Ga0307514_10037190 | |||
| 3478 | Ga0307514_10375139 | |||
| 3479 | Ga0307516_10004400 | |||
| 3480 | Ga0307516_10035476 | |||
| 3481 | Ga0307516_10058975 | |||
| 3482 | Ga0307516_10128425 | |||
| 3483 | Ga0307516_10356786 | |||
| 3484 | Ga0307516_10363028 | |||
| 3485 | Ga0307516_10453728 | |||
| 3486 | Ga0307405_10021832 | |||
| 3487 | Ga0307405_10053071 | |||
| 3488 | Ga0307405_10058871 | |||
| 3489 | Ga0307405_10190515 | |||
| 3490 | Ga0307405_10226137 | |||
| 3491 | Ga0307405_10260018 | |||
| 3492 | Ga0307405_10894422 | |||
| 3493 | Ga0307405_10996428 | |||
| 3494 | Ga0307405_11040726 | |||
| 3495 | Ga0307405_11075034 | |||
| 3496 | Ga0307405_11313412 | |||
| 3497 | Ga0307405_11440125 | |||
| 3498 | Ga0307405_11608569 | |||
| 3499 | Ga0307413_10199627 | |||
| 3500 | Ga0307413_11169348 | |||
| 3501 | Ga0307413_12123964 | |||
| 3502 | Ga0307410_10006186 | |||
| 3503 | Ga0307410_10493002 | |||
| 3504 | Ga0307410_10699597 | |||
| 3505 | Ga0307410_11238769 | |||
| 3506 | Ga0307406_10009086 | |||
| 3507 | Ga0307406_10048547 | |||
| 3508 | Ga0307406_10154488 | |||
| 3509 | Ga0307406_10424736 | |||
| 3510 | Ga0307406_10613602 | |||
| 3511 | Ga0307406_10795272 | |||
| 3512 | Ga0307407_10125284 | |||
| 3513 | Ga0307407_10197530 | |||
| 3514 | Ga0307407_10237909 | |||
| 3515 | Ga0307407_10789264 | |||
| 3516 | Ga0307412_10008934 | |||
| 3517 | Ga0307412_10106523 | |||
| 3518 | Ga0307412_10152178 | |||
| 3519 | Ga0307412_10156542 | |||
| 3520 | Ga0307412_10209380 | |||
| 3521 | Ga0307412_10427755 | |||
| 3522 | Ga0307412_10565616 | |||
| 3523 | Ga0307412_10710080 | |||
| 3524 | Ga0307412_10725839 | |||
| 3525 | Ga0307412_11299118 | |||
| 3526 | Ga0307412_11376482 | |||
| 3527 | Ga0307412_11639177 | |||
| 3528 | Ga0307409_100001314 | |||
| 3529 | Ga0307409_100049671 | |||
| 3530 | Ga0307409_100065516 | |||
| 3531 | Ga0307409_101124546 | |||
| 3532 | Ga0307409_101406187 | |||
| 3533 | Ga0307409_101614946 | |||
| 3534 | Ga0307416_100020404 | |||
| 3535 | Ga0307416_100063772 | |||
| 3536 | Ga0307416_100071278 | |||
| 3537 | Ga0307416_100087114 | |||
| 3538 | Ga0307416_100320417 | |||
| 3539 | Ga0307416_100345066 | |||
| 3540 | Ga0307416_100388486 | |||
| 3541 | Ga0307416_100568835 | |||
| 3542 | Ga0307416_100997030 | |||
| 3543 | Ga0307416_101441695 | |||
| 3544 | Ga0307416_101727569 | |||
| 3545 | Ga0307416_103778436 | |||
| 3546 | Ga0307414_10057023 | |||
| 3547 | Ga0307414_10115978 | |||
| 3548 | Ga0307414_10116063 | |||
| 3549 | Ga0307414_10149621 | |||
| 3550 | Ga0307414_10594092 | |||
| 3551 | Ga0307414_10808429 | |||
| 3552 | Ga0307414_10881583 | |||
| 3553 | Ga0307414_11170491 | |||
| 3554 | Ga0307414_12122285 | |||
| 3555 | Ga0307411_10006938 | |||
| 3556 | Ga0307411_10022274 | |||
| 3557 | Ga0307411_10239552 | |||
| 3558 | Ga0307411_10247367 | |||
| 3559 | Ga0307411_10814359 | |||
| 3560 | Ga0307411_10968779 | |||
| 3561 | Ga0307411_12363398 | |||
| 3562 | Ga0307415_100004417 | |||
| 3563 | Ga0307415_100124110 | |||
| 3564 | Ga0307415_100152845 | |||
| 3565 | Ga0307415_100894793 | |||
| 3566 | Ga0307415_101060223 | |||
| 3567 | Ga0307507_10031462 | |||
| 3568 | Ga0307507_10055670 | |||
| 3569 | Ga0307507_10376296 | |||
| 3570 | Ga0307510_10000568 | |||
| 3571 | Ga0307510_10564632 | |||
| 3572 | Ga0373950_0004635 | |||
| 3573 | Ga0373958_0028957 | |||
| 3574 | Ga0373959_0080937 | |||
| 3575 | Ga0373938_0018968 | |||
| 3576 | Ga0373938_0247902 | |||
| 3577 | Ga0373928_0027809 | |||
| 3578 | Ga0373928_0114285 | |||
| 3579 | Ga0373940_0035128 | |||
| 3580 | Ga0373944_0326561 | |||
| 3581 | Ga0373952_0002684 | |||
| 3582 | Ga0373952_0052535 | |||
| 3583 | Ga0373932_0018539 | |||
| 3584 | Ga0373932_0030415 | |||
| 3585 | Ga0373939_0133835 | |||
| 3586 | Ga0373941_0042220 | |||
| 3587 | Ga0373945_0413159 | |||
| 3588 | Ga0373953_0270922 | |||
| 3589 | Ga0373960_0006818 | |||
| 3590 | Ga0373946_0179335 | |||
| 3591 | Ga0373946_0189477 | |||
| 3592 | Ga0373942_0031813 | |||
| 3593 | Ga0373961_0112681 | |||
| 3594 | Ga0373961_0244560 | |||
| 3595 | Ga0373962_0019072 | |||
| 3596 | Ga0373962_0040272 | |||
| 3597 | Ga0373924_0050922 | |||
| 3598 | Ga0373931_0007502 | |||
| 3599 | Ga0373931_0306109 | |||
| 3600 | Ga0373935_0664801 | |||
| 3601 | Ga0373947_0273281 | |||
| 3602 | Ga0373937_0168463 | |||
| 3603 | Ga0373937_0377255 | |||
| 3604 | Ga0373937_1291590 | |||
| 3605 | Ga0373937_1872254 | |||
| 3606 | Ga0373925_0219622 | |||
| 3607 | Ga0373925_0487964 | |||
| 3608 | Ga0395898_0707204 | |||
| 3609 | Ga0395905_0000071 | |||
| 3610 | Ga0395905_0003377 | |||
| 3611 | Ga0395905_0158997 | |||
| 3612 | Ga0395905_0205360 | |||
| 3613 | Ga0395905_0292538 | |||
| 3614 | Ga0395905_0637559 | |||
| 3615 | Ga0395905_0726434 | |||
| 3616 | Ga0395905_1171095 | |||
| 3617 | Ga0395905_1245362 | |||
| 3618 | Ga0400483_050487 | |||
| 3619 | Ga0400483_054100 | |||
| 3620 | Ga0400483_058112 | |||
| 3621 | Ga0400483_147621 | |||
| 3622 | Ga0400483_243387 | |||
| 3623 | Ga0400483_250036 | |||
| 3624 | Ga0400483_259735 | |||
| 3625 | Ga0436365_0385285 | |||
| 3626 | Ga0436365_0393891 | |||
| 3627 | Ga0436365_0508202 | |||
| 3628 | Ga0436365_1754335 | |||
| 3629 | Ga0436365_1910867 | |||
| 3630 | Ga0439436_0000087 | |||
| 3631 | Ga0439438_022946 | |||
| 3632 | Ga0439439_0023785 | |||
| 3633 | Ga0439447_029848 | |||
| 3634 | Ga0439461_0005108 | |||
| 3635 | Ga0439461_0036152 | |||
| 3636 | Ga0439466_0016508 | |||
| 3637 | Ga0439466_0045273 | |||
| 3638 | Ga0439466_0049909 | |||
| 3639 | Ga0439465_0008564 | |||
| 3640 | Ga0439465_0134195 | |||
| 3641 | Ga0451787_135752 | |||
| 3642 | Ga0451789_0485836 | |||
| 3643 | Ga0451789_0873756 | |||
| 3644 | Ga0451789_1195116 | |||
| 3645 | Ga0451789_1353168 | |||
| 3646 | Ga0451791_0888711 | |||
| 3647 | Ga0451791_1547075 | |||
| 3648 | Ga0451793_0351601 | |||
| 3649 | Ga0451793_0606671 | |||
| 3650 | Ga0451793_0969557 | |||
| 3651 | Ga0451793_1911556 | |||
| 3652 | Ga0451797_0651689 | |||
| 3653 | Ga0451797_1136303 | |||
| 3654 | Ga0451797_1454471 | |||
| 3655 | Ga0451797_1559014 | |||
| 3656 | Ga0451795_0264279 | |||
| 3657 | Ga0451795_0458032 | |||
| 3658 | Ga0451795_0612071 | |||
| 3659 | Ga0451795_1631029 | |||
| 3660 | Ga0451798_0075940 | |||
| 3661 | Ga0451800_0112075 | |||
| 3662 | Ga0451802_0039409 | |||
| 3663 | Ga0451802_0496814 | |||
| 3664 | Ga0451802_1029972 | |||
| 3665 | Ga0451804_1177037 | |||
| 3666 | Ga0451807_1456924 | |||
| 3667 | Ga0451833_0642716 | |||
| 3668 | Ga0451833_0671749 | |||
| 3669 | Ga0451833_0863719 | |||
| 3670 | Ga0451839_0092707 | |||
| 3671 | Ga0451839_0195547 | |||
| 3672 | Ga0451839_1646573 | |||
| 3673 | Ga0451841_0064685 | |||
| 3674 | Ga0451841_0374427 | |||
| 3675 | Ga0451849_0140783 | |||
| 3676 | Ga0451849_1174768 | |||
| 3677 | Ga0451851_0377524 | |||
| 3678 | Ga0451851_0664708 | |||
| 3679 | Ga0451851_0775016 | |||
| 3680 | Ga0451843_0094093 | |||
| 3681 | Ga0451843_0289726 | |||
| 3682 | Ga0451843_1448663 | |||
| 3683 | Ga0451855_1473803 | |||
| 3684 | Ga0451853_0258583 | |||
| 3685 | Ga0451853_0312486 | |||
| 3686 | Ga0451853_2717321 | |||
| 3687 | Ga0451853_2957169 | |||
| 3688 | Ga0451853_3970409 | |||
| 3689 | Ga0439431_0002540 | |||
| 3690 | Ga0439431_0019679 | |||
| 3691 | Ga0439431_0161495 | |||
| 3692 | Ga0439433_0006733 | |||
| 3693 | Ga0439433_0009312 | |||
| 3694 | Ga0439437_000403 | |||
| 3695 | Ga0439445_0000816 | |||
| 3696 | Ga0439445_0067787 | |||
| 3697 | Ga0439445_0118103 | |||
| 3698 | Ga0439432_004375 | |||
| 3699 | Ga0439449_0005260 | |||
| 3700 | Ga0439449_0009502 | |||
| 3701 | Ga0439449_0019959 | |||
| 3702 | Ga0439449_0035314 | |||
| 3703 | Ga0439449_0069502 | |||
| 3704 | Ga0439449_0269811 | |||
| 3705 | Ga0439452_001338 | |||
| 3706 | Ga0439452_021923 | |||
| 3707 | Ga0439455_0023026 | |||
| 3708 | Ga0439455_0031169 | |||
| 3709 | Ga0439455_0103196 | |||
| 3710 | Ga0439457_006319 | |||
| 3711 | Ga0439457_037410 | |||
| 3712 | Ga0439457_160441 | |||
| 3713 | Ga0439462_0003614 | |||
| 3714 | Ga0439462_0005695 | |||
| 3715 | Ga0439462_0082272 | |||
| 3716 | Ga0439463_155667 | |||
| 3717 | Ga0450911_022634 | |||
| 3718 | Ga0450914_002759 | |||
| 3719 | Ga0450917_007679 | |||
| 3720 | Ga0450919_000846 | |||
| 3721 | Ga0450920_033140 | |||
| 3722 | Ga0450922_013808 | |||
| 3723 | Ga0450923_062420 | |||
| 3724 | Ga0450890_010639 | |||
| 3725 | Ga0450891_000064 | |||
| 3726 | Ga0450891_018549 | |||
| 3727 | Ga0450892_003526 | |||
| 3728 | Ga0450892_020418 | |||
| 3729 | Ga0450894_001711 | |||
| 3730 | Ga0450896_048175 | |||
| 3731 | Ga0450898_030446 | |||
| 3732 | Ga0450898_030894 | |||
| 3733 | Ga0450898_055455 | |||
| 3734 | Ga0450899_009529 | |||
| 3735 | Ga0450889_003240 | |||
| 3736 | Ga0450906_007913 | |||
| 3737 | Ga0450907_019923 | |||
| 3738 | Ga0450910_042973 | |||
| 3739 | Ga0439446_0004543 | |||
| 3740 | Ga0439446_0240238 | |||
| 3741 | Ga0439446_0253262 | |||
| 3742 | Ga0450909_002243 | |||
| 3743 | Ga0450909_012351 | |||
| 3744 | Ga0439434_0005187 | |||
| 3745 | Ga0439434_0032148 | |||
| 3746 | Ga0439434_0106731 | |||
| 3747 | Ga0439434_0120244 | |||
| 3748 | Ga0439434_0184084 | |||
| 3749 | Ga0439444_0193484 | |||
| 3750 | Ga0439459_0079902 | |||
| 3751 | Ga0439464_0021522 | |||
| 3752 | Ga0439464_0169221 | |||
| 3753 | Ga0439460_0146488 | |||
| 3754 | Ga0450916_001775 | |||
| 3755 | Ga0450918_000344 | |||
| 3756 | Ga0450918_083618 | |||
| 3757 | Ga0450893_0021080 | |||
| 3758 | Ga0450893_0059738 | |||
| 3759 | Ga0451577_0026364 | |||
| 3760 | Ga0451577_0061568 | |||
| 3761 | Ga0451577_1682399 | |||
| 3762 | Ga0439440_0185855 | |||
| 3763 | Ga0466969_0037790 | |||
| 3764 | Ga0466969_0089971 | |||
| 3765 | Ga0466972_0020558 | |||
| 3766 | Ga0466972_0035894 | |||
| 3767 | Ga0466972_0041116 | |||
| 3768 | Ga0466972_0046599 | |||
| 3769 | Ga0466972_0170373 | |||
| 3770 | Ga0453683_0394669 | |||
| 3771 | Ga0453683_0429046 | |||
| 3772 | Ga0453683_0934536 | |||
| 3773 | Ga0466965_0068051 | |||
| 3774 | Ga0466965_0108619 | |||
| 3775 | Ga0466965_0131641 | |||
| 3776 | Ga0466965_0212725 | |||
| 3777 | Ga0466965_0386555 | |||
| 3778 | Ga0466965_0801347 | |||
| 3779 | Ga0466966_0015315 | |||
| 3780 | Ga0466966_0752500 | |||
| 3781 | Ga0466961_0003217 | |||
| 3782 | Ga0466961_0006410 | |||
| 3783 | Ga0466961_0043879 | |||
| 3784 | Ga0466963_0000935 | |||
| 3785 | Ga0466964_0003021 | |||
| 3786 | Ga0466964_0118004 | |||
| 3787 | Ga0453684_0000917 | |||
| 3788 | Ga0453684_0001658 | |||
| 3789 | Ga0453684_0017401 | |||
| 3790 | Ga0453684_0051049 | |||
| 3791 | Ga0453684_0272674 | |||
| 3792 | Ga0453684_0346557 | |||
| 3793 | Ga0453684_0613701 | |||
| 3794 | Ga0453684_1282602 | |||
| 3795 | Ga0466971_0382138 | |||
| 3796 | Ga0466968_0005264 | |||
| 3797 | Ga0466968_0721818 | |||
| 3798 | Ga0466970_0007142 | |||
| 3799 | Ga0466970_0015254 | |||
| 3800 | Ga0466970_0128278 | |||
| 3801 | Ga0466957_0007668 | |||
| 3802 | Ga0466960_0012592 | |||
| 3803 | Ga0466960_0654384 | |||
| 3804 | Ga0466959_0013106 | |||
| 3805 | Ga0466959_0250383 | |||
| 3806 | Ga0451576_0034152 | |||
| 3807 | Ga0451576_0126973 | |||
| 3808 | Ga0451576_0228247 | |||
| 3809 | Ga0451576_0312262 | |||
| 3810 | Ga0451576_0393108 | |||
| 3811 | Ga0451576_0422698 | |||
| 3812 | Ga0451576_1296890 | |||
| 3813 | Ga0466958_0023688 | |||
| 3814 | Ga0466958_0695385 | |||
| 3815 | Ga0466967_0021184 | |||
| 3816 | Ga0466967_0546277 | |||
| 3817 | Ga0466967_1103268 | |||
| 3818 | Ga0495627_032297 | |||
| 3819 | Ga0495590_0131290 | |||
| 3820 | Ga0495629_0040968 | |||
| 3821 | Ga0495638_0191549 | |||
| 3822 | Ga0495638_0240052 | |||
| 3823 | Ga0495638_0306508 | |||
| 3824 | Ga0495651_0038375 | |||
| 3825 | Ga0495650_0002988 | |||
| 3826 | Ga0495650_0147479 | |||
| 3827 | Ga0495650_0200566 | |||
| 3828 | Ga0495580_0175846 | |||
| 3829 | Ga0495580_0631714 | |||
| 3830 | Ga0495582_0409091 | |||
| 3831 | Ga0495582_0418253 | |||
| 3832 | Ga0495582_0578047 | |||
| 3833 | Ga0495605_0484521 | |||
| 3834 | Ga0495639_0518165 | |||
| 3835 | Ga0495662_0358629 | |||
| 3836 | Ga0495664_0543098 | |||
| 3837 | Ga0495583_0380114 | |||
| 3838 | Ga0495606_0103334 | |||
| 3839 | Ga0495606_0184202 | |||
| 3840 | Ga0495606_0426203 | |||
| 3841 | Ga0495606_0619442 | |||
| 3842 | Ga0495610_0020900 | |||
| 3843 | Ga0495610_0035222 | |||
| 3844 | Ga0495610_0201109 | |||
| 3845 | Ga0495616_0002648 | |||
| 3846 | Ga0495618_0779930 | |||
| 3847 | Ga0495620_0083637 | |||
| 3848 | Ga0495620_0134181 | |||
| 3849 | Ga0495620_0309700 | |||
| 3850 | Ga0495628_0503705 | |||
| 3851 | Ga0495628_0630016 | |||
| 3852 | Ga0495630_0141411 | |||
| 3853 | Ga0495631_0000024 | |||
| 3854 | Ga0495632_0007918 | |||
| 3855 | Ga0495632_0010962 | |||
| 3856 | Ga0495632_0067015 | |||
| 3857 | Ga0495632_0485708 | |||
| 3858 | Ga0495637_0010974 | |||
| 3859 | Ga0495637_0282631 | |||
| 3860 | Ga0495643_0106698 | |||
| 3861 | Ga0495643_0248979 | |||
| 3862 | Ga0495648_0371714 | |||
| 3863 | Ga0495666_0197046 | |||
| 3864 | Ga0495642_0091393 | |||
| 3865 | Ga0495642_0176947 | |||
| 3866 | Ga0495652_0345447 | |||
| 3867 | Ga0495654_0041183 | |||
| 3868 | Ga0495640_0302006 | |||
| 3869 | Ga0495586_0208483 | |||
| 3870 | Ga0495586_0445148 | |||
| 3871 | Ga0495587_0680751 | |||
| 3872 | Ga0495598_0018863 | |||
| 3873 | Ga0495598_0021212 | |||
| 3874 | Ga0495621_0003869 | |||
| 3875 | Ga0495621_0058128 | |||
| 3876 | Ga0495621_0162718 | |||
| 3877 | Ga0495597_0010476 | |||
| 3878 | Ga0495645_0203502 | |||
| 3879 | Ga0495645_0313913 | |||
| 3880 | Ga0495622_0121235 | |||
| 3881 | Ga0495633_0254105 | |||
| 3882 | Ga0495667_0114833 | |||
| 3883 | Ga0495667_0623864 | |||
| 3884 | Ga0495656_0001070 | |||
| 3885 | Ga0495668_0056564 | |||
| 3886 | Ga0495668_0148126 | |||
| 3887 | Ga0495668_0340680 | |||
| 3888 | Ga0495611_0037183 | |||
| 3889 | Ga0495611_0352882 | |||
| 3890 | Ga0495625_0021963 | |||
| 3891 | Ga0495625_0040736 | |||
| 3892 | Ga0495625_0060694 | |||
| 3893 | Ga0495625_0078070 | |||
| 3894 | Ga0495625_0161052 | |||
| 3895 | Ga0495625_0683058 | |||
| 3896 | Ga0495635_0146612 | |||
| 3897 | Ga0495635_0283978 | |||
| 3898 | Ga0495635_0298249 | |||
| 3899 | Ga0495588_0026440 | |||
| 3900 | Ga0495588_0067240 | |||
| 3901 | Ga0495588_0542843 | |||
| 3902 | Ga0495657_0592767 | |||
| 3903 | Ga0495599_0642120 | |||
| 3904 | Ga0495646_0176976 | |||
| 3905 | Ga0495646_0186533 | |||
| 3906 | Ga0495646_0525651 | |||
| 3907 | Ga0495647_0029408 | |||
| 3908 | Ga0495647_0145353 | |||
| 3909 | Ga0495658_0014926 | |||
| 3910 | Ga0495658_0093624 | |||
| 3911 | Ga0495658_0164808 | |||
| 3912 | Ga0495658_0226087 | |||
| 3913 | Ga0495613_0231866 | |||
| 3914 | Ga0495624_0413054 | |||
| 3915 | Ga0495670_0501458 | |||
| 3916 | Ga0495670_0733163 | |||
| 3917 | Ga0495670_0818997 | |||
| 3918 | Ga0495671_0115776 | |||
| 3919 | Ga0495671_0151942 | |||
| 3920 | Ga0495671_0330015 | |||
| 3921 | Ga0495649_0009554 | |||
| 3922 | Ga0495589_0137142 | |||
| 3923 | Ga0495600_0792769 | |||
| 3924 | Ga0495600_0822637 | |||
| 3925 | Ga0495660_0119551 | |||
| 3926 | Ga0495660_0368547 | |||
| 3927 | Ga0495581_0511806 | |||
| 3928 | Ga0495581_0903825 | |||
| 3929 | Ga0495674_1479822 | |||
| 3930 | Ga0495676_0035806 | |||
| 3931 | Ga0495676_0078953 | |||
| 3932 | Ga0495676_0682244 | |||
| 3933 | Ga0495680_0048736 | |||
| 3934 | Ga0495687_002064 | |||
| 3935 | Ga0495687_005696 | |||
| 3936 | Ga0495687_022510 | |||
| 3937 | Ga0495673_0107757 | |||
| 3938 | Ga0495673_0153463 | |||
| 3939 | Ga0495681_0392955 | |||
| 3940 | Ga0495684_0548175 | |||
| 3941 | Ga0495686_0133926 | |||
| 3942 | Ga0495686_0149048 | |||
| 3943 | Ga0495614_0183605 | |||
| 3944 | Ga0495614_0219437 | |||
| 3945 | Ga0495615_0023842 | |||
| 3946 | Ga0495615_0132714 | |||
| 3947 | Ga0495615_0168331 | |||
| 3948 | Ga0495626_0050116 | |||
| 3949 | Ga0495626_0090337 | |||
| 3950 | Ga0496100_0046363 | |||
| 3951 | Ga0496100_0058669 | |||
| 3952 | Ga0496100_0849746 | |||
| 3953 | Ga0496100_1204822 | |||
| 3954 | Ga0496101_0005293 | |||
| 3955 | Ga0496101_0008869 | |||
| 3956 | Ga0496101_0019357 | |||
| 3957 | Ga0496101_0692603 | |||
| 3958 | Ga0496101_0891250 | |||
| 3959 | Ga0496102_0004160 | |||
| 3960 | Ga0496102_0022357 | |||
| 3961 | Ga0496102_0025441 | |||
| 3962 | Ga0496102_1735265 | |||
| 3963 | Ga0496103_0052729 | |||
| 3964 | Ga0496103_0545910 | |||
| 3965 | Ga0496104_0004072 | |||
| 3966 | Ga0496104_0225894 | |||
| 3967 | Ga0496105_0013340 | |||
| 3968 | Ga0496105_0335099 | |||
| 3969 | Ga0496105_0346090 | |||
| 3970 | Ga0496105_1017770 | |||
| 3971 | Ga0496106_0004162 | |||
| 3972 | Ga0496106_0054027 | |||
| 3973 | Ga0496106_0118004 | |||
| 3974 | Ga0496107_0012377 | |||
| 3975 | Ga0496107_0185959 | |||
| 3976 | Ga0496107_0743017 | |||
| 3977 | Ga0496107_1023953 | |||
| 3978 | Ga0496107_1315008 | |||
| 3979 | Ga0496108_0017286 | |||
| 3980 | Ga0496108_0054001 | |||
| 3981 | Ga0496108_0059614 | |||
| 3982 | Ga0496108_1037113 | |||
| 3983 | Ga0496109_0040199 | |||
| 3984 | Ga0496109_0069350 | |||
| 3985 | Ga0496109_0499406 | |||
| 3986 | Ga0496109_0508627 | |||
| 3987 | Ga0496109_0959386 | |||
| 3988 | Ga0496110_0010357 | |||
| 3989 | Ga0496110_0110191 | |||
| 3990 | Ga0496110_0238223 | |||
| 3991 | Ga0496111_0226566 | |||
| 3992 | Ga0496111_0824314 | |||
| 3993 | Ga0496112_0290238 | |||
| 3994 | Ga0496113_0185358 | |||
| 3995 | Ga0496113_0713531 | |||
| 3996 | Ga0496114_0022464 | |||
| 3997 | Ga0496114_0419093 | |||
| 3998 | Ga0496114_0563757 | |||
| 3999 | Ga0496114_0736330 | |||
| 4000 | Ga0496114_1051712 | |||
| 4001 | Ga0496115_0002077 | |||
| 4002 | Ga0496116_0066945 | |||
| 4003 | Ga0496117_0004106 | |||
| 4004 | Ga0496117_0051373 | |||
| 4005 | Ga0496117_0195326 | |||
| 4006 | Ga0496118_0009212 | |||
| 4007 | Ga0496118_0078153 | |||
| 4008 | Ga0496118_0374968 | |||
| 4009 | Ga0496119_0213336 | |||
| 4010 | Ga0496120_0199693 | |||
| 4011 | Ga0496121_0002206 | |||
| 4012 | Ga0496121_0026908 | |||
| 4013 | Ga0496122_0000415 | |||
| 4014 | Ga0496122_0092947 | |||
| 4015 | Ga0496122_0181637 | |||
| 4016 | Ga0496122_0223552 | |||
| 4017 | Ga0496122_0491478 | |||
| 4018 | Ga0496123_0000330 | |||
| 4019 | Ga0496123_0022183 | |||
| 4020 | Ga0496123_0036339 | |||
| 4021 | Ga0496123_0047297 | |||
| 4022 | Ga0496123_0245124 | |||
| 4023 | Ga0496124_0044485 | |||
| 4024 | Ga0496124_0135708 | |||
| 4025 | Ga0496124_0415473 | |||
| 4026 | Ga0496124_0525099 | |||
| 4027 | Ga0496124_0874145 | |||
| 4028 | Ga0496125_0041632 | |||
| 4029 | Ga0496125_0674360 | |||
| 4030 | Ga0496126_0148535 | |||
| 4031 | Ga0501309_000004 | |||
| 4032 | Ga0501309_092679 | |||
| 4033 | Ga0501310_002992 | |||
| 4034 | Ga0501310_019556 | |||
| 4035 | Ga0501310_057280 | |||
| 4036 | Ga0501305_001609 | |||
| 4037 | Ga0501305_036628 | |||
| 4038 | Ga0501305_096135 | |||
| 4039 | Ga0495682_0343906 | |||
| 4040 | Ga0501292_023460 | |||
| 4041 | Ga0501297_002256 | |||
| 4042 | Ga0501303_004947 | |||
| 4043 | Ga0501312_026367 | |||
| 4044 | Ga0501333_022767 | |||
| 4045 | Ga0501032_0090633 | |||
| 4046 | Ga0501034_0016622 | |||
| 4047 | Ga0501034_0792889 | |||
| 4048 | Ga0501037_0007252 | |||
| 4049 | Ga0501043_0000545 | |||
| 4050 | Ga0501046_0000021 | |||
| 4051 | Ga0501046_0004297 | |||
| 4052 | Ga0501046_0008745 | |||
| 4053 | Ga0501047_0000757 | |||
| 4054 | Ga0501048_0013766 | |||
| 4055 | Ga0501069_0002093 | |||
| 4056 | Ga0501070_0008659 | |||
| 4057 | Ga0501198_000047 | |||
| 4058 | Ga0501198_133305 | |||
| 4059 | Ga0501201_004855 | |||
| 4060 | Ga0501206_015864 | |||
| 4061 | Ga0501207_019125 | |||
| 4062 | Ga0501222_000056 | |||
| 4063 | Ga0501222_010931 | |||
| 4064 | Ga0501223_035862 | |||
| 4065 | Ga0501227_030701 | |||
| 4066 | Ga0501233_174043 | |||
| 4067 | Ga0501235_029982 | |||
| 4068 | Ga0501236_062095 | |||
| 4069 | Ga0501238_043408 | |||
| 4070 | Ga0501242_026331 | |||
| 4071 | Ga0501249_040180 | |||
| 4072 | Ga0501253_020019 | |||
| 4073 | Ga0501257_031579 | |||
| 4074 | Ga0501258_028345 | |||
| 4075 | Ga0501221_000933 | |||
| 4076 | Ga0501225_0013159 | |||
| 4077 | Ga0501225_0032891 | |||
| 4078 | Ga0501229_000077 | |||
| 4079 | Ga0501079_0051579 | |||
| 4080 | Ga0501080_0199531 | |||
| 4081 | Ga0501232_004559 | |||
| 4082 | Ga0501241_108453 | |||
| 4083 | Ga0501262_000157 | |||
| 4084 | Ga0501265_002252 | |||
| 4085 | Ga0501268_087695 | |||
| 4086 | Ga0501271_052504 | |||
| 4087 | Ga0501282_007907 | |||
| 4088 | Ga0501035_0120765 | |||
| 4089 | Ga0501044_0180518 | |||
| 4090 | Ga0501045_0002486 | |||
| 4091 | nmdc:mga03683_218037_c1 | |||
| 4092 | nmdc:mga03683_22920_c1 | |||
| 4093 | nmdc:mga03683_30347_c1 | |||
| 4094 | nmdc:mga03683_354569_c1 | |||
| 4095 | nmdc:mga03683_447720_c1 | |||
| 4096 | nmdc:mga03683_48543_c1 | |||
| 4097 | nmdc:mga03683_51579_c1 | |||
| 4098 | nmdc:mga03683_90285_c1 | |||
| 4099 | nmdc:mga03n38_226732_c1 | |||
| 4100 | nmdc:mga03n38_399825_c1 | |||
| 4101 | nmdc:mga03n38_454002_c1 | |||
| 4102 | nmdc:mga03n38_603014_c1 | |||
| 4103 | nmdc:mga00v17_152383_c1 | |||
| 4104 | nmdc:mga00v17_202355_c1 | |||
| 4105 | nmdc:mga00v17_401612_c1 | |||
| 4106 | nmdc:mga00v17_87307_c1 | |||
| 4107 | nmdc:mga0yw44_240784_c1 | |||
| 4108 | nmdc:mga0k408_10460_c1 | |||
| 4109 | nmdc:mga0k408_12490_c1 | |||
| 4110 | nmdc:mga0k408_164742_c1 | |||
| 4111 | nmdc:mga0k408_171695_c1 | |||
| 4112 | nmdc:mga0k408_18200_c2 | |||
| 4113 | nmdc:mga0k408_190517_c1 | |||
| 4114 | nmdc:mga0k408_256190_c1 | |||
| 4115 | nmdc:mga0k408_26610_c1 | |||
| 4116 | nmdc:mga0k408_270913_c1 | |||
| 4117 | nmdc:mga0k408_302597_c1 | |||
| 4118 | nmdc:mga0k408_36110_c1 | |||
| 4119 | nmdc:mga0k408_40302_c1 | |||
| 4120 | nmdc:mga0k408_438894_c1 | |||
| 4121 | nmdc:mga0k408_583656_c1 | |||
| 4122 | nmdc:mga0k408_6644_c1 | |||
| 4123 | nmdc:mga0k408_794578_c1 | |||
| 4124 | nmdc:mga0k408_83530_c1 | |||
| 4125 | nmdc:mga06z11_125624_c1 | |||
| 4126 | nmdc:mga06z11_255108_c1 | |||
| 4127 | nmdc:mga06z11_363850_c1 | |||
| 4128 | nmdc:mga06z11_37405_c1 | |||
| 4129 | nmdc:mga06z11_445710_c1 | |||
| 4130 | nmdc:mga06z11_507645_c1 | |||
| 4131 | nmdc:mga04h51_235928_c1 | |||
| 4132 | nmdc:mga07m45_12950_c1 | |||
| 4133 | nmdc:mga07m45_151739_c1 | |||
| 4134 | nmdc:mga07m45_154307_c1 | |||
| 4135 | nmdc:mga07m45_156357_c1 | |||
| 4136 | nmdc:mga07m45_16681_c1 | |||
| 4137 | nmdc:mga07m45_18099_c1 | |||
| 4138 | nmdc:mga07m45_18802_c1 | |||
| 4139 | nmdc:mga07m45_18856_c1 | |||
| 4140 | nmdc:mga07m45_201253_c1 | |||
| 4141 | nmdc:mga07m45_21210_c1 | |||
| 4142 | nmdc:mga07m45_342605_c1 | |||
| 4143 | nmdc:mga07m45_399292_c1 | |||
| 4144 | nmdc:mga07m45_4213_c1 | |||
| 4145 | nmdc:mga07m45_460138_c1 | |||
| 4146 | nmdc:mga07m45_506933_c1 | |||
| 4147 | nmdc:mga07m45_529161_c1 | |||
| 4148 | nmdc:mga07m45_724059_c1 | |||
| 4149 | nmdc:mga07m45_836123_c1 | |||
| 4150 | nmdc:mga07m45_912609_c1 | |||
| 4151 | nmdc:mga05p37_182246_c1 | |||
| 4152 | nmdc:mga05p37_220452_c1 | |||
| 4153 | nmdc:mga0qj67_110899_c1 | |||
| 4154 | nmdc:mga08y16_605174_c1 | |||
| 4155 | nmdc:mga08y16_714912_c1 | |||
| 4156 | nmdc:mga08y16_823151_c1 | |||
| 4157 | nmdc:mga08y16_950785_c1 | |||
| 4158 | nmdc:mga0n895_280592_c1 | |||
| 4159 | nmdc:mga08x19_1194464_c1 | |||
| 4160 | nmdc:mga0sz30_14201_c1 | |||
| 4161 | nmdc:mga0sz30_185966_c1 | |||
| 4162 | nmdc:mga0sz30_37847_c1 | |||
| 4163 | nmdc:mga0sz30_405475_c1 | |||
| 4164 | nmdc:mga0sz30_442377_c1 | |||
| 4165 | nmdc:mga0sz30_5056_c1 | |||
| 4166 | Ga0495601_0284010 | |||
| 4167 | Ga0495612_0091577 | |||
| 4168 | Ga0495612_0385124 | |||
| 4169 | Ga0500635_0087433 | |||
| 4170 | Ga0495595_0323284 | |||
| 4171 | Ga0500578_0000006 | |||
| 4172 | Ga0500578_0265118 | |||
| 4173 | Ga0500643_006994 | |||
| 4174 | Ga0500643_012618 | |||
| 4175 | Ga0500644_0018587 | |||
| 4176 | Ga0500646_0033981 | |||
| 4177 | Ga0500646_0346932 | |||
| 4178 | Ga0500651_0000156 | |||
| 4179 | Ga0500651_0076022 | |||
| 4180 | Ga0500651_0168496 | |||
| 4181 | Ga0500651_0444845 | |||
| 4182 | Ga0500566_0160156 | |||
| 4183 | Ga0500650_0145041 | |||
| 4184 | Ga0500650_0338961 | |||
| 4185 | Ga0500557_128395 | |||
| 4186 | Ga0500562_005406 | |||
| 4187 | Ga0500562_008977 | |||
| 4188 | Ga0500571_000005 | |||
| 4189 | Ga0500594_0001096 | |||
| 4190 | Ga0500597_317525 | |||
| 4191 | Ga0500608_022424 | |||
| 4192 | Ga0500608_074158 | |||
| 4193 | Ga0500618_164499 | |||
| 4194 | Ga0500621_251616 | |||
| 4195 | Ga0500623_007865 | |||
| 4196 | Ga0500626_035282 | |||
| 4197 | Ga0500628_003722 | |||
| 4198 | Ga0500628_060492 | |||
| 4199 | Ga0500642_0064667 | |||
| 4200 | Ga0500652_001283 | |||
| 4201 | Ga0500655_000516 | |||
| 4202 | Ga0500655_020988 | |||
| 4203 | Ga0500658_0000141 | |||
| 4204 | Ga0500658_0000561 | |||
| 4205 | Ga0500658_0006983 | |||
| 4206 | Ga0500658_0163347 | |||
| 4207 | Ga0500559_0000880 | |||
| 4208 | Ga0500559_0006764 | |||
| 4209 | Ga0500564_001417 | |||
| 4210 | Ga0500568_0001097 | |||
| 4211 | Ga0500568_0127304 | |||
| 4212 | Ga0500573_0032467 | |||
| 4213 | Ga0500579_150348 | |||
| 4214 | Ga0500604_0019070 | |||
| 4215 | Ga0500604_0284338 | |||
| 4216 | Ga0500616_0059379 | |||
| 4217 | Ga0500619_000073 | |||
| 4218 | Ga0500622_0001738 | |||
| 4219 | Ga0500624_028461 | |||
| 4220 | Ga0500624_115262 | |||
| 4221 | Ga0500634_0055702 | |||
| 4222 | Ga0500638_016327 | |||
| 4223 | Ga0500636_0214708 | |||
| 4224 | Ga0500625_115871 | |||
| 4225 | Ga0500645_007607 | |||
| 4226 | Ga0500596_018165 | |||
| 4227 | Ga0590071_099013 | |||
| 4228 | Ga0501082_0033320 | |||
| 4229 | Ga0501082_1844706 | |||
| 4230 | Ga0466962_0056126 | |||
| 4231 | Ga0466962_0127631 | |||
| 4232 | 2587725128 | |||
| 4233 | 2587731512 | |||
| 4234 | 2587756191 | |||
| 4235 | 2588295157 | |||
| 4236 | 2599623208 | |||
| 4237 | 2599674855 | |||
| 4238 | 2599680812 | |||
| 4239 | 2599692827 | |||
| 4240 | 2643743907 | |||
| 4241 | 2643933067 | |||
| 4242 | 2643966984 | |||
| 4243 | 2644142647 | |||
| 4244 | 2644217210 | |||
| 4245 | 2644248385 | |||
| 4246 | 2644259022 | |||
| 4247 | 2644273678 | |||
| 4248 | 2644301595 | |||
| 4249 | 2644314316 | |||
| 4250 | 2644340934 | |||
| 4251 | 2644467186 | |||
| 4252 | 2649122609 | |||
| 4253 | 2652974065 | |||
| 4254 | 2738723941 | |||
| 4255 | 2738882767 | |||
| 4256 | 2739055759 | |||
| 4257 | 2739250496 | |||
| 4258 | 2739280468 | |||
| 4259 | 2819600344 | |||
| 4260 | 2831271862 | |||
| 4261 | 2838059700 | |||
| 4262 | 2842682804 | |||
| 4263 | 2842735792 | |||
| 4264 | 2885193535 | |||
| 4265 | 2885198646 | |||
| 4266 | 2885211974 | |||
| 4267 | 2887632367 | |||
| 4268 | 2899928485 | |||
| 4269 | 2904451787 | |||
| 4270 | 2904462556 | |||
| 4271 | 2919467229 | |||
| 4272 | 2919494179 | |||
| 4273 | 2919543811 | |||
| 4274 | 2919688610 | |||
| 4275 | 2923525961 | |||
| 4276 | 2923527662 | |||
| 4277 | 2928041406 | |||
| 4278 | 2928048248 | |||
| 4279 | 2928056092 | |||
| 4280 | 2928066428 | |||
| 4281 | 2928076083 | |||
| 4282 | 2928087728 | |||
| 4283 | 2929523670 | |||
| 4284 | 2945946087 | |||
| 4285 | 2945975686 | |||
| 4286 | 2954768861 | |||
| 4287 | 8002746423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pep-assembly1.cif.gz_8 | focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex | 0.9257 | 4 | 81 |
| 6r6b-assembly1.cif.gz_H | structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). | 0.9188 | 4 | 85 |
| 8axk-assembly1.cif.gz_G | type 3 secretion system export apparatus core, inner rod and needle of shigella flexneri | 0.9099 | 1 | 85 |
| 7ah9-assembly1.cif.gz_1J | substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 1 | 0.9019 | 4 | 86 |
| 7bin-assembly1.cif.gz_G | salmonella export gate and rod refined in focussed c1 map | 0.8997 | 1 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53692_1_97_1.10.287.1060 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.57 | 1 | 87 | 1.10.287.1060 |
| af_O53692_1_97_1.10.287.1060 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.5572 | 1 | 87 | 1.10.287.1060 |
| af_O16530_48_904_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.5513 | 8 | 59 | 1.20.1640.10 |
| af_Q54DE8_365_465_1.10.472.100 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin | 0.5225 | 6 | 69 | 1.10.472.100 |
| af_Q9H3M0_307_417_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.5161 | 4 | 79 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A074TVX4-F1-model_v4 | deleted | 0.9918 | 12 | 89 |
|
| AF-R9VIP8-F1-model_v4 | deleted | 0.9903 | 10 | 89 |
|
| AF-A0A0Q8XBI4-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9852 | 14 | 89 |
GO:0005886
GO:0009306 |
| AF-T1BP84-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9794 | 10 | 89 |
GO:0005886
GO:0009306 GO:0009425 GO:0031514 GO:0044780 |
| AF-A0A0R2D0F7-F1-model_v4 | Flagellar biosynthetic protein FliQ | 0.9793 | 11 | 85 |
GO:0005886
GO:0009306 GO:0009425 GO:0044780 |